GenomeNet

Database: RefSeq
Entry: NC_006680
LinkDB: NC_006680
Original site: NC_006680 
LOCUS       NC_006680            1019846 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 11
            sequence.
ACCESSION   NC_006680
VERSION     NC_006680.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1019846)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1019846)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1019846)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1019846)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017351.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1019846
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="11"
                     /note="MAT-alpha"
     gene            <905..4979
                     /locus_tag="CNK00010"
                     /db_xref="GeneID:3254597"
     mRNA            join(<905..1173,1231..1244,1301..1344,1432..3463,
                     3541..4295,4392..4484,4604..4979)
                     /locus_tag="CNK00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658010.1"
                     /db_xref="GeneID:3254597"
     CDS             join(905..1173,1231..1244,1301..1344,1432..3463,
                     3541..4295,4392..4484,4604..4801)
                     /locus_tag="CNK00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513761.1"
                     /db_xref="GeneID:3254597"
                     /translation="MSVDLSHPDIAAARASISNPSDPAAWLLLQYASPPSTTQLPQLL
                     LLDSGPLPVLPAWQHHLQNTHQSILFGYAEIAEKGLVLVYLTPDVGGVKRARAIVHSR
                     AFASLFPDYSAIITISHPSELTEQLITDQLALNLPSATSLPACVPVASTRYVVPGADV
                     LVPDPLSPRAAGMGRDLPSLPFPTSNQQSLQTTQLQTSQLPPLPPLPPSPIPPSPVSK
                     DETGINRVSNANEMNEDNQIEKGMDLEEGGEQEREDGLEDSHGSRFENGNGNGNVSTN
                     TNTSSRKPVPALSLSPSPPRPPRHSQPRTPPKPQPILLPTSAHAPATSLDLVPAPATP
                     TQGTGGTETRKSSTPLSLTSRLKNTFHRSSLKDKDSPTVVPSSPTATPSSPSVPSSTN
                     NAKPDGLGSPTFNPNATSMPHSPSTPSAGKFKASSLSKVFGKRKSSGTSTSTPSGAGT
                     WAGRGEGPKLTEEPEGQRIDEFGRPPQAEEGLQVFSQSTGIDPPAAPASMPIGSPSLA
                     TAPTPPPKSPLPRPSDPSDPSDPSGPTDELNSSPTCLEPGPGLATPLPPRGSSLRPQH
                     SPSPLSSPGAQEGQSIRAGNTAFPLAGVPLLGPEAPLPHLPPSSPSSHSHHGLDSNLE
                     RVGTPYYTPSLMQPSPSFQPQEEGTQHQPHTYPSRLHPHTQIPSHSHPSATATTLQPP
                     LSRSTSLSPSVPLPATLATTTLDPVYTADTQGAYANAEEDREEIEAEEGKQRDRDRER
                     DKERESVLLAYDRPEIEPESDPRQVESTTEIMEGMEKGFFPRQGEQVSDASAPSPVSL
                     RAPAPASVDEYDSPSHPSALQPPSPLHPAASIHATVPHLAEGQAEEMEKETPVETEEA
                     KAEVEGDEQTEKEEQRQRLEREREREVLEAQQIAQWQAAETARWEAEESARLEQEEAA
                     RLAAEEQARRDAEEAERFRLEEEERMRAEEEVRRQKEAEEEARRQVEEEQRRQREKEE
                     EEKRQVEEEERRKREEERRKEEEERRKREEEEERERKRMEEAEERKRTVRDGLERGKR
                     EGGVMLKGWVTVQTCKSLTWRRRYFQLFPREMQLFKNENDTKPIQTIPLSKSTGISET
                     YEESQVKDSFMITSGDEGEGGEAFFLFTDSAEDKEFILDGMRLCIG"
     gene            5182..7967
                     /locus_tag="CNK00020"
                     /db_xref="GeneID:3254475"
     mRNA            join(5182..5391,5456..5475,5569..5589,5650..5865,
                     5992..6084,6172..6746,6876..7618,7726..7967)
                     /locus_tag="CNK00020"
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /transcript_id="XM_024658011.1"
                     /db_xref="GeneID:3254475"
     CDS             join(5326..5391,5456..5475,5569..5589,5650..5865,
                     5992..6084,6172..6746,6876..7465)
                     /locus_tag="CNK00020"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /protein_id="XP_024513762.1"
                     /db_xref="GeneID:3254475"
                     /translation="MAHNPRVFFDFAVAGQPLGRVVFELYANVVPKTAENFRALCTGE
                     KGISPISSLPLHYKNSIVHRVIEGFMIQGGDFTKKTGAGGESIYGAPFEDERLNGEGC
                     EVDTKGLLVMANRGPNTNGSQYFITLAAAPHLTGKHVVFGRVVFGMEHVETIGQLPTD
                     EKDRPLSTVMITHCGELELRRPPPKSRARSASISSSFSSRSRSLSRSRSPSRSRSRDR
                     SVSIKRRSRSRKYSDSGSESDYDSDDSRERRRRRKDRKRSKHAKHSSKSKSKSRRRSS
                     KSDREETLSELDARLEREENERLEKERLEKLAEMKRKIEEEKQRVKDAGGVVYKGRGA
                     MKYLDPETINRQQLPQNFSIRGGRGRGDLPPPRGGSFRDRDQERYGDRDRGQDRRDRR
                     EQSDRGDRERDRGYPSSRSHSDPYSGRTGDPLDRYPRTTRRENGQDRRTKLDRDMDQW
                     QHDRSQGSDVRGEGDKFKRGARNELERDREGKQEERKEEGEMTPEDEMERAGKIERED
                     RGERAMSEGSDMVMDKDD"
     gene            8200..11673
                     /locus_tag="CNK00030"
                     /db_xref="GeneID:3254476"
     mRNA            join(8309..8803,8902..8937,9007..9046,9113..9259,
                     9416..9434,9514..9570,9652..9706,9788..9876,9965..10041,
                     10109..10293,10397..10498,10602..10745,10868..11040,
                     11186..11280,11412..11673)
                     /locus_tag="CNK00030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567771.2"
                     /db_xref="GeneID:3254476"
     CDS             join(8395..8803,8902..8937,9007..9046,9113..9259,
                     9416..9434,9514..9570,9652..9706,9788..9876,9965..10041,
                     10109..10293,10397..10498,10602..10745,10868..11040,
                     11186..11280,11412..11538)
                     /locus_tag="CNK00030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567771.1"
                     /db_xref="GeneID:3254476"
                     /translation="MGSFPPPTASSSRVTLDSHPNDRQPLLSSSLSSHSAHQHVVSHY
                     RSISPASNPDPNPSAIRDMVSTMLGFAPQDVPESSVKDIAVIDPTASVYVDPQTGALI
                     EEKSKAERWFVARLDAVLLLFVCISQVIKYLDQQNISAAYVSGMKEELSLYGNQYNYF
                     TTYFNVGYAIFLIPSQIIITRVRPSLWLPALEACWGVLTIATYKVTNYKQVYALRAFT
                     GAFEASCYPGAIMLLMSWYTPRELALRIGFYHSCQSIGSMLAGALQAAIYNSMDGRNG
                     ISGWRWMFIIDGIVTLLVSFAGLILIPDFPSKPNPWSFYLRPSHISIARSRAAQFHRA
                     DNKKFTFSSVKKAVTGPLFYCFVVLYVATVLGQGGYNYFNLWLKSLTNPDGTPRWSVA
                     QINAIPIGGSAIAVAMIWVWGFISDYFQTRWIPVIIQAGIGLIPGIIMSIWNVSDNAK
                     YFSYFTCYLSLATAPPIFAWLSDLNPFDAEQRAFTLGFAIAFYYACGAWSGPLIWPAS
                     EAPHYRHGWQVTIAMWCLVIIMACSLRIVELKFIRPQNVRKAVDAENAERIRQEEEDE
                     DDKKDTTVGRIISVVSRA"
     gene            complement(11843..13937)
                     /locus_tag="CNK00040"
                     /db_xref="GeneID:3254633"
     mRNA            complement(join(11843..12009,12070..12217,12361..12570,
                     12635..12945,13008..13100,13158..13300,13367..13429,
                     13490..13579,13633..13937))
                     /locus_tag="CNK00040"
                     /product="arsenite transporter, putative"
                     /transcript_id="XM_024658012.1"
                     /db_xref="GeneID:3254633"
     CDS             complement(join(11959..12009,12070..12217,12361..12570,
                     12635..12945,13008..13100,13158..13300,13367..13429,
                     13490..13579,13633..13831))
                     /locus_tag="CNK00040"
                     /codon_start=1
                     /product="arsenite transporter, putative"
                     /protein_id="XP_024513763.1"
                     /db_xref="GeneID:3254633"
                     /translation="MVQCHPLDSLSSAAGGSPHEKTPLVHPPMICKGDCQCFKENYET
                     IPALNTSSIHTDRREVGDVDLEGGIYIVKSLSFLDRFLALWVLAAMIIGVIIGEFAPN
                     VELILTGANLKGVSVPVLVGLLCMMWPILTKVQYERLPSLLQSSHIYRQIGMSLFLNW
                     IVGPFIMLGIAWATLPDLPTYREGIILVGLARCIAMVMIWNRLAHGNEDYCAILVIIN
                     SILQIILYSPMSVFFINIISRSENAISLSYGETAIAVLIYLGIPLGAGVLTRFGGLLV
                     LGKKRFDSFLTYFGIVSLVALLYTVIIIFAEQSHRIIHNLGPTFRTFVPMILYFALMW
                     TSSFALIWLLSQKKGGGRKWGYEMAVVQAFTAGSNNFELAIAVAIAVYGVSSDQALAA
                     TIGPLVEVPVLLALTWVALLAKKRLNWGENDVTGETCERECGC"
     gene            complement(14328..16229)
                     /locus_tag="CNK00050"
                     /db_xref="GeneID:3254464"
     mRNA            complement(join(14328..14844,14897..14995,15060..15130,
                     15191..15470,15525..16229))
                     /locus_tag="CNK00050"
                     /product="expressed protein"
                     /transcript_id="XM_567774.2"
                     /db_xref="GeneID:3254464"
     CDS             complement(join(14404..14844,14897..14995,15060..15130,
                     15191..15470,15525..15719))
                     /locus_tag="CNK00050"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567774.1"
                     /db_xref="GeneID:3254464"
                     /translation="MHEHVTLALLYVAQLLPRDDTDKTRYISISPSDLSKFNVEGQIM
                     LVKHSQSPIDHAEVIQWSGKFVPGKACEPVNHRLFPNVSGELDACDGDTAGQVQQERS
                     VSMSLVWEYPVEELAVLIDVLFRGHCKENDKENGNKRTSSTVSQVIKERFPYSSEDGR
                     LLLESARAREEIVAKLDVLCYQCNAETTPQKLRAHVGAHILAYHYQTGIPKAQKPVGK
                     HYPCGFCGREGCTLLLKASRSGKTPQASSNCPSFQSFQQLSALKSKECSNAPVRCKEV
                     GCEQVHWKYNMRYHYEYAHVGTPMPAKYRIGREELVRMKVMTKEKKRAAPVLSGSSDE
                     GESRTVETVEGKRRRKYTKKGAAVMKE"
     STS             15737..16533
                     /standard_name="Bam13"
                     /db_xref="UniSTS:470678"
     gene            16743..19062
                     /locus_tag="CNK00060"
                     /db_xref="GeneID:3254668"
     mRNA            join(16743..17298,17354..17420,17470..18596,18705..19062)
                     /locus_tag="CNK00060"
                     /product="beta-fructofuranosidase, putative"
                     /transcript_id="XM_567775.1"
                     /db_xref="GeneID:3254668"
     CDS             join(17134..17298,17354..17420,17470..18596,18705..18905)
                     /locus_tag="CNK00060"
                     /codon_start=1
                     /product="beta-fructofuranosidase, putative"
                     /protein_id="XP_567775.1"
                     /db_xref="GeneID:3254668"
                     /translation="MFRSLVPVTIAGLAYVLQSLAQSTTSSAASVPTGVPIDGDYSGP
                     YRPRVHFSPPKGFMNDPNGLHKDGNGTWHLYYQYNPTDIVAGNQHWGHATSPDLYHWT
                     NQPIALFPPNSSSGVFSGSAVIDTNNTSGFFPDQDNGVVAIYTLNTPTAQVQQIAYSK
                     DGGYSFEEYEGNPVLDVGLTQFRDPKVIWYEDHWVMVVAFPVDYVIGVYTSPDLKSWT
                     HASNITHVGFLGLQYECPNMVSIPIANSSDSSWVLTISINPGSPLGGSITQYFPGEFN
                     GTHFTPYDSAARLTNFGKDDYAGQFFYDEPVSIGWASNWQYTNFVPTGEEGWRSAMTL
                     PRKNYFTNITAAGWDLVQEVYDLSPVLGDQLDTQQLVNKSSTATITEAAYIDVNFTIP
                     DDASFAEYASLNFTVSTNSSGETVKGGYFFAEPYSIAAWLDRRDTKAFESPFFTDKFS
                     VAPAQQAKRLQVIIDRSLIEIYIDNGALVGTMVAFPEEPFTKLEVTTAGLPDGMEVEV
                     GVWDLKDSWTS"
     gene            complement(19050..22023)
                     /locus_tag="CNK00070"
                     /db_xref="GeneID:3254444"
     mRNA            complement(join(19050..19713,19769..20331,20386..21214,
                     21268..21628,21680..22023))
                     /locus_tag="CNK00070"
                     /product="phosphoketolase, putative"
                     /transcript_id="XM_567776.1"
                     /db_xref="GeneID:3254444"
     CDS             complement(join(19266..19713,19769..20331,20386..21214,
                     21268..21628,21680..21983))
                     /locus_tag="CNK00070"
                     /codon_start=1
                     /product="phosphoketolase, putative"
                     /protein_id="XP_567776.1"
                     /db_xref="GeneID:3254444"
                     /translation="MAEETSSLTSFGQARSTVKDQPLTVEELKKIDAYMRASLYLCLG
                     MLYLRQNPLLKEPLKKEHLKARLLGHWGSDAGQIFTYIHMNRLIKKYDLDALFVSGPG
                     HGAPAVLSQSYLEGVYTEVYPNITEDVEGMRRFFKQFSFPGGVGSHATPETPGSLHEG
                     GELGYSISHAFGTVFDNPNLITLTMVGDGESETGPLAASWHSTKFLNPITDGAVLPVL
                     HLNGYKINNPTVLARISHEEIEALFIGYGWKPYFVEGSDLTSMHQAMAATLEKAVLEI
                     KAYQKQARDSGKAFRPRWPMIILRSPKGWTAPRNVSGHHLEGYWRAHQIPLADVASNS
                     EHLKLLEDWMRSYKPEELFTEDGKLIPELKALPPAGQARMSANPVSNGGLVRKALNLP
                     DFKDYAIKDIAPGVTLAPSMSNMALFVRDVIKKNQTNFRLFGPDETESNKLAAVYEAG
                     KKVWMGEYLPEDTDGGNLAHAGRVMEILSEHTVEGWLEGYVLSGRHGLLNSYEPFIHI
                     IDSMVNQHCKWIEKCLEVEWRVKVSSLNILLTATVWRQDHNGFTHQDPGFLDVVANKS
                     PEVVRIYLPPDGNCLLSVMNHCFDSKNYVNVVVADKQDHLQYLDMEAAVAHCTKGLGI
                     WEWACVGDPNENPDLVMACCGDVPTMESLAATALLKEYLPELKIRFVNVVDLFKLISH
                     VDHPHGLTDRQWVSYFTEDTPIIFNFHSYPWLIHRLTYKRPGSQNIHVRGYKEKGNID
                     TPLELAIRNETDRYSLAMDAIDRLPHLKNKGSMAREKLYDAQIKARDWAFEHGIDPED
                     VRKWKWPYGPKTEGIASKLGFGGENKQQVASVGTSE"
     gene            complement(23454..25904)
                     /locus_tag="CNK00080"
                     /db_xref="GeneID:3254503"
     mRNA            complement(join(23454..23936,24010..24075,24139..24185,
                     24258..24804,24862..24871,24927..25101,25150..25182,
                     25240..25308,25362..25904))
                     /locus_tag="CNK00080"
                     /product="lipid metabolism-related protein, putative"
                     /transcript_id="XM_567777.1"
                     /db_xref="GeneID:3254503"
     CDS             complement(join(23539..23936,24010..24075,24139..24185,
                     24258..24804,24862..24871,24927..25101,25150..25182,
                     25240..25308,25362..25720))
                     /locus_tag="CNK00080"
                     /codon_start=1
                     /product="lipid metabolism-related protein, putative"
                     /protein_id="XP_567777.1"
                     /db_xref="GeneID:3254503"
                     /translation="MLSLKESKKSKPSKEHPAATKAQGTTFSAILSAIYYYTLGALFS
                     NISNSVYSLVGSLGMARWARDIVRIVPSKPGIVKLRSSLGSGGAKTGKGNKNLTEWIN
                     ESVPSLMGRFTPAAWLPNGHLQTLFTAAGDFTKVDKVHYIRTYLRLPDGGTLGIDATP
                     ENHDGLPADAPTVVVCHGLTGGSHESYVRNILAWVAKPKEDGGLGGRGVVVNFRGCAG
                     VPVTSCQLYSAGTTMDLALALHFIRNRHPSSPLIGIGFSLGASIISRYLGEYGYSSIL
                     SAGVVLGCPWDLTAMSHKLENDWFTARVYSSTLGRNVLRLFFKAFDQNPAVFEAPDSP
                     IREYIEELKAERKNQGTQSRLRRIDDLLVSKIGGPRGIGAWPFPSAKEYYDWASSTHV
                     LRNVKVPLFAINAFDDPVVDGGALPLDEFVASSHIYTAVTGGGGHLGWFDGPFFDKTK
                     SKQRWVLKPVSEFISACTRDLSPPDEDPDSRVDIVAGSRIGPKGADVKLGAEANGNAD
                     FKSNIDADVELNADGGWEWVVNPKYKIPGFEKVGWKVLKEGEVVEGESDEGEGGLVQG
                     L"
     gene            26151..30358
                     /locus_tag="CNK00090"
                     /db_xref="GeneID:3254545"
     mRNA            join(26151..26837,26906..27370,27430..28539,28594..28683,
                     28738..28943,28997..29409,29471..30358)
                     /locus_tag="CNK00090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658013.1"
                     /db_xref="GeneID:3254545"
     CDS             join(27524..28539,28594..28683,28738..28943,28997..29409,
                     29471..30139)
                     /locus_tag="CNK00090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513750.1"
                     /db_xref="GeneID:3254545"
                     /translation="MVDLSALSIPQFSSLSPSDGFSPLKHAFGPSRPLSIAPSDSSSE
                     PLTVSPAGTKTSWALISYSSCCPDNSQDIIDRSPFPTSTNFTSSFSMSQSQQNNDTYS
                     YRMTPNTGTSQWSQSPTADNSFISSPLTKSIAFQNGLTGISPMFATFNTTSIPNASYP
                     TAAHPINPSCPMPVRGYSASSAVHSPNRRRSSTLVTLSSPSPMTPPFNHYPYPPLHIS
                     YPSTPSSVSARNLFRQPSIPAFSENKRIFHPSPAGKTPATGAKLTQLPYEHGYEGGSQ
                     FGSGNMLGGMGMNMETGNPLSLNMFPQMNTGFRPGNGQEFKLPRFKPTKEQLEILIKS
                     YEENKTPDGPTREALAKKLGPDVRPKTLQIWFQNRRSKSRAKERDAANIPKPLQTNSP
                     TIKPSAQGHEKGKSGPTRSTSGGPGEMKQGGVNIERLNSLIHDDDPSLSILPITVLSI
                     AKWTRFLTPGTGNICPDLAASIRFRSASTPSHPSPLLPTLHLYVLHTTIFRIDIPLSA
                     SVISNLQATNNPSVITDAVAVRFELGRGQVRFACWIDEEGAGWKEVGDFTGGEAGAGG
                     RVELTGPASILLPAFSTVQQLLTNTAYPTPISSFLISGPISIHPKPINALHLPTNANT
                     QSHSNPTSTPPSFSSPPNLTATPPLPLSSVSVDTDMMSRSHQGQQAATLAPAGHQRQR
                     SFSQPIFPTSALISGMMPIDTSLSSTAPIDKTTRDSLTMRPSVNTTLQASAQSSFEPS
                     PVSFIGNSGHSQTPVTGSFNGNATVLGTDQLWESPGGLSDSTSLTLNINEFELVEKK"
     gene            complement(30705..34679)
                     /locus_tag="CNK00100"
                     /db_xref="GeneID:3254426"
     mRNA            complement(join(30705..31470,31540..32161,32250..32412,
                     32479..32585,32653..34679))
                     /locus_tag="CNK00100"
                     /product="ubiquitin-specific protease, putative"
                     /transcript_id="XM_567778.2"
                     /db_xref="GeneID:3254426"
     CDS             complement(join(31100..31470,31540..32161,32250..32412,
                     32479..32585,32653..34512))
                     /locus_tag="CNK00100"
                     /codon_start=1
                     /product="ubiquitin-specific protease, putative"
                     /protein_id="XP_567778.2"
                     /db_xref="GeneID:3254426"
                     /translation="MGGAGPGPATMQNGYGGYGEYGVYYGYAGYPDYQPPHAGYPPAD
                     GDDYSDPAKTPSSAHAVPQPPAIVAPNHTPHGMPQQFPSYPPNHPYAFGGGVGYPQGY
                     TRPPQHMHQHQHHPQPHFHPQHQQHLQQGPYGGYGYQEGYHGGKLNPAAQGFKYNRFQ
                     QQQQQQQQQQQQQQQQHQQQQQQQQQQQQQHQQQQQQQQQQQQQQQQLQQAHAHAHAQ
                     AQAQAQSQGPPRQPVHSQQPPPAPAPIAPSQNQPSEPLQPPIPNGHSHPEPPTPSTPT
                     ATTKEREAQSAAQQEPVPASAAVEQEKETAKDEETCPDASSAIAAPRWNFIHPSSLPS
                     SSSTGIATLHLEMNKHAHPQRIRLVRARPGEESDGNSFAIEVKTGLPEEIVVDEQSPS
                     QSQEKGTGRGKGGKKKTKETGRGVWKTGEKRRVELVFGEIVPEQEKEKEDKAEWVGEK
                     PVVDEKEEEKVEKKERSTPARAPAPAPSPAKPRSWAALLKTPTPSSPSTPGAVPSSSA
                     RVTSTTEAGPSRPRPSTSASPSTPNLTANVNGLQLSPPTQGQQQQQAKTFNYAAAAMS
                     SVPSPHEELIKLLSEGVSSLRGSGTTVGLSVKEKEALMVPRGLINTGNMCFANTILQV
                     LVYCPPFTELFEEFGKRLKADLARKTPLLEAMIIFLREFVSSPESSTSTTSTPKGKGK
                     DKDSRKEAFIPENVYDAMKENKRFDSMRRGYQEDAEEYLGFFLNTLHEEIIYLLSQTS
                     TTSSSMPNGQPSDSSSRQVERPVSPRAGAGINGNADSSSGWLEVGKKQKTHVVRATES
                     RESAVSRLFGGKLRSILHTPGQKDSVTIEPYQPLQLDITGPAILSITDALRAISTPEI
                     IHGVYSAAKGGEVDATKTVYVETWPKVLICHLKRFVYDTEEGGVVKRSKAVAYGVDLA
                     IPNEIISPARRTSTSIKYALFGVVYHHGSSASGGHYTVSVARPSSSSSSSTSSTSIQS
                     PAGTSSSLPPPPSSTTIASRWLHFDDENVREVREEDVVVSLDQAKGGETGSVGGRERC
                     AYLLFYKRVQ"
     STS             33760..34059
                     /standard_name="GTT6"
                     /db_xref="UniSTS:470681"
     STS             33832..34118
                     /standard_name="CTG11"
                     /db_xref="UniSTS:470680"
     gene            34905..36328
                     /locus_tag="CNK00110"
                     /db_xref="GeneID:3254425"
     mRNA            join(34905..35111,35172..35491,35551..35716,35769..36017,
                     36075..36328)
                     /locus_tag="CNK00110"
                     /product="methyltransferase, putative"
                     /transcript_id="XM_567779.2"
                     /db_xref="GeneID:3254425"
     CDS             join(34973..35111,35172..35491,35551..35716,35769..36017,
                     36075..36145)
                     /locus_tag="CNK00110"
                     /codon_start=1
                     /product="methyltransferase, putative"
                     /protein_id="XP_567779.1"
                     /db_xref="GeneID:3254425"
                     /translation="MAFGDRGGRGGGRGGPRGGGRGGAGGRGGFGGGRGGGAARGGAG
                     GRGRGAPRGRGAPGGRGGGRGGKAGLGRSGPGAVTLEPHKHEGVYIAKGKEHLLVTRN
                     MTPGESVYGEKRISIATTNADGEEEKVEYRVWNPFRSKLAAGILGGLDNIHIKPGAKV
                     LYLGAASGSSVSHVSDIVGPDGVVYAVEFSHRPGRELIGMAKKRTNVVPIVDDARHPQ
                     KYRMLVQMVDVIFADVAQPDQARIIALNAHHFLKNGGAIVISIKANCIDSTAPAAQVF
                     ASEVNNMRKEGIKPKEQLTLEPYERDHAMVVGIYQRHT"
     gene            complement(36338..38518)
                     /locus_tag="CNK00120"
                     /db_xref="GeneID:3254686"
     mRNA            complement(join(36338..36583,36679..37095,37163..37306,
                     37363..37378,37430..38518))
                     /locus_tag="CNK00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658014.1"
                     /db_xref="GeneID:3254686"
     CDS             complement(join(36494..36583,36679..37095,37163..37306,
                     37363..37378,37430..38133))
                     /locus_tag="CNK00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513764.1"
                     /db_xref="GeneID:3254686"
                     /translation="MLPLPTSQPKPRPSAPPRRRVLVLLPFVAAAAYLLYLFLAYCAS
                     FPPHHRYNAALHYSPPWLHPAIGRLVPRPGRPASPPRIIPGLRSARPMEEWDVPLLTG
                     PAYAPDPSDTSHAVLTSPALLMLHVFSTPTPESRARRALIRSTASPLRAVPPQHRHLV
                     ELKFILGRPTPIVGSSSASPLWNGTEEQMVDAEDRMYGDLVRLEGLEDGENRDKGKTW
                     EWIRWVGSRERAGWWVMKCDDDTLPILSNLLPILLANPPTIPSYIGTSLGHWTGYHFY
                     FEGMMYGFSWPVIKTLATAAVPAYERNAQRNEDAFMGELMFSLPFLHTPSSGCLPEGE
                     TVMFPRPIPRPGVVAGEGEGAEHNDVEEGNSKNEKQKDDTNYSLPPPNPDPCTGLFRL
                     DLGRRLGDYHHAQGQGLVTGNMGDIVGLHGLKNDEDYVKVYNQFRTRLEGERKWEWAV
                     PDALSV"
     gene            complement(38769..39849)
                     /locus_tag="CNK00130"
                     /db_xref="GeneID:3254692"
     mRNA            complement(join(38769..38933,39000..39244,39302..39641,
                     39721..39849))
                     /locus_tag="CNK00130"
                     /product="thioredoxin peroxidase, putative"
                     /transcript_id="XM_567781.2"
                     /db_xref="GeneID:3254692"
     CDS             complement(join(38883..38933,39000..39244,39302..39641,
                     39721..39786))
                     /locus_tag="CNK00130"
                     /codon_start=1
                     /product="thioredoxin peroxidase, putative"
                     /protein_id="XP_567781.1"
                     /db_xref="GeneID:3254692"
                     /translation="MSLRLGDIAPDFEADTTHGRIKFHDWLDGSWAILFSHPDDFTPV
                     CTTELSAVALSYADFASRGVKLIGLSANNIASHEGWIKDINALKPDAPALEFPIIGDE
                     DRTVSELYGMLDKLDKTNVDKKGIPFTVRTVFVIDPKKQIRLTLAYPASTGRNFPELL
                     RVIDSLQLGDKHRITTPANWGIPDPKTGQVEERVIVHPSVQGEEVKQLFGDDVETVYP
                     YLRFTSNPSKKEVTA"
     gene            40320..44218
                     /locus_tag="CNK00140"
                     /db_xref="GeneID:3254466"
     mRNA            join(40320..40417,40469..40637,40751..42006,42148..42198,
                     42272..42565,42631..42706,42784..42922,42994..43680,
                     43749..43952,44019..44218)
                     /locus_tag="CNK00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658015.1"
                     /db_xref="GeneID:3254466"
     CDS             join(40822..42006,42148..42198,42272..42565,42631..42706,
                     42784..42922,42994..43680,43749..43952,44019..44073)
                     /locus_tag="CNK00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513692.1"
                     /db_xref="GeneID:3254466"
                     /translation="MFESHLNLNPHGAIGQPSPSIGVIGEQPQAIDNLSPAPARPAAH
                     PRQVAAASLSQGQLGGRPRTPINRDWDRDTDTDRDRDVVMGERREQADVESDLTNLLV
                     QTRLHRTGLFSDREVHSQPHSHSQSQSQSQPQSEAPSQRQRQYQSQSRSQPQSQSPSQ
                     GKDDVTGGIDDFRKRWERESREGGKRFDEETWDRSLLGMGMGMGTVQRQGRGSPAPGG
                     FGIGLGSGLGLGGKAMGIGGTVGGSTQSKMTTGTFAGYQPFMGKISPVSSAQYRPSLS
                     PSNHHLPSSTYGNQAPSQPQSYTQPQTPSHTAAPNTLVAGAGTGGQNDTTATQITRHL
                     ESLTILLNPLLAQADEVERLRKEVEMWKSEWARAERERKRLEEKVGGMGMELEKAVGK
                     SRDIAGPSFTAVLIDGNGLIFQDPYLQAGFKGGQLAAHHLLSSIPNLAPGSPSSKTTH
                     TGIIAKEVTLGLDSLPVNNNKGGDDDDYGGKKTEKGGREMGSVVVQIFVNKQGLGGAL
                     IKSGIVPSWNVYDQFWQGLSSSHELFTVCDVGQGKEASDAKIREYLNLYASNAQCRSI
                     ILGASHDNGYANVLSSLQTGSRLSNVVLLKGYATLAPQLKTYSSRVVSIPDLFRLEKV
                     PPPLPSFTSSTTADVVSSIQAGGSPDLLSAVTGLAGVSFSSIVASSPKDKEADFAGPY
                     GANVRDNTNTATSARNISSADIGKARISTPKRDEYEESEEEIEEFEYEWGSGAQFKGR
                     SDLASGFAPGSAKKKKIPAPFSREANFSRVGGKDREMDDEWTEMAPKKKVKGKRKEAA
                     EYVRTLKPRPCHTFYLGPRGCKNGDDCQYGHEYKLNAAQLDELARLAKCIMCPYVKDG
                     RCRYSDDDCVYGHQCPNPDKCVFGETCRFYELPNGHGELN"
     gene            complement(44185..45779)
                     /locus_tag="CNK00150"
                     /db_xref="GeneID:3254594"
     mRNA            complement(join(44185..45442,45515..45779))
                     /locus_tag="CNK00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658016.1"
                     /db_xref="GeneID:3254594"
     CDS             complement(44487..45362)
                     /locus_tag="CNK00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513693.1"
                     /db_xref="GeneID:3254594"
                     /translation="MSEDSSTSTSISEDELSSSSPPPSTNPSRSKSRPRPSSRSPGSR
                     SRDGSRRSVSSSREESRRSSNEMSIRRSKGNKEDLSKTTDDNTSSAPSDDEGSTMPDK
                     KEENTKATADMGGSSVEKESSQTLATSSAPSPPATASVPTSTAVSEPSEPADAYGTAL
                     LSFSTSAQTLSSIDPFFTIPEPETGKRYQEMFDRARKDADEVYKKLLDYLDKRANGEG
                     GIEGEKGGKGEGKGEEEEKVAKSKASTAQPSPPSSEPPNLDATSVPPTDIKTETTTCA
                     PSAPPSSPSADNKTT"
     gene            47871..52896
                     /locus_tag="CNK00160"
                     /pseudo
                     /db_xref="GeneID:3254651"
     gene            53935..56245
                     /locus_tag="CNK00170"
                     /db_xref="GeneID:3254438"
     mRNA            join(53935..54146,54204..54225,54280..54290,54358..54519,
                     54580..54762,54825..55109,55180..55335,55412..55720,
                     55813..56245)
                     /locus_tag="CNK00170"
                     /product="Tubulin gamma chain (Gamma tubulin), putative"
                     /transcript_id="XM_567730.1"
                     /db_xref="GeneID:3254438"
     CDS             join(54120..54146,54204..54225,54280..54290,54358..54519,
                     54580..54762,54825..55109,55180..55335,55412..55720,
                     55813..56004)
                     /locus_tag="CNK00170"
                     /codon_start=1
                     /product="Tubulin gamma chain (Gamma tubulin), putative"
                     /protein_id="XP_567730.1"
                     /db_xref="GeneID:3254438"
                     /translation="MGREIISLQAGQAGNQIGAQFWQKLCAEHGISPQGDLEDWAADG
                     GQGDRKDVFFYQADDEHYIPRAILIDLEPRVINSILTSPFKGLYNPENIYVSKDGGGA
                     GNNWAQGYSAGEKVYDDLMEMIDREADGSDSLEGFMLLHSIAGGTGSGLGSYLLERLN
                     DRFPKKLIQTYSVFPESSDVVVQPYNSLLATKRLVNNADSVVVLDNAALTRIAADRLH
                     IQDPSFVQTNQLAATVMAASTTTLRYPSYMNNDLVGIIASLIPTPRCHFLMTSYTPFT
                     GDEIDKAKSIRKTTTLDVMRRLLQPKNRMVSTTSTKSSAYISCLNIISGDVDPTDVHK
                     SLLRIRERQLANFIPWGPASIQVALTRKRGMGAGSNRVSGVMMANHTSMASLFKRMLH
                     QYDMLRKRNAFLEQYKKEDMFANGLEEFDDARRVVQELQEEYLAAERPDYIDFGGE"
     gene            complement(56234..58107)
                     /locus_tag="CNK00180"
                     /db_xref="GeneID:3254664"
     mRNA            complement(join(56234..57372,57448..57501,57554..58107))
                     /locus_tag="CNK00180"
                     /product="L-serine ammonia-lyase, putative"
                     /transcript_id="XM_024658017.1"
                     /db_xref="GeneID:3254664"
     CDS             complement(join(56334..57372,57448..57501,57554..57657))
                     /locus_tag="CNK00180"
                     /codon_start=1
                     /product="L-serine ammonia-lyase, putative"
                     /protein_id="XP_024513694.1"
                     /db_xref="GeneID:3254664"
                     /translation="MTIATPELYNHKAIPQPWRETPLVQSAALSRLAGCRIFLKLDNL
                     QPSGSFKSRGIGNLVRRSIQRSPPNAPLHFYSSSGGNAGLACVTAASSLGYPSTVVVP
                     MTTTPMMISKLFTAGASKVIQEGASLYQADAYLKEHILPQDQWGVYIPPFDHEDIWQG
                     AESVAEEVVRQMGGERPDGIVCSVGGGGLMIGICQGLEKVGGAKREGAVNGKGGEEVY
                     QTEVIAVETLGADSLNQAIKAQQLITLPSITSIATSLGCARVASRALDIALGLSPSLP
                     PPISLPPSPLPSPSSSPAETSSSLPDPTITSDKSRIPMKNSKVVPTLVTDKEAIQACV
                     QFLDDERILVEPACGATLALVYTGRLREVMKGRLTEDSKVVLVVCGGSNISLEVLQRY
                     KMEYGL"
     gene            58423..59457
                     /locus_tag="CNK00190"
                     /db_xref="GeneID:3254578"
     mRNA            join(58423..58562,58622..58845,58901..59457)
                     /locus_tag="CNK00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658018.1"
                     /db_xref="GeneID:3254578"
     CDS             join(58526..58562,58622..58845,58901..59302)
                     /locus_tag="CNK00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513695.1"
                     /db_xref="GeneID:3254578"
                     /translation="MVAAHILVIGATGQSGLEFCSAALNEGHQLTLYVRNPGKVPAAI
                     SGNEKVTVIHGTLENESSLRKAIESGATIFVSFAGPVGPSKGTPITDAMKSIFPLLIA
                     NKFERAMVLGTCSFTAPEDKGSLKWKALIVLIKLIGGSAFEEFQGLGGFVTSQDITQL
                     KWTLFRVPFLWNGPEAPVNATFTGSGTDGMFLSRKSLVIWVLKEMNGESDWIGKAPVL
                     SN"
     gene            60292..61865
                     /locus_tag="CNK00200"
                     /db_xref="GeneID:3254397"
     mRNA            join(60292..60521,60572..60648,60698..60744,60802..60924,
                     60981..61300,61353..61441,61519..61865)
                     /locus_tag="CNK00200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567591.1"
                     /db_xref="GeneID:3254397"
     CDS             join(60343..60521,60572..60648,60698..60744,60802..60924,
                     60981..61300,61353..61441,61519..61697)
                     /locus_tag="CNK00200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567591.1"
                     /db_xref="GeneID:3254397"
                     /translation="MSSTEPTIIPSSNTMPPPNGVPGATGTSTPILGSRGGPSGGGAG
                     GSFGVKSGLAQMLKGGVIMDVMNAEQAKIAEEAGASAVMALERIPANIRRDGGVARMS
                     DPGMIKEIMEAVSIPVMAKVRIGHIVEAQILQAVGVDYIDESEVLTPADDQHHIGKHA
                     FKVPFVCGCKNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHQRAVMSDIRKAASMT
                     DEELYAFAKELSAPYHLLKETARLKRLPVVSFAAGGVATPADAALMMQLGCDGVFVGS
                     GIFLSGDPAKRARAIVQAVTHYNNPQVLAEISTNLGEAMVGISTAHEGEKIQGGRLAG
                     RGN"
     gene            complement(61926..64551)
                     /locus_tag="CNK00205"
                     /db_xref="GeneID:36393094"
     mRNA            complement(join(61926..62417,62574..62732,62882..62889,
                     62945..63004,63064..63095,63178..63243,63374..63479,
                     63539..63599,63662..64551))
                     /locus_tag="CNK00205"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658799.1"
                     /db_xref="GeneID:36393094"
     CDS             complement(join(62355..62417,62574..62732,62882..62889,
                     62945..63004,63064..63095,63178..63243,63374..63479,
                     63539..63599,63662..63757))
                     /locus_tag="CNK00205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514634.1"
                     /db_xref="GeneID:36393094"
                     /translation="MTADWLGPRTFPNLWMKVCKLWVIVALGALVMPLIVWIMIFIEN
                     TKTFSDTMNHYLGNDQSVYDRMDGDPDAGYVGNTNIPKHLGGVVFAAAFDIAMWVIII
                     IAACADLFWRFPICKQLIDAFYAQGLHDAKGLVDIEFFFLVANAFLKLFIVAATGSQT
                     YTGLYPDNKQVDTPLFCLYATMILLCSIPLTLIALFFILHAMKREEYTAAQKMTAA"
     gene            64725..67087
                     /locus_tag="CNK00210"
                     /db_xref="GeneID:3254404"
     mRNA            join(64725..64819,64879..64932,65394..65444,65497..65874,
                     65933..67087)
                     /locus_tag="CNK00210"
                     /product="RNA-binding protein sce3, putative"
                     /transcript_id="XM_567592.2"
                     /db_xref="GeneID:3254404"
     CDS             join(64816..64819,64879..64932,65394..65444,65497..65874,
                     65933..66984)
                     /locus_tag="CNK00210"
                     /codon_start=1
                     /product="RNA-binding protein sce3, putative"
                     /protein_id="XP_567592.1"
                     /db_xref="GeneID:3254404"
                     /translation="MAPKKKGQKMALHEFFEEAATSGSSWADDDFDLPTAPAAREESG
                     SGLKRGDPGYFESLPDRGSRQATFAGAPAQREELPLPTVPPFTAFIGNLSFEPDVEEE
                     VRAFFNDLDPVSVRIVKDPQGKPKGFGYAEFKTQDGLKQALDRSMSQLQGRTIRVNVA
                     EAPSTSRNPPSAAEEASQWRRSTPLVSRESSSQPSRRTGGPSEPAGDLDWSVARGAKF
                     TPSAPAAPLSGVRRDSSGPGHAREPREPGVSDATDQWRSNKPLTEKLDRDVPPHQAGV
                     APPIVSPSLADTEQTWSRGTKLRTPTTTSRQSSADSTPSSGAPQERRKLNLKPRTAGS
                     PSATAPAIAGTPTSGIFGAAKPIDSAAREKAAEEKLAQREEERRKAREEAEKQKVAAG
                     DKPAEGEKLGWREEKLRSIKAAQDKVAGKPTAATTTTTTNTGAGRKGSADKSKKDEQG
                     FEQVQPSRKSAQTGAVSENKPKKDYTTRPQFSFAAAAGAIRNDLVEDKDEEDVTKGVE
                     EVKI"
     gene            complement(67084..68374)
                     /locus_tag="CNK00220"
                     /db_xref="GeneID:3254479"
     mRNA            complement(join(67084..67591,67705..67819,67922..68184,
                     68257..68374))
                     /locus_tag="CNK00220"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567593.2"
                     /db_xref="GeneID:3254479"
     CDS             complement(join(67149..67591,67705..67819,67922..68184,
                     68257..68299))
                     /locus_tag="CNK00220"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567593.1"
                     /db_xref="GeneID:3254479"
                     /translation="MPEQTTVSPCCITGHIHSGKPLGSISIQHGLRTYVSLPSSAEKG
                     KAEGQVGQKQDTIILISDIFGIDLVNSKLVADEWAGQGYKVLLPDFFEGDPIPESLLQ
                     SIVPNLRHQAEATALTKAADTAKAAAALGPWLVKHREAVTRPLVEKYVQSVRSDTSTG
                     KIAAVGYCFGARYALLLAQPQSGAKSSVDVVVANHPSFLVLDDVKDINSTPCIILKGD
                     KDDIMSEDDLDKVEEIMKQNLGEKLVVKRFPGAVHGFTIRGDMEDGQEKSQKEQANKD
                     SFAFVAKYFKS"
     gene            68533..73505
                     /locus_tag="CNK00230"
                     /db_xref="GeneID:3254478"
     mRNA            join(68533..69865,69914..70295,70413..70466,70556..70606,
                     70693..70764,70866..72130,72208..72864,72927..73505)
                     /locus_tag="CNK00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658019.1"
                     /db_xref="GeneID:3254478"
     CDS             join(68930..69865,69914..70295,70413..70466,70556..70606,
                     70693..70764,70866..72130,72208..72864,72927..73307)
                     /locus_tag="CNK00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513696.1"
                     /db_xref="GeneID:3254478"
                     /translation="MPSWCDFSNEDETELLALLTPFTVMTAACVGRPGRWKRVGEKTA
                     YEPGALRLLLVGCLFYSFLVIFLHLSTYSKSCLSPLLIFSSFLLPFHSLTLLLLFSFS
                     PFLQCADYSVFWPAISSIPSIFTTLSSLTHARHRNILRPANTLNSALIMPSRFHSPSK
                     MSLKDVKAPFKTRRLSASSISHPFSVSPLSFNLSVSLADSGNNVNEDNHGHTDNGIRE
                     KPVGIIKHGTPSPPFVPPKSPSPPPVPPKSPPRLLPLPLHPPSQPLPSIRPRRQPQRS
                     SIPGKSLPKSPTKNSIFKMVAKSVSMPSLHSTTNIRDQVKNNGRTKYKGKDTKELSSK
                     APDGFKDNPRWKKTTKEKIKPAPKSQEKMKSPKQGILKFGRKEANHTLNSNSEITGKK
                     KSKAKMAQDVPRQVRFHHVPPTPPVSGVSRGSRDAKRNRIGGAITSAESLRFPIPSVL
                     ISDIANQSVDSMLDQMLAAQANYKPTSPIAFPTAVPTPLETASEVSTRHEGHAQVQNP
                     VYERVMKSEKSTPSPPSSIDTYSQTHTHISTANPVSEPCAGYGSTSPSLLSAQGPTNR
                     SLSISGGLGIETASLTRGVSLMENMHQAPEVRAMPDSQHRREMPVISVEMVDDQAYRG
                     NSYPHFAAGGVTSSFNSSLRSTNTSSKKDNPQAIVSSTHSNSTTPWYDVSIHPTEPAS
                     PALSAISSSAVIGAPLSSHPSLYPSSGGPFLSVESEKNSGERLSSNFEPISKTDNPRQ
                     SALMVDLGIGRPYDEALAQASNVTAITAAPTATNTTTGMRMTSIPSLLPLNQLKQPLN
                     ENSSAFPPVISPSMSESSGAEILLTPMDHQFHGHTAHTMAKTSSTGDGSSGGAPEALL
                     TMEESLMYRALFARAFQRGFLTADDLKGEKTFVEALNPGGHLPNVDHGVAKEIVALRR
                     ENARLKTQLAVSEDIVESQRAELSAFLHSPKSSYSQDPCSPSPSPINSPSRKQGLKIT
                     IESPNVNSRLLRYINSSLSSPPTSRGAKYNHRRSAGVDYLINEVCQLRTELEITRDRQ
                     GQWQHRAEMAETHRERAEESVAAMQAMFGRVMEDLDEARRRSQMTREENDRARSEMEE
                     KRIKGEVAKLELRRRDDKELLEKEKMKVKVKIMEKKIEGYNEAVRMFKNCLVEVAQLR
                     EQRSGIEQELFHLRTDYDHLSFSTTASIKSPPSHSAALLPETKRHPHSQQQRIATPSS
                     TNISTNDQDGKQEGSLTPVGPTTSKRSQSFQPTSEGSKTSPGLSRPSFWKFASAPRTQ
                     ETI"
     gene            complement(73375..76767)
                     /locus_tag="CNK00240"
                     /db_xref="GeneID:3254610"
     mRNA            complement(join(73375..75596,75648..75757,75808..75960,
                     76025..76343,76424..76767))
                     /locus_tag="CNK00240"
                     /product="deadenylation-dependent decapping-related
                     protein, putative"
                     /transcript_id="XM_567731.2"
                     /db_xref="GeneID:3254610"
     CDS             complement(join(73766..75596,75648..75757,75808..75960,
                     76025..76343,76424..76677))
                     /locus_tag="CNK00240"
                     /codon_start=1
                     /product="deadenylation-dependent decapping-related
                     protein, putative"
                     /protein_id="XP_567731.1"
                     /db_xref="GeneID:3254610"
                     /translation="MPLPVHPHLHPGYYSPSSSSSPLESNSFPVVGPDQDDITTGDDE
                     DNMFRDMSFDEILEDLNARFLINLPKEEMNLLRVYWQAEQAHWFYEDYLRPLNPSLPS
                     LSQRQFTRLIIESSPLYSRLVSGSAVDYESVWDEYKSYKRMVPCCGGILLNKEGDKVL
                     LVRGWKSNAGWSFPRGKINLAESEEACAVREVEEETGFDLTGMVNPDDKIKTYINAQE
                     VTMFIVPGIDEATEFETQTRHEIGAIEWVALQDLPTWSGNKRGPRKTAKAKRFYNVTP
                     FVNPLKSWMKEHGMDPYPKARQSKPTGKNSSVFHRDIQPFQFDTFTGSPSNSPVPHAP
                     SPSHFPSRGSSALDQLFTKFIHKQEEEIMAPSRAAVLGSDNNAGLERLFGGLNVLQEE
                     EDALRLRQRQQTEEEMRKKEDDALARLLGGVGGATPQKEAPQPQPQPQPQGKTLKQTN
                     LLAMLNQKPSEARPAAKTQPSTQTQTQAQPQPHHDRLLSVISPQAPPSSLRRNVAALS
                     GTGNMAGIRDSDAGVVITTSQSSTPSANRLESESGETERQARARALLDMTIAGIGGSP
                     ATEIGSAPTAATMATARTDGEQGKQLVSPPLGSMQTQSTIPPQSLPPNLARHPYAPYP
                     SQSSYPSHEPLLSHPAPPAPPAHPSLPPHPGHGHANMNMNMNTNATQARPPIIAPPPM
                     SMPMPMPMSQSYRPAAHVPHPHLTSPQNMQGMYINLGAPHAQGLAQVPGQGQGQQGQG
                     YYQTFPGGSPPHTQIGSQPISVNMPGPGPGPAVGYYNSPPVPQGQGMLPHQVNVNVNG
                     QQQHQHQHPLPMPPIHNQGLPPQLGQVGQYNRVGQIGQSGQNGQRTLPTKSSFAGVQT
                     QGQAANVYHPIPRPPMGAAGLLAMLNGDRQSK"
     gene            complement(77041..83019)
                     /locus_tag="CNK00250"
                     /db_xref="GeneID:3254498"
     mRNA            complement(join(77041..77475,77545..77819,77887..78523,
                     78584..78807,78866..78991,79042..80598,80649..82839,
                     82888..83019))
                     /locus_tag="CNK00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658020.1"
                     /db_xref="GeneID:3254498"
     CDS             complement(join(77301..77475,77545..77819,77887..78523,
                     78584..78807,78866..78991,79042..80598,80649..82826))
                     /locus_tag="CNK00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513697.1"
                     /db_xref="GeneID:3254498"
                     /translation="MSTTPSSPHSPPSARIRIHQSPVSASISTRNSIIHSSAKGWSPL
                     QINKGDYRSGLSLSPSPEPSTQSGPRRTSNSFKVVTSNSLVSNSPFKSPQAGGNGEND
                     QVIHERRTTRRLGEVAPSARGVGSTPKTAIGLGISAKRSGSRSPSGGAAVNGQRKVSG
                     ERPRVAFPVSNGERRSSGERDVSGSKENESPDVRYGKRLPRASMGLKGLVEGSYVSKS
                     PFKKSPSGLSAASDNQADETASAAPGAVPVEIDDVFSSPSPRRVSGGKQRRASPGTLG
                     SMAHRSPSSSSPRSVASNVFLAPPSNGPSPLREQLSASYPVDFEPMPTPTAHKSALTP
                     SRRLRGPRRASQGYDSPSKKTVTFQPTPDVKEYEILSAEPSADGSFDVEMEDEADWED
                     ERQNSLDDLLIEGENMSPNEEIEQESHDDHGAQHNESTTADFMDTLVQEGLFSPPEMD
                     TPAFQDQAAFEIPLETSFTEAENESDKPYLATPSLGDSVHASPLFENHDVFSETDSAG
                     IPFGRTHHAERAAEAHKTALHIPIEQPSLPHAQEHRMLFNANAAQPSILPPITPTSPS
                     FYHDYNDPFASVTPSLPSRAPEPKRQQGPEPHAHQSGPLPDPFITLQTATKTILPSSE
                     ESKNREEDGVPLGRTSHKDRVLAARILATRELGLGMPGRPNRSLPTSSAPTSPLPESE
                     PVFEWREEEVVEEKPIRKLPKVPPPAPMPVEVPSPVMSPQKETEEGKLAVGGFSLPDI
                     DKTSPFFNSASTFEQAVQPVEERATSSSVSSSDSKSESLADDVDRPLTPPTLPSALEA
                     TKPESPHRLPELNFNFETINFDSADDKGEKVVKSESIPLRLSSVEQKKVTTPIEVERA
                     TKEDIPKIASNSASDFSPSPLKSHSQEKKTTHDSTTNRIRQRISREMIRETIQQRIAD
                     GSLSRRPASMDMDSLSKSFSRTSLNDFEMKRNRRVSMDKDLPSPPAESPAMVSSAPST
                     PSKPRPKSEILGRVTCRQSQSHSAERPGMRPRSQTQSAHEVFKQSEREGGEAKSALDK
                     IVALVRRDAGENKEGEEKMERDVSGTIAAAMSRVPTPGKDIDKPAGILKNPNGLLDVN
                     SKAEESEIGPGSPVSKRRVSNNVRPISETSISPRSSLSGTQSSKDGPTAREQAIIAKR
                     RQDRDRQVSIASAVSAISASSRKSRRSLSTGDVNAEISQAKSHRHTMMGPPNAGNNGT
                     PSGVAARRGTRGNPRLTLGIDDEERSILDAFREEVDNIGSERGYKVRERPVVRASYNG
                     KVPHSNAGNLEVGKAWKALRRPSDLHEHAAAIKAMREREADLGKATGTIFVKVLGIEG
                     VQFPIPQEQTHFCITLDNGIDYIKTPYSVLKEGARVNQEFSLVEHPNFEFSLSIDIRR
                     DPHILKLIHEKNNPPQPTVTASPAKHHGGHLRALFGSPRKPKGPVPKGAVPKKDVRPA
                     IPVSTPTVAKKETIANYLLDSTNGTIAKTHIQFKTIAKNCEARVLEIRYPMFAMFKGD
                     ASNVGSLGASGSGSSKEGESARKALAKITLQVFRLPPIPGLNADELPQCIDDCLRGLR
                     HHAWHEHDYYDGVLTQDGGDLNNPKRRLFKIIGGNLVAINEVTKKKVAMIDLRQAISI
                     IDLNEDQPGTPKSKMTMRPRDSDEGFGQRPRSFMIEFKDGEGITFMADTDTAKAGWME
                     VLQGLVGKIPSNPLWAELLTLRMREKAAKRSASSGSLAKEGRKVSVKRPSAAGKR"
     STS             78859..79657
                     /standard_name="Xho23"
                     /db_xref="UniSTS:470682"
     gene            complement(83214..85046)
                     /locus_tag="CNK00260"
                     /db_xref="GeneID:3254472"
     mRNA            complement(join(83214..83766,83826..84009,84074..84244,
                     84316..85046))
                     /locus_tag="CNK00260"
                     /product="expressed protein"
                     /transcript_id="XM_567596.2"
                     /db_xref="GeneID:3254472"
     CDS             complement(join(83341..83766,83826..84009,84074..84244,
                     84316..84596))
                     /locus_tag="CNK00260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567596.1"
                     /db_xref="GeneID:3254472"
                     /translation="MPERHTSKPARVSGISVSSWLANVYIPPTPPPKPSLKTFKSPLL
                     PDGVIPIRDSSKLGQSMEDEPVTTLWDGYSTRYVDGIMDFTLPEKDFDRVPPDVRAYY
                     ALVYRWSQGDYDHLGYFDLHPCIFRPITEQEVRKGAAYLERERLANRRGLFIDPEMYR
                     DKTVPDSTTVHVWQHLGNDWREEFHRAESSFGKVYTLVPSGTPPYVIPHIIKTNVRAP
                     FFSWSTGFPAELLQLYVAWAYHDSYNPFLYLLLESAGDKSSFSEMNFMELFDEFPEDV
                     FEELLYPLYRIDLMPNHIRTMWFDPDEQWDSDVEKDSTVEKIIDEYYKDRERKEKEAE
                     VLKDQDENKPETKDKEDIL"
     gene            complement(86364..88725)
                     /locus_tag="CNK00270"
                     /db_xref="GeneID:3254414"
     mRNA            complement(join(86364..87213,87303..87491,87561..88111,
                     88164..88284,88370..88725))
                     /locus_tag="CNK00270"
                     /product="UDP-N-acetylglucosamine-dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase, putative"
                     /transcript_id="XM_567597.2"
                     /db_xref="GeneID:3254414"
     CDS             complement(join(86886..87213,87303..87491,87561..88111,
                     88164..88284,88370..88689))
                     /locus_tag="CNK00270"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine-dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase, putative"
                     /protein_id="XP_567597.2"
                     /db_xref="GeneID:3254414"
                     /translation="MSTMSYGHPTPVLLTSTLIPISLLLILNPLLPLILPALPPPIES
                     IISNVPLPKQPTLPALQANIGFALLAFVGAVWIVPRVSGAFVEKGLRGRDLLKPGGRT
                     SGPWIPESLGLPCASWYIALMMLFIPFPFSHLFQGGMLEVFPQRELTLYLSSLLSLLT
                     ATLLGFIDDLFDIRWRHKLPIPIVAAVPTLLVYYSVGGATSVVLPQGVVGWARTMGMG
                     EWVDNGVVDLGPLYYIYLILLPTFTTNSINILAGINGVEVIQALLIALSVILNDLLFL
                     PIWPERFLRLLGVDQPENGRVLEWAIGEVVDRHLMSLYFMAPLAGVCAGFLWHNWYPA
                     RAFPGDTFCYFTGMAFSAVAIQGHFSKTLILFFIPQIFNFVLSCPQLFGLVDCPRHRL
                     PAFDAETGLLHPSRVTFENPPPTKTRITLQILEFLRLVRLERSKSSRGDQQIHIKSST
                     NLTILNFLLVHFGPMREQTLCALVAGVQILGSAVAFGIRYGVGSWFYGGDRR"
     gene            complement(88823..90927)
                     /locus_tag="CNK00280"
                     /db_xref="GeneID:3254538"
     mRNA            complement(join(88823..88995,89050..89169,89223..90350,
                     90411..90637,90754..90769,90830..90927))
                     /locus_tag="CNK00280"
                     /product="phosphoglycerate mutase, putative"
                     /transcript_id="XM_567598.2"
                     /db_xref="GeneID:3254538"
     CDS             complement(join(88961..88995,89050..89169,89223..90350,
                     90411..90637,90754..90769,90830..90902))
                     /locus_tag="CNK00280"
                     /codon_start=1
                     /product="phosphoglycerate mutase, putative"
                     /protein_id="XP_567598.1"
                     /db_xref="GeneID:3254538"
                     /translation="MSTRPPTSPDAVDANKKQKTVQVNKKVCLIVHDGWGLSTEEKGN
                     AIFHGDTTHMDAIRDKHNFVELEAHGLAVGLKEGLMGNSEVGHLNIGAGRIVWQDIVK
                     IDQSIKKDEFKDQPAIVDAMKHAKETSGRLHLLGLISDGGVHSHIQHLFALLRVAKSY
                     GIANVYIHFFGDGRDTAPKSATKYIKQLQDYIKEVGVGEISTVIGRYYAMDRDKRWDR
                     IKIAVDGLVKGEGEKTDQEGLIKTVEDGYEKDVTDEFIKPIISGSEDSRIKKGDSLYL
                     FNYRSDRMRELAQVLGLPDKPMEVDVPEDLHITTMSRYNIEFPFPVAFPPQAMTNVLA
                     EWLAKQGVKQCHIAETEKYAHVTFFFNGGVEKQFENEKREMIPSPKVATYDKQPEMSV
                     QGVADKVAETVKSDKYEFVMCNFAPPDMVGHTGDYDAAVKAITATDAAVKTVYDACEE
                     AGYVLCVTADHGNAEQMLDPETGNPHTAHTTNHVPFIVTGDKGSLEVSEEPGALADVA
                     PTILDILGLPKPEEMSGRSLLSKK"
     gene            complement(91047..92572)
                     /locus_tag="CNK00290"
                     /db_xref="GeneID:3254671"
     mRNA            complement(join(91047..91142,91193..91619,91668..91887,
                     91936..92081,92144..92334,92409..92572))
                     /locus_tag="CNK00290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567599.2"
                     /db_xref="GeneID:3254671"
     CDS             complement(join(91111..91142,91193..91619,91668..91887,
                     91936..92081,92144..92334,92409..92538))
                     /locus_tag="CNK00290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567599.1"
                     /db_xref="GeneID:3254671"
                     /translation="MADDSVPLPYPNLKVPTWYYQVQHVDYKKDEAEKSFWEAVEKDE
                     MAPYLKSINSDKTELIQKLEEKNKQQVEEYDRKLKDAEENEGDSEISELLRNKAMYFV
                     RIGDKERALPALEIAIEKTAGLGAKIDLVLAIVRIGLFFSDIHLVTTNITRANNLIDS
                     GGDWDRRNRLKVYRALRHLTIREFKEAAELLIDSLSTFTAAELMEYDEFVALTILAAG
                     VGCDRKGIKDKVLASPEVNGALPNIPSLASLTNSLYKSNYSAFFIALAEVEQQYLLTI
                     PYLVPHARYYVREMRIKAYSQLLESYRSLTMERFCRSFGVSEQYMDKDLSRFIASGRL
                     ACTIDKVNGVITTNKLASQNKTAMYEQVLKQGDVLLSDIQKLHRVVG"
     gene            92741..94916
                     /locus_tag="CNK00300"
                     /db_xref="GeneID:3254493"
     mRNA            join(92741..93171,93236..93420,93479..93790,93862..93970,
                     94028..94087,94150..94226,94297..94916)
                     /locus_tag="CNK00300"
                     /product="cell wall chitin biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_567600.2"
                     /db_xref="GeneID:3254493"
     CDS             join(93015..93171,93236..93420,93479..93790,93862..93970,
                     94028..94087,94150..94226,94297..94482)
                     /locus_tag="CNK00300"
                     /codon_start=1
                     /product="cell wall chitin biosynthesis-related protein,
                     putative"
                     /protein_id="XP_567600.1"
                     /db_xref="GeneID:3254493"
                     /translation="MSDNAAFKFGSFDYICEHAALVVCPMLGDQQGMAPTCYSRNVQL
                     GSQIIFQPATCILHIAALVMATIMLLHVRSKYTAVGRKEIVLFFYMYIWVELFAIFLD
                     SAIIPTANKVYPWFAAIYAGSVGALYWCLLLNGFVGFQFHEDGTPMSLWFLRISSLVV
                     GAVCFGIPVATFKGTSSSMSPTNTVGLFITYLVFPCVCVLIYFISQMLLVVRTLDDRW
                     VIGDLLFMAGFYIAGVLLLVTFSVTICDAVKHYVDGVFFSTLAFLFAVMMVYKYWDSI
                     TKEDLEFSVGSKQAVWDVKDPLLATGMEYYEDDAQSAYRGAGGSLVGGYNGNQYYGNQ
                     PGYAQSAYGQQGYGQYGAGGGYGQGHY"
     gene            complement(95190..95282)
                     /locus_tag="CNK00310"
                     /db_xref="GeneID:3254516"
     tRNA            complement(95190..95282)
                     /locus_tag="CNK00310"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:3254516"
     STS             97321..97981
                     /standard_name="Sca3"
                     /db_xref="UniSTS:470683"
     gene            99917..102328
                     /locus_tag="CNK00320"
                     /db_xref="GeneID:3254474"
     mRNA            join(99917..101793,101850..101916,101977..102328)
                     /locus_tag="CNK00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658021.1"
                     /db_xref="GeneID:3254474"
     CDS             99983..101791
                     /locus_tag="CNK00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513698.1"
                     /db_xref="GeneID:3254474"
                     /translation="MCRDQFDPITMFSPSGSPRSSVSSATTNVCGAPLTPLYELDGAA
                     GEMVVTESATVDDSEGEQDALLREHIAAGQASKRVVNLSLAVPPPPAFSTFAFPPQGG
                     AAAAASLGVVSPGDEGIALPREGFTFGTCPSAPFLGTPVVEQGPFEYPDMTGDRSTSR
                     SSSIKGSSPQSRSNSRSPIFRARPLSISSQHSLHSQSDIPSPPATRRSSTVSDITTLP
                     VAGRRPSIVHSATAETPVVTDATSASSSNNHHPSTRSVTPLPTPGPLAHHGSIRRPST
                     LSFQQKALPQPIPPSLLARRGSLPAAHLFRLPLSELSAHRSRASASGIPTVPQSPAVS
                     TASLYQRRQSIATETEAGGVGHARGGTLGEKMRTTSISAGSDSTGYTSAGRRGSVPSS
                     SSSFAAASSRNTLLNRSGSTCSQTSRRSFTTLRTPTTPPVPCASATPSPRIQPASLLP
                     PLSVPSSPRSTRSSLAEGAHAQTRSGHSGSSDDDDEMLPTPAMDSLSISSGGVGAGLN
                     RDVVCRGSSEDEVYLGVAAAASGGQMVVVESPTAMMRDEKTVCKPSPPPWPVQVIAPT
                     PPIETETEMETPGLETVFERPPLESAESVDSGKTLT"
     gene            102711..105521
                     /locus_tag="CNK00330"
                     /db_xref="GeneID:3254441"
     mRNA            join(102711..102890,102933..104950,105007..105521)
                     /locus_tag="CNK00330"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567602.1"
                     /db_xref="GeneID:3254441"
     CDS             join(102729..102890,102933..104909)
                     /locus_tag="CNK00330"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567602.1"
                     /db_xref="GeneID:3254441"
                     /translation="MNTHSPPLLGLQALAVSPPAYPPAYRYNPVFGAPPAASPDWSPA
                     NKRSSRGLPNNWYDPHEYRPDVPSPPPTLSPPSSAPNPRQPYPYQPYPDGAFATPMDI
                     VRTPSPPIGYAPIGFAGAYAVSRQHPQASHPADGWRNGYAMPAIPTQDDDVIPTAIVI
                     KNIPFAVTRETLLGVMESLGAPLPYAFNYHHDNGVFRGLAFANFRAPDEAASVVAALN
                     GYDVQGRKLRVEYKKVLQPGEKDKIEREKALKRMRSLQFDRKEMPPPLTLPTRHQQPP
                     TLAGYDQSPPHSASAASTNSNSQADSLPSTLDMNDPMTLDIYSRVLVFKEDRMRDELA
                     FSKNLSPTERRIVHLVAQRLGLTSVTRGEEEQCVVVTREPQRPALLSTTSLTSPTYLL
                     PYGSQQNSASSSGGGGGGSGDPSPNLRYKKSMPDLRGFNGPAVARDPARSLNPQRSSG
                     NIREMGREYASMGAVGGRRLNGHASAATLNVNGQNHPYGNGSGREQGYGAFNGLFGNS
                     VNDIPPVPPLPSGLGMHNKMYSVSSVHNVNGIGHGHTHSHSYSQTHSHAQNGRVSPED
                     LLSPTSTTSFSGQQQIPSPQPQPSQSQQSQSSQPPSSQTASQSQSQSQPLRNPRGPAG
                     ESRGFGGTQSSLNGISGLGGLKSVASRNMLGGGGSGAGSGSAPGPPGSVIGGAPVSSS
                     PASTGSASVGTGGYERDTEETMRTRENLDI"
     gene            105710..107541
                     /locus_tag="CNK00340"
                     /db_xref="GeneID:3254613"
     mRNA            join(105710..105879,105931..105950,106074..106169,
                     106271..106316,106385..107541)
                     /locus_tag="CNK00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_567603.2"
                     /db_xref="GeneID:3254613"
     CDS             join(105766..105879,105931..105950,106074..106169,
                     106271..106316,106385..106459)
                     /locus_tag="CNK00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567603.1"
                     /db_xref="GeneID:3254613"
                     /translation="MSKAALMASEVDILKTKAANKKGAGSEEVETVWPKPEFITLYLA
                     NTALDNVTLAGKTITEYIVPAGSMFTLGAALPNHTVLKWGAYFPPGTMFPDGVLVPIH
                     ARMVSVQPLETPKN"
     STS             107224..107855
                     /standard_name="Kpn1"
                     /db_xref="UniSTS:470685"
     gene            complement(107513..108914)
                     /locus_tag="CNK00350"
                     /db_xref="GeneID:3254433"
     mRNA            complement(join(107513..107565,107628..107945,
                     108007..108237,108292..108914))
                     /locus_tag="CNK00350"
                     /product="expressed protein"
                     /transcript_id="XM_024658022.1"
                     /db_xref="GeneID:3254433"
     CDS             complement(join(107653..107945,108007..108237,
                     108292..108886))
                     /locus_tag="CNK00350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513699.1"
                     /db_xref="GeneID:3254433"
                     /translation="MPKINVTFDDFDPLLVYSDYTQWSTPNPQDNPTWYNASENETGV
                     PWHEATMHYTTTQGASFAFNFTASSAWIYGASGPSSSATNYTMTLDGTSSSHTAENTT
                     SSDNTLGQGRTLLWSVQGLEEGEVHEVELRNEGSGVGVDLVVLEVDVGENTSNSTLDN
                     TSPEISYTGTWDSNNGSFYGGSSSYTQGAGNEFSFNFTGSALYIYGDQVNDHGPYSIF
                     FNASTIPYATYSGRSGCGVGGVEKSCEKLGTLKVFVGGLGEGEHQVRLINEGEGTYFD
                     FDYLEYTTPSTYPSFTLDPTCANGICASSSSGNITTTAASGASGAATSATTSAPSSSE
                     SSGANANLYNRERGYAGLGTGLLVGVMGVWGMRKMGWA"
     gene            complement(108976..110718)
                     /locus_tag="CNK00360"
                     /db_xref="GeneID:3254492"
     mRNA            complement(join(108976..109179,109234..109614,
                     109672..110061,110114..110196,110247..110317,
                     110372..110426,110476..110521,110581..110616,
                     110668..110718))
                     /locus_tag="CNK00360"
                     /product="autophagy-related protein, putative"
                     /transcript_id="XM_567605.2"
                     /db_xref="GeneID:3254492"
     CDS             complement(join(109111..109179,109234..109614,
                     109672..110061,110114..110196,110247..110317,
                     110372..110426,110476..110521,110581..110616,
                     110668..110694))
                     /locus_tag="CNK00360"
                     /codon_start=1
                     /product="autophagy-related protein, putative"
                     /protein_id="XP_567605.1"
                     /db_xref="GeneID:3254492"
                     /translation="MNNPLLAIQSQYWAVRDYLSPVLRESKFKEHGRITPEEFVAAGD
                     FLTFKFPVWQWEKGESSRARDFLPPDKQYLVTRNVPCLRRATAVDYTNADEDAEKLLS
                     FLDDAEEAPGPDDDWVATHINRSPPHRPTDMDEIPDIPDSPTTAPTREMAGLNVSSGG
                     KLEEDEIPDIDDIPDMDEEGLEDLEDDAAVRIVHPSEAEVNSTAGKNLLQVRTYDCII
                     SYDKHYQTPRFWLFGYDEHKNPLTPAQVFQDVPADHAFKTMTMESFPHSGAQLASVHP
                     CKHASVMKKFIDRMEAAQGPAPTAEPETISSTSGTSGSAGGKEEKEKKKKWGLGSMVR
                     KVTGGSVPKVEKDKDEVVTGVPVDFYLVIFLKFIASIVPTIEVDSTTSTAL"
     gene            110970..112276
                     /locus_tag="CNK00370"
                     /db_xref="GeneID:3254514"
     mRNA            join(110970..111066,111123..111709,111764..111776,
                     111826..112276)
                     /locus_tag="CNK00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_567606.2"
                     /db_xref="GeneID:3254514"
     CDS             join(111002..111066,111123..111709,111764..111776,
                     111826..111913)
                     /locus_tag="CNK00370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567606.1"
                     /db_xref="GeneID:3254514"
                     /translation="MTVEELPPSKLGTKGHWDSVYEREVNVFNDIGDEGEIWFGEDSV
                     RKMREWAHTHLPSSISPDHPLRILECGSGNGTLLLSFLISPSPPAQYYHLTGIDYCES
                     AKILAEGVEAAKRESLEDEMEPEDVENECATDWRVADLLRHDFEGENWDLVMDKGTYD
                     ALCLSNESVEGDEKKRLPSGVYPERIAKLVKPGGFFLITSCNFTEEEIKERYSKEELG
                     LAFHSSVPHPTFSFGGKKGSTVCTVAFQKASV"
     gene            113315..116661
                     /locus_tag="CNK00380"
                     /db_xref="GeneID:3254591"
     mRNA            join(113315..113871,113944..114263,114327..114355,
                     114500..114540,114596..114627,114693..114782,
                     114838..114864,114927..114970,115035..115096,
                     115150..115197,115256..115628,115689..116018,
                     116076..116185,116258..116392,116452..116661)
                     /locus_tag="CNK00380"
                     /product="membrane transporter, putative"
                     /transcript_id="XM_567607.1"
                     /db_xref="GeneID:3254591"
     CDS             join(114049..114263,114327..114355,114500..114540,
                     114596..114627,114693..114782,114838..114864,
                     114927..114970,115035..115096,115150..115197,
                     115256..115628,115689..116018,116076..116185,
                     116258..116392,116452..116484)
                     /locus_tag="CNK00380"
                     /codon_start=1
                     /product="membrane transporter, putative"
                     /protein_id="XP_567607.1"
                     /db_xref="GeneID:3254591"
                     /translation="MSDSKHLDDEKNVGVTAADVSVLPATADDVHCVQLQDVDEAAAF
                     VAGWEGEITEEMNARIRRKCDWHLLPLMMTLYFVQFTDKTTLGSSAILGIKTDTHLSQ
                     AEYNWLGTIFYLSYLIFEWPQSLALQKFPPGKWMACNILVWAVCLCCHAACKNFAGLF
                     VCRFLLGVCEGSITAGFLILTSMFYTQEEATQRVGYWFLMNGTAQIFNGVVSFGVYHV
                     NPDIIAPWKVYMLITGLLTLVVGLCFWFFIPNNPMTAYFLTKEERIIAIERLRGKSTG
                     IENKTWKKEQFIEALTDWKCWTFAIYAGSNNVANSLTNMTSLIINSFGFTVWQTTLLG
                     TVSGAIEILTIWSSVLVIKKFPNARGYVGASYSIPNVVSGILLVALPWTAKGALLFAV
                     YLGGVGTPGFVLSLSWCSTSNTGHTKKATANAMLLIGYCLGNLLSPQMWEAKYAPRYY
                     VPWGIILGTYVVNPIILLGIRFFLNRENKRRDRLVEKGELVHEKFVDEYGEEIDPTFL
                     DMTDRKNLSFRYPL"
     gene            117243..119177
                     /locus_tag="CNK00390"
                     /db_xref="GeneID:3254408"
     mRNA            join(117243..117628,117693..119177)
                     /locus_tag="CNK00390"
                     /product="sodium-hydrogen antiporter"
                     /transcript_id="XM_567608.2"
                     /db_xref="GeneID:3254408"
     CDS             join(117388..117628,117693..119053)
                     /locus_tag="CNK00390"
                     /codon_start=1
                     /product="sodium-hydrogen antiporter"
                     /protein_id="XP_567608.1"
                     /db_xref="GeneID:3254408"
                     /translation="MPSDFSYEEPSTAHLLIFSTYLWLLNMARWFVQRITGAGLLGEI
                     AIGMIFGSPLAQWLDVDWQSTMVTIGYIGLLAIVLEGGITTSLPLLIPLIPISMAIAF
                     TGVAGTLALSFLCIPAFGYSPLSAFASGAAMSSTSLGTTLAVLAGTKGIGFDLRQTKV
                     GVALVGAAVADDVIAFVFSEIMKILGRSNGGVGPQIGRIVGVTIGLGAIAIPLTIWVL
                     KPLLTSQRSKKLLFQSGRLGSMGVILLVAVGMVAAAGYAGTSPLYGIYVGGLMLSYVS
                     EPDEDTVETTSNSDIPLTRINTNPTPDTGSGDQAPKPIPMAYTLSRQSLDLSRAHTHP
                     GTIGYHFAYLPSPARARRPAPAGSDDRPNPLDFASTYNAFLFPLVEYILLPIFFGSIG
                     YSIPFLRLWRGSIIWKGIVYSIWMVLGKLMCGLWLFWPSKSKGGKISEAQGLPVTEKE
                     GKGDWTWKDRVPAVLFLGFAMVARGEIGLLISQIGRHTPIPLFDEDEFLIAIWAIVVN
                     TIIGPVAVSSILKKWRVGVVRGGWE"
     STS             118554..119333
                     /standard_name="Eco21"
                     /db_xref="UniSTS:470684"
     gene            complement(119072..123537)
                     /locus_tag="CNK00400"
                     /db_xref="GeneID:3254650"
     mRNA            complement(join(119072..119271,119333..119380,
                     119424..119632,119716..120071,120145..120386,
                     120481..121152,121221..121296,121409..122148,
                     122210..123110,123167..123396,123467..123537))
                     /locus_tag="CNK00400"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024658023.1"
                     /db_xref="GeneID:3254650"
     CDS             complement(join(119165..119271,119333..119380,
                     119424..119632,119716..120071,120145..120386,
                     120481..121152,121221..121296,121409..122148,
                     122210..123110,123167..123295))
                     /locus_tag="CNK00400"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513700.1"
                     /db_xref="GeneID:3254650"
                     /translation="MATESRRIALADPHHLAPPRFLVGGQLAHMLSGDVKLYEWDRDN
                     GKMSMLGLQTEIGQIKALAWSPSPAHRHLVATGLSTGKTLLLNLSPSTLSLPVANPPP
                     SPPVIAALTVKHTRAVSSISFSPHDANYLATGLERHRSDSSLLIWDIHDAVAASRLPP
                     DGDVHYTRPELRLPITTPLAKTSSASEPRPIQAYCPSEQVNSVAFIPTAPYSLLSSAG
                     NKVIRLYDLRAPSNTLKEPNSAGSLAQWSTRTVMSLCPNPSSTLFASYESIQGGNSTV
                     RLWDTRYPGQEIVGWEVRGGVVGMSWVDSMRLGVGSKEGGVGVWDIVRCKPDQSGASE
                     WVTLGGMRQIIKPKPNMHSFAFTPPTPPKHIDVMYVLKDSTISIGPVSTAPVLASNSH
                     GGLSISEPTLYFIDPDIPLRSSSSSTSPTAHGFVQGSGLGLEIGQGDRAAEGEAGAGV
                     EAIYPRNKFQLPPDQVSTILNEHSRLRSSSFGAVSTIHPASSPLHSHTNPHGHGRPHV
                     PPSAPTRHLPSGSGPNVAIHHIPDMLTQSFLSRDRWHEEDPTGVINDRDEITGGYEGW
                     RRVLGGDVGVVMRRRAMEGYGLDNLLLNAAIATKYRGKFKLAGVWEFVEHLTKTMSPS
                     VSSSGGYNLTHQGIYPIWTSLGTLDAASASGGPISAALNADEDGPGGEGGGLVSELEE
                     RLRRMNIKGSGGSTGRGSRSASVSRKGSGTHTPRERKISERTSHTHTNTHSHSHAHTS
                     STYPQGPPSYLPAISHLLSSRLSFPDKAIHPSELRPSISSSSEKVELRRLILTICGES
                     KEGGKGEVEEMLRRGERSKAAFRAFFRGDESGTVGILMSSEDPNDTLLGSTIAGFMSQ
                     SASTRGSEYFNAHWPNLIRRVDDPYVRAILSRIAGEDWESVLEEEYIPLLERMVVGVQ
                     YLDDWEFSTFLKGRMSRFARSSSLHMLPLTGLSPPALSLLSRYLARTGDLQTVTLLAA
                     FFPPGKLNQAEKMMVERWREGYRDMLDSWGMWGERCEFDVKWGNLQRSLGGEDAGEEG
                     YGKTGTCPVCNNPLPIDTEHRLHQKHAMRGTPSVGWPSERTTVCVYCQAPLPRCVICL
                     LHVDPHRPPVDDGERPGHVTDTIDSAYVFCLTCRHGGHANHILPWFEGGLDGGIAHSV
                     CAVADCDCECANI"
     gene            123415..124047
                     /locus_tag="CNK00410"
                     /db_xref="GeneID:3254662"
     mRNA            join(123415..123526,123581..123672,123772..124047)
                     /locus_tag="CNK00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658024.1"
                     /db_xref="GeneID:3254662"
     CDS             join(123468..123526,123581..123672,123772..123902)
                     /locus_tag="CNK00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513701.1"
                     /db_xref="GeneID:3254662"
                     /translation="MSNRVSTGKMAMAPQESVQPAVLYKLVLFALLMAVVPIGTYFST
                     LNYLWDGSTTFAAISAIAAANLILVGYVVVAFREDAASRTGPLPEKKTS"
     gene            124153..128632
                     /locus_tag="CNK00420"
                     /db_xref="GeneID:3254630"
     mRNA            join(124153..124560,124642..124765,124835..125212,
                     125284..125530,125604..127675,127728..128632)
                     /locus_tag="CNK00420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658025.1"
                     /db_xref="GeneID:3254630"
     CDS             join(124303..124560,124642..124765,124835..125212,
                     125284..125530,125604..127675,127728..128449)
                     /locus_tag="CNK00420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513702.1"
                     /db_xref="GeneID:3254630"
                     /translation="MPTSKSSIDHRDVYYRKGKSAGYRARSAYKLLHLDEEFDLFTNV
                     HTAVDLCAAPGSWSQVLGQKLKPKSKQGGEGTRVVSCDLQPMAPLPNITTLQTDITLP
                     STIPLVLDALGGRKADLVVCDGAPDVTGVHDLDAYLHSQLLLAALTLSLTLMAPGATL
                     IFKIFLSPLDPRAEFLASQLRCFFSSPLPEDKEKEDEFGQYAEFEEEGEYAEEAGQDK
                     GDEKKRNVGTKGYDPQGRRGGVWVRKPRSSRQGSAEAFIVCRNFSPSSLPLPPTFSPS
                     ALDKLRTTTGTLTLDSLSSLVPQDESKGEEIQGFKGSKEQVKQQWHRWEMIKGYVGGG
                     DLSSSSFIPSLYPLLPPSLPAQSPKMTLSSPPKLHLPMPTTPPNLVHHILKTPEIISP
                     HSSTASPKALQPQPTPVDEPPEYFSPKRAHIQALFLSPTKMKEHRQGQGQGQGQGQDG
                     GGTSRQSSLDSLTPNPSPVGDVDSTRPWTSSSPPSSSMSASPPTPVPPTITAPPQEKT
                     SLSIPLLLHSASTSSAVSDGGYGIHGVHGVHSVHSVHSVHSSRPQTPATLGVITPALA
                     SPALSSSSKTDLFFSASSAELPTPPRALSPASALDKEPFSSSSAASSGLDVSGNERAQ
                     STTMPSSSFPSTATSGAASWSGSGISTVKLRLPTRKERFRETVIPAEMKDEMDIDRSR
                     EGWGAPFGMGLGAGFEEISTSRLRSLSNPIAPPPAHTVPPAPPAPLPAPLPSSFTTQN
                     SSNDGDSRPEFARQSSLTPTVVSPQTPRAGFFPLNNARTKANAVPSVPFHPSPSAGGY
                     TPPPPPWKLRRKESQQLEREHRQAGVDESVKAGDVIEPCFPNTNADNNGEHEKEKRKE
                     RVIGGWRLVKKMGEGAFSAVWSAVPAGSTPLSSTPTHAPTATSLLVALKLLTHPLPDH
                     RTRIAFLREASVLRHISHPSIVGYIDDFSTERHDVLVLEAAGGGELFELMSEEENRRR
                     MILPAPAPVAGSEESEMGWDKDGEGFVRRVFSELVKAVGWLHEVGIVHRDIKLENILF
                     TTNPFILPPTSTSSIPLHLLPPPGQPLIKLTDFGLSRFISPASPLLYTRCGSESFAAP
                     EIIMGKPYDGRETDAWALGVVLYGLIIGELPFDREESIKLPDGIATPGGGNSERVRGR
                     KKMHRIAKGEYTWPSPEPALSQDIPGAYVPGTATPSARAVISSLLERSPSKRAKPSDL
                     WEYEWMLGPGGVPRPVEGAGTPQQEGVGKDKGREASGRGRRRVLDGFLVEEERIEDVA
                     MTEH"
     STS             125231..125620
                     /locus_tag="CNK00420"
                     /standard_name="ha3106"
                     /db_xref="UniSTS:515650"
     gene            complement(127294..131504)
                     /locus_tag="CNK00430"
                     /db_xref="GeneID:3254515"
     mRNA            complement(join(127294..127621,127695..129482,
                     129547..129616,129656..129777,129832..129897,
                     129949..130246,130294..130445,130513..130581,
                     130629..130850,130903..131504))
                     /locus_tag="CNK00430"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024658026.1"
                     /db_xref="GeneID:3254515"
     CDS             complement(join(129144..129482,129547..129616,
                     129656..129777,129832..129897,129949..130246,
                     130294..130445,130513..130581,130629..130850,
                     130903..131283))
                     /locus_tag="CNK00430"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513703.1"
                     /db_xref="GeneID:3254515"
                     /translation="MCGLTLSIRSLSTGYPRASLLDAFQSTITCRGPDTQGSYTHIVK
                     GKSGAEIEITLSASVLGLRGELTAQPLVGKRGVLGWNGQVFEGLQVEKDANDTRKIFE
                     KLEEGAEFQSVLKDIEGPFACIYLDLISSTLYYQLDPLSRRSLLLYPQISGNGTVSNM
                     FILSSCCCGLVREAGLEMRALLGGEGGIIRFDQVQVLEDGTVDLCNALIMTNNFDLPE
                     SSSTPWTRVAPINTVLPPSGLTEDSPAIHNAAVISFVDHLQASVRRRVENIPDLAPGE
                     AKVAVLFSGGIDCTFLAYLLHQCLPLSDPIDLINVSFAPSPRPQLANGKGKGKHKTPG
                     VEGDVYAVPDRLSGLEAVEELRNVCKEREWRFVEVNVPYEEAREHRARVVELMYPSVT
                     EMDLSLAYPLYFASLGKGSVVGEDGNKRPYQVKAKVYISGLGADEQLGGYSRHRHAFN
                     QAGWQGLIEETQMDLNRLPTRNLSRDDRLISSHARDARYPYLSLSFIAYLSSLPIWLK
                     CDPRLPPGQGDKRLLRLAVERVGMSKTGARVKRAMQFGTRSAKVGGTGSGVKGPKAGE
                     RPVEWI"
     STS             131635..131811
                     /standard_name="ACG15"
                     /db_xref="UniSTS:470686"
     gene            131754..133564
                     /locus_tag="CNK00440"
                     /db_xref="GeneID:3254401"
     mRNA            join(131754..132242,132293..132758,132813..133135,
                     133191..133288,133344..133564)
                     /locus_tag="CNK00440"
                     /product="expressed protein"
                     /transcript_id="XM_567613.2"
                     /db_xref="GeneID:3254401"
     CDS             join(131831..132242,132293..132758,132813..133135,
                     133191..133288,133344..133448)
                     /locus_tag="CNK00440"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567613.1"
                     /db_xref="GeneID:3254401"
                     /translation="MSNSSSVRNPLQRAHALSAQASSLLDSDQPSAQAMSQALQAYRE
                     AASLFEASAGDLDVDESTKVTLKLLTTQHRKLARDLERRISIAAKGKMATPVNTRLAG
                     MPPNRRYFSEGSPARGYLPDNKQVAGGMTPLRVDSTAQHLSHTQEVPPFAYRPPPNPS
                     GSQPNSASIFSPSDAPSPLQSSSSSSEAPEESYVHFGAPPDITDPFNRFWAMLDNMLE
                     DISNPIAFASAPLDTLGPTIPQPKKSQEKRNSKSGKEEKRKEESPSPTDSFYLVHPKG
                     KMTPEGSEDGDKPRGNPAPLAKTPEELALENTSLRHSLDTLASHTQSLEQTNRLLKIQ
                     LEERDKKFLAAMAGVKKEAARAKQGQELWRSQVMAGSIIPVRAPRVDGSPINSVPGLK
                     DGPGSDSTVLRKRIKELEEEVKALKLESEKQKNHIEKYKGKFEKLKANARAKKEAKLA
                     AAAAEATAQGQNSSTPT"
     gene            complement(136227..136864)
                     /locus_tag="CNK00445"
                     /db_xref="GeneID:36393095"
     mRNA            complement(join(136227..136423,136503..136523,
                     136583..136642,136708..136864))
                     /locus_tag="CNK00445"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658800.1"
                     /db_xref="GeneID:36393095"
     CDS             complement(join(136373..136423,136503..136523,
                     136583..136642,136708..136770))
                     /locus_tag="CNK00445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514635.1"
                     /db_xref="GeneID:36393095"
                     /translation="MAISIADIAQRTIVLTSIGLTIYGGVLTAHGIGYRALRARGYFG
                     GPPEPSKPLEAQSPVPTQPS"
     gene            136927..137671
                     /locus_tag="CNK00450"
                     /db_xref="GeneID:3254659"
     mRNA            join(136927..137272,137334..137671)
                     /locus_tag="CNK00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_567614.2"
                     /db_xref="GeneID:3254659"
     CDS             join(137003..137272,137334..137474)
                     /locus_tag="CNK00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567614.1"
                     /db_xref="GeneID:3254659"
                     /translation="MSSPIANRVSQLKSIARSFPRSPLSEPTQISEAWISILDRTLAS
                     DAASASFQANSSQATLGALREAGQQQRLMQFKAAVERLKAGNAMRDYPLSKSLLTPPN
                     DELFYTRARNAIHNAEQGIRRPWWKVFFNVKGAE"
     gene            complement(137652..138797)
                     /locus_tag="CNK00460"
                     /db_xref="GeneID:3254431"
     mRNA            complement(join(137652..137797,137851..138222,
                     138286..138415,138470..138513,138562..138613,
                     138677..138797))
                     /locus_tag="CNK00460"
                     /product="35S primary transcript processing-related
                     protein, putative"
                     /transcript_id="XM_567615.2"
                     /db_xref="GeneID:3254431"
     CDS             complement(join(137693..137797,137851..138222,
                     138286..138415,138470..138513,138562..138613,
                     138677..138705))
                     /locus_tag="CNK00460"
                     /codon_start=1
                     /product="35S primary transcript processing-related
                     protein, putative"
                     /protein_id="XP_567615.1"
                     /db_xref="GeneID:3254431"
                     /translation="MLRQPGTQIKLTNVSIVRMKKGGKRFEIACYQNKVSEFRSGVEN
                     DLSEVLQIEQVFTNVPKGLVAKKEDWSKCFGTDDLNKVIEEILKKGELQINNLERTQH
                     LSSLSREIATIVSEMTVDPNTSRKHTVGMVEKAMAEVGFSVRADRPAKAQALELIKKL
                     AEGDVLPVRRVRMRVRITMPGKDAKRCKDKIVAECDEVEEEDMGMEWEAIVQINPSTF
                     RTLTDLVNNEAKGKGRVESMGSVGN"
     gene            138911..139778
                     /locus_tag="CNK00470"
                     /db_xref="GeneID:3254437"
     mRNA            join(138911..138972,139023..139194,139256..139362,
                     139423..139778)
                     /locus_tag="CNK00470"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567616.2"
                     /db_xref="GeneID:3254437"
     CDS             join(138941..138972,139023..139194,139256..139362,
                     139423..139615)
                     /locus_tag="CNK00470"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_567616.1"
                     /db_xref="GeneID:3254437"
                     /translation="MKVFENDLVYNYPASHTLNLLHRKYPNPFATHVYSVDTMERSID
                     AETGILRSERLIGVQQGAPKWVTKLFHLPPIAYVREVVFIDPSETSATSMSVNLNLAQ
                     YISCLEHITYTPRPDNTTLFRQRAMLVSGFPTKLIARRIEQASYDRFKSNAGIGKQGF
                     DWVLAGN"
     gene            140113..141656
                     /locus_tag="CNK00480"
                     /db_xref="GeneID:36393096"
     mRNA            join(140113..140263,140320..140414,140459..140556,
                     140620..140742,140800..140855,140925..141039,
                     141100..141174,141237..141472,141514..141656)
                     /locus_tag="CNK00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658801.1"
                     /db_xref="GeneID:36393096"
     CDS             join(140204..140263,140320..140414,140459..140556,
                     140620..140742,140800..140855,140925..140948)
                     /locus_tag="CNK00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514636.1"
                     /db_xref="GeneID:36393096"
                     /translation="MDKEATPKPTAHDYRGACVEDLQLPPAFCLPEDAPLLKALEAAY
                     DREFDHLPILNAKRRPIGYLDIPSIKDQFKNNKIDADEPVSSRMIHFSLSSRSHPYTV
                     ISPLTPLEELEEFFKSRKIDFALVTDTERNWVLAVATKDDLVTFAQRRG"
     gene            146937..152747
                     /locus_tag="CNK00490"
                     /pseudo
                     /db_xref="GeneID:3254587"
     gene            complement(152774..154423)
                     /locus_tag="CNK00500"
                     /pseudo
                     /db_xref="GeneID:3254596"
     gene            156019..161577
                     /locus_tag="CNK00510"
                     /pseudo
                     /db_xref="GeneID:3254459"
     gene            complement(161860..166401)
                     /locus_tag="CNK00520"
                     /pseudo
                     /db_xref="GeneID:3254629"
     gene            168732..169346
                     /locus_tag="CNK00530"
                     /pseudo
                     /db_xref="GeneID:3254462"
     gene            complement(178522..180709)
                     /locus_tag="CNK00540"
                     /db_xref="GeneID:3254488"
     mRNA            complement(join(178522..178767,178825..178932,
                     178989..179115,179163..179278,179329..179755,
                     179806..179918,179970..180085,180136..180311,
                     180359..180709))
                     /locus_tag="CNK00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_567617.2"
                     /db_xref="GeneID:3254488"
     CDS             complement(join(178627..178767,178825..178932,
                     178989..179115,179163..179278,179329..179755,
                     179806..179918,179970..180085,180136..180311,
                     180359..180642))
                     /locus_tag="CNK00540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567617.1"
                     /db_xref="GeneID:3254488"
                     /translation="MIIPAEAQVASPPIFTEDEEVVLEEEDVEQPDLRRIATHLHDPA
                     STATLSDDQAGTTAGQTVLSHDLEKGEGRMVVDFAEGHYEDPKEWSKGKKWFVTIATS
                     ILCLTVALGSAMPTGDLPGAAETLHVSNEAIYLTIALFVVGFGVGPLLFAPLSEVIGR
                     KTVYCISIFFYFIFTLPSCLAPNIATMLAGRMIAGIASSAPMTNVGGTIADIWSVEER
                     GIPMALFSGMIFMGPCLGPLFGGWIAYKTGQWRWIYWVLFIFVGVVFLFTLVMPETLA
                     PVLLRRKAKKLNKENHVDSYVSKHDLHHVPLSTTLKTAMIRPFILMFMEPIILFMSFY
                     LSFVYALLYATFFAFPIAFEEIRGWNMGTTGVSFVSIIIGIAAALLCMPFQERIYKKA
                     CRNGQVPEARLYPMLLGCVILPIALFILAFTSYPGIHWIGPCVAGVLFGFSMVIIYIS
                     ANSYIVDSYASFAASAIAAKTLMRSLIGASVPLWITQLFHNLGFQYAGLFLALISCVI
                     IPIPWVFFLKGAAVRKRSKRAEKSGTN"
     gene            complement(182325..184860)
                     /locus_tag="CNK00550"
                     /db_xref="GeneID:3254684"
     mRNA            complement(join(182325..182677,182744..182749,
                     182821..182843,182891..182942,182999..183070,
                     183144..183273,183328..183434,183495..183587,
                     183667..183778,183830..183857,183917..183919,
                     183980..184178,184227..184317,184373..184441,
                     184496..184560,184624..184665,184720..184860))
                     /locus_tag="CNK00550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658027.1"
                     /db_xref="GeneID:3254684"
     CDS             complement(join(182613..182677,182744..182749,
                     182821..182843,182891..182942,182999..183070,
                     183144..183273,183328..183434,183495..183587,
                     183667..183778,183830..183857,183917..183919,
                     183980..184178,184227..184317,184373..184441,
                     184496..184560,184624..184665,184720..184825))
                     /locus_tag="CNK00550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513704.1"
                     /db_xref="GeneID:3254684"
                     /translation="MIHQYHHKALKLAATCTRRQILARGMATANSVVSGPVSFSLSDD
                     QRGIQELATKFTRDVIVPQAAEYDRTMEYPWPILKEAHSLGLLNTHIPEAYGGPELGL
                     LECAIISESLAFGCSGIQTAMEANGLAEAPLIVAASHEQKRKYLGRMTEEPLMAAYCV
                     TEPGAGSDVAGIKTRAEKKGDKWVLNGSKMWITNAGHANWFFVLAITDPEASPSRGMT
                     GFIVDADTDGIILGKKEINMGQRASDTRMVTFEDVIVPEENVLGSPGEGFKIAMKAFD
                     ITRPLVSAAAVGLAQRALEEATKYAQERHTMGQPIINHQGVAFMLADMAIGVEAARGL
                     VWKAAWAKDCRQRNTFYASMAKAFAGKTAVENANLGVQVFGGAGFNTEMPMEKLYRDA
                     KIYELYEGTSQIQKLIVSKHLPSLYPAA"
     gene            185133..189339
                     /locus_tag="CNK00560"
                     /db_xref="GeneID:3254390"
     mRNA            join(185133..185336,185389..185460,185521..185708,
                     185762..185903,185963..186069,186114..186211,
                     186267..186427,186488..186730,186785..187050,
                     187098..187491,187544..187936,187991..188154,
                     188210..188304,188359..188711,188761..188880,
                     188933..189069,189128..189339)
                     /locus_tag="CNK00560"
                     /product="delta DNA polymerase, putative"
                     /transcript_id="XM_567620.2"
                     /db_xref="GeneID:3254390"
     CDS             join(185210..185336,185389..185460,185521..185708,
                     185762..185903,185963..186069,186114..186211,
                     186267..186427,186488..186730,186785..187050,
                     187098..187491,187544..187936,187991..188154,
                     188210..188304,188359..188711,188761..188880,
                     188933..189069,189128..189244)
                     /locus_tag="CNK00560"
                     /codon_start=1
                     /product="delta DNA polymerase, putative"
                     /protein_id="XP_567620.1"
                     /db_xref="GeneID:3254390"
                     /translation="MAIQEPITKKRKLDISSQKELEPQPSFTEVLEQLVAEEDAAGDS
                     IETSAAWPRPPVPPFDAKKDTISFQQIEIEESADPKHGPTLRLFGVNKSGNSVLAHVY
                     GFKPYFYVAAPSGFLNKDLQPLADKINSSISALGPCVTNCAIFNRRSLWGYRGDDTVP
                     FIKITVSDPKNLSKVKGAFERGQIDFNGLFPPEILTYESNIAYTMRFMIDTKIVGMNW
                     VSIPGGRYDLLEGGSKKSQCQIEISCNYKDLISHPPENEWLDIAPLRVLSFDIECAGR
                     KGIFPEANVDPVIQIAAMVTRHGESKPFIRNVFTLNTCAHIVGSQVLEFKDERQLLLE
                     WRKFVDTVDPDMIIGYNISNFDLPYLLDRAKALKIPDFAFLGRLRNVRTEVKETHFSS
                     KAYGQRDSKAVNMEGRLQLDILQVMQRDYKLRSYTLNAVCAQFLGEQKEDVHHSIITE
                     LQNGTADSRRRLAVYCLKDAYLPQRLMDKLMCFVNYTEMARVTGVPFNYLLSRGQQIK
                     VISQLYRNAADAGYVIPALKSEGSDEQYEGATVIEPSKGFYDVPIATLDFASLYPSIM
                     MAHNLCYTTLLDKGTIERLKLVEGEDYVHTPNNDFFATSKRRKGLLPHILENLLAARK
                     RAKQDLKVEKDPFKRAVLDGRQLALKVSANSVYGFTGATVGKLPCLAISSSVTAYGRQ
                     MIELTKKEVEAEYSMKNGYDHDAKIVYGDTDSVMVRFGCPDLPTAMRLGAEAADLVSG
                     KFIKPIKLEFEKVYFPYLLISKKRYAGLYWTRPEKYDKMDTKGIETVRRDNCRLVSTV
                     IETCLFKMLIDRDVKGAEDYVKDTIADLLQNKIDMSQLVITKALAKADYAAKQAHVEL
                     VERMRKRDAGSAPSLGDRVAYVIVKGVKGAAAYEKSEDPLYVLEHNVPIDTRYYLENQ
                     LSKPLMRIFEPILGEKANSLLHGDHTRTIQIATPTIGGLMKFAVKTVTCMGCRTPLRG
                     KNESAVCVNCRPKLPELYQKQVAQTSALQIDFARLWTQCQRCQGSLHQDVICTSADCP
                     IFYRRTARQKEVASSVAQLDRFEKETGW"
     gene            complement(188190..191269)
                     /locus_tag="CNK00570"
                     /db_xref="GeneID:3254465"
     mRNA            complement(join(188190..188744,188804..189697,
                     189757..189988,190039..190330,190376..190733,
                     190780..190968,191015..191269))
                     /locus_tag="CNK00570"
                     /product="expressed protein"
                     /transcript_id="XM_024658028.1"
                     /db_xref="GeneID:3254465"
     CDS             complement(join(189343..189697,189757..189988,
                     190039..190330,190376..190733,190780..190968,
                     191015..191247))
                     /locus_tag="CNK00570"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513705.1"
                     /db_xref="GeneID:3254465"
                     /translation="MEHTTDIEAGPSKLAASQTLQKKPRKSALSTPVINDNGDDSGPT
                     SAKAISGPATGGQGDEEEEGEERMDFKLIQSFADKIQLLPTADSVDGLTSRPQVIIPR
                     RGEKDFEPLQETVNLQEMMLEKSRQALFNALIGVRGGHNNSISHALLTPKKPFPRVLV
                     VHGHLLDTMGITVRTPPPAGSKGKGKTSLELLPEEALYLLERGSLQIWIGRDPETDEE
                     IEAGVGEWCDEEYGVKGAIEMSVMEGFGAFIGREGLTWERYQAYSYLKRLGYNVQRSR
                     QFIPEYFLTAPLVQLDEQDPRLPPFNTWWLNIPKWIAEFFKAFVRGVQRVAGSMASVG
                     LGLRLTRDPFKGTLLNGWRGSSYNSLFSYLRVVPAGHDKPLSPRPAPPPSDDIYAPLV
                     HNPYIPFWHIWKPMTPWSKRNWDKGSEEGLRTQRPDYFAAVIQARITPLPTIHQLEEI
                     YAMLPDEPKGPIKRYGPQYQRPPRAQASKPHIQTPTQIPSRLQSLLERMGWKQQAKTK
                     PQAPNVNVGALRNGDRGFIVGVNDSGNNAWIRFGRTDFSQTPAI"
     gene            191404..193804
                     /locus_tag="CNK00580"
                     /db_xref="GeneID:3254569"
     mRNA            join(191404..191609,191666..191995,192047..193218,
                     193275..193804)
                     /locus_tag="CNK00580"
                     /product="homoaconitate hydratase, putative"
                     /transcript_id="XM_567622.1"
                     /db_xref="GeneID:3254569"
     CDS             join(191419..191609,191666..191995,192047..193218,
                     193275..193768)
                     /locus_tag="CNK00580"
                     /codon_start=1
                     /product="homoaconitate hydratase, putative"
                     /protein_id="XP_567622.1"
                     /db_xref="GeneID:3254569"
                     /translation="MVAIPRLARLSVPAWALSARGRFYATVSTPQTLVEKIVQKYAVG
                     LSEGVKVRAGDYVMIKPEHVMTHDNTGPVISKFLSLSCSKLDNPRQPVFALDHDVQNQ
                     SETNQKKYKKIQAFAKEHGVDFYPAGRGIGHQIIVEEGYAWPGKMVVASDSHSNHYGG
                     VGCLGTAIVRTDAAGIWATGKFWWQIPRIVSVSLDGRLSPGVTGKDVIVALAGLFNKD
                     EVLNAAIEFTGSGVEHLSIDERLTIANMTTEWGAVAGVFPVDDKLKEWYQGILRKAEL
                     RKFISPTVPSTVGAKVHPRLNAARLDDAMTNRVVADPGAHYAARLSLDLSTLVPHVSG
                     PNSVKVATALPKLLDPPIPINKAYLVSCTNSRASDIASAAQVLRGKKVAPGVEFYIAA
                     ASSRVQEDAEAAGDWQTLIDAGAKTLPAGCGPCIGLGVGLLEKGEVGISATNRNYKGR
                     MGSPDAIAYLASPAVVAASAAKGVICGPESMDLSQLPQYEQPKFSIIEEGAAGEEKPV
                     EVDEASLEPLLEGFPAYFEGPLLFAPQDNLTTDGMYPGKYTYQDDITPERQAEVVMEN
                     YDPTFAATARELRTALPTASSPSTLPGAILLSGYNFGTGSSREQAATAIKNAGIPLVI
                     CGSFGDIFKRNSINNGLILIESPSLIKDMTERFAKDGVRNKGGKDGKLTVVPEGWRIK
                     VDSQRGLVTVNMGEEEEKTYPAAKVGRSVQELWVNGGLEGFIRASL"
     gene            complement(193834..197518)
                     /locus_tag="CNK00590"
                     /db_xref="GeneID:3254625"
     mRNA            complement(join(193834..196165,196217..196919,
                     196980..197136,197222..197518))
                     /locus_tag="CNK00590"
                     /product="fork head homolog XFD-2, putative"
                     /transcript_id="XM_567623.2"
                     /db_xref="GeneID:3254625"
     CDS             complement(join(194192..196165,196217..196919,
                     196980..197053))
                     /locus_tag="CNK00590"
                     /codon_start=1
                     /product="fork head homolog XFD-2, putative"
                     /protein_id="XP_567623.1"
                     /db_xref="GeneID:3254625"
                     /translation="MSRPTSSDSQHSGSMSSHNVIQNDITHENSFMTTPTSASYQTQV
                     YYADPYAHASFQQYQSGAYGGEMREHMITPYGGHQVAQGRIAMPMHGQPLHRSPNGAY
                     EEFEFTPFVPEEETTPYLQVPERYHAMVQSPSTTMGQFTHPLSPVDQMTMDQQHHFRQ
                     SNSLGSQPQQFIVQTGRPQRPKLQTSQSMIVSTRPSTQTSMQRPGMTRHASLRGTTRP
                     DSPYVAGDVFDHVPGHLEESPIYQPIPPQDPSWELSAFEPNYANGQGISPARALGPAP
                     PQPQRFSPRHDELMVTPQANKIAYSEHPPSSAISTAASTSSSFSVTMKHQRREFDSSD
                     DEQEGRTRKPLPSRTVKTRQEEKLPPPPLPLPTRPPKASSARAPVKPAKVAEDPGVEG
                     VPPGPRSHERPGPSFACIIGQAILSCKAGGLSLEHIYRYVETAYPYFKSGDNAWRNSV
                     RHNLSIHKMFETIPRTEKFPPGKGGIWIIHEDEKCHWPAQDKFIKNFPPGHPHHDVCR
                     QTLHERQKEKDAMEKAAREGRVYVPKKGKKRRKQMLKEELEAEVAKRLVMGNSGAVTS
                     EQKVEEEKEQTPEPVEQETISEEPVVTEPEARPAPEPEPTAETEGASKPQTKKNTPMP
                     PPAAKLGKWALPPPPVDPKGKRKQAESEDDPLFSTSKRVRMAEPLAPIHPFPQETVPG
                     KAEKYDASFVTPERERPIPNGSKLLSSASDFKTPALVQSSSSPGSPPMPATVTRPTHH
                     PSSLQQAWTHDDMSQTPPRDSSPARPMLDAAFDLKPKSLRTKQVAQEDEFPHSHTHLA
                     SPPHPRGPPKTPVTRSSAAADKTQTPRLHHRKTPSMSTVTPVVFRDSPGLPPPTSSAL
                     LSTPMWEIGGCLDRLKDHFAPSPTSSIHPIRSPAPPTSPTRYAMMLMDTGSSPRKGKS
                     AS"
     gene            complement(197990..198968)
                     /locus_tag="CNK00595"
                     /db_xref="GeneID:36393097"
     mRNA            complement(join(197990..198478,198531..198968))
                     /locus_tag="CNK00595"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658802.1"
                     /db_xref="GeneID:36393097"
     CDS             complement(join(198019..198478,198531..198952))
                     /locus_tag="CNK00595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514637.1"
                     /db_xref="GeneID:36393097"
                     /translation="MTTLSPGVSTWAAPTWFRSFYSTFPLVVHPQDDQLEWKAHARGL
                     PPQSAVLWIHPSSAHPHPHRRPWLSANPSSLRTQLLFLLRHTASQPPVVFKEWPNESS
                     APNGTLPALHIPSQERLLSTDEIRGWLEGTYPLDGRHREWQGLASQESYDKALALSQL
                     ILTHLLPAYLASLPPPSSSRIPFHLHFPVPPPLYAGLTTPLPASLTGDRRDIDIDDVL
                     RKGQEAVDVVDGLLRGDGWALGAKRPTSLDALVASHLYVLFTLPEDSFLRGAVQGKQG
                     VEKYIERVLDYAESRRV"
     gene            199061..204372
                     /locus_tag="CNK00600"
                     /db_xref="GeneID:3254418"
     mRNA            join(199061..199155,199192..199247,199287..199491,
                     199531..199771,199827..200348,200402..203968,
                     204021..204147,204201..204372)
                     /locus_tag="CNK00600"
                     /product="endocytosis-related protein, putative"
                     /transcript_id="XM_024658029.1"
                     /db_xref="GeneID:3254418"
     CDS             join(199140..199155,199192..199247,199287..199491,
                     199531..199771,199827..200348,200402..203968,
                     204021..204147,204201..204296)
                     /locus_tag="CNK00600"
                     /codon_start=1
                     /product="endocytosis-related protein, putative"
                     /protein_id="XP_024513706.1"
                     /db_xref="GeneID:3254418"
                     /translation="MAPAYSPQETQYYDQLFAFVDKDNTGILPGQDAYPFLTSSNLST
                     TALGEIWAIADPDNNGFLTRDGWYKAARLIGWLQKGGATSVEESLLAKPGPLAAFDQG
                     PKPPVAAQPTAQPLSAHTTGSALPQLTPTDRAKFTRLFAGAGPANGLITGDKARDIFI
                     KSGLSYEKLGQIWNLADTQGRGSLDLTDFIIGMHLIQSCMANPALVLPAVLPPGVYET
                     ASGGRPPPPPAPVSPVVRNNTGPASPLRQQYAGGAVAPLQQQGTGGSIGGTSAPVPPA
                     RSFTASSAYAPPSRQMSITSTQWDVTPQAKATSDGFFSQLDPQNKGVIDGDVAVPFML
                     QSQLDEATLANIWDLADIRKEGKLTRDEFAVAMHLINVKLSGQEIPASLPVSLVPPSL
                     REEYGPGKQEVLQSSATKDLFDLFADEPPASKAASPAPQAPAQAQAPARTPAPAPASA
                     PAQPPALPARSLSQQPPPPTPQTPFLPQPPPPPSRRQASHATSALSPAPTGQQPSSFQ
                     GSAFASPFSASPAPAAAPAPASRGGDLLSDDAETSSTPVPDHSAELGNKQNQLAQTTR
                     SITDLSSQRTELEGSDKSSKQQLEELEGKLAAAREKHQTELRAVADLRTRVGEQQAKV
                     KKLNSDLITASSDLSALQSEKTELEQSLLHDKEEVRSLQRRMKEVDDEKQGLVLVLEK
                     LRKEARQQKGMVSIAKKQVSTAEGARDEVQAEMKGVEKEIEEDKAFLVQHEKNQAQQQ
                     QQQTKALSPQSTGIFAAGIALPPTPQALSPAATGMSNRSNNPFDRFLASGRSTSQAQV
                     PSSTAATAGSPSNASTPTGQTPPQAVSAPASAAEESTDRSLSPGSPFGGIAETTGSAF
                     GSVGAAATAAAGAVAAGAAGLYETAKHAVTDEPEHDPHLDTSSPSAAPTSVEVADGAA
                     SRAVEEGNLNTERDVAEQEVGPITAGEGEGQQEQEQEQDPFGAPSGGFGFAGEDEKTP
                     IAQQEELDPFGAPQVPGTTIASTAGAENNNGIPTDPFGAPAIPQTDGFSEQQGQAAGS
                     QDGGFNDFEEGFGDSFGATGTTTTATAAPAEKAVAGAEQEANKAPTDFDSAFAEFDSP
                     AETPPQFEQHPQESTLSPNQGIPSGIPKSELPVSLSERPDAERTFSTQATIAPESEPI
                     TPMADIPGEYRSREEGSSGVPSSRGSTPGLAGVGAAAAVAGGGVGVGVGSALAHEFKP
                     EPEPEPEQQGGYEHSRQQVQGVNVGESSDEDEGPEDLERPRKGYGTKGAESSVSSPIE
                     QEPSPTSAGAAAALAPPIAGFMTVTEDPQPKVRRSAPPPPSKTASASSAVVANPAAPA
                     PSAPATESETVSPVVATAGGVNPGEEFDPFGAPMVANVNAAPGNIATTQGASYIDAPS
                     TAASQAHPKTASFDEDDFDFSDLPPAQVESGIPVAAVQQSTAIAGGAPPSAGFDDEFA
                     TFDDEFEKPEELSAGNGSENSSGNKSYEMVSPQPKPSGLYDEWGFGSSAKRAGNPQEQ
                     QYQNQQEASGFGDAFGTQASQGTQQGGLSFDDAFGNDFEPSSSAQTQEYAPPPGSPPQ
                     QQALRPPMPERRPSGAQADDIEDVKKLCAMGFPRELVVEALAANAYDFQKTLNVLLA"
     gene            204909..206346
                     /locus_tag="CNK00610"
                     /db_xref="GeneID:3254556"
     mRNA            join(204909..205276,205372..205749,205817..205952,
                     206036..206346)
                     /locus_tag="CNK00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_567625.2"
                     /db_xref="GeneID:3254556"
     CDS             join(204989..205276,205372..205749,205817..205952,
                     206036..206274)
                     /locus_tag="CNK00610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567625.1"
                     /db_xref="GeneID:3254556"
                     /translation="MTSAEEDQFENLPKFDASKFQPPAWAKPANFQWGDRNGESSKAT
                     ASSADKEGNQNILDLGDDESYDDNDDSGDEVFEDAHSTVDPEEAMFTISELKELLSRA
                     TKHKITGNSHYTSKPPQYEQAIASYKLAIDHLPTFPSDPTDPEHQEQDSKNDFKGKMK
                     VEEPVPSGLQEVTEEEAVAIQKEENTKKGKSPEELEREEVEDEIKECTKACWGNLAAC
                     YIAIKDDGNAVKACTEALKIDPHYTKGLHRRATANERLGTLTALTSAQQDYTLLKTLL
                     PASSPLLPSIRRSLIVLPPKIKSEEKKQYDEMMGKLKDLGNSLLGNFGLSTDNFKFEQ
                     QPGGGYSMNFNR"
     STS             205132..205882
                     /locus_tag="CNK00610"
                     /standard_name="Xba26"
                     /db_xref="UniSTS:470688"
     gene            complement(206609..206701)
                     /locus_tag="CNK00620"
                     /db_xref="GeneID:3254485"
     tRNA            complement(206609..206701)
                     /locus_tag="CNK00620"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:3254485"
     gene            complement(206944..208478)
                     /locus_tag="CNK00630"
                     /db_xref="GeneID:3254715"
     mRNA            complement(join(206944..207853,207917..208478))
                     /locus_tag="CNK00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658030.1"
                     /db_xref="GeneID:3254715"
     CDS             complement(join(207497..207853,207917..208330))
                     /locus_tag="CNK00630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513707.1"
                     /db_xref="GeneID:3254715"
                     /translation="MPSTLRTVLVSTTLAAAVTYQQHFRLVRLYPSMPAPQFPVPPEP
                     PYTSQAWAECNAGDAWVVDIPSLHLSNKGEEGEDGKMVYTFARAFWSTWALRLEGAIV
                     NGLGKIGVVQPFEESGKIQSVERGRFDKGATEVGGCFILEANLSSPPTTASQTLSCGS
                     LIYRWGSLSLSEKSLGGYHVLSIVPSPLPQHIRLNFTTYLVSEGYEKSNGFILPSTPS
                     VSDNAGLGRKVLAQFHMIYSRLLVDLALRRLGVAVSWV"
     gene            complement(208645..210060)
                     /locus_tag="CNK00635"
                     /db_xref="GeneID:36393098"
     mRNA            complement(join(208645..209891,209941..210060))
                     /locus_tag="CNK00635"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658803.1"
                     /db_xref="GeneID:36393098"
     CDS             complement(208792..209856)
                     /locus_tag="CNK00635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514638.1"
                     /db_xref="GeneID:36393098"
                     /translation="MQVSIAPPMSPTPAQMSILQLPWSFDQPSSFSKLLPVQDYIFDE
                     LLLIAPLSTITLTRRYYQKTIRTIYREVSVSNKLFCSLLCGDRTAFERGVMAFENTHI
                     LRIKNFEGFSILTQFHIPLLFATLRNRKIFCNVERIDISWEAIKTFFFTRWCQGFPAT
                     TSDDSRLLMSHVGRKFREVVLYVDVGDPTSGECSEDIQAIADYFSPRTMTMVSSYHPR
                     SDFLVIRQNVNAQLLPISWMGSQTSRLIIPHWPLMVKPGCSMEESDEYQRAATEQCVL
                     NYMDDLYAVWNELEGADLPTEGVVVSKMEFFVSKDPKAIRDRVLHSPLHTRQDTSRFL
                     NKGIVVRELDEDIKDRYDLL"
     gene            210234..214585
                     /locus_tag="CNK00640"
                     /db_xref="GeneID:3254634"
     mRNA            join(210234..210452,210499..210703,210753..211504,
                     211559..212208,212261..212519,212567..212820,
                     212873..213099,213152..213615,213667..213878,
                     213926..214006,214065..214152,214208..214585)
                     /locus_tag="CNK00640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567627.2"
                     /db_xref="GeneID:3254634"
     CDS             join(210282..210452,210499..210703,210753..211504,
                     211559..212208,212261..212519,212567..212820,
                     212873..213099,213152..213615,213667..213878,
                     213926..214006,214065..214152,214208..214378)
                     /locus_tag="CNK00640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567627.1"
                     /db_xref="GeneID:3254634"
                     /translation="MSSAPLADDWEPTYTHFSHKTEFLDSLRKFVTLDIGKESTEKED
                     EDEDALVTCLGAVLDYYLPMPGLLDPSLDEIVRPIMQLLEKSLHTIVEEDSCTSNPVN
                     PKRLERLGRVLNWVVKVRGWKAVVPHFPSTIPNLPILIKLLSPPTSPSASTSPATPHH
                     HLLSPTTAWELRAVLLLWLALLLTVPFNLSALSDSDDFVSSAPYGIDLPSAELLFPVA
                     ASELAQKVTFLAVPLLHRPGREGAYAALVLARLLSREDSVQNLRGFFAWATSEIEEGD
                     RESESHLIASLFTLLALFSSLLKPNHLPLVEGFLEEKLLPHLRGSRTAAESGLIRKLA
                     IKAKGRLWVSKLGKKYYDDDDVDLPEGLEETMDDLMGGLSDKDTIVRYSSAKYLSRIS
                     ALLPPAFSSQIVLATIALFAGTEEEPVQFTSFGTVIDPGGSSASGGTMGFGGSEVQRG
                     EARWHGVCLALAEMGRRGLIWGEAVGGAVEWVVKALTFDLRRASHSIGANVRDAASYL
                     LWSLSRACPPSALEPYANTIATNLVCVACFDREVGVRRAASAAFQEGVGRTGVYPEGI
                     DVLAKTDFHSVSVRRTAFLTASQAVGVHSVYRTAMIDHLHNITLRHWDCSIRRLGAQA
                     LRKLLEVDRKEMLEYALQRELKELVSLDSVNVHGALVALKEVAEMFEDSDPRNQIIFD
                     ALATIRAATLVSQQAADVLSALCDLLSTILNPSITSSATTQSVLARYFELTSKRREVE
                     VHESMARVYRRLSELRDCEKDINKLISDLRSFRVTQRQSATLALGHIQYPTAPSSMAE
                     KTVVALLGLLKDPIKTEVESRRWAVRSLGDIAVQRMDGSLVVESTTLNTVVRAFIKGL
                     EDYSTDQRGDVGSWVRIASLDSIGRVLASLPPHSSLSSMLEPGICDEAIGGLVKQGVE
                     KLESVRSASALALARMRECGWQWDTQDAMSVSKKQLAEEGFRYVDQKEWFQSAMPLLE
                     SRFRKELVAGLIFTIGSQVVTLSNSALHPLIEYLMVHTSTIVFVLQIISSLMADNLNS
                     NRIFIPTLQTLHKLLSANIWEDIEDAEDCKGAADVLMKSLGAATRGLGNMKSIERISA
                     AMRVVIACLTAPSEVRSKATSLVSLFLAHRFPRIRAMASEEIYLALSEVDDDMGEELE
                     QVLLETDWVGSGVEVQAEMVVQLLHGRKEEP"
     gene            214855..216968
                     /locus_tag="CNK00650"
                     /db_xref="GeneID:3254617"
     mRNA            join(214855..214952,215007..216495,216550..216968)
                     /locus_tag="CNK00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_567628.2"
                     /db_xref="GeneID:3254617"
     CDS             215144..216394
                     /locus_tag="CNK00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567628.1"
                     /db_xref="GeneID:3254617"
                     /translation="MLPDPCREQVSPKVPLEPLGSLSYLISDEVLGEDPTDVLYLRVS
                     REFYKFIVPQVYRHLHLHTGNVFSVLYPLDDSLVKRRLDGERKAKALKNVKVVTLEEF
                     FSAARIAWWSEQWSFQVNPHWRDAVPRSPVRAFPAIEHVHLGENFINPDITPKWDAII
                     DHTFTRQLPSPSFCNDVPIDKSDHPDFYFDHSIYLDQYKSLIRLLASRQNIRLRRFTF
                     HVRLTKDLNGYQPYLFNLDNDKVVPIWYIFEVEEEEKYSTIDLMDRIFKRFLQYPKIH
                     QLNNRIKLILPDRPDLESSLTQLGQRQGDHNRAIFQTFRNHVLPLTADRVCPCKSPVI
                     PRNPKKAPPKHIHRCMFDNEDKGDSHGYGNEFGAGVYFTDDSQPVVSYASSWGGGRTG
                     ATFGGFGGGYGFMGMRGGFGGGFN"
     gene            complement(217448..218977)
                     /locus_tag="CNK00660"
                     /db_xref="GeneID:3254681"
     mRNA            complement(join(217448..217848,217913..218058,
                     218123..218347,218568..218694,218805..218827,
                     218874..218977))
                     /locus_tag="CNK00660"
                     /product="RAB small monomeric GTPase, putative"
                     /transcript_id="XM_567629.2"
                     /db_xref="GeneID:3254681"
     CDS             complement(join(217779..217848,217913..218058,
                     218123..218347,218568..218694,218805..218827,
                     218874..218903))
                     /locus_tag="CNK00660"
                     /codon_start=1
                     /product="RAB small monomeric GTPase, putative"
                     /protein_id="XP_567629.1"
                     /db_xref="GeneID:3254681"
                     /translation="MATRKKHLLKVIILGDSGVGKTSLMNQYVNKRFSTQYKATIGAD
                     FLTRELVVDDRVVTMQLWDTAGQERFQSLGVAFYRGADCCVLVYDVNSNKSFEALDGW
                     RDEFLVQASPHDPENFPFVVLGNKIDMEESKRMVSQKRAMTWCQAKGNIPYFETSAKE
                     AINVEQAFQTIAKNALAQEAETELYADYPDPIRIDSESTQNYGCNC"
     gene            219175..221295
                     /locus_tag="CNK00670"
                     /db_xref="GeneID:3254480"
     mRNA            join(219175..219335,219412..219511,219573..221295)
                     /locus_tag="CNK00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658031.1"
                     /db_xref="GeneID:3254480"
     CDS             join(219245..219335,219412..219511,219573..220917)
                     /locus_tag="CNK00670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513708.1"
                     /db_xref="GeneID:3254480"
                     /translation="MSQPEWQSVIRERLIANQRQQEPYTDIVDQYRKLAKTTRELKVR
                     NKALLKSGGGGGGGGGGPDGTAPLLTHLDAQLTSLRNELSTLYRSQAVSQNKQLQLTD
                     AIRERDATAANLRDELNSLRADRAALEKRVIEWDLRWKNREKDMETLSDEIMSLNLEI
                     SALTERNEGLLKDNANLLQRWLDKMNERAEEMNQAFEKEAGVAKGFKEEEEIFEEAFE
                     EVEPPEESENDERKKDKEKAKAPAAITTTASQSTKSKPSITKPAIAHTKPPAPAADPT
                     RSRTSRTSLPSSTSSRLVTKPRTSSSTKLSSTSEKPEKEKDEKKTVPLRSATPRSSRP
                     SLSPSPSPIPTPPTGTVNSTSASAAASVSNTGRKSSSPNPAAQPRTRTGSQPGASTPN
                     VPTAPSAPTTRRSPSASSLRGGSITGTPGVRSTSSSVRDKIRAMEGSGTLSRAGPTTG
                     AGKAMGKGTGTRTRKISSPAPTATPKESDTPASQGRGGSERMDESQNSGTADKGKELG
                     DFR"
     gene            221741..223598
                     /locus_tag="CNK00680"
                     /db_xref="GeneID:3254721"
     mRNA            join(221741..222026,222077..222307,222355..222652,
                     222700..223079,223135..223598)
                     /locus_tag="CNK00680"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_567631.2"
                     /db_xref="GeneID:3254721"
     CDS             join(221969..222026,222077..222307,222355..222652,
                     222700..223079,223135..223295)
                     /locus_tag="CNK00680"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_567631.2"
                     /db_xref="GeneID:3254721"
                     /translation="MAKPTHARGHIYSLAEVAKHNTRVSTLCTYNGKVYDLTSFLDDH
                     PGGDDIILSYAGQDIGKVMSDEDIHQHSRAAYEMLEEFEVGELGGGEKIVSEDWVCDE
                     NFQPSDTDLLSDYNLNKFIDLTKPLLIQVWHAPWTKEYYLSQVHEPRHLKESARLFGS
                     DLLEPFTRTQWWVVPMIWWPIAGLIGWLSMLQFTDSSITAKSILTYPLPSSIPVPSFA
                     ALGYFSLCFAFGVFIWTILEYSMHRFLFHLDYYLPDTRWAITLHFMLHGVHHYLPMDK
                     LRLVMPPLLFFVLQTPFTKLAHIVFPKAIANGIISGAFAMYVVYDLGHYALHHTRLPA
                     YLREMKRYHLAHHYKNFELGFGVTSKMWDYVFGTVLPTTTK"
     gene            complement(223563..226082)
                     /locus_tag="CNK00690"
                     /db_xref="GeneID:3254435"
     mRNA            complement(join(223563..224035,224119..224393,
                     224462..224552,224606..224676,224745..224890,
                     224954..225148,225204..225282,225337..225441,
                     225496..225669,225740..226082))
                     /locus_tag="CNK00690"
                     /product="regulation of meiosis-related protein, putative"
                     /transcript_id="XM_567632.2"
                     /db_xref="GeneID:3254435"
     CDS             complement(join(223703..224035,224119..224393,
                     224462..224552,224606..224676,224745..224890,
                     224954..225148,225204..225282,225337..225441,
                     225496..225669,225740..226007))
                     /locus_tag="CNK00690"
                     /codon_start=1
                     /product="regulation of meiosis-related protein, putative"
                     /protein_id="XP_567632.1"
                     /db_xref="GeneID:3254435"
                     /translation="MSNIIEVGAPPPRSSSSKARNFVSPSTGLSKTLSSEKTFEKVNG
                     NHEAESHIYRDEDSMEEDIMGEESMLVDTDQEEDSDEDEEKEVIHVEVRQKPFSHLRE
                     QPIMQIVTQFIQEDLARIELGCELSGWNEIKILRDHVERIWVEEGVAGVASVQVSEVD
                     IQVHVYKTSLNNEVEDFSADLDDDDSEEKVSAASVRSLPSAELDGIWDTLVYSDDIKA
                     RLLNYIYSTILFSESDIDFNVIAWNRVILLHGPPGTGKTSLCRALAQKMSIRLSQKYR
                     HGKIIEINSHSLFSKWFSESGKLVQKLFQTVTEMVEDESGFVVVMIDEVESLTAARAG
                     AMKGNEPSDSLRVVNALLTQLDKLRTRKNVLVMTTSNLVDAIDEAFISRVDLLESVPL
                     PPPRAIYSILSGCLKECITRKLIKRCRILDWKAAEEALRERKFAGEVSVAEKEKEARE
                     VRERGVAASLADLAVKCHALELSGRTLRKLPVIAHARYLSSSSSSTSSMGEYRSLKVE
                     RWIEAMGKVVYIEQEKKHDLTRGGSTLDAVRGETDARRDGMNGHAEAHGHGHSHMEKN
                     EVGMMVGTKVKH"
     gene            complement(226387..226495)
                     /locus_tag="CNK00700"
                     /db_xref="GeneID:3254482"
     tRNA            complement(226387..226495)
                     /locus_tag="CNK00700"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3254482"
     gene            228282..233602
                     /locus_tag="CNK00710"
                     /db_xref="GeneID:3254589"
     mRNA            join(228282..229358,229408..229849,229896..230437,
                     230486..231155,231204..231810,231862..232025,
                     232073..233602)
                     /locus_tag="CNK00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658032.1"
                     /db_xref="GeneID:3254589"
     CDS             join(228538..229358,229408..229849,229896..230437,
                     230486..231155,231204..231810,231862..232025,
                     232073..233458)
                     /locus_tag="CNK00710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513709.1"
                     /db_xref="GeneID:3254589"
                     /translation="MSNNNQEQNPFAGFNMAQLNQLNPALFASLANQMGMNNQAGPSQ
                     PQNQAQQPAMGNLRNIPPQLLQQLQQQQQQRQQSGQPPSQASINDTLQNIMLPTFNRL
                     QSQNSQQMQQERLQTSNNPAIQAQVAAQQAKARQAAQAVQAAQAQAHAQAQAQAQAQA
                     QTQQQNLGIGVQGMTGMQGMGGLPGMGGIGGFGGMGQNQTQQPNQPNQVQRNQNQFSV
                     HSHQPDLGLNQSSQPQSSNTNIQQGNIGQGQSGQFNLGMNMGMIGDDSVRRAALQSML
                     AQSTQNQNQNQPPPPQPAPSNPTPQISPEVHEFMRTRSDIASAVFKKHGNPQAALEDL
                     QRIVGMLKGQNQAQNQPQAQTGNNMGAAGVPVGINGQMFNQRIASGQTQSAQNQGQSQ
                     QAGHQRIPSSGNFDLPGSQFANTLSQLEALQQVKERQQRGGLKTPQMPQSNTLPMTSP
                     QMGNNANNLNPPFNLTLPNQPNNAQNPVQNRQTPRMSNNIPTLPSGPAAPRPPQGTNP
                     VQSGARPLPNQVIATWPLDKLIGASSNLSKKIIESEAAHGNIIQPGKPSTMGLGVPGR
                     TAAEQAAKFQLLVMIAEIKRRAVPVPDDALNVAASLLPVANAKEQILQMEHSQLSEVA
                     RATMSQLSRQAQAQAQAQAAQAQGQNQSQLGQAPGQQGSQGTLNAQQMARFLQQQQQQ
                     SQQQQQNQQQALRGSQANPIELVTPTMTNTQLPHFPTPSQTSATMANSASQHPQPNQL
                     QGNQSSQPPQANPNSTPQLSQATTQSNAGPGGPDINDIPEESFYGYLRQMMAKNGITS
                     GIPTIEGRQVNLYKLFQMVIKNNGSSHIEPMRWTFVAGQLGFATEPTQPGQPPVSNMQ
                     VAQQVRHIYISLLQPMEDAYMTMKRNKMAQANMRRAGMPPGQGSTPGQAPGQVRPPMN
                     VAGPSVTPTLASQNQNQGQPLSEQQRRFLEAAKNAGAGNVGTGVGLGEAWQGQAQQNA
                     GQGSQSQSIQPPTQPQTQQPAGHQTATPTAQRLELSALKILEFIRMQESLIRNGLEKQ
                     PNTDVNPDIYRNELRTILPIAKEAESRLPIYLLMISDGGSVEPQSVLTIINMCTTPSY
                     AALLAERNRFIFNLADFPRLRAGLSQFLSKAQATYRTMAEKPVGQAKLKSMVSAVQMA
                     KGLIAQKDREKQAQTTPNAAPANVAAAGSGLGLNLGSTQGATGIGLDVQQMVQQAHNH
                     AASQLQSSQNQQQQQPPAQPQTLLPPPALPKDSPSNLQEAIRHKGLRVEDLKPPPSKR
                     QKSKGSPATPANAQVPTPESAKTPANTAVIGTQGTLGESPKEKKATKRKRQSSTATAA
                     GTEKPVKQTKAEAAKAKKAAVAAAAAVAIPATVPEDPVNALGIQLAADEAATKAEIAQ
                     HKAFFDDQRALASAAAPGDGEKKVGGEDAMAVFTKIFEAHQAGIQADMVRTDPVAQSA
                     STAAGHMPPVTSAGDPNDQDLFDTYFDVTLFSLAADLPTPDLVIEATPQEVDGESPES
                     VRTVGSTAGHTVPGKEVKSGSKEEKGKEEGTKIILGSPGSMAYNGGIEW"
     gene            complement(233812..235847)
                     /locus_tag="CNK00720"
                     /db_xref="GeneID:3254477"
     mRNA            complement(join(233812..234061,234142..234311,
                     234368..234432,234488..234670,234722..235029,
                     235078..235440,235507..235847))
                     /locus_tag="CNK00720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567634.2"
                     /db_xref="GeneID:3254477"
     CDS             complement(join(233907..234061,234142..234311,
                     234368..234432,234488..234670,234722..235029,
                     235078..235440,235507..235768))
                     /locus_tag="CNK00720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567634.1"
                     /db_xref="GeneID:3254477"
                     /translation="MVKDKKQSKKRKLNGRVNEPKPVASLPTPPGDTSSSSSLIEPEE
                     LETAIYVLNTLCEFPEELSDKKYKELKRSMYDLHRVMADGATLGASLTSKISAALQDY
                     RFSDALIFLFEMYTRRIAPKLGALQRWVRECDATSAADGSPGDAEALKCLDLILRIAN
                     MTNADEQAQSASANSSSSVINHREPWVARGPIEGEIAIWERMQTGALFDGQIPPKPYP
                     HFRPVHHVPAAERRPPNLYDSTVYGSSPSAITLTPKESRPRKPSKMEVPGVPGAFIVL
                     DVFTPEECLQIVQAAEAIGFDKDEAAAGSAIMKTSILARNFVWLADTPFLEHFYSQIL
                     PFVPQRAPVSPDGHGGGKVRGINARFRVYQYNENQLYRPHIDGAWPAAGLHPETGEYL
                     HDSSPPDDPLWSRYTLLVYLNSDIPDDTGCTTFFLPSETMGVMEATSVKPVQGAVLCF
                     PHGDTQGSLLHEGSAVGAGGGKLVIRTELLFEAPGFGQFKPPTNGNVTAQS"
     gene            236185..238449
                     /locus_tag="CNK00730"
                     /db_xref="GeneID:3254626"
     mRNA            join(236185..236782,236839..236951,237007..237134,
                     237189..237468,237522..238177,238225..238266,
                     238319..238449)
                     /locus_tag="CNK00730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567635.2"
                     /db_xref="GeneID:3254626"
     CDS             join(236275..236782,236839..236951,237007..237134,
                     237189..237468,237522..238177,238225..238266,
                     238319..238406)
                     /locus_tag="CNK00730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567635.1"
                     /db_xref="GeneID:3254626"
                     /translation="MPDDHELDSYGIQASSAEGSSSSRPLLSRDPSPPPSPSRRGRSH
                     PVASHGYPSIHSMFRRLWKPIVILSIPFFLVFLYSLVHPHVKGLPPLPKISITSGGAV
                     SQPYYEEKIVQDCICGTTDEGKRLCSLYHEEGLRNSRLIEGTGARMRKVLQKARNGEK
                     IKIGVLGGSVSACHGVHPSDRFPQGDPAGPGCYTSLLMEWFKETFPDADHEFTNGAIG
                     GMDSSYYAFCGTHHIPADSDLIILEFDVNDQNDVLYETFFDQLLRALSEFQNEPAILI
                     LGAWAPQVAQDQGYGDPQMVHSPIALYYDVPYLSMKRLMFNHYLRYPHSTAKTFFQPD
                     LLHPNARGHRVLSDLLIAYLDSELCMLSKYGLPIAPPLQDTISTTHPFTDLIDVHVPL
                     ETLHLVDPAAPPEGWEETFKTEPLEALSHEKRLFAVPLTPYSIPPVGMFTPLSDVVNP
                     TNDDPITGEHIAAIAQPRLFCADANDKKNPMKPTQADGWEPFAWNGEKHYWVSHKSGS
                     RIRVNIKVSAGKVAVYYFRSQHYNLGDAKCWVDDNEKGAVTLSGYWTKQYNVAVAAYI
                     DEKVTPGDHYVVCEVLHTTSHPTNPDAHHFRLTAVMAT"
     gene            239324..241667
                     /locus_tag="CNK00740"
                     /db_xref="GeneID:3254551"
     mRNA            join(239324..239582,239665..239817,239877..239965,
                     240019..240098,240148..240264,240315..240438,
                     240491..240640,240693..240792,240850..241075,
                     241131..241247,241307..241667)
                     /locus_tag="CNK00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_567636.2"
                     /db_xref="GeneID:3254551"
     CDS             join(239392..239582,239665..239817,239877..239965,
                     240019..240098,240148..240264,240315..240438,
                     240491..240640,240693..240792,240850..241075,
                     241131..241247,241307..241387)
                     /locus_tag="CNK00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567636.1"
                     /db_xref="GeneID:3254551"
                     /translation="MPLYALRLVIDHKTFRLPSLLSISQVFGFPIRFVSEDKTRGLLV
                     IELEKDDDMEKILDRETLVLSAAEVYAEGATYEELHAQLKSKLHVLDPYKHSSFKVII
                     ESAHHSIPEPRQIETINSFKYTGLEGKIRLKNPEVEFIVYEDYDWVAANTPEQRLARD
                     GKFHRVYFGRKIGNGRARQLIISHSVKTRAYYGNTSMEAQMGFLMANQALPAPGKLIY
                     DPFVGTGSMLYAVAQFGAYVMGSDIDGRQIRGKKKGKGIKPGILRAAEQYGLQDKFLD
                     FYIFDVTRGPIRRGGWIDAIITDPPYGVRAGAKRLGRKEGKKPLREEPYQLPDGTYSH
                     ERSDYIPPSRPYELANLTLDLILLARWILVPKGRLVFFLPTVNEDYDEIDIPKVEGMR
                     ELKIGDGSVQDFGKWGRRLITMEKTALDDGEPPMFEDHEEFKEGAEDLPGHFGFYKRY
                     LSGFKPNSNSASPDPSTSMAKSRDT"
     STS             239861..240651
                     /locus_tag="CNK00740"
                     /standard_name="Hind11"
                     /db_xref="UniSTS:470689"
     gene            241758..243256
                     /locus_tag="CNK00750"
                     /db_xref="GeneID:3254580"
     mRNA            join(241758..242051,242104..242232,242277..242509,
                     242567..242662,242717..243256)
                     /locus_tag="CNK00750"
                     /product="protein phosphatase type 2A regulator, putative"
                     /transcript_id="XM_567637.2"
                     /db_xref="GeneID:3254580"
     CDS             join(241827..242051,242104..242232,242277..242509,
                     242567..242662,242717..243122)
                     /locus_tag="CNK00750"
                     /codon_start=1
                     /product="protein phosphatase type 2A regulator, putative"
                     /protein_id="XP_567637.1"
                     /db_xref="GeneID:3254580"
                     /translation="MQPHTQPPQPEASSSRAVHIPSDPAPPRPCLTNDAIVSRWQSSP
                     GFQYFWAWIKRRCDRLKGKEIIRGPFDHSAHGIRSLMNMLDQMTSWVEDATPQPQSNQ
                     RFGNLAFRTYNKLLQERLPPLIDSWDIPSNLRSQLLPLFINSHAFGHPTRLDYGTGHE
                     LAFVLGLWCCVVPGWVGGDNGTEEEEDELILRVFTRYLELTTFLQKTYNLEPAGSHGV
                     WGLDDYCFLPYLFGSAQLLGSNLTPSASLSLALSHHPSATSPPSAPITDLYTLSLHHL
                     TLFKFGASFSEHSPLLYSLSQMPNWVKPHGGLKKMFLGEVVGKRVVVQGIWVGGWCWG
                     EDVPNVEERGDKNEGKGTDAGTKAPWAR"
     gene            complement(243136..245556)
                     /locus_tag="CNK00760"
                     /db_xref="GeneID:3254411"
     mRNA            complement(join(243136..243475,243711..243920,
                     243984..244097,244152..244396,244453..244484,
                     244534..244722,244778..245183,245239..245556))
                     /locus_tag="CNK00760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567638.2"
                     /db_xref="GeneID:3254411"
     CDS             complement(join(243468..243475,243711..243920,
                     243984..244097,244152..244396,244453..244484,
                     244534..244722,244778..245183,245239..245468))
                     /locus_tag="CNK00760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567638.1"
                     /db_xref="GeneID:3254411"
                     /translation="MGLASKLAASHNQAGVGAGAAPAGAPSQQAPQQQQYGQQQQQYG
                     APQQQFPTPQTYGAPQQQQYPPPSSAPPVPGSRPAAAPTQGQYASTPSQYGQAPGQPQ
                     SQYGQQAGQYGQPQSQYGQQPGQYGQPQSQQPGQYGQPQSQYGQQAGQYGQQQGQQQG
                     QYGQLPSQQYGQQPPAYGAPGTGAPPPPSGPAGANNSNPQYLLSLLQQCVQDQNLQAF
                     YPPGSLEPIAQRVAQSGALNKIAQEWRLPLELASDLVKLSLFDVILYIDDSGSMAFEG
                     GGERIDDLKLILSRVAFATSLFDHDGIQVRMMNSRVEGNGITSEAQALQLIQQIKFSG
                     LTPLGTSLWQKILQPLVLAPAQQGRLQKPVVVVTITDGSPAGEPKEEIFNVILRADAE
                     LKRSRYGPDAVSYQFAQVGDDLKAQKFLEELDNHPVIGSLVDCTSNFEAEQEEMMRKS
                     GVNLDPSMWIVKLLMGPIDTSYDTKDE"
     gene            complement(247006..248744)
                     /locus_tag="CNK00770"
                     /db_xref="GeneID:3254541"
     mRNA            complement(join(247006..247323,247372..247603,
                     247652..248189,248242..248542,248595..248744))
                     /locus_tag="CNK00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_567640.2"
                     /db_xref="GeneID:3254541"
     CDS             complement(join(247320..247323,247372..247603,
                     247652..248189,248242..248542,248595..248626))
                     /locus_tag="CNK00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567640.1"
                     /db_xref="GeneID:3254541"
                     /translation="MPTPLSRQTESFNSSTGTIVPDRRGPARNTRSAAAAAAAAVDNA
                     HTLTLSQSSQSTQVSNASQSSSRALRPQSSLERRINSVIGVGGGDDGLMGMLQMQDVP
                     SNSLAGWSFLGDSQPKINQAQSADQEHRVEEFLKNIDVGPVPSPMPSDSPYDRPIRLQ
                     HPPVDSYRPSTAASWHSASSSVDHSELYSSTDVDTEDEARSAIIGHSNVGDLGLGGMD
                     IDNPQDVERQRSWPTEQAMIALNRAVSPQQLYANSPAPSSTGDSVSSRRRRSNTGQAV
                     SASEDERKRLDRLEHRRDINRRSAQKHRAKRKEEIETMNHKLYVREQRIRELEMLLEA
                     ERGKVASLEGTVQKLLGGLGRSSGSDGSEKVNGR"
     gene            248928..251260
                     /locus_tag="CNK00780"
                     /db_xref="GeneID:3254696"
     mRNA            join(248928..249153,249218..249517,249572..249887,
                     249937..250413,250467..250892,250949..251260)
                     /locus_tag="CNK00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_567641.1"
                     /db_xref="GeneID:3254696"
     CDS             join(249085..249153,249218..249517,249572..249887,
                     249937..250413,250467..250892,250949..251178)
                     /locus_tag="CNK00780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567641.1"
                     /db_xref="GeneID:3254696"
                     /translation="MINEQKPVVGWIGLGAMGSGMAASLVSQGYKVQAFDVYPPSLKR
                     VAEQGAIPSSSPRDAAEGVQVLCLMVVNAQQVEETLFGKDGGVAEILKNGASIIVFST
                     VPPSFLVEVARRLDKLGKNIGLVDSPVSGGSTRAAQGQLAIMSSGTPSSIATARTVLD
                     SLTLPPQGGLTLVGDRVGIASDFKMINQVFCAVSIAAQGEALGLAKALGLNVRTVYEI
                     VKQTTGDSFMFGHRAPWSIRPDPIPKSAMTIINKDIAIVMGEARRDHFPAPLSAAAEQ
                     LYTAALAVGLEKEEDGLVSKFWEKLGGEPIAEQGTEEEEIEKARELVIKPGKKVQKVL
                     LATKNIDSRISYLKETLKKAGVEVVEQGKEVDAVIVSAGSAAAVEELLLHISSAGLSV
                     NTPVIIISNVLPSSRLSQLAIEIKPLQLIDAPTAGGSKEAKGGSLTVFASGEADALSA
                     SHSILSALSIQGGDSTKLHFIAGGVGSATKVKAVNSLLEAIHLAVTGEGFAFAKHKGM
                     DIEKVFKVLSGGAARSFIMGDRFPRIIKKSSQDAPENTVSTLWNDLSITLAEAKQHKC
                     PFFLTQAAMQQLERLHSSGYADADDSSIIKLWEETGVKI"
     gene            complement(252222..253542)
                     /locus_tag="CNK00790"
                     /db_xref="GeneID:3254421"
     mRNA            complement(join(252222..252681,252748..253009,
                     253073..253542))
                     /locus_tag="CNK00790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567642.2"
                     /db_xref="GeneID:3254421"
     CDS             complement(join(252276..252681,252748..253009,
                     253073..253445))
                     /locus_tag="CNK00790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567642.1"
                     /db_xref="GeneID:3254421"
                     /translation="MSTTITIDLLIIGGGPAGLSAAITFSRLRRSCFIYDSGDYRNAP
                     ASHSHTILGFEGQDPVDYRAKVRSELVRDYNATTTFRKGQIISLVKDGEYFEAKDAEG
                     NTLKARKVILATGLKDHLPDIAGVSEQWGKRIIHCIFCHGTETANQPFAFLFTPNNAK
                     MNPFLVAGMLKLWGAMNHQPIYILTHGSDVSTEEGRREAGLETYWKIIQNKGYQVISS
                     PIQSIKEDDSKSSLIIKFADHPSISVPYMLLFPEKFTPSDHGAPIVNEKLLGGPLGPM
                     GTIPAPTESSGAPKMPPRMGDDPRTPVDGLFWAGNSGSMPANVTISAAQGCAAAIVAA
                     DELGTEDLVKLA"
     gene            253937..257007
                     /locus_tag="CNK00800"
                     /db_xref="GeneID:3254628"
     mRNA            join(253937..254296,254356..255139,255188..255267,
                     255322..255684,255736..256022,256077..256616,
                     256671..257007)
                     /locus_tag="CNK00800"
                     /product="expressed protein"
                     /transcript_id="XM_024658033.1"
                     /db_xref="GeneID:3254628"
     CDS             join(254198..254296,254356..255139,255188..255267,
                     255322..255684,255736..256022,256077..256616,
                     256671..256785)
                     /locus_tag="CNK00800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513739.1"
                     /db_xref="GeneID:3254628"
                     /translation="MDDSQAGPSLTAYASRFLANRMGDRGREVQGSQIFRSPSPSSPT
                     HDPFIPSPSLNASHPHLPGSRSPSRSPTRTPPFPGAGIEAIPDIDGTMGASSVGVGLL
                     FDGPEDDDQPKPQESFTQPPVGFGGNKGKERSRIPNPYESSSESEDEDEGEPEMALDE
                     VDTVRRSLLRPHPQQQREPLSERAKKGWLAHQSVFPPSSSSSSDDESDKETESESGDG
                     ESRFTNGGQGLYEGGADSSNLYDTRTIPAAYNVATNLEEPLLAEEDGQRESRVPVRLH
                     VYHGRFGHWEKEGLRKYKDSGFLALWLASLIGIIVGLLFVWGSTDPSPDAPRSPPSIL
                     PLLPLLLILLIPPLVLPPAFLFLLQKTVRPVLMGTAISIPFSLFVCGWWALGASFETA
                     GLDGVEQGDRWWGTTGLRVGALLLWALAGWFGRLVWLRRKRLERAASVVELSTKLLLS
                     HPPLLLLTPILLGVFAITSIPFLTLLIRLGMIGYWRHPRENTWVFHIRPYAGWLIFLV
                     TLVWVWTWGVIRGVGRVAVAGVIGEWYFHREEHSRQDPVEVTTAAVHRATGSSLGSIC
                     LGAGIIAVVRTVGRAASTLKQYTSPKNTRLPSFLSFLHHLAPVFTIIAGVLDQLNGYA
                     LVYVGITGDAFWPSARRAVGLAGRRRVGKLLDYTLIKLLLTLSSTAMGLFTATAGYLY
                     MAHSMGNPGYAPLAGMLCGGVPFLAVRAGAGVLTDAADALFICYQIDRELGGQHSEET
                     KGAFLGEQPRGAGAV"
     gene            257155..261606
                     /locus_tag="CNK00810"
                     /db_xref="GeneID:3254412"
     mRNA            join(257155..258602,258651..259168,259249..259283,
                     259336..259484,259538..261115,261172..261606)
                     /locus_tag="CNK00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658034.1"
                     /db_xref="GeneID:3254412"
     CDS             join(257795..258602,258651..259168,259249..259283,
                     259336..259484,259538..261115,261172..261290)
                     /locus_tag="CNK00810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513710.1"
                     /db_xref="GeneID:3254412"
                     /translation="MSLAEQRSTQGIVQELMEEIRAGSSRNSPTSSTSTIEYIGQVRV
                     TAGSGHRRIHSTPGASASSEVDVRARTLSDGAFAKTTNMLDGGSANPRGRIREAVTAP
                     TSPVMNKPKLTSTSVPGPKEKVEAGTASAAETNDPKQSSSSSLPPSKIPLAFPSTQSA
                     QHEPSASHPQAETSPTTPELRIIKSSVPPPCSLPSSPPLSPTNLSSGDMHPFPVVADI
                     EKNVSPSKKRSGNLPTPSTREKGKGSEIGERPGEGRAQTMRRGFIGPGGVMHKIASSQ
                     SLNKVRTALPFTRNVEAERSSPAILSSKAFSPTTQVQTSSSLNIPNQATFLRPAPPPP
                     RTPSYRQPRQPAFARPSTRISSPSPSPSPHKSLSPGANFAPRQSRPRKGMSSQLPRMG
                     LPEEDVEMIEIPRFKKRELNLGIVRKHPGKQRAAWLALGGLWVVNGLLSLFFDMNVIY
                     ILVQCSIHPSFDTNNTKLWQFAAAAYAILWALSTIVVWLGWELGYEFWRRWRLERPAI
                     EPIYLSLPASLHLSLKSYDHFIFLLHIRTSAFGTAYAKDIIPETCHALIQLLPGLIPL
                     LPRAAIAVVMLISFWKPSADVQAPYGGPVDRTADRDPNFFRSDAPGELTNYSKGVLLT
                     FTMYIAFRLLVVIASAIGLWVSSARPLGGFIGKRFQRRSPVGPAGPSTPRRHHRKSAF
                     QPRDPSLTHSPQKNWVDESSWDWAWKERMRARVQDAFELCIVRLDGDDGIFKQTGETG
                     TGQDVPWAKSSYKATERIPMEEREQKDASYSATNFIGQIIAHESSPSCSLSAIDEFEA
                     TRPESILDPTGDAKVQPSSSRAATNPTSSTNDLFYTPPASITSAAKKESSVADAIVKG
                     GVPLSAYEKPSGWMTEFGVKEEKARETQDCEGSDNESTGLLSAQTSPRESMLFREWSG
                     STASHLSHKMSGDVSQHSHSTTSGTGSGSDKTSTTSIRQSAYTTSHPHVTDLARTRSS
                     SITMIKESLNGVALAAANGSAGLVRRARSGTMLSNGTKGKRYNKISDDEGGEELANDE
                     LVTPRSKHDKTMGLGVPFVYLSPHDDYNHQGTTRNDMT"
     gene            complement(261200..264427)
                     /locus_tag="CNK00820"
                     /pseudo
                     /db_xref="GeneID:36393099"
     gene            complement(264486..265801)
                     /locus_tag="CNK00825"
                     /db_xref="GeneID:36393100"
     mRNA            complement(join(264486..265044,265086..265801))
                     /locus_tag="CNK00825"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658804.1"
                     /db_xref="GeneID:36393100"
     CDS             complement(join(264604..265044,265086..265406))
                     /locus_tag="CNK00825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514639.1"
                     /db_xref="GeneID:36393100"
                     /translation="MSTDNTYPASSSPASDISRAGSYGDSITPEALTTYITSEISRVV
                     RSVDWSSDPESGASAIKGLIEIAGLVKARLQTGDSSPNSKGSGGGESENATGEEATEL
                     SRCKESPTSETSIAASSSSSAQDRSRPPWESATTASTTGKLPPSPAPPESLLPSPTRL
                     PLASPKPTPPSTQPSTTSEKSSSSIIPSSLKIAPSSESFNLSQSAPNTTPSANEWVFK
                     PLTEMSTTIMGLRGDGDRSQWPRGKGRRFPTQGIA"
     gene            265974..268633
                     /locus_tag="CNK00830"
                     /db_xref="GeneID:3254407"
     mRNA            join(265974..266145,266205..266292,266350..266386,
                     266443..266682,266734..267701,267753..268016,
                     268068..268633)
                     /locus_tag="CNK00830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567646.2"
                     /db_xref="GeneID:3254407"
     CDS             join(266078..266145,266205..266292,266350..266386,
                     266443..266682,266734..267701,267753..268016,
                     268068..268229)
                     /locus_tag="CNK00830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567646.1"
                     /db_xref="GeneID:3254407"
                     /translation="MPFNDELDTPAFRAWLSRTIEPLCDADPTVLSDYIVALMKHDAS
                     MTEDEWKTFISRELVDFLESSSGPFVETLFQTLHSKNYDLTQTLPVPAAASHPIPTGP
                     AAEVAPRPSAGPSTMQNGQQKDVIMQEMPVGVSGRRKCRDYHERGYCMRGANCQYEHS
                     ADMLIPTPEMMFQGFLPPFMPGMPGVPIQYQGMQPMRPMAMQVPEFRDNPNGRNRSFG
                     NRPPPSNEGESFEGSSRPPSDHSKTTLLITDIPDANMSVVAIRNYFQQFGTITSVALE
                     GRGNRALVSFASNLEAYKAWKSDEAVFGNRRVKVLWHKPRPGQGAAGQKALEQSKQLL
                     ENLQKMEAGEGPNQGIKPKLSGPETRLQATLAELEHREKQSKKEPLIAEQKVLLKRAS
                     TGTKEEKVQILKRLREITKELDIINNPPPKPESMDVDDAKSRLDRELAAHGMEMGGQD
                     EEELARLNAQLASLKEKANTLGVNASARYSPYSRGRGGRGRGRGGPPRPMRLDNRSRT
                     ILVSGDRFGDEEARRVVQEWYESTGGGVEFVDGSLRITYPQREMAEKALALGTNELRE
                     KAGPIRTAWEPLKPLERYQPSDVEMTVHMGEEELRGEKDDDE"
     gene            268650..270852
                     /locus_tag="CNK00840"
                     /db_xref="GeneID:3254415"
     mRNA            join(268650..268735,268785..269129,269175..269486,
                     269535..269596,269651..269917,269967..270655,
                     270714..270852)
                     /locus_tag="CNK00840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658035.1"
                     /db_xref="GeneID:3254415"
     CDS             join(268930..269129,269175..269486,269535..269596,
                     269651..269917,269967..270655,270714..270779)
                     /locus_tag="CNK00840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513711.1"
                     /db_xref="GeneID:3254415"
                     /translation="MHFVSNTALFAILTALAVRSAPAPQSGTDYTCDSDTQWHDAYQT
                     VTCPGDTVCVTGASGNPCQFPSGYGQSGVVAVAVTSAAAVTSAAAVATSASAAGGVTS
                     ATSAGGISISGNAATSASEEAVTLSSGATATESGGGGSASHTNSAASASGTSTSDGTS
                     VSNRFVTYWDNYANMGGVNAGQLTAVTHVILSFADMTDWATEQTTWKFMESSNGNFDS
                     STAATLKGMQSGLKVCGALGGWGLDSVMATAVRGGDSTIATFVANVKGFADYFNLDGI
                     DIDWEFPSASDDANLITFITQLRAALGDDKLISVALGSRVDTTDAAAFNSDTFSKLDS
                     LVDMWNLMTYDYVNRYSTVTEQQAGNRVVTTVMDYYEQQGITMEKCNVGFPMNAKYFT
                     LTETCDSSNPIGCSLPGTDYYEDSGVDNYKSGWVRFNPDLDSSLGTEGTEWATKMRAQ
                     WEARPTDGSTEITADVSNAWVDETNDVFWTWLSDSDMKTTCQNWVTSGKVGGAMVWSL
                     NQDDESQDGGSHLTALAECIQGS"
     gene            complement(271114..272317)
                     /locus_tag="CNK00850"
                     /db_xref="GeneID:3254588"
     mRNA            complement(join(271114..271436,271500..271735,
                     271796..271947,272017..272317))
                     /locus_tag="CNK00850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567648.2"
                     /db_xref="GeneID:3254588"
     CDS             complement(join(271174..271436,271500..271735,
                     271796..271947,272017..272175))
                     /locus_tag="CNK00850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567648.1"
                     /db_xref="GeneID:3254588"
                     /translation="MTVANVATAHTTTVQNPRLRLLNALRSKTPALMTFIAIPSVRHA
                     QIIALTGLDGVIIDCEHGHIGDDQMHNSVSAISALGVSPIIRVRGPQPDILKRALDTG
                     AHGLMVPMINTAKEAAAVVTYSKFPPYGLRGQGSAFPAIGHGLTTPEYMKTANETILT
                     IVQIETKQGVENVEEIAAVPGIDYLFIGPNDLAQSLLGYTPARGDEPVFVEAIDKIVA
                     AARKHGKWVGRLVNDGPLAVDALKTFDSVAITGDTKAITNWYTAQIDCVRN"
     gene            272493..274900
                     /locus_tag="CNK00860"
                     /db_xref="GeneID:3254422"
     mRNA            join(272493..272906,272955..272986,273042..273209,
                     273270..273564,273620..273815,273869..273941,
                     273999..274099,274160..274457,274523..274900)
                     /locus_tag="CNK00860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567649.2"
                     /db_xref="GeneID:3254422"
     CDS             join(272701..272906,272955..272986,273042..273209,
                     273270..273564,273620..273815,273869..273941,
                     273999..274099,274160..274457,274523..274689)
                     /locus_tag="CNK00860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567649.2"
                     /db_xref="GeneID:3254422"
                     /translation="MTSPTTTRPPMPPSPKSSFDEPKEDVVVELRGVDAKYTKPIPEN
                     IRNLSADELKAIEKRIVRKADMVMMPIMGLLYILNYVDRQNLASAKLQGIMTDLNMTT
                     QQFATAVSILFVGYLPYQIVSNVLISRISRPGLYICIACAIWGVLSACTAAVKSYGAL
                     LAVRIMLGFVEAVFFPGAIYLLSAWYTKNELGKRIGGLYIGQQVGNAFGGLIAAGCLK
                     LDGVHGIAGWRWLFIIEGAATVGAALLCAFVLPEYPYNARLLKPLEREVAVWRLEIEA
                     GAAEGNEKVGAWAGFKEGFHDPKLYALIFFNMMSQTQGSIANFFPTIVQTLGYSSIIT
                     LLLSAPPYVFAGGYYMGMTWISDRYNIMYPLIVINICLAIVTYIIPMATLSIGGRYTA
                     MIFMPCTSVGPQLLLYKTINHHMPRPVAKRAAAIALMNAIGGTSNIWASYLWFSGPKY
                     YAAFGTFIGAAVLFLITITAYRFYVRRENRLLDGTPEEVARVMKRGVTQEQVDMGWRY
                     EGY"
     gene            complement(275262..276277)
                     /locus_tag="CNK00870"
                     /db_xref="GeneID:3254648"
     mRNA            complement(join(275262..275467,275529..275657,
                     275731..275804,275861..276277))
                     /locus_tag="CNK00870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567650.2"
                     /db_xref="GeneID:3254648"
     CDS             complement(join(275369..275467,275529..275657,
                     275731..275804,275861..275912))
                     /locus_tag="CNK00870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567650.1"
                     /db_xref="GeneID:3254648"
                     /translation="MSRELISSAEFPPKPHNCPAVKVPGLVFCAGQTATGEIKQATHT
                     VLSNLQKVLELAGSSLDKVVKYNVYLKDMKDFAAMNEVYIAFLPPNPPSRTCIQAGDL
                     PGEGTIIEIECIAQA"
     gene            276426..278512
                     /locus_tag="CNK00880"
                     /db_xref="GeneID:3254536"
     mRNA            join(276426..277149,277207..277332,277401..277523,
                     277581..277967,278022..278186,278247..278512)
                     /locus_tag="CNK00880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567651.2"
                     /db_xref="GeneID:3254536"
     CDS             join(276904..277149,277207..277332,277401..277523,
                     277581..277967,278022..278186,278247..278405)
                     /locus_tag="CNK00880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567651.1"
                     /db_xref="GeneID:3254536"
                     /translation="MTATPAFNPPAANLPGKPYVRPWIPPPVTKETHNFAKLSSIKLS
                     LMDSDDPEVVDNLVQQVKGAIREDGFLFLEDYGVSLEQLHRQFALAQYLYDNIAEEDK
                     EALLFHPDTGRWAGYKHPYGFKRHKGTKDGIEQFNWYTAEWDDINRVPKCLHPFMDEI
                     RAFAEYLTGSVNRRLLTLFSRVLELDDDYLWNNVQSHGSPTGEGYFRHALFRPVEKST
                     DEASKGLRMHGHTDFGLTTLLFSVPVSCLQIWGKDEQWYYVPYNPGSLVINIGETLEI
                     VSGGHFKATRHRVYRPPADQLQTERLSLVLFNSSVGDLRMTPAAESPLIKREGCIEEQ
                     GVYKEFKRVMDLGVPVPTNRQWREIQIAEATDPTDTERNRVGADQVIVNGKLMQTREY
                     MGVKVLLPV"
     gene            complement(278698..281362)
                     /locus_tag="CNK00890"
                     /db_xref="GeneID:3254484"
     mRNA            complement(join(278698..279086,279140..279804,
                     279854..280759,280823..281362))
                     /locus_tag="CNK00890"
                     /product="early growth response protein 1 (egr-1),
                     putative"
                     /transcript_id="XM_567652.2"
                     /db_xref="GeneID:3254484"
     CDS             complement(join(278738..279086,279140..279804,
                     279854..280759,280823..280891))
                     /locus_tag="CNK00890"
                     /codon_start=1
                     /product="early growth response protein 1 (egr-1),
                     putative"
                     /protein_id="XP_567652.1"
                     /db_xref="GeneID:3254484"
                     /translation="MLSDQGKLQPFKCAVCLRRFTRMENLKRHSKLHDDTSERPTFPC
                     GRCTATFSRADLRRRHLASKHGEEKSTSRSPRELPSVSSGVNESHERRESVSVTNFSP
                     IITAQPISITSPRPLPSALEAALTFDFGVNEFSSDATWNSTQEVDNSPSRHTSQSQTS
                     ASSIPNYHAHSSIGSISMTSVDLQARLSQSPLSAIPPSVEEAIQNPAFIFASLESFFS
                     HAAHIFPFIHRATFDARSCHPSLLFGMMCIGLHMKGEDSGDVDQQRAIYCYKAGLRAL
                     DGVMEITQEKSTDTLTTIQAHLLLEMYAIMALCGSHTMQGLRLHSQCVELSRKAGLME
                     SYPTKPSVTQDLDSLWRQFVRAESHKRTLYSLYGFDSAWYHFLSRPRCLSHLEIKHEL
                     PCGNDLWNACTPTEWAHRSLIASSLCSRDDSSSTRMRFLDMVRAAFVNQVEDPLPLPL
                     DSTGASLMTHFVLASVREMTGWTTMTGRSCFERFEALLASMVRLEPLVTVQNAKLETP
                     ASAAAEATWRMSMIELLLWSQSHTGGLVEDSIDAALAAITTLGANNPIELTAQIIQSV
                     EQHITWFLLYLQRTSSPTSPSLQSESPLLTFYLFKATIIAWQIVKSGGSSPLEVVGVE
                     DEEGLLNWMKKMFRMRKKWGVGRSAMRCLGDLHVQNVL"
     gene            complement(281537..285853)
                     /locus_tag="CNK00900"
                     /db_xref="GeneID:3254429"
     mRNA            complement(join(281537..281908,281961..282097,
                     282151..282171,282221..282271,282322..282389,
                     282443..282583,282647..283349,283403..283532,
                     283581..283745,283794..283805,283858..284002,
                     284056..284172,284237..284288,284342..284393,
                     284443..284599,284655..284771,284831..285001,
                     285060..285349,285742..285853))
                     /locus_tag="CNK00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658036.1"
                     /db_xref="GeneID:3254429"
     CDS             complement(join(281672..281908,281961..282097,
                     282151..282171,282221..282271,282322..282389,
                     282443..282583,282647..283349,283403..283532,
                     283581..283745,283794..283805,283858..284002,
                     284056..284172,284237..284288,284342..284393,
                     284443..284599,284655..284771,284831..285001,
                     285060..285349,285742..285762))
                     /locus_tag="CNK00900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513712.1"
                     /db_xref="GeneID:3254429"
                     /translation="MPSKQAFKPPKPVQGAKTAAATGKSSTKGKQPLRQAVTTQNAKQ
                     ALSQSQSQAISQAQGPKSKNSLELQSAAVKQDLSTITHQESLVIMRTTLGASLGAICY
                     LRRLLPDDSFSDTYMTDSIPLPGKSADQQYQMSQPDPNGSQQPGGGKGFKYPRIRGDG
                     SPEGAKILKFVEEGVMDAVSKGYLRSFMFIIFLDKDDPQNIVESYTFNFFYSGPSNIP
                     SIDMTHQVAGEDSSTDTPGIGDPRTHQDVRRSVKTLMKTLILSCQKLTDLPRQRYVDF
                     KLSYNENAPKGYEAPGFRDCTEDPLFMCTSDKDTGPTDVTMGKTTTGSHGVSVTTQSI
                     VQLLPARTDSDERKASGEKDDPEKERAEQLEAAEKRNVAWSADLPVYDRKAYEQPDDI
                     YDVLKRPLGTLLADGNILPFSMPDASSAEKNVTGKKRAHQTLEEEIMELSQAQVTQPP
                     VSQTRRRASSRASIARRRSQTAFDFDADGETDYCGSMAIIPPAPAQTAPCRSKGSTSA
                     IFADQNSSASEDGPNSKSAPKSAPMAIENDTDETQECGALRSKSVNQLSERPKKAQKT
                     NNNSSPADTDQANKENANAKLKKPNKSETPKAKADKSPKFASSSKSNSRSRPSATPTS
                     TPQKPKDSTPRKRSTPPARRMLARTVEAARTSPLKKKTSRKTASRTDTHLVEANEDKI
                     NCFCGADDEQDGSMQCDGCRNWVHCPCVGFSELKAAAQVDNWYCLICKMERIEGQKWT
                     KLQLQRAREGMSKLALFRRALLTVRQQGGIGKAGPLRDVLGCSVNALAIICKQLYSEG
                     FIDAPFGSRKKKGAFYKWVQLPEINERFLGYFKPNGGVERELFEFYKDQSSDPMEEDN
                     EEPSSQTTQVNPDADEVSVPKALTSSLAPPNTIKTPFGTFIPSFDGQPISLYSVLAIR
                     SSRAESPIELLEDW"
     gene            complement(286039..288234)
                     /locus_tag="CNK00910"
                     /db_xref="GeneID:3254667"
     mRNA            complement(join(286039..286318,286378..286473,
                     286542..286852,286907..287099,287149..287265,
                     287315..288234))
                     /locus_tag="CNK00910"
                     /product="tbc1 domain family protein, putative"
                     /transcript_id="XM_567654.1"
                     /db_xref="GeneID:3254667"
     CDS             complement(join(286151..286318,286378..286473,
                     286542..286852,286907..287099,287149..287265,
                     287315..288226))
                     /locus_tag="CNK00910"
                     /codon_start=1
                     /product="tbc1 domain family protein, putative"
                     /protein_id="XP_567654.1"
                     /db_xref="GeneID:3254667"
                     /translation="MTHPIQPPTRPHSANPLTLNPSLSIFPRPSSRPTIPRGAPMSSF
                     GLVTKDAEDWEDAWDSSSDKEDGGEPSGMPMSMPGGGRKSRDDGEGIAASWASTSYTH
                     VTYPNSSPTRPALPQSKTFTEGVAPPAPGTSAINGALRSHGHGHAGGSRLPPGGAWEI
                     VEPEEIIEEEQEPIKTGKEAVRVDVENILRDPLELLHSLSLDSPAISRASSRSSSFPF
                     FASNDPLSSAPASPSYTPTTPTAATNMKSRKDGMNRQRSVRSERRREKFAKVLRGDEG
                     GVDVGELRRLAWSGVPMEVRPIVWQLLLNYLPLPVQPRLTTLNRKRKEYTQLVDQYFG
                     RGLSSLDQQIWHQIEIDVPRTRPGVPLWSCEKTQRSLERILYVWAIRHPASGYVQGIN
                     DLVTPFFEVFLSAYIDTDPESFDISHLPESILSAIESDSFWCLTALLNGIQDNYISQQ
                     PGIQRLVKRMSELIKRIDTPLATHFEEQGVEFMQFAFRWMNCLLMREISVKCTIRMWD
                     TYLAEGTDAFSQFHLYVCSALLVKYSDRLREMDFQEIIIFLQRLPTQNWGDHDIELLL
                     SEAYVLKTVWQGAENHFKDLPPGGGGFGMLGR"
     gene            288355..290893
                     /locus_tag="CNK00920"
                     /db_xref="GeneID:3254420"
     mRNA            join(288355..290105,290174..290273,290326..290893)
                     /locus_tag="CNK00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_567655.2"
                     /db_xref="GeneID:3254420"
     CDS             join(288633..290105,290174..290273,290326..290783)
                     /locus_tag="CNK00920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567655.1"
                     /db_xref="GeneID:3254420"
                     /translation="MQDEQPPQGNAGMNEDTPMHTPTSPQSNSASGASHHPQSALPLC
                     LPRFTTSTNAFGLTSSPSSSSSSQRSNDYFGSVSGSSMVIIPGMAAAAASDRKVRRPS
                     MLSLAQNASFLSEGSGEGERTPMALVVDTAGERDKRGAMDMVEDPSSSKAISQFTGDG
                     GPLQPTPRWPSSGSFQSSLLRRSTSTSTIPMETLKTSTPVQIESVDEEARGNSEVEMA
                     TDWLNKSSNRKGKAREGSPSNHDTKLHPRPLPSALLQTLISESAPLEHEIQSEARLQR
                     LLSSHPAKLPLTPRAPRGSRGRFPDQVGGDDDDDELGLSAFSAAARRWGTGRPWSKED
                     SDSDSDDGLPAGEVNAAFAAGMDMDRPESSSSNANTMGGGWGAMSESGKSTPGQGERR
                     RSNSGSRSGSGSAGPGAGTGAGYPFPNTMSTPGMSTPGAGSQVQTQGQGQQPISAIKG
                     SSKLSMSGMVPSPGNGLPNAFGGLGMGTGTPLASPTVERNELVGSPNAPMSSPGLMQY
                     RESLGGSASLRPNKRKAQEDRFDPYKRPRAASPSLLSSPAFPLSPSRPTSIPIPASPS
                     HAPLYPSALSTSHPRSVGGVGAQTHPSSSRPNHPYTRPMASRSRAASPALSAGSGGTS
                     LGRERYLGQHVQNGNNGHGGQGALGGLGLLSLANRVREEDEKEERGERMEED"
     gene            complement(290877..295814)
                     /locus_tag="CNK00930"
                     /db_xref="GeneID:3254392"
     mRNA            complement(join(290877..291001,291054..291130,
                     291182..291319,291369..291463,291519..291569,
                     291622..291732,291787..292177,292236..292338,
                     292397..292525,292579..292663,292720..292753,
                     292806..292863,292913..292925,292981..293099,
                     293154..293197,293253..293277,293325..293413,
                     293476..293535,293596..293717,293771..293876,
                     293937..294135,294190..294225,294275..294360,
                     294416..294494,294548..294752,294801..294937,
                     294991..295076,295135..295271,295327..295458,
                     295518..295814))
                     /locus_tag="CNK00930"
                     /product="DNA ligase (ATP), putative"
                     /transcript_id="XM_024658037.1"
                     /db_xref="GeneID:3254392"
     CDS             complement(join(290985..291001,291054..291130,
                     291182..291319,291369..291463,291519..291569,
                     291622..291732,291787..292177,292236..292338,
                     292397..292525,292579..292663,292720..292753,
                     292806..292863,292913..292925,292981..293099,
                     293154..293197,293253..293277,293325..293413,
                     293476..293535,293596..293717,293771..293876,
                     293937..294135,294190..294225,294275..294360,
                     294416..294494,294548..294752,294801..294937,
                     294991..295076,295135..295271,295327..295458,
                     295518..295793))
                     /locus_tag="CNK00930"
                     /codon_start=1
                     /product="DNA ligase (ATP), putative"
                     /protein_id="XP_024513713.1"
                     /db_xref="GeneID:3254392"
                     /translation="MAVHAPYNHAPPPTQEINGQKPTLAPAITLERPADCINRGQYPA
                     FYIICGYLNRLRADAPHKKYELLTRIFGNWREKVGPDLYPLIRLLLPDKDRERPVYNL
                     KESMLARCYIDILSLEKHSEAAQRLIKWKQPAGNSPNPTGDFAKVCYNEIKARSTVEE
                     GQLSVEAVNMLLDKLAVGKMKQKDYVPILKAINMQCTAEEQEWIIRIILKDLHISIRE
                     RGVLSAFHPDAIDLYNVCSDLKRVCWTLYDPGFRLNKNETHLELFHSFLPQLCGRMND
                     ASLENIAKAIGAPKEFIMEEKLDGERIQLHMRGNGAQWFYCSRKAKDYTYLYGAHPGE
                     GSLTRYIATAFQDNVRNVILDGEMMVWDPVVERYLAFGTLKSAALDHFNDETAPRPCF
                     KVFDILFLNDHCLSRKRLSERKRLLRSGKIFKNIENYKGRLEFVDEKRGKNAKDIREY
                     LERVVETKGEGLVVKKTDVIYQTNSRGYDWIKVKPEYSDQMGENLEVLVLGGWWGKGG
                     RSGKISRLLCGLREQAFDDGTVERPSFKTFCSIGSGMSYSDYEWILNKHKKHWRPFDR
                     SNPPPFMKLGPVGLDDKPDVYIEPENSFVIEVKASEIVPAGGYGIGFTLRFPRCKYIY
                     YDKNSRDYALDDESKERDMWTSMSVDDFMDLFSRPKRSYDDSQGPGKRKKRKVIRSKK
                     NHLISNFRGQKLSDADVETSIFSDMTFFIVKGTSDYPKADLEALVHKHGADFTQAQLS
                     DLSAIVISPDQKNPLVRAQIRHGVNVIKPEWVFESIARRTALPFLKEFLVFASEEAQD
                     GRYYNKTLEQYDKVSFVRDRTGGALVDEDGDADVEDEIMDGEDKDEIDVEESRESKNR
                     RMAREDLKEKESNRTLEQKKLQEAWGLRSRASPGDSDSEPEEEMSLKEESDTDSERSR
                     GLRAIYEDEEDGENDSHESDVGVNGDDYRAVPLSGLNDKEEGLMGESPEAMHYDEDRI
                     FYHLAFYIDTAKNAAVNGLESSSPSFDTQERLVKVEKLLIENGGRVARSISDPKLTHI
                     IMDDEDSRRYVELTRKTAMPKRKHIVTPKWVEDCVDEETLLDEDLYKPK"
     STS             294166..294922
                     /standard_name="Hind30"
                     /db_xref="UniSTS:470690"
     gene            complement(295928..297536)
                     /locus_tag="CNK00940"
                     /db_xref="GeneID:3254423"
     mRNA            complement(join(295928..296746,296792..297536))
                     /locus_tag="CNK00940"
                     /product="hexaprenyldihydroxybenzoate methyltransferase,
                     putative"
                     /transcript_id="XM_567782.2"
                     /db_xref="GeneID:3254423"
     CDS             complement(join(296390..296746,296792..297469))
                     /locus_tag="CNK00940"
                     /codon_start=1
                     /product="hexaprenyldihydroxybenzoate methyltransferase,
                     putative"
                     /protein_id="XP_567782.1"
                     /db_xref="GeneID:3254423"
                     /translation="MNRQQLCRRLYFSRSATAFPSTRIAARSITTASPASPASPASPS
                     TAPSTFSTINASEISHFSKLSSQWWSETGEFALLHRMNPVRVEWIRQKVALAPPPEEE
                     WSFETRHMDAQREAARGTGAWLTGLRCLDVGCGGGILSEALARLGATVVSVDASESNI
                     GIATTHANQDPYLAKKMEKGELEYRFSTAEALRDAGEKFDVVCSMEVLEHVDEPGEFM
                     KCLGEMVKPGGHLLLSTISRTPLSHLLTITLAEDILRLVTPGTHTYRKFIKPEELRRF
                     VYSDMGGFKTWHRNDDASDIRENEVGETRGIIYDPLKGAWRLWDGVEGSWWKEAGEVC
                     NYMYHAKKRS"
     gene            297582..299767
                     /locus_tag="CNK00950"
                     /db_xref="GeneID:3254413"
     mRNA            join(297582..297965,298019..298082,298133..298242,
                     298304..298417,298471..298609,298687..299367,
                     299429..299570,299634..299767)
                     /locus_tag="CNK00950"
                     /product="Pol II transcription elongation factor,
                     putative"
                     /transcript_id="XM_567783.2"
                     /db_xref="GeneID:3254413"
     CDS             join(297631..297965,298019..298082,298133..298242,
                     298304..298417,298471..298609,298687..299367,
                     299429..299570,299634..299722)
                     /locus_tag="CNK00950"
                     /codon_start=1
                     /product="Pol II transcription elongation factor,
                     putative"
                     /protein_id="XP_567783.1"
                     /db_xref="GeneID:3254413"
                     /translation="MIAPTTSQSELHLLCVSAVVRDLISTYNSSSSSATQPPNVNSLR
                     AKYAKKYGLKAVPRLTDVLAAVPEEWKDRLRGWLRAKPVRTASGVAVVAVMCKPHRCP
                     HVAMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVNQLRDL
                     GHSVDKVEIIIMGGTFMSMPEDYRHKFIAGLHNALSGHTGEDVDEAVKFSEQSKVKCV
                     GITIETRPDYCLKPHLSQMLRYGCTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHMS
                     KDAGYKIVAHMMPDLPNCGTERDIWQFQEFFENPAFRSDGLKLYPTLVIRGTGLYELW
                     RTGKYKNYPPNALVDIVARIMALVPPWTRVYRVQRDIPMPLVSSGVENGNLRELALAR
                     MKDFGAECRDVRYREVGLHEIHHRVRPRDIELIRRDYAANGGWETFLSYEDPQSDILV
                     GLLRLRKCSEEGTFRKELVGMQGGCSLVRELHVYGTAAPVHSRDPKKFQHQGIGTLLM
                     EEAERIAREEHGSGRIAVISGVGTRDYYRRLGYFLDGPYMVKDLLYDDE"
     gene            complement(299775..302624)
                     /locus_tag="CNK00960"
                     /db_xref="GeneID:3254559"
     mRNA            complement(join(299775..301432,301505..301794,
                     301852..302356,302408..302624))
                     /locus_tag="CNK00960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567784.2"
                     /db_xref="GeneID:3254559"
     CDS             complement(join(299873..301432,301505..301794,
                     301852..302326))
                     /locus_tag="CNK00960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567784.2"
                     /db_xref="GeneID:3254559"
                     /translation="MLRTDFEQPIREIPNKVVAWRRIGDQDANLDKTLRDYEKVSAKL
                     EKASSKSKSSKVDALQSDINNITHALSSLSPMVYTTYQRLDEERLRALKEIIVRWATV
                     KGDMASRDGQRAEAIVSHLLQWETSDEVMDVGRKLGAIGGARVPERSASVATSATTPQ
                     SNRRLSAVTSTTATHGDFSPRPPAARANGSSTNVSQGTPGSSFTGGFKSMLARSKTVG
                     GGRNRGESDATSTRSGTRGDNFEAIGEEAPQLRESSTAPPVDEEGFSVAPSDRHRNPW
                     EDPNELIPTPAGQTVPSQAQAPVVPTKEAPASAPAFSQPFDSSPNASDENLSTPTSLQ
                     QQPFKNLSLAPLPIQESEEERRAALEKMQKTLQLPPSQPSRRSTIARGRRDVRNTMFA
                     GSTDEATAASNAVFGAGAVAAGGFANGASKSAEPEEKLVDSPTSTVHTGVSLPHDMPS
                     PSPIAARRTSLSSVTSNNPFDSPTIGLGGTMTPPINLHTTTPLSAAAAADQPGLRAHV
                     NESINVIFRNKQVQRIHITGEIHLSLRAKDASSSSPSALPGGPIHIRLAAFEHLEKIA
                     PNPAYLAQVPDKPGEYFLNSDVLAAATTARGSAAGPLLFKYVVHVQPGKELATAPLIL
                     DPVFQCKSGETRMILHYSANPSSPLATTGTQLGSATVVAAFTPGGPSVSNVQAKPAGG
                     VWSPSTRRMTWKMDSLLGTTGGKVIAKFTSEPGQEALVPQVVQVSWAAEGSLISGLGL
                     DVVDGELEGNQWVFEEIRKSTTTGKYLAEPVVTP"
     gene            302903..303904
                     /locus_tag="CNK00970"
                     /db_xref="GeneID:3254695"
     mRNA            join(302903..303079,303128..303239,303282..303589,
                     303640..303750,303804..303904)
                     /locus_tag="CNK00970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567785.2"
                     /db_xref="GeneID:3254695"
     CDS             join(302936..303079,303128..303239,303282..303589,
                     303640..303750,303804..303830)
                     /locus_tag="CNK00970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567785.1"
                     /db_xref="GeneID:3254695"
                     /translation="MKVFSISLLAVAQTAPPTATLLGTAQDLSSFTFYQRSSVGEFLT
                     FFTKTVAERTPANQPSSVEENNHKAHVFVTAGRTPGGPGLAAVMITDLEYPLRPAFSL
                     LTKILDEHTALLASLPNQSAAPSFGSASANAFGGNPSQAAAGGLPPAQKGKLEGTLAN
                     YLTKYQDPKQADTIMKVQKELDETKVVLHKTIESVLERGEKLDNLVERSNALSAQSKM
                     FYKTAKKQNSCCVVM"
     gene            303934..306174
                     /locus_tag="CNK00980"
                     /db_xref="GeneID:3254410"
     mRNA            join(303934..304029,304080..304182,304241..304490,
                     304582..304671,304734..304847,304899..304952,
                     305004..305945,305996..306174)
                     /locus_tag="CNK00980"
                     /product="expressed protein"
                     /transcript_id="XM_024658038.1"
                     /db_xref="GeneID:3254410"
     CDS             join(304023..304029,304080..304182,304241..304490,
                     304582..304671,304734..304847,304899..304952,
                     305004..305945,305996..306055)
                     /locus_tag="CNK00980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513765.1"
                     /db_xref="GeneID:3254410"
                     /translation="MPAEVVVISDDESDQEIHLVACKPILSHSLPALAPASAAIVIDS
                     DSEDGIDSDSEDGIETDDDDDDDGENQDILGLLSQMADHSGLRAPTRTQSTSVLETCR
                     ARTERGSSRTFAGSILSQVDSLDKTKSKKRASSGDDSSVQKRSKIDDTNGLTREEMAA
                     IKASEKEAKAAQKAKEKEARQFERDTAKAAKEAERSYQRKVAQVNKLRTSKQDALREI
                     HLYLSADMCLPSSPIAGALPEIRHRIQDCQSALCFLPEPDSPIPGAIRFKRHLQARWD
                     PGSKRFVPLDDPRWVWEKTVLVLITAEELVDKVADGGDTLGQWASDVRLLLGLATGDQ
                     VVLMIKGLQKYYSKSRSLANKDYINAARAGLEGGSAATATPITFRRPTREQIEAEMVR
                     LQVAEHFFLVHVEKTEDVEDWVYNIAADIALRPYKLIAKSHLNFAPAEGSRKALQPTA
                     VLELMLQEVQGITPSAAAGITEKYPTFRRLMEAFEMEEQRGGIERAEMMLQYCEVRNL
                     KSGHASGRNLNKALSKRVYNAFRGTDSLSLA"
     STS             304130..304378
                     /locus_tag="CNK00980"
                     /standard_name="ACG23"
                     /db_xref="UniSTS:470692"
     STS             304181..304380
                     /locus_tag="CNK00980"
                     /standard_name="CGT4"
                     /db_xref="UniSTS:470691"
     gene            complement(306146..307566)
                     /locus_tag="CNK00990"
                     /db_xref="GeneID:3254428"
     mRNA            complement(join(306146..306613,306700..307115,
                     307183..307566))
                     /locus_tag="CNK00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658039.1"
                     /db_xref="GeneID:3254428"
     CDS             complement(join(306228..306613,306700..307115,
                     307183..307430))
                     /locus_tag="CNK00990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513766.1"
                     /db_xref="GeneID:3254428"
                     /translation="MASASTSKGSAKKSKSRAAPSVKPDIASQVDSASSDDDSGSGSD
                     DSTDGESVDSDQDLENVEPRRNKGKETAKKSTASAGSFDKYKPPAGMTELGITAEFVK
                     SEFEWDALASRPGIELWAIRAPRDLKPSRLSALSIPVPKKDEPLTGNLKTKSQSYILR
                     TAGFTGSSSSSKAGEQGQGLVDSLGMGDGEGVDQLAEEGGEEMGGLRLLVPRVKEHGK
                     LLVAPLPISRHLILTPDFSAESSSDADADTEPIPDFLREAAQQASSATPAKRAQPTHL
                     MKFRNHTYGFNTPGPEKTSKKLRGEVMEVEQVEREAAPASKVVAVENKKEKKRKTDKD
                     DSPAKAKKKAKKSKD"
     gene            307624..310230
                     /locus_tag="CNK01000"
                     /db_xref="GeneID:3254398"
     mRNA            join(307624..308648,308696..308759,308813..309033,
                     309094..309387,309436..309555,309636..309665,
                     309734..309826,309902..310230)
                     /locus_tag="CNK01000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567788.1"
                     /db_xref="GeneID:3254398"
     CDS             join(307633..308648,308696..308759,308813..309033,
                     309094..309387,309436..309555,309636..309665,
                     309734..309826,309902..309998)
                     /locus_tag="CNK01000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567788.1"
                     /db_xref="GeneID:3254398"
                     /translation="MATSKVKARAAMFEKGAPGTGTPPSFRSIPRTSSTPESPPAEPA
                     PPPATAGRTERFSDVPLTDIAPSAPEIAETLAARGDPAATPPAKEHRSFFAAISPAIS
                     PADHPDTATLHASPGWKSTMSHLLTRSASSTSDPSRAPSPLASASPPTLSPSPAPALH
                     RVESAPTRDRRLSKDLSVYERGREGFEKVRSEMDSAAMEMRRERQSRRTSTYISSADA
                     PAIRTPDTIPETPEEEEVDWTFWGSVVQGYEQVALARPKDLSKAIQQGVPPVIRGAVW
                     QLMSSSKSLDLEEAYKALLKLSSPHEKAIMKDLNRTFPNHKYFKEGGGVGQEGLFMVV
                     KAYSLYDQEVGYTQGLAFIVAALLLNMPDEEAFCVLVRLMDSYNLRSHYTAEMQGLQL
                     RLFQFDRLVEEILPLLHTHFVRKGVKSSMYASQWFMTLFSYRFPLSLVYRVLDIVFAE
                     GIEAVFRFSLALLKKSEEKLVQLDFEEILQFLQADLFQVYRASTENGDGDAGAGDGKK
                     DGHDVEEEEWKANEFVRDAFKIRITPLMLDAYASEWEERCRDQNRHAIELDQLRNANR
                     NLSSQVKQLEASLAAINQEHVELVRRLVMSNIEKEEMENELVRYKMLYAELAHAQQEA
                     LSVHSRLSSSSTADTLKSTK"
     gene            complement(<310338..311271)
                     /locus_tag="CNK01010"
                     /db_xref="GeneID:3254525"
     mRNA            complement(join(<310338..310721,310820..310971,
                     311067..311165,311215..311271))
                     /locus_tag="CNK01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658040.1"
                     /db_xref="GeneID:3254525"
     CDS             complement(join(310338..310721,310820..310971,
                     311067..311165,311215..311236))
                     /locus_tag="CNK01010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513767.1"
                     /db_xref="GeneID:3254525"
                     /translation="MSRTVPTIPRDGRLISLILASKGIEDADERVIHQLLDFSRRYTA
                     DVLQSAQTLADHAARTGASSNRIEKEDVELAIKMRKLYEFFEAPPRDYLATLAHELNS
                     HPLPALPETFDLVRLPPAHQRLAEVNFDIVPDAELVLTEDEREDGEDSEDEEEDDDGG
                     EDGDEDGKPNGEADGEVDGDGEDEDMEEVGVDGLPSAGVAPEAAPVRQAVDVDEDYDM
                     "
     gene            311463..314048
                     /locus_tag="CNK01020"
                     /db_xref="GeneID:3254416"
     mRNA            join(311463..312977,313036..313282,313339..313389,
                     313444..313721,313786..314048)
                     /locus_tag="CNK01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658041.1"
                     /db_xref="GeneID:3254416"
     CDS             join(311496..312977,313036..313282,313339..313389,
                     313444..313721,313786..313854)
                     /locus_tag="CNK01020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513768.1"
                     /db_xref="GeneID:3254416"
                     /translation="MAPKRSLKGPFYDSGDDDTEVEPIGKPTSSFDRTSSQLSVELPV
                     FSFAERSKYSPWHPKPLAASQANEPALKIFQVSPPPRNRFPTKTYGTKRQSKRAKLPP
                     VPTEEGDDDDDDDVFRDTNYDELLAGSEFSGGEGPLPAKRRKNSKGKQKEVATLSGES
                     ENGTPRASVTRMRTRTSGKNENLKKKMPTPRIPSSTSKPRRHQETNEREGGLVSRLRK
                     PIETPAKRTLCKLQQKRAGIPTTFQSQGTDSDSGFVVKDPEDPVDPPPSPPKRRRSSG
                     HKKRNSKQGNHPDPDDSSSHMAETSDEDMVEAIKLDDPERFKATSRLRHTRLETAQQR
                     RIRKLRNKRLGIKDDSSGSGGEESAWEDDGEDEPIYVSSGDNNDDYDSVQEDDVAEED
                     ISNFIVDDGSQPLAEDLLPPEFSRNALQSTEYKFRVVFHYFLLLAMKGAKRVLPLDKK
                     TRGYFGPPLADLRRRMKDYQNNRVRSQVWSRELVQILEKYPCLRTEYTGAEMGCDACN
                     ISGRIGTITVTIGGEPYDKETFQTLRDMDDERKDEGSDIISVSSEGKDPSDADEDVSA
                     PPIVHSKLVMGKICKARTQAYHQLFHWEYTLYHRIRRYYKNLLRAAGDIPPVTSGSEI
                     EQSEEEPDQAKSNAGSRRKSQRNEREAERRVKSLRQQGLPDDLEELDDVMEWMEEKAN
                     YVTEEFEWMEQLVENAERLDREKATD"
     gene            315814..318180
                     /locus_tag="CNK01030"
                     /db_xref="GeneID:3254405"
     mRNA            join(315814..316114,316172..316282,316339..316557,
                     316610..316786,316839..316988,317043..317431,
                     317484..317535,317594..317711,317777..317946,
                     318002..318180)
                     /locus_tag="CNK01030"
                     /product="Glutamyl-tRNA synthetase, putative"
                     /transcript_id="XM_567791.2"
                     /db_xref="GeneID:3254405"
     CDS             join(315863..316114,316172..316282,316339..316557,
                     316610..316786,316839..316988,317043..317431,
                     317484..317535,317594..317711,317777..317946,
                     318002..318130)
                     /locus_tag="CNK01030"
                     /codon_start=1
                     /product="Glutamyl-tRNA synthetase, putative"
                     /protein_id="XP_567791.1"
                     /db_xref="GeneID:3254405"
                     /translation="MTRPLRPLLKVLSPRLGIRHYHSHHSSPQTTNVSSEIPKSARLR
                     FAPSPTGHLHLGGLRTALFNHILARKWKGKWLLRIEDTDRSRYTEGAVDSLRNALEWA
                     GLEYDEGVGVGGSYGPYTQSERIDIYQHYTKELLSRDEAYECFCSPTELEAIKLSLAQ
                     QGFKHSYDGRCRHLTEEDVARRKRAGQKFVVRYKNAPGELDLPPDMIFGTHQPTAVIG
                     PDDFVLLKSDGWPTYHLASVVDDHLMEITHVLRGEEWLPSIPKHHKLYRAFGWTPPQF
                     AHLPLLCNPDGTKLSKRRGNTFVQHYQKQGYEPEALLNFLALMGWDYHAAITSSSPET
                     TLDPHIRTDGHSLYELFTLPQLIAAFDPTHINHRKAAVNQGKLDFLNKMTLRRKAGRL
                     GEDGVMVEAGKVFTGQEEEERQKLVERFQVSLREEKVLQGCELVNDLDFVGKVFDAEL
                     PRTTRLCEMPIHSIFYFLPPTYTCQESKSILKDLNFRLYCQYTHLFADALQTRAESAE
                     SVDEALVWDVIHEVVEASGVTKKSQFLIPIRHALTERKKGPSIPELVTVLGLDESLSR
                     LRRGEEFVREQDLARRKAAEAE"
     gene            complement(318147..322143)
                     /locus_tag="CNK01040"
                     /db_xref="GeneID:3254396"
     mRNA            complement(join(318147..319720,319768..319903,
                     319961..320150,320204..321408,321460..321594,
                     321645..322143))
                     /locus_tag="CNK01040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567792.2"
                     /db_xref="GeneID:3254396"
     CDS             complement(join(318283..319720,319768..319903,
                     319961..320150,320204..321408,321460..321594,
                     321645..321930))
                     /locus_tag="CNK01040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567792.1"
                     /db_xref="GeneID:3254396"
                     /translation="MSMAAPRPFAGPSYPISPTPTTPSSVGYSQYGSQSFAGTPSRQL
                     SMTSSVYGPSASVPSNRGPGMKPNEKKGESREVARVHWMALKEFLAAWIERESPSSRA
                     SAREKLTRLTKLQFQELSTDVYDELMRRLAAEKGEGEIAPFLPVREDFHPKRNQARQK
                     LATLPNNRFKDLASDVFYELRRRFPDFDREDAQEAETRKYDEPPPAPGPRPSISQSIS
                     QQSFSFSTHDRASPTPLQAYMSRDASSSSLHQRQGSRQMSRDESSNSLHQRQSSRQMS
                     SSTHRSRPSNDPIRQAQRGPEEEFLDDGLERRPQANHMAATNDVIVPSKSRLREEEIE
                     VPYARDSTVDVLRQNTASRGGEQSLVNGRDSRASYNMNFSLGGDRSRSTPQTEKSQLD
                     MRSPERREYRNLDDKASLDEEREKRLRSEYEFRISGLDRKLLNAEKERDEARRAEAQE
                     KDLRMEWEEEVRTLKEQAVTHASSLRALQHELDLARDQMESARQRADEAHADADQEVS
                     QWRERCEQLENECRRLEDEKAALEEELQKGGPGGQAMEDMKQELQSLVDELNSLSVRN
                     EELMTEREQDAVRMSEMEARVSDYRRKYDAVRIELRNLKATSTMFATFSKPMTDDHLP
                     ASPDGNIMDVNVSAFQSSIDGLLSAARSSTPSGVLPAMKAIVEAITSIGEDVKSFEAH
                     PNRDVDVSRLESLKHESTSRLNNLMQSARNHAMASGLSPVSLLDAAAGHLSANVVEII
                     KLLKIKRSDKNDLKRSSSRLSIRDMVNRDRDRERERANEAWDNNYRPESRTETPDSRS
                     PPAMASRPPTERTSSAQAPSRSDSSNDLRYDGARTATPTEVAHAKLSGVAPPSSYRSP
                     SVTSTLPLAVTPSSAPMPQVSSSTISDPSLASAPSSATAPAATSRPTNTRINSFQSTS
                     TARSDSFDLERKSTLINERSLAAHVEPRGLRTMNHVREESGSGSNERESLGSTGSASS
                     SGGPMTALGSAQPFNAVELKQDEAEDDGREWEDLRPYLNGQSSALVNSIQNLLASIRT
                     NGSPSVLNEHLSEVIAIASSIVAVSTNALPSSLRAQGDGLLRELVNNTNKLSEAQELG
                     KQGQGSGQQGGFEKGVRQQIASASFGVAKSLKALMKLGQNE"
     gene            complement(324100..326507)
                     /locus_tag="CNK01050"
                     /db_xref="GeneID:3254576"
     mRNA            complement(join(324100..324329,324387..324778,
                     324830..325125,325177..325367,325430..325756,
                     325808..325851,325903..325961,326095..326128,
                     326279..326507))
                     /locus_tag="CNK01050"
                     /product="phosphogluconate dehydrogenase
                     (decarboxylating), putative"
                     /transcript_id="XM_567793.2"
                     /db_xref="GeneID:3254576"
     CDS             complement(join(324211..324329,324387..324778,
                     324830..325125,325177..325367,325430..325756,
                     325808..325851,325903..325961,326095..326128,
                     326279..326292))
                     /locus_tag="CNK01050"
                     /codon_start=1
                     /product="phosphogluconate dehydrogenase
                     (decarboxylating), putative"
                     /protein_id="XP_567793.1"
                     /db_xref="GeneID:3254576"
                     /translation="MSSELADVGLIGLAVMGQNLILNMNDKGFKVCAYNRTVAKVDHF
                     LANEAKGTNVIGAHSVKELCSKLKRPRRIILLVKAGKAVDDFIAQLEPYLEKGDIIID
                     GGNSHYPDSIRRTHELEAKGLLFVGSGVSGGEEGARNGPSLMPGGSDAAWPHIKDIFQ
                     KTAAQAQGEPCCDWVGETGSGHYVKMVHNGIEYGDMQLIAEAYDILKRGLELDEDEIA
                     AIFDKWNSGVLDSFLIEITRDILKFKDTDGVPMVRKILDKAGQKGTGKWTAIDALDNG
                     MPVTLIGEAVFARCLSAIKDERVRASKVIPGPPKEAFKGDKQQFIDDLEQALYASKII
                     SYAQGFMLMREAAKVNDWHLNNAGIAAMWRGGCIIKSVFLSDITAAYRENPALENLLL
                     APFFTKALEKAQAGWRRVIAQSTLWGIPVPAHTTALSFFDGYRTETLPANLIQGQRDF
                     FGAHTFRVVPGMGNDHLKEDEDVHVRWTSTSGNVSSSTYNA"
     gene            complement(327147..328693)
                     /locus_tag="CNK01060"
                     /db_xref="GeneID:3254451"
     mRNA            complement(join(327147..327282,327347..328073,
                     328125..328693))
                     /locus_tag="CNK01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_567794.1"
                     /db_xref="GeneID:3254451"
     CDS             complement(join(327244..327282,327347..328073,
                     328125..328573))
                     /locus_tag="CNK01060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567794.1"
                     /db_xref="GeneID:3254451"
                     /translation="MSAIEYHDILRQADAAFPSDLEHAASFEQQEDREQIVALGDHHI
                     DEQHLHSQVIEGEDEFVVMEDQHHMDPSQEVQHIHEQVMEQQTLQSHQQQEDSQAQAQ
                     NHVQSHSQPGPSTSGRIKGLTAAEKKERQRAQNRKAAEKSRNKKKGEQMALEISVANM
                     QEENQRLRARLQTLLASRPSDSPVEPTSSSIDPILSSSSTSVVPAPVTGTGIDYMYIA
                     KLQNELTSAKTILFERCLELSRLKEGSEDCVEDPQRSLKLDMVSNLTKVVGLQAEMAG
                     LQTVLNHLNTEKDGLEQQRERIEKEVNGNKVVKDAIAVARRITEQENAERVTQAQIVE
                     RAASVPNLPLADEHQSAPPESTQQTPEGDDGDREGAGVDKALLDIRGWIDAAVKGWDQ
                     NLPESQGKEGSS"
     gene            329007..330384
                     /locus_tag="CNK01070"
                     /db_xref="GeneID:3254399"
     mRNA            join(329007..329103,329166..329185,329237..329327,
                     329390..329416,329470..329882,329939..330025,
                     330082..330148,330205..330384)
                     /locus_tag="CNK01070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567795.2"
                     /db_xref="GeneID:3254399"
     CDS             join(329056..329103,329166..329185,329237..329327,
                     329390..329416,329470..329882,329939..330025,
                     330082..330148,330205..330303)
                     /locus_tag="CNK01070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567795.1"
                     /db_xref="GeneID:3254399"
                     /translation="MGVSQNEKSVILTHESGCSAEIYFYGATVVSWKQGGKERMFVSS
                     KSAMDGSKAIRGGIPVVFPIFGPPPPSPPEYASLGQHGFARTSTWKFDSVVMDRPEGV
                     SVRFVLPSAPPTFLHEFKLSYVVTLAPHQLSTDLHVVNSGKEKFSFQALLHNYLAVPD
                     SSKIKITGIDKGTTYKDKVLGGKMDEWDGSTLVIDREIDRVYQKVPSREITVDDGAGS
                     GYKVRFRGFEDCTIWNPQEATGSKMADMEDKGWDKYVCIEPGYVREFKTLSPSQELIL
                     AQTITVL"
     gene            330614..331892
                     /locus_tag="CNK01080"
                     /db_xref="GeneID:3254406"
     mRNA            join(330614..330724,330818..330915,330969..331038,
                     331097..331228,331282..331316,331371..331512,
                     331563..331712,331772..331892)
                     /locus_tag="CNK01080"
                     /product="wos2 protein (p21), putative"
                     /transcript_id="XM_567796.2"
                     /db_xref="GeneID:3254406"
     CDS             join(330662..330724,330818..330915,330969..331038,
                     331097..331228,331282..331316,331371..331512,
                     331563..331712,331772..331789)
                     /locus_tag="CNK01080"
                     /codon_start=1
                     /product="wos2 protein (p21), putative"
                     /protein_id="XP_567796.1"
                     /db_xref="GeneID:3254406"
                     /translation="MAPLHPEITYAERSSASEPEKNIIYFTINAPDIQDEYKLDVKPT
                     EISFRAKAGDASNGIPEKEYSFDLQLWGEVIPEETKKVVTSRAIVLVLRKKEAQAEYW
                     PRLTKEKPNRNWVKTDFSKWVDEDEQEGTEDLSAGMEGMEGMGGMGGMPGMGGMGGMP
                     GMGGMGGMPGMGGGMEGMDFSKLMEQMGGMGAMGDMGGAGSGPNFGDDEEEGSGEEDE
                     VKPAEDKSNNASLDDVE"
     gene            332199..333128
                     /locus_tag="CNK01090"
                     /db_xref="GeneID:3254391"
     mRNA            join(332199..332771,332817..332896,332944..333128)
                     /locus_tag="CNK01090"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_567797.2"
                     /db_xref="GeneID:3254391"
     CDS             join(332255..332771,332817..332896,332944..333048)
                     /locus_tag="CNK01090"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_567797.1"
                     /db_xref="GeneID:3254391"
                     /translation="MPRPFLTIKDLTINRDSGSPILDNLSLDVSEGEVLVIRGPSGSG
                     KSTLLKCMAELNLYQSGAIELHGQSSQEMGVPNWRVKVQYVPQRPSILPGTPYDLLET
                     IKKFSARKASQEAKENGTGDRIDPMDLAADWGIEKTMWRRNWDTLSGGEAQRLALALA
                     VGIGGAEVLLLDEPTSALDEESSKRVERSLVNLLDNQSSRGRDTGLKALVWITHSAEQ
                     AERVATRTFDVQLRR"
     gene            complement(333061..334333)
                     /locus_tag="CNK01100"
                     /db_xref="GeneID:3254709"
     mRNA            complement(join(333061..334101,334164..334333))
                     /locus_tag="CNK01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_567758.2"
                     /db_xref="GeneID:3254709"
     CDS             complement(333147..334094)
                     /locus_tag="CNK01100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567758.1"
                     /db_xref="GeneID:3254709"
                     /translation="MAYQPYTGFAMTEPRPNTQVAPRRVSPSIRELPPPLFVSERNFK
                     GVKLKDDTFFLIIDQYQRTRALRIFDNEGMKTIGEISEVYRWLKMFPNVERVEINASA
                     LIPSPEDDVQKKVRRNRLYEPETPVRRHFQQQLGDRFEELAIFIDGDTTEVYKTFSEF
                     LMNDIQPRILTYIIPSEHSGSDEELDCIYGMPQCWPGGRWIRVIADFRWPEKRRKELH
                     EFHRRISVQIAERVLQQSYDHELVADDDRFYTRDGPLSGRWAKVQWNVVGAKRIKGLV
                     KDIINKEKDQDPKRLLNLFDQYVEVFELTEGVAKEFGLW"
     gene            complement(334593..334687)
                     /locus_tag="CNK01110"
                     /db_xref="GeneID:3254566"
     tRNA            complement(334593..334687)
                     /locus_tag="CNK01110"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3254566"
     gene            complement(335102..337415)
                     /locus_tag="CNK01120"
                     /db_xref="GeneID:3254395"
     mRNA            complement(join(335102..336179,336232..336712,
                     336767..336925,337003..337057,337115..337415))
                     /locus_tag="CNK01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_567798.1"
                     /db_xref="GeneID:3254395"
     CDS             complement(join(335320..336179,336232..336712,
                     336767..336925,337003..337057,337115..337176))
                     /locus_tag="CNK01120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567798.1"
                     /db_xref="GeneID:3254395"
                     /translation="MPPKSRRPDLPTLSFSAMQSAMSEDVHTPLPGTPIPLEQDPLMM
                     TPGIPAVELAANLAKTKRSLDDDASGSTESLDFEHEKWTDDEDGLLQGFLLRPPRRLN
                     IAYPPSALPPPAALDEITSQVIESQSRKDPSSSSRSPKSFWHHTWRSTRQRLFLIARR
                     ESMSAIGGHRRQKSDSVIPAVKRQENIKLKEGKESLIALKGGRVGRHQNDSMDSLFGN
                     EQPGKLSEALRLSNCLQSNAARDEEPSASSASSIAFSSPFSNNTLQRSLSPFASADPP
                     ARPASLLQRGRSFTFAEFEHEQAVGNAAQDPLKFDNEDAASSSSRMSRPDLYHSLSSP
                     VAAMLSSPSMSVSSRMSDCDTSTVNVQWFGPALGLDTSSGSNCSTPTGPAFSIPALPI
                     SCTSNLPTTDVSPNAFASLSISSLEDSSTPVLGVQSSSSDSSPLKHPSYIRRSALHRS
                     FSDGTFLPKFDKFGSLSSTRENKRQRAELPSSALESVAKGSSGGKAVGAGPQRRGGLK
                     DVIMRSSPDEQHVFGQVLEGLQPPFETKRL"
     gene            complement(338169..342685)
                     /locus_tag="CNK01130"
                     /db_xref="GeneID:3254394"
     mRNA            complement(join(338169..338367,338437..338671,
                     338730..338788,338841..338997,339045..341178,
                     341232..341323,341371..341466,341516..341932,
                     341976..342070,342120..342232,342280..342459,
                     342506..342531,342570..342685))
                     /locus_tag="CNK01130"
                     /product="TIP120-family protein TIP120B, putative"
                     /transcript_id="XM_567799.2"
                     /db_xref="GeneID:3254394"
     CDS             complement(join(338225..338367,338437..338671,
                     338730..338788,338841..338997,339045..341178,
                     341232..341323,341371..341466,341516..341932,
                     341976..342070,342120..342232,342280..342459,
                     342506..342531,342570..342626))
                     /locus_tag="CNK01130"
                     /codon_start=1
                     /product="TIP120-family protein TIP120B, putative"
                     /protein_id="XP_567799.1"
                     /db_xref="GeneID:3254394"
                     /translation="MSRATAVPLSSQLPGLLEKMRSIDPDYRIMALVDLNKELTRTLA
                     PQPSSTRRPDPHYTDDYTESQLVEMVLKLLADTNGEVKSAAVACISLMVKKPRPSSLS
                     KVINSLLEDVSSDNDERRDTSCLALKNVVLEMPLESQQVLSDIERIVTRVFKLFTNEI
                     HPQIASELLQILTDLFVRFSPNVASSAAIQSTALSSLIQILDNARPAIRKRAVPTLSS
                     LIATSPQLFNEDLEKEIVNGVGQGGESSRIWMGTVASLARGKSAGSIGKLVNEGKLAE
                     LILSQTKNVEDVETVEAALTALEALVLRCPSEMFPYISAITQRSLVLVKYDPNYVDLE
                     DDDDDDVDMASDAEVDDDDEYGDADYSDEDDDFWKIRRSSAKLLRALISTRPDLLSEL
                     YNSATPVLISRFAEREESVRLEVLAAFEMLLKQTATSRSTDLATGGRNKRKRSEGMDE
                     DYVSDDGPISSLQSYLPQLSKAILTQLSSKSVPTRQQSFSLLRQAATALGGGLDDSAD
                     PICTAAASALRTIDSATSSSLAIATLSFLTVFFDTHSARTFASHLGNLVPAIVRCMKD
                     KLQRISFEAFDTASALTKSLRPAGSSASVSGDLSTPIQEVFVATTEVLGDNSVDGDVR
                     EKALATLGSILVQSGDLFASSFSTSLPLITNRLGSESTASTAIVVIGQLAASSQCKGP
                     EFEGWLLQILPEVVVALRRTKRGTSKNAEFTCLLNIIERVGKALPVDLAEGLIIELTP
                     VIDTPMALQTIALALTHQPSARPTVDAQLYPKILTTLKTSLNPHLVDALAEFFTAYAA
                     SLNSPERAVQLVQELSNNLGSGKRDSLPDATSGGTAAWGTTAKCVGGVVKGEIASAGE
                     SLALFEDVVKGKNVKETDAYLALLCIGEIGRIVNLSTKTDLFEIILSFFKHDSEEVRS
                     AAAFAAGNLAVGVPDVYVPAIITRISAAKDESERLLLLHAIKEVILHSPSAQLESLAD
                     TLWAPLFSATDATPASKADSTGGDGIRNVIAACIGKLTTTVPAKFLPQLQQLLYSSPS
                     NRAIVAAAVRYTFIDTSNGYDELIAPIIVEFLSLMKDENLIVRRLSLASLNAALQNKP
                     YLIVDKLDILQPLLYQETYVKKELQREVTMGPWKVIEDDGLENRKTAYETMYTLLGAC
                     FSKIDLPTFTARVLVSLSDVNEVKILGLMLLLRLGQVSPESVIPRLDEVVESLKGMMK
                     DVEVKDDTVKQDLERKAEMQRSTLRTVVPLYKSSTVQQAPAFHVFVENLLANEKWKEF
                     RDYQA"
     gene            342892..345104
                     /locus_tag="CNK01140"
                     /db_xref="GeneID:3254400"
     mRNA            join(342892..343635,343686..344533,344592..344889,
                     344941..345104)
                     /locus_tag="CNK01140"
                     /product="capsular associated protein"
                     /transcript_id="XM_567800.1"
                     /db_xref="GeneID:3254400"
     CDS             join(342936..343635,343686..344533,344592..344889,
                     344941..345017)
                     /locus_tag="CNK01140"
                     /codon_start=1
                     /product="capsular associated protein"
                     /protein_id="XP_567800.1"
                     /db_xref="GeneID:3254400"
                     /translation="MPKGTYPRTRIAVTAGLAISFLFLLHFLFSSPDRLLATQRWTTA
                     SSSVIRSKFLRAKAQAPKPPIHHPIPKLMADARNEFDQKLKKQSKSLPEAVAEYKKRY
                     GRNPPKGFDEWYAFAKENNAVIIDEYDQLDRDLKPFWLFSGQELRRRCVQVGFLPSVD
                     LVRVEKGQTRTIDVSKGFDDSEVGARAKGFRVMLEKFQAKLPDMDFPINEKAEGRILV
                     PWEENLYSNLTADSSLGIEHVLGGEFIPDWRGDGNVWEAYRRTCEPSSQARRLFGSLR
                     ANLKEGQAPVSRLADAGVTADAPSEDFFFPQSVDDKYDFCAHPWAHYNQGHFFSDWRT
                     IHALYPMFSPAKGLGYSDILIPSHYYFSSTKRYTYGWDPVNMVIKDVDDMETKWEDKS
                     DDIFWRGATTGGGSSPPGFLAQYQRHRLIKMTSDSSNVNKTVVFADPPGTDHFISAQV
                     PIGQLNKDMMDVAFTKAVGCTQYPGGCDGMRKDHRFADAVPLGENWRHKYLIDIDGMG
                     YSARLFALLKSESAVLKSTVYTEFMSEWLQPWLHYIPISQMYQEIYNVHAFFSGPSKA
                     MLDASNSTRTLYQQPGVHTKKFDGDAELRKIAKAGREWMFTIGRKIDMEIYVYRLCLE
                     WARLMADDREAMTYNG"
     gene            345339..350232
                     /locus_tag="CNK01150"
                     /db_xref="GeneID:3254393"
     mRNA            join(345339..346309,346359..346663,346715..346868,
                     346917..347029,347084..347250,347311..347458,
                     347514..347595,347648..347693,347748..347757,
                     347817..347943,347997..348038,348089..348131,
                     348183..348393,348454..348650,348722..350232)
                     /locus_tag="CNK01150"
                     /product="polycomb protein e(z), putative"
                     /transcript_id="XM_024658042.1"
                     /db_xref="GeneID:3254393"
     CDS             join(345382..346309,346359..346663,346715..346868,
                     346917..347029,347084..347250,347311..347458,
                     347514..347595,347648..347693,347748..347757,
                     347817..347943,347997..348038,348089..348131,
                     348183..348207)
                     /locus_tag="CNK01150"
                     /codon_start=1
                     /product="polycomb protein e(z), putative"
                     /protein_id="XP_024513769.1"
                     /db_xref="GeneID:3254393"
                     /translation="MPPHQPGDLEPPPKVPPEIYNTVRQTWVQTWKDFYAWKPPSTLP
                     VEDGWVSMRAEEEDKNLVKDHEDFGKRMAALLEKFEQESGREGKLAEVEFEGAAELKP
                     LQNTNKSPIEWNVHGRPIRPLPPIYSLTPTIDPVPEYAFCIYTPRSILSPDEVIMPFM
                     PTFDDDTLDIPGFETEKEKYSSLFTSCLWDLPGRDADVDIIMFETLKRLEKLEVEKED
                     IDRTRILPKECLYVESLDLRRDLPPFPLPPQNIDSVTGRKLPDGLNHVVGAKRKWEEP
                     LELIEEDFEDDLEGFEEACCHYPTCTSVMCIRHTGMYFDGLTRNTARGSSFNAGNQRL
                     PRISSVLPTLSEPCSPTCYSLTSNEATLGERLLSIRLEKEWSESDKQQLIDILSAYEG
                     SRLERICGLKDVFNRTCAEVARQVTSILQDRSRGPSVHEPGADMECSTPSSTSGSLRP
                     LLQRSKSSKAQLIPITNRLPEFVECEHEGECLPGVCSCANGKLPCGRHCSCPSTCTRR
                     HRGCNCRRIAIQEGRPVRDGKICINGKCPCIRSFRECDKELCGSCGAAEELVQDEEIL
                     KTTGSFGKDGEWVENKDKMAQGQTFISCGNIALQKAKWPKLRVGISKVAGYGLFADED
                     IGQHVPVGEYVGEYISEWEGDNRNFAESINKRRYQFTINPQFIIDAGFFGNHTRFINS
                     AQGNNVNCVAHQRAVGHELRILFLTTRPIRRHEEIHFNYGDDFWDNH"
     gene            complement(347734..350521)
                     /locus_tag="CNK01160"
                     /pseudo
                     /db_xref="GeneID:3254577"
     gene            complement(350522..358210)
                     /locus_tag="CNK01170"
                     /db_xref="GeneID:3254382"
     mRNA            complement(join(350522..351990,352044..352358,
                     352410..352544,352600..352730,352777..353853,
                     353907..354056,354117..356394,356447..356667,
                     356718..356952,357001..357068,357119..357248,
                     357295..357367,357421..358060,358113..358210))
                     /locus_tag="CNK01170"
                     /product="DNA repair protein rad8, putative"
                     /transcript_id="XM_024658043.1"
                     /db_xref="GeneID:3254382"
     CDS             complement(join(350649..351990,352044..352358,
                     352410..352544,352600..352730,352777..353853,
                     353907..354056,354117..356394,356447..356667,
                     356718..356952,357001..357068,357119..357248,
                     357295..357367,357421..358060,358113..358193))
                     /locus_tag="CNK01170"
                     /codon_start=1
                     /product="DNA repair protein rad8, putative"
                     /protein_id="XP_024513770.1"
                     /db_xref="GeneID:3254382"
                     /translation="MKETEGRAVNGENMRNIPSIQSQKRKRASPSPEVESEEDGDDWY
                     EIDYIADSRIIRRKGRQILQYLIHWAGYAVHERTWEDEDGIGGENCSLVQEFYQKNPG
                     KPRLLPPPVRKEVKLARKVEVVITTRRIDGKSSATYSTGQPSPHRSSITSPQANSIGE
                     EDPNSFPTRRPVRSTVSKTAKRSSLRKLHPNKKRKTSSDDESDFVFEGGEWDEDDDGD
                     VHFRSDEDSEQERSAEEPESDEEIIKSAKKARTSLPKAKLRPKPANLGSFVTGVRPLG
                     QELDIKAAVRNMSEDLPPISDIEAMFDHLVSRIPDIIELVRRLNGRKLRVATMCSGTE
                     SPLLALNMIAKAIKAQHGLTLAFEHVFSCEIEPFKQAYIERNFAPPVLFRDVTELGKK
                     RAHTAYGSMVEVPGDVDILIAGTSCVDYSNLNNVQQDIDANGESGRTFRGMLQWVKKH
                     QPPIVILENVCNAPWDRVVEYFGQIDYDAQYTRLDTKEFYIPHTRTRVYLFATPSSPE
                     PENLPEKWAQTVKDLRRPWSSPFEAFLLHTDDPNIHRARLELASARAQADGTSRKTTD
                     WNRCESRHQRARQDEALGLLRPLTSWQEAGVCKGLDWTWNDWLLAQTERVVDLLEIST
                     LRMAKDGIDSGFKACIWNVSQNVDRQTGSSKTALAPCLTPNMIPWVTIRGGPVTGREA
                     LALQGIPVRELLLTNENEDQLADLAGNAMTTTVVGSAMIAALKVACHKIIEGTNPGKE
                     AALILEKEAIDDEQVAGRIIGEDSLERHDLDLAKVSKSNLSEILDLAFRSSRHCQCEG
                     QSGIVPNILECQECSYRACKSCGGRPEHVYAPCASQRVEPAEFEKIFKGLLPMRVRIA
                     GLTDHCLNAVRKAAEKSNRGSVSDVDWQLWSTALLEGIHDAEFRFRYLKRQSTWTAVY
                     EARGAMLSLVLRNQIPEWRLTIKAPPSEPNNSQLRALLLHPVARLQIDIGGQDVLCGP
                     WELCIPSMKSIDIEITGKGELLPSWEASLGLQGPFAHTTRWSELEISLQAEDDNALDR
                     KLSGTYQLLPRCGQAMSSLHKKKPDPSEDGLPQLYFFLDPTRCGESREDRYVFSTSTE
                     RLDYGTERPVIARLDSKWREGNEKQRKVKLDVSGAWVKCAEAHLTAIGGDDIAVVAND
                     AGANEIHRDRATYAIPASASAISASLTTKGCSHAMALLSCRVPLDPTHSESMWRRGAW
                     AEIDLSHQGNTTFANLAWITERLPPLDGLKNWTHITDDVPENVCERCAPRPPKIHWIK
                     REGKTNKKGNKTKSTIIAFEDKLEAGQYEHALKHRPSPFVVQLRLDGDIGSFRIGLNI
                     VSLAHRALSRLPPTTSEHKISLSWRLTPGHVAETFQPRRVFILPSNKQDPENSQPEAF
                     KLPLRKEQLRSLWWMLEQEKAAGKTHTFVEEEISESLLPAVGWRAEGKAERPVMVRGG
                     VIADQVGYGKTIISIALVAQTMSLPAPEPAPPGLIDLKATLIVVPGHLSKQWPNEIAR
                     FTGSMFKVIVIQGMKDLQGKTIAELGKADIIVMASEIFESDVYWSRFEYLSARPREWL
                     NDTQGGRFFCDRLDAAMESLMSQTEILKEKGSEAAMRAMEDKKKSLVDSAGAKKEVHI
                     AVSFGRRMKGQAYRDKHSSDSKAKPITKEELERWEASEDEDDDEESKTYIPIPKFHSF
                     TGSESILSASVKKDYKLLPNPVLHMFRFRRVIADEFTYLQKKSLAAVLRLSSSYRWIL
                     SGTPPVSDFAAIRSIATFMGIHLGVQDDGEGDVQYQKARAKEQTQAEKFHAFREIHSR
                     AWHNRRDELAQEFLNVFMRQNIAEIEDIPTVEHIRTFKLPASEGAIYLELEHHLQALE
                     MQARKETKFKNVTQGDRNARLEEALSDSKTAEEALLKRCCHFTLDLSDKTQDAKTAQE
                     ACDHITSARARQLLACQEDLSRSVNQAIALHGWIKKKGGFSKNDDERQPFAEWIAFSS
                     NISKHQGDIEAARILLNVIEKCGVKDGSIPLSPSDKQSPSIASGARMDDVKWQLREQT
                     HLLRKLVKELVARVRSLRFFEVVRKIQKGKSDAQIVLESSECGHKPSTNPDIEMAVLS
                     CCGHVACHECMRKAVASQRCVKSGECHAAVRPTNMVKVSSLGTEGELSSGRYGAKLEH
                     LVNLIHSIPKDERVLVFLQWEDLAGKVSEALSAGKIPHVTLSGSAKSRANTLDRFQST
                     NADTARVLLLKMNDASAAGSNLTTANHAIFLGPLFTNSLFNYRAVETQAIGRVRRYGQ
                     QKKVHIHRLLALDTIDMTIFNTRRAELKEKTDWEEIPQEEYKA"
     gene            358919..360272
                     /locus_tag="CNK01190"
                     /db_xref="GeneID:3254387"
     mRNA            join(358919..359234,359289..359406,359460..360272)
                     /locus_tag="CNK01190"
                     /product="expressed protein"
                     /transcript_id="XM_567804.2"
                     /db_xref="GeneID:3254387"
     CDS             join(358962..359234,359289..359406,359460..359998)
                     /locus_tag="CNK01190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567804.2"
                     /db_xref="GeneID:3254387"
                     /translation="MATSSLLQTALQNLHVSQQIHQQSHTPHPPSSPGSTSSRLSSPG
                     GTPPMSDWEADEDELIAVGRGTRPATPVGGRGGTKLPSILGGKSKDPLRTLPTHLAVR
                     IFLMLDIRSLARCDRVCKRWHKSSTLNYVWFLQNRALLLPRITTPETPGGKTRKIEGE
                     IEFYDPYDKSPRLSSLPSPPIPTSTQPQWTKIESKKEWKSQFKHTFKRTDPTAEPEPD
                     RGRVDIASLHSSGFSTPTGSHSYAGLGSGNSSRWEAIGGEAPSSTERKLAAREAYKSL
                     GGRKSRIKRKMGGELGAKDKGGAIDDNRFDAPW"
     gene            complement(360246..363373)
                     /locus_tag="CNK01200"
                     /db_xref="GeneID:3254388"
     mRNA            complement(join(360246..361550,361606..361908,
                     361966..362122,362168..362365,362419..362531,
                     362577..362941,362980..363373))
                     /locus_tag="CNK01200"
                     /product="expressed protein"
                     /transcript_id="XM_567805.2"
                     /db_xref="GeneID:3254388"
     CDS             complement(join(360426..361550,361606..361908,
                     361966..362122,362168..362365,362419..362531,
                     362577..362941,362980..362995))
                     /locus_tag="CNK01200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567805.1"
                     /db_xref="GeneID:3254388"
                     /translation="MAGIYNGHILEFPFIRVDSFVAPPASHRPQWLIPRPFSSPSEPL
                     EFYQPPRAQLFLLSHTHADHVVGLTSDFTGHIICSPDTKRMLLDLEPERERQWLDKGI
                     REIKTKRFGGLAAKRGIHGKVVDRIEALPYGQPKVFTLGYESEKPQEITITLLDANHC
                     PGSTMFLITSDKKAVLHTGDVRADTRFIDSLKRNPILQEFLAPASVYQKAKSLVGGGR
                     RVLDRIYLDTAAILGTGDMPDKEPVLQELVKIMGLYPEDTTFFLNTWCFGWEDVIKEV
                     ARYFNEKVHVDRYKRQIYSAVRSDPFLLNCTTTDPHETRFHACERFAKCVACRRFDDE
                     SGKPVYNLNKMIVHVNMVEVKQVGWDSRRQGFMETLFKAAGKGGPWPLNIDIPISRHS
                     SLPELQSLVKLFKPLGLTPNTVASYAKGLDYYLLPDLFEDCLSPGGYERIVVERDHYL
                     GQVYGKWYTEGLNKLRQQGFGVYPDIDKIEREDYYYKREDYLPEDMVAEGSLNGKAQK
                     VLGATRTDISMDQVSRLGGLPSLSPKEIYNRALRLMNQALVDNSKSAAMDRSGEWEYD
                     TEEESMGRRKRRRRFASSPYESSQEMITEAEKQEEGILCATHEETRDEIDMKPFVDNI
                     QGIPAPEVAIDRAQIQPTSPSNVKLRPPNPNLVKVKLEPVSPRAPLHTLRPNIHHISG
                     VSMSDKLPITASSSTKPPGGRKRDCTGSPYPFSSQSKMRGKRSMSKEELERMRKRLAE
                     GGGPGLGRGLGRMKRADA"
     gene            complement(363475..365071)
                     /locus_tag="CNK01210"
                     /db_xref="GeneID:3254386"
     mRNA            complement(join(363475..364417,364473..364741,
                     364791..365071))
                     /locus_tag="CNK01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_567806.2"
                     /db_xref="GeneID:3254386"
     CDS             complement(join(363623..364417,364473..364741,
                     364791..364953))
                     /locus_tag="CNK01210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567806.1"
                     /db_xref="GeneID:3254386"
                     /translation="MSHSSNSSLLQQHRPESLPPQLPDRTVAISQAQALWLETHERTQ
                     QLLCKSRSRDLLVPANNDSTLSPQSSFSQLSSFSQPVASSSTGLKYLSMEPTSKEFVD
                     HAVADVHSPLSDSSENIQSCVSLLANAQVTAIGEAMSKKRWQPDASSALCTFPLCTAN
                     FAQSSYFFLRHRRHHCRLCGQLFCGAHSAQRAPLIHSTPSGRAIVQARVCDMCLPRPE
                     SSDAPYPTLSQPRKISSTESEPLSSDASILATPSDDDVAMLSSNIGSSILRASATTEH
                     ASVADVGEQLAPIEDWMDRSGVLSLYPLAVKPSHSRSKHSSSPAPSVAPLFAPSLKYR
                     RAAKEKELARQTLRQRRLGKDDFWLPENWGYKREDFDPTCRDDESEKTVGGVVEDGPI
                     RFRTRVVTPLATPLRV"
     gene            368318..369773
                     /locus_tag="CNK01220"
                     /db_xref="GeneID:3254385"
     mRNA            join(368318..368556,368614..369145,369195..369521,
                     369572..369773)
                     /locus_tag="CNK01220"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567807.2"
                     /db_xref="GeneID:3254385"
     CDS             join(368356..368556,368614..369145,369195..369521,
                     369572..369687)
                     /locus_tag="CNK01220"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567807.1"
                     /db_xref="GeneID:3254385"
                     /translation="MQTSDPGHLFQTTAQLKQAASRERKLKAAEKIGSPITLSSKVLA
                     LEIRDNDAFTAESGWQARRVDLKTGKTIRLYRGHQGPVTSVALMRIQGENPTDILLTG
                     SWDKTVRVWDIDTGAHLQTIEGHTDFIKSLTVIPCSPPLLLSTSSDRTCRLWDVSEVL
                     KGNGSARSSQILKEHTRPVECATWKADVDEDGKPMGTITVWTGDSLGVIKKWKVEQGK
                     LVYQEDVLGHETSVAKLVVAEEGLWSVSMDKMAILHPFTNASALTIPHNSYVKSILPL
                     TSFALPNAHSLVLTGSEDEDIRVWDIESQPHRLKGTIQGHCAEVSDIKPYLRERDGKP
                     ELVVVSAGLDATLRTWTVQDILNPPELMCDEAEEKDAVGLTEEEERELAELMSDEED"
     gene            369921..371646
                     /locus_tag="CNK01230"
                     /db_xref="GeneID:3254384"
     mRNA            join(369921..370059,370117..370138,370236..370289,
                     370341..370348,370420..370503,370676..370760,
                     370819..370930,370979..371139,371201..371211,
                     371276..371308,371367..371646)
                     /locus_tag="CNK01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658044.1"
                     /db_xref="GeneID:3254384"
     CDS             join(369988..370059,370117..370138,370236..370289,
                     370341..370348,370420..370503,370676..370760,
                     370819..370930,370979..371139,371201..371211,
                     371276..371308,371367..371627)
                     /locus_tag="CNK01230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513771.1"
                     /db_xref="GeneID:3254384"
                     /translation="MNRNFTSLSRQHTRRARNMITLTIVRHGESTDNLKPLWAGWSDA
                     PLSQHGMNQAKALGESLKDTKFDYIFASDLKRAHWTSQQILKNQADPKPPLVISELLR
                     EQHFGEGEQKPFGETSGWVRQPGRVFKFPGGESLTDVRKRADQAVEQFIEPILKECRG
                     RPATSKHVVVVAHGIFNSEFLGALMARRKTDAPLEWSYRGMTNTGWTKAEVGYADEAR
                     TESTSKISTDPSGPVSPSSAPSAPPPSTPNPDNLEPLVIRVLCSDVTDHLKGVIRQKG
                     GLGSQSYDEKQEDIRKFFGGGGTK"
     gene            complement(371690..373387)
                     /locus_tag="CNK01240"
                     /db_xref="GeneID:3254383"
     mRNA            complement(join(371690..371852,371906..372052,
                     372105..372290,372337..372810,372867..372977,
                     373041..373387))
                     /locus_tag="CNK01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_567809.2"
                     /db_xref="GeneID:3254383"
     CDS             complement(join(371694..371852,371906..372052,
                     372105..372290,372337..372810,372867..372977,
                     373041..373379))
                     /locus_tag="CNK01240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567809.2"
                     /db_xref="GeneID:3254383"
                     /translation="MFVPSKARQALHLASISKRCLSRSNNSAHHCPCGCSKFQPGLSS
                     SLSGRRLSSITFQNSRSVILEQKTRYTGPKRSYSSNIPNQWATEAEEAHAKLIEAAEA
                     KVNVYKKVTEDEAKATDIDIKSQIERARVQKELAPLVEVWNKYLELKQSIIEIKPFLE
                     DSDPTLRQMFEAEHASLGTELDALITSTLPIVLLPPLSTAALPAVMSLNAGVGGLESA
                     LCTEDLARMYLRFATNRGWKVEEISRVEGTGGKGGGGIRELTVKFEPPQYAEEGIEVY
                     GALQWEKGVHRIQRVPANETQGRIHTSTVAVIVLPMYPDTAEAPLVDPKDVRIDVMRA
                     RGAGGQHVNRTESAVRLTHIPTGITVSMQDSRSQHQNRTWAWEILRARLSEKKHNEEV
                     EARRASRRDQVKGADRSDKIRTYNFNQDRLTDHRFGITVTGLQHVLDGEGLEDVISMM
                     KKDFNERRLEALLKGEEDLDY"
     gene            373555..376698
                     /locus_tag="CNK01250"
                     /db_xref="GeneID:3254665"
     mRNA            join(373555..373636,373685..373754,373812..373887,
                     373937..373991,374054..376442,376497..376698)
                     /locus_tag="CNK01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658045.1"
                     /db_xref="GeneID:3254665"
     CDS             join(373601..373636,373685..373754,373812..373887,
                     373937..373991,374054..376442,376497..376498)
                     /locus_tag="CNK01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513740.1"
                     /db_xref="GeneID:3254665"
                     /translation="MATDINKKRKIQRACDICRKKKIKCDGPMNSLSSHKCAYCTERD
                     LECTYIEEAQRRGPPKGYLETVEQRCGRLEKLLQELHPDFNFDSYVGPPIDRQTFDLV
                     TYHDLLDTLEIPPYPSQKPIVIDDLRPGLSASDPSVTPLSSESSANSLSNLKRILTRF
                     YKAVSLDAQRESDTEETEMEARTQLSVAESMKRMGARDHHWRYHGTASGIQFITHLQE
                     LRSRAASRRMDFISCVNRVKRQRFWEVPEWELAIASEGLSPLDLSSWPEKGLDQQLID
                     AYFDHVNLHLPLLNRKVFQEQYNSCKWKNHHGFARVCLLLFANGARYLDDDPRVIWPL
                     DQCASESGRDTIINDPYDLRRYSAGWRYVRSYLRMGQSIVQGPNLFELQGRILTCQFV
                     AGTAIPHFIWIVAGYGLRSAQELGIHMRATLLHADPTERELCSRAFWCLYHIDRISCS
                     AIGRTLAIQDYDFDLQYPADVDDEYWSTEDREKDFQQPIGKGPSILATFIETLKLDHI
                     VGAALQTIHTHSKGWLKSKDITANYAVLAELDSALNNWEKQVPQALKWNPQQSDTRLF
                     KQCALLYCRYHYVRMLIHKPFVPIQYKAKKQHSDALPSLRICVEAARSLASIFDACLV
                     RGRREQYQPSVDVEMALPMWDAATILLVDIFSSKQTASERETALMCLRCCQQTSAVLE
                     GTWRQVAKYSDFLVSLMDESIMPPIVDESRAGSEKRTRQDDDSGRSKKRAWRAGSEPI
                     MNPRGENEESNLQSRSQSRMNTLVSQQEPTRTPFVGTDIPFVSSTPTHDIPNPNMQLP
                     SFPYSQARGEYPSQPSPAAFVPSTQDTFQPSDIMYDWLMNMASAAPQTLSMSSMALGG
                     AEGGIDDPIWAQLFGDTVF"
     gene            complement(376593..379577)
                     /locus_tag="CNK01260"
                     /db_xref="GeneID:3254442"
     mRNA            complement(join(376593..376829,376881..377288,
                     377347..377350,377410..377477,377543..377733,
                     377783..377852,377909..378175,378230..378421,
                     378477..378530,378589..379217,379292..379577))
                     /locus_tag="CNK01260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567736.2"
                     /db_xref="GeneID:3254442"
     CDS             complement(join(376815..376829,376881..377288,
                     377347..377350,377410..377477,377543..377733,
                     377783..377852,377909..378175,378230..378421,
                     378477..378530,378589..379098))
                     /locus_tag="CNK01260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567736.1"
                     /db_xref="GeneID:3254442"
                     /translation="MALYKDLLETTICGMALSGKQLSFAMFSKSLAIFTALTATVKGA
                     TIAPRNATSSSDLPQVVLNYSTVQAYESGTTSAGTYYAFKNIRYAAPPVDDLRWAAPQ
                     DPVQEDSVNDGTWSNTTGTQGCNVAEDCLFLDVYVPESALNGSEKLPVLFWNYGGGWV
                     GGSKNENTPEGLFEVANNSFIFVAYNYRLDIFGVLNGPTLQRSGGISNVAIYDARKAL
                     EWVNTYISQFGGDPDEVTNWGFSAGGSQVMCAITAFGGNKWTPYFKRAVVNSPGWVPG
                     AGHAQAERFLQNVTEYVGGCPINTPDTIQCLRQVSFDTLLAASQNITSTYSYQMQPRA
                     DGVVLPDTAEYLLSIGQFHKEVQVFLGHSAHELNTQSTSAVTDDASFRAMFKTIFPSI
                     TDWAIDLIEELYPADDYSSQGLRFAAARQHYDIPGKLLPLTNAFSNQTYNYINYLGAA
                     THGSDQTYWWYSDSSSSASSSSESTSISTSAQATASASSSSDESSADAPTDGDTLPGS
                     SSLSSSEILVAKQMQRYLTSFVLTGNPNTYSSPGSGNITYVDDWPLYGSDENVLEFQP
                     SGAGFNLTSDELDSPQVVFWNKVLWY"
     gene            378578..379955
                     /locus_tag="CNK01270"
                     /pseudo
                     /db_xref="GeneID:3254592"
     gene            complement(380673..382963)
                     /locus_tag="CNK01280"
                     /db_xref="GeneID:3254652"
     mRNA            complement(join(380673..381359,381412..382283,
                     382334..382963))
                     /locus_tag="CNK01280"
                     /product="expressed protein"
                     /transcript_id="XM_567735.2"
                     /db_xref="GeneID:3254652"
     CDS             complement(join(381457..382283,382334..382868))
                     /locus_tag="CNK01280"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567735.1"
                     /db_xref="GeneID:3254652"
                     /translation="MSHSSPNLNPSQDVSPAERAVSVPNKERSAPDPTSENWLKRSVD
                     SLEASDPKRPKPSIKGKEKEIESERPRVTINWKNDLGHNARTAEQILIAWMSVPENWE
                     AWRSAQYDRRLNYFADVIIRQKLIEAGTRGDERSSGAILAKIEKTYHDFKAAYGVAER
                     GDNTLTPEEIERGITDIQGAILWHCKYYYELFPALSSTVKEGNAQASDPVSLLNSTEC
                     PSVTEAIGLEENSDAAPLSSSAFAIHKSNPNSVPITIRGMRTSSGTPVGPSSRPHRQS
                     LPPHFAPPRNSGAGPSRPTHITQLAPPPHVLPPSSSSHPSDAQHWRLELESRKITLEE
                     ARLKMEREELERRFKWERDLELRKLALEEKKLKFEQADRDRSYEIQRRTVQAKMTYQI
                     LETLEKLQKLGLEDWKLVKHLLFFDKEIKELWHGESEEEMDDVLSEDNAGSYEPSVGQ
                     SDE"
     gene            383233..384603
                     /locus_tag="CNK01290"
                     /db_xref="GeneID:3254605"
     mRNA            join(383233..383440,383499..383658,383707..383765,
                     383819..383934,383984..384285,384344..384603)
                     /locus_tag="CNK01290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658046.1"
                     /db_xref="GeneID:3254605"
     CDS             join(383375..383440,383499..383658,383707..383765,
                     383819..383934,383984..384285,384344..384447)
                     /locus_tag="CNK01290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513751.1"
                     /db_xref="GeneID:3254605"
                     /translation="MSDFTPCGSFSPSSFTSSTLILPVVSLGNVPQLTADLLIFSLGL
                     KRVGFVGKGDTVTPFAGRGEKKGEIVTGGLEVYGREESQLYVIQQRSPTLKSQKDRHV
                     SLLKTFINSNGFGAVLVLTSLDSAIQGDAQLSIPYQRVIPPGLRSLPNQIQKIQNIPP
                     LSLSLSQPASSGQSISSSYPPFLPAAGLTRRLLAALSEEKTLIPHGAIAAWCVEGDNR
                     GDARSFADVVLDVLDLQDVVQVQEPVSWEGLFGTTEGWSGGLGADAELYG"
     gene            386682..388158
                     /locus_tag="CNK01300"
                     /db_xref="GeneID:3254593"
     mRNA            join(386682..387211,387266..387376,387429..388158)
                     /locus_tag="CNK01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_567734.2"
                     /db_xref="GeneID:3254593"
     CDS             join(386939..387211,387266..387376,387429..388043)
                     /locus_tag="CNK01300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567734.1"
                     /db_xref="GeneID:3254593"
                     /translation="MSSAGPSRSPQPSSRFHPYTLHPHTHSHPSHHAEDYRTKSRRPE
                     RSPARNAKGEYPPSPPHSRRDASETPSVSLSMAFGGMGGGKWWDEELPPPPASLASIL
                     DSFRKSGEGDRELLLSILGAKKAEEERLSAMIHTRLTVLQARLSLHQAAALGAMSVPV
                     MPAPPSTALAMSNTSPNPQQPPVPRSEELNRSPERTPSLTSRDSGRSSSAGVASPPAQ
                     TASEFMPPPPRPVAHGYGNGYEKEREDPRPRFWQLHPNLASRVPPRPSGQDLPPLRDT
                     AEGRDKERSRGGSRSISPKDSGVAAGVGRDGRDRSGSGLEMLLDVGMRGLETERRE"
     gene            complement(388151..390098)
                     /locus_tag="CNK01310"
                     /db_xref="GeneID:3254389"
     mRNA            complement(join(388151..388289,388341..390098))
                     /locus_tag="CNK01310"
                     /product="DNA replication origin binding protein,
                     putative"
                     /transcript_id="XM_567810.1"
                     /db_xref="GeneID:3254389"
     CDS             complement(388341..390035)
                     /locus_tag="CNK01310"
                     /codon_start=1
                     /product="DNA replication origin binding protein,
                     putative"
                     /protein_id="XP_567810.1"
                     /db_xref="GeneID:3254389"
                     /translation="MPPTAKRPRQKSPQHEDPGARPRESPDPEASASHLVSFLSGYAD
                     HQSDEEENEHDLDDDDADRYEPSDQEEDAEDGVNEEEEETRVTPRKMGLLPASMTSTP
                     RSKRGTPKKRKPGSTTPTPRRTPVKTPKRSFVLAPGDGEQEDMGFIRASKADGYFTLM
                     AQSSKTSGNSYSLLADPLSKQAYERYIAESSEVRATLIPPETFMGKFRQWEKELEAGF
                     NLLFYGFGSKRPALNLFAQNRLAKKGHVVVVNGFFPGLGIRDVLSEVEDRLEVPQNVS
                     VPAYCSTPLERAAHRIYAYLLPPAAIQSHSRKHWPTASAPLYLVIHNIDAQSLRTPRS
                     IATLSLLASSPRIHIIASFDHVHTPIIFSTSLSNSPPHSYPDGGWRGTPQKDRGFNWI
                     HHSLTTYAPYDLELSYLRLSAQSLTPSGSGTGGISEEGALQILKSVPVKAARLLKLIL
                     TQQLSRLPSHPKWHVAYPAPSSGSGIAPPFAVDGYLLNKTAKDKFIATEDERFEAFIG
                     EYKDHGLVAEASVASDVDENHDGAVTEGRKEGRWFWVPLGKAAVERILQSMEDIES"
     gene            390284..394388
                     /locus_tag="CNK01320"
                     /db_xref="GeneID:3254402"
     mRNA            join(390284..390428,390482..390493,390547..390726,
                     390780..391052,391100..391290,391347..391514,
                     391570..391896,391949..392065,392114..392360,
                     392413..392538,392593..392678,392730..392777,
                     392827..392964,393018..393174,393228..393493,
                     393554..393716,393766..393917,393968..394076,
                     394131..394388)
                     /locus_tag="CNK01320"
                     /product="purine nucleotide binding protein, putative"
                     /transcript_id="XM_567811.1"
                     /db_xref="GeneID:3254402"
     CDS             join(390348..390428,390482..390493,390547..390726,
                     390780..391052,391100..391290,391347..391514,
                     391570..391896,391949..392065,392114..392360,
                     392413..392538,392593..392678,392730..392777,
                     392827..392964,393018..393174,393228..393493,
                     393554..393716,393766..393917,393968..394076,
                     394131..394295)
                     /locus_tag="CNK01320"
                     /codon_start=1
                     /product="purine nucleotide binding protein, putative"
                     /protein_id="XP_567811.1"
                     /db_xref="GeneID:3254402"
                     /translation="MSSKADSPKKKPANKADGPAGKDIRGFFTSGNSQKTSVTKQVAT
                     KSGSGKKPITINDSDDEPEEVVKTQSSSKAVPPSSAPNSTASKHFGSKAIVLSSDDEP
                     APARSKSVTKSASGAASKPVLTRKPALAKRKILSDSESEEEYYKPQRKRQSLGGRAGK
                     ESDDQGTKSTKKGKTKNDDDFGPVDVDNEDEYNFDDEDEPREKPKPKSTANKSPAAPK
                     KSTSVKKPAEPKTAKMEEPEKKEEKKFDWRAAAAARAAGPKAPGSKEIPEGAPDCLAG
                     LTFVFTGEMESLGREDAQELVRRYSGKVTTAPSGKTSYVVVGENAGVSKLNKVKEKKI
                     PMINEDEFLELIRQRSSGKGPDGTVDKAAVEKATKAREKEEKKILEQAKEMEEREKKE
                     EKERIRKQKALEGQGMAVKKMGPASAQLWTTKYAPTSLKEICGNKAPVERLGQWLQDW
                     QKNYKANFKKPGKDGMGIYRAVLISGPPGIGKTTSAHLMAKEAGYTPLELNASDTRSK
                     KLIENETNVDNKSLDGFFKGQGVGDINAAGLKIDSRTCLIMDEVDGMSAGDRGGVGAL
                     NTLIKKTKIPMILICNDRTLQKMKPLQSTTFNMTFRRPQPNEIRSRIMSILHKEKLKI
                     PPNVVDELVKGVNSDIRQVLNMLSTFKLGKSEMNFDEGKQLVKVNEKNTIMTPFTIID
                     RLTGPYAFSKNSKETLGDRIELYFHDFSFVPLFMQEHYLKTNPTVLNNLDGPEKNLKH
                     LELVSKAADSISDGDLIDRMIHGSEQHWSLLPLHAVASTVKPAMHVYGAMRSQGGGWG
                     SWGPAFPQWLGQNSKQNKLQRQLTDIQIRMRLRVSGSREEIREQYMPLLASKIVSPLI
                     DRGAAAVEETIEYMDEYYLGKDDWDAFVELGVDTMRDEDILKKIPSATKASFTRQYNK
                     TDHPIAFHKGDMFAGAKKKIDAGPVPDNEDVFEEDEPVPDEPEEDTDEEEDPLQDKLV
                     KAVKPKGKAAAKSASKPTAAKGVKSKAKK"
     gene            395047..397594
                     /locus_tag="CNK01330"
                     /db_xref="GeneID:3254380"
     mRNA            join(395047..395584,395634..395940,395989..396095,
                     396146..396332,396384..397221,397278..397394,
                     397446..397594)
                     /locus_tag="CNK01330"
                     /product="calcium ion transporter, putative"
                     /transcript_id="XM_567812.1"
                     /db_xref="GeneID:3254380"
     CDS             join(395093..395584,395634..395940,395989..396095,
                     396146..396332,396384..397221,397278..397394,
                     397446..397467)
                     /locus_tag="CNK01330"
                     /codon_start=1
                     /product="calcium ion transporter, putative"
                     /protein_id="XP_567812.1"
                     /db_xref="GeneID:3254380"
                     /translation="MASLPIVEPEPEPDIEGHNPQQQIHTNTSTSSGYPSNTGDATSQ
                     QQQNVLSEQEPGGSAPAIKQPTTLRTILKPRSRPGHARVPSIKISEVDPVSHGTADLP
                     SRPNSAPTISVDVNSGSAFGINRLAPLKNISIPLPPKMGPPESEEEKLPKTFIEPTWR
                     QCFRNTIKAQPALAAVPIILPISWALHFSHQDPIAIFVTSLIAIVPLAGGLGFATEEL
                     AHRVGEAWGGLLNASFGNAVELLIAILALVKGQLDIVQASMVGSILSNVLLVLGMSYF
                     AGGLRFHEQLYTIIGAQMHISLLGISLMAIVLPAAYHYAYPSTSDIVSSTRAGSQPEG
                     EELENLLKMSRGLSFILLAVYAMFLTFQLYTHAYLFRIPREKVRHPLPGPAPHHQHVF
                     PRPHWVDSIVDSSSSSSSSASSVSSVKSNRRFRKFRKFSVSSKKEQRQKEPCADGHEA
                     DNEGEQRQIPGNPLNPETPPVSEKNDNTLTQSSPISPFRTSSNISDTLRPSVANEDIE
                     RQSVVSSAESEHIIVDEDGTVHVQPKVKFHFALGMLFLMTALAGVTAEWLVDSIDGLT
                     ATGHVSREFVGLILLPVIGNSVEHITAVTVSVKDKLNLSMSIAVGSSIQVSLCLLPIL
                     VLIGWAIGQPMLLFFDTFETMALVISVLLVNFAISDGRTNYLEGFVMMMAYLSIALVC
                     WFYDPLV"
     gene            complement(397519..399298)
                     /locus_tag="CNK01340"
                     /db_xref="GeneID:3254649"
     mRNA            complement(join(397519..398217,398268..398357,
                     398409..398696,398753..398852,398916..399298))
                     /locus_tag="CNK01340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567813.1"
                     /db_xref="GeneID:3254649"
     CDS             complement(join(397625..398217,398268..398357,
                     398409..398696,398753..398852,398916..399191))
                     /locus_tag="CNK01340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567813.1"
                     /db_xref="GeneID:3254649"
                     /translation="MPFLPRTSFPFSPNTPSWFAGHMARSLRELPPLLENINLVIEAR
                     DARLPLTSINPIFDGVLRRWKARAKVEGERERIVVYTKRDLAETRFEGPLARAFVQNG
                     SQKIMFADTRKNSDVSHILRYAVDLAQKSVPFSPTYSILVLGMPNVGKSSLLNALRRV
                     GLRKGKAFQTGALAGVTKKLTGTVRIYEEPQVYVYDTPGVMMPYLGKGEEGGEKGLKL
                     ALTAGIKEDLFELDAISDYLLWKLNRRYVSEPSLPSYLSSLPLPPSFEPTDHLPTLLS
                     ALSNRLAAKQKGGEEDWESVMRWFVRAWREGKMGEWTLDELVPYRPVEVLLPHEVDNM
                     RLGGETVDLPVAGVPERQMSQGELDTHVNQTVTAYLSTLSSSTSLENPASVSQQRKIS
                     KSQRLQEKDAKLRGKGINVKRREEWQPGGVVSGGKRKGMSVKSTMGAAGRAVRRRG"
     gene            399449..400827
                     /locus_tag="CNK01350"
                     /db_xref="GeneID:3254646"
     mRNA            join(399449..399754,399815..399966,400022..400289,
                     400354..400827)
                     /locus_tag="CNK01350"
                     /product="mitochondrial ribosomal protein s24, putative"
                     /transcript_id="XM_567814.2"
                     /db_xref="GeneID:3254646"
     gene            complement(399479..401515)
                     /locus_tag="CNK01360"
                     /db_xref="GeneID:3254660"
     mRNA            complement(join(399479..401074,401130..401515))
                     /locus_tag="CNK01360"
                     /product="mitochondrial ribosomal protein s24, putative"
                     /transcript_id="XM_567815.2"
                     /db_xref="GeneID:3254660"
     CDS             join(399498..399754,399815..399966,400022..400289,
                     400354..400759)
                     /locus_tag="CNK01350"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein s24, putative"
                     /protein_id="XP_567814.1"
                     /db_xref="GeneID:3254646"
                     /translation="MSAPNATASSSKHKKDKSKEKHGKEKHHHDKSKSKKDKKSKSEK
                     HEKGEKSPFEHREMRMRLSVPPKFAGDVMAGVRDQLDGMIMQYVPEVKGVLIAHWDHS
                     FDDDTAKIINECPFEVVNVEFHAIYWAPKIGQKLRGIHSISSPSHLSLIFAGAFNVSI
                     PIQHIPADLYEFEETDEVVETESLDGSEVEYVDKNEMEVKETGRWRNKKTGEFFGKRE
                     LVKFTVIGMQVTNQMLSLTGSLLEDPSNPPPAPEIVAVPIMPSPSPSPEPQQLRPAKK
                     ARTQAQSQVKQVDIKDEVDTSKMTARELKAYRKEEEKKKRDARKARKEGRVDDDAEGE
                     EQEEGSAGTKRKADEQEGEKRKKKKE"
     CDS             complement(join(400961..401074,401130..401429))
                     /locus_tag="CNK01360"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein s24, putative"
                     /protein_id="XP_567815.1"
                     /db_xref="GeneID:3254660"
                     /translation="MPVRIRFARHGHRKNPIFHLVAINSKRPRDGKPLELLGVYDPIP
                     RVREGNTPPAAANVFAKGTEDMIVKEKKVELNVDRIKYWLGVGAQPTRSAVKLLERGG
                     VLTTPHKWQHMWSPPPSGIPQTGAASGKAVESTLP"
     gene            401909..407292
                     /locus_tag="CNK01370"
                     /db_xref="GeneID:3254635"
     mRNA            join(401909..402258,402321..402529,402582..402774,
                     402825..403172,403223..403390,403444..404059,
                     404111..404214,404280..404402,404463..404577,
                     404657..404794,404861..404970,405029..405147,
                     405203..405332,405390..405450,405504..405554,
                     405621..405811,405862..405930,405988..406212,
                     406266..407292)
                     /locus_tag="CNK01370"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_024658047.1"
                     /db_xref="GeneID:3254635"
     CDS             join(401989..402258,402321..402529,402582..402774,
                     402825..403172,403223..403390,403444..404059,
                     404111..404214,404280..404402,404463..404577,
                     404657..404794,404861..404970,405029..405147,
                     405203..405332,405390..405450,405504..405554,
                     405621..405811,405862..405930,405988..406212,
                     406266..406538)
                     /locus_tag="CNK01370"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_024513772.1"
                     /db_xref="GeneID:3254635"
                     /translation="MPLTTITYTLHPTPSPASSSSSVLHNAVAGIKAHLPLRNLHWKS
                     SSRTSLRTIQEVDIDLVDLGEVTSLRDKNVSVLDSPLVNMCLVVCEDGEVYKSQTRNF
                     IRDWLSLLAARRTPHAPLIVLVNPPNSAADKSGKTVWGKDKGVLGKLKADFNVGKRDR
                     CVQLNLPPPGVNDPAAWPELINKLKECFVIAFDSAILEREDEVKRGEAQRVMVGWNFC
                     TWFLLKESLAQSFEGVNLPEDSLIIYEELEAAFIQVLKEQNLSWFGKLGATGSRDDSL
                     PVLNTTMKPYREMLRSSSISVFDFRIYLFARQGILLGKLGRITEVAKRGQWFVASLAN
                     RLRENEADLAEHFIESWTYTACMDIVSKCDQWARLERPNNDYSGLTAYESVRSELLDI
                     ARIQVEHLGVSSGHLPSTYPFQSFQSASVPQSSTSDVLFDESTLASSVPSSPVVPIDS
                     SSTSRPQMSNSILLAAIADRSNFFALYRDLTLKVIAAYRKCAKNLSCIRPLTNLLGLA
                     VILDQWDEAYTQAQELAKECQELGVWDRVVKYALGVALKASKKLDKDGMEWGELAIGY
                     LEVSVRETGKTGDGDEDELLKEVIEGLKKVNEVWNVEGHRSFSIRLLGKETKIDRNEI
                     TVDVEITNELDIDVEADGVEVRLSHPHSGGVVHFSAKETSLHPGVNLIRLSSSTSTHG
                     IYNLQSASLFLGQLNFNYDLKDSGRSVIIRRDEVKLTDDTLVILDIKNGQVDLQEVRV
                     NLTSLTRGVGFILEDAKWDETNLTLNDEGLITIGDIRAEETVRISIPYTGLPPTDYMR
                     AHIMLLHNTDKGVRQWVDVQTIDTGLPLTINVQDFFRPDCLLSHFTVSPDDKEILRIA
                     SAALIAPDGSGYEVESCRKQGGGPIVSVASQPLSFLFKIRRKKDGDPVSSLNLRIKYR
                     QIDEEIRSSVTDALRSLSPTSRSSIERAVREILADRSKWRSYLIGESLEEIFRYELKD
                     MGDSGLAFCESIKSATLPEWRSLEIPVDVPQRRLLTAISLTPTLSPSTSIYQGRPLAF
                     LLKLSTSSQWMGLPSELTKEEKTQRLVYDVQVNPEDWIVLGKKKAYFVPDPEKDVSVE
                     IVLLPTRAGTIFLPNVAIYPLDSPGGSSEGQAKIQGVLCESYMKNAAQTVRVLPAKKE
                     VTVLVPVPLPGAVPIGEQWEGVRA"
     gene            complement(405571..407543)
                     /locus_tag="CNK01380"
                     /db_xref="GeneID:3254647"
     mRNA            complement(join(405571..406491,406582..407269,
                     407335..407543))
                     /locus_tag="CNK01380"
                     /product="expressed protein"
                     /transcript_id="XM_024658048.1"
                     /db_xref="GeneID:3254647"
     CDS             complement(join(406654..407269,407335..407486))
                     /locus_tag="CNK01380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513773.1"
                     /db_xref="GeneID:3254647"
                     /translation="MSSDKSQVTPYGQSQATQYKTHPFHTKGDITLVSSDGVLFKADV
                     WCLAHASAVFHDMLEMSNPSVADTSTPESISVPAKPPHPSEPIDIPFPSRTLQLFLDL
                     SRVSDDVMLAITMEEAGDLLSFSHLYDLREFVLKKLKDRAMDLGRRRPWDLLVLASRL
                     DLDDLGVSALEAMNEDTFVRGQKGSTSNFWESIALLQNGWQSRIIKSVIDKPEGGSVR
                     RPGYPDDYSYKTGYVFKLRDWSEAGRRFRNTRLRDEQ"
     gene            407727..409577
                     /locus_tag="CNK01390"
                     /db_xref="GeneID:3254640"
     mRNA            join(407727..408006,408068..408240,408298..408617,
                     408671..409253,409312..409577)
                     /locus_tag="CNK01390"
                     /product="histone acetylation-related protein, putative"
                     /transcript_id="XM_567818.2"
                     /db_xref="GeneID:3254640"
     CDS             join(407835..408006,408068..408240,408298..408617,
                     408671..409253,409312..409437)
                     /locus_tag="CNK01390"
                     /codon_start=1
                     /product="histone acetylation-related protein, putative"
                     /protein_id="XP_567818.1"
                     /db_xref="GeneID:3254640"
                     /translation="MPPKLTALQPPSPSPPPPTNDAQDLLVIQDIMDTLDQIPPELTR
                     VHSDLNELGAVLYSTLVSLEKKLYTLIDWIQDPNVTPEKRFELLQEIAEEAARYKLGG
                     DDKIRVAAGACDGILNHQKHISNLLASSTLLVPSPPSPYSQSLTLPFPQPVTNSRRVA
                     RAANSPFGSRGYTANGGPSETKVGDTPSKKKRSRVQQLGARDDDESSSAGGEKKKPVK
                     RRKQNRATSPTDSVVSNSGFGGKPIEPRTARQLAAAANRARREADDGGSDTESRTGND
                     EKRSNVPMQPSFSIDSKRTDGLGLDTGSREGSGVRSANVTPTLGYAAVMPPTAELKRP
                     SRRGGKRSSTNIPAAEEFEEEESEGYGDDDRSKRGERYAEMEMGEETGGAGDDLDSKV
                     YCTCRQVSYGEMIGCDDDDCEIEWYHIGCLGLDKTPAGNWICPRCIERRKKQPRGKKG
                     TRGKARK"
     gene            409685..410903
                     /locus_tag="CNK01400"
                     /db_xref="GeneID:3254583"
     mRNA            join(409685..409823,409887..409929,409996..410056,
                     410122..410365,410443..410903)
                     /locus_tag="CNK01400"
                     /product="pyridoxine metabolism-related protein, putative"
                     /transcript_id="XM_567819.2"
                     /db_xref="GeneID:3254583"
     CDS             join(409772..409823,409887..409929,409996..410056,
                     410122..410365,410443..410780)
                     /locus_tag="CNK01400"
                     /codon_start=1
                     /product="pyridoxine metabolism-related protein, putative"
                     /protein_id="XP_567819.1"
                     /db_xref="GeneID:3254583"
                     /translation="MTIQPEQVPEKVVIGVLALQGAFIEHIHYLQRLRPHGHTIEAIP
                     VRNADELSRCHALILPGGESTVISHLASLTPCLLPALLSFAQDPSKAMWGTCAGMILM
                     AEEDGIGGGKKKGVKGWGGVKGLKVWRNLYGTQLESFEAALDIPVLSDPSRPFNAVFI
                     RAPAVHSLAPTKTDMEETQVLATLPAEYLPSPPPCDSPLGEPNVDDLGKVMIRQGRKM
                     VTSFHPELSGDMRIHEYWVEKCVLGRR"
     gene            complement(410884..414743)
                     /locus_tag="CNK01410"
                     /db_xref="GeneID:3254554"
     mRNA            complement(join(410884..412076,412130..412849,
                     412902..414491,414535..414743))
                     /locus_tag="CNK01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658049.1"
                     /db_xref="GeneID:3254554"
     CDS             complement(join(410953..412076,412130..412849,
                     412902..414491,414535..414688))
                     /locus_tag="CNK01410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513742.1"
                     /db_xref="GeneID:3254554"
                     /translation="MASQKGAHYHQALAHALTAGAWSHAAPATTPRAAPLSWPELVRK
                     WGKHTQHNTALVHRLRDISLLYLASTGRPSHSRPFLAPPRPGPHPSPSPPASAESESP
                     TASSFVHVPRPHLRRRRPADDAPAAARPAAFLSAADLDGDDAQDQRAWSEGEAWWAAV
                     PPDETSDGAGELEALLASGHLPPAERESAKLVLAYHLHAAGAHDAALRRYDTVDWATD
                     ARAGVVEGDAAVVDRLRARCLQGLCHELSSTPSPALALQAYLATVPLFHALAAPSFDA
                     CREACRFLATALFRAAILAARQPAGARAQTLAILRTFHACSASWPASFRPVQRQKMLV
                     LYLRALLSPSPAPALPRQQWEKQVSLALTNGQALLEQSTTFPRAGSVNHPVVLFAQLA
                     VQLYTLLPRSRALSDQVVGLLWWATTLTFQSQSILRALIRVLSDREEYSDAKRVFELY
                     VGLVLKARQTAQPEIALQLQRRPTDDDAAHPAEIQRQASQATRTADPSPEADALVRQA
                     TSASHEADDDTDFVQTLLAGAKLLTEGMNEPEEAWRYACLAGDVVQVGKLAHNKELEA
                     SVEQVKGIVRMLMARNVTPHERANYQSQSLNHLAFSTTIAPTPTSLYHLAHAYAQARK
                     IPQAIDAIRKSLEMDEKNVEAWHLLGILLTSMRDWEAARKAVEAGWRVWEETDENERR
                     MEEGVEDGAAAQDLMATRPEISSKDFAAPFTDTAASSPLVLPTGAFPPLPPLPASPPT
                     SSYRLAQVIRLRMTLNMIIEKTMGCEEAMVRQQDLFAFFSARCSLAVANRQPQSGAAG
                     GEKKEVPDREEGLGESFVNIKEQEKDSPIPITATSPDGIPTLATPIPPTPTSLDPAPL
                     PTEVQMINENTLTPFRSVSEKGRRRRSLSLSLRSKSSKPKNQLGVLPARGGGGGRTAS
                     LRGAVLSGEMEKATDYGGLQPLALVGANPRGRTVSHSTAPSIVPTAIHSHYRSSRARP
                     FPSPPPAPPPPSAPSKPSPLDNRSPQEKRILSDLWLASAATFRRWGKLEQCLVSVMEA
                     EGLDPGNEDVWVQLGMYHVANTAMTMSSKASAGKEEEEDDDGEKERVWKPAEEAFSKS
                     LLLKTDHPPALVSLAKLYLSTSTFQNLSTSTPTDHAPKRYQGADLAESLLNPFTQSIG
                     WDIPEAWYLLGHVARVQGREERARECWEFALGLEQGRGIRDWSCLKRWL"
     gene            414720..417049
                     /locus_tag="CNK01420"
                     /db_xref="GeneID:3254584"
     mRNA            join(414720..414810,414847..415064,415107..415189,
                     415236..415356,415406..415993,416039..416258,
                     416309..416604,416663..416758,416818..417049)
                     /locus_tag="CNK01420"
                     /product="threonine ammonia-lyase, putative"
                     /transcript_id="XM_567820.2"
                     /db_xref="GeneID:3254584"
     CDS             join(414797..414810,414847..415064,415107..415189,
                     415236..415356,415406..415993,416039..416258,
                     416309..416604,416663..416758,416818..416954)
                     /locus_tag="CNK01420"
                     /codon_start=1
                     /product="threonine ammonia-lyase, putative"
                     /protein_id="XP_567820.1"
                     /db_xref="GeneID:3254584"
                     /translation="MAPTPIPVPAARPAASHLSKSPPTTNEYTSTAPIPALPPQHTDE
                     GVPSHLYQGLPAHLLIDDAQGQKVPDYLRMILMSKVYAAPLNLKETPLTYAANLSARL
                     GNEIWIKREDLQPVFSFKIRGAYNMMASLSDEEKKKGVITCSAGNHAQGVALSGHALN
                     IPAIVVMPVSTPSIKWRNVQRLGATVLLHGRDFDEAKAECLRLEKEKGLTFVPPYDNP
                     YVVAGQGTVAMEICRQVTDADQIDGIFASVGGGGLAAGIAAYMKRVAKPSVGIYGVET
                     VDGDAMDRSLKAGKRVLLDEVGPFADGTAVRLVGEEPFRVCKNFLDDVVLVNNDEICA
                     AIKDVFEETRSVPEPSGALALAGLKAHIIRNNLQGAGKRFVAVISGGNMNFGRLRFVA
                     ERADVGERREVLMSVRVPEKPGSFLKFHSLLGSRAVTEFSYRHSNNSTGYIICSFLLS
                     SSSSSSSGPSPEARANEIHEMVESFKQHGIEAVDLSEDEFAKSHVRHLVGGRSAVEHE
                     RIFRFEFPERPGALGNFLKGMKVEWNISMFHYRNHGADVGKVLIGVQVPSQDNPAFDE
                     FLEKLGYPYVEETHNEVYTMFLRS"
     gene            417275..424973
                     /locus_tag="CNK01430"
                     /db_xref="GeneID:3254656"
     mRNA            join(417275..417658,417730..417855,417904..417999,
                     418073..418382,418436..418740,418802..419007,
                     419063..419354,419414..419599,419655..422777,
                     422828..424342,424392..424481,424542..424668,
                     424724..424973)
                     /locus_tag="CNK01430"
                     /product="DNA polymerase epsilon, catalytic subunit a,
                     putative"
                     /transcript_id="XM_567821.2"
                     /db_xref="GeneID:3254656"
     CDS             join(417347..417658,417730..417855,417904..417999,
                     418073..418382,418436..418740,418802..419007,
                     419063..419354,419414..419599,419655..422777,
                     422828..424342,424392..424481,424542..424668,
                     424724..424788)
                     /locus_tag="CNK01430"
                     /codon_start=1
                     /product="DNA polymerase epsilon, catalytic subunit a,
                     putative"
                     /protein_id="XP_567821.1"
                     /db_xref="GeneID:3254656"
                     /translation="MPSRGSFRGRGRGSGSGFGSNTRFTGRRRGRGGGGGGGGVAYGI
                     DRRPATSTNQANREDGTAATEKFEEVKVYDEIDEKIGFWRFESVRAEGEEKVGWLVNM
                     HQTLVPSDVHPGGLAAVDYYFIQDDGGSFKVSIPYEPYFYLTCRGGTESIVEEWLLKR
                     YEGIIIRIEREKKWDLSLPNHLLSAPPVFLKLFFHNTADLQTIRRDLLPLARSNSEKF
                     TAVDAYADVVSAEAAANGHGDDENRAWGAEDDTKKKKDKEPSECIIEVREHDLAYHLR
                     VAIDLNIRVGLWYTVTSRTGVITLERIPDRVKRADPVVMAYDIETTKQPLKFPDQQTD
                     QIMMISYMIDGMGYLITNREIVGEDIDDFEYTPKDEYPGEFTVFNEPDEPAVIRRWFE
                     HIRDSKPTVIATYNGDSFDFPFVDARAKIHGISMYEEIGFKPDIEEEYKSRSTMHMDC
                     FRWVKRDSYLPQGSQGLKAVTTAKLGYNPIELDPELMTPYAIEQPQILAQYSVSDAVA
                     TYYLYMKYVHPFIFSLCNIIPLSPDEVLRKGTGTLCETLLMVEAYDAHIIMPNRHEDP
                     HGVTYEGHLLASETYVGGHVEALEAGVFRSDIPTHFKIVPSAIQELIDDLDAALRFSL
                     IEEGQVKLEDVENYDEVKQQIQTALETMRDEPNRFDNPLIYHLDVAAMYPNIMLSNRL
                     QPDSVKEEADCAVCDYNRPDKKCDRRMEWAWRGEYFPAKRDEVNMVRYALEQETFPPK
                     RPYDPKRRFVDLTPTEQSALLHKRLGDYSRKVYKKTHDTKIVTKTTIICQRENSFYID
                     TVRAFRDRRYEYKGLHKTWKKNLDKAFEEGGAVATVDEAKKMIVLYDSLQLAHKCILN
                     SFYGYVMRKGARWYSMEMAGITCLTGATIIQMARQLVEQIGRPLELDTDGIWCMLPGV
                     FPEDFNFKLKNGKKFGISYPCTMLNHLVHAQFTNDQYHELVNNDSGTYNVKKENSIFF
                     ELDGPYKAMILPSSKEEDKLLKKRYAVFNPDGSLAELKGFEVKRRGELQMIKIFQSQI
                     FDKFLLGKTTEECYAAVATVADQWLDILQSKASSLHDDELVDLIAENRSMSKTLAEYA
                     GQKSTSISTARRLAEFLGEQMVKDKGLSCRFIISAKPNGAPVTERAVPVAIFTAEEPV
                     KRHYLRKWLKDNSLTDFDLRTILDWDYYTERLGSVIQKLITIPAALQKVPNPVPRIRH
                     PDWLYKRIATKEDKFQQHKITDMFTKLKDMEDLGDGQKKVGPKLAVVRRRNRKEQEKE
                     SEVEEVPPEPEYDYAGYIRIMKKKWRKQRQEKARARKSGLRQDGTISSMLRTQTSSMN
                     SKQWDVIQIASTNRPGEFKLWLAIDGTFQSVRLKVPREFYLNFKEDPEPQMLATDRYE
                     AVEVVRTLPRGQPARHLYKLSVDEVLFMEGESHFSTLINNPNVDGAFELQVPLVVRAL
                     LSLGTSCALRSNILGGLNRGLDKGFDLVDLERSGNLSRRKYLNEGRGIRYHFLFHAVA
                     DQRHIIGLFSPDSTNASIYLVDRAKNRQQLPNPLKFYTDRVERAERGVFSYPDMLDFT
                     TSYHSSESSAFKALGKDLQAINHGLNVIALCSPFEHSYYQAKAPVYSNFPFITYRLGK
                     EEDPGLMWLLQTSRRMIGLYLRLSSWLKEQIQIASHFDVPIGNLGADIAVFLADIEFA
                     RRLKQQDMLIWWSSTPRPDLGGSEEDANSSEDLVSPHISNRGCYSSTVLEMEVSDLAI
                     NAVLQSALVNEMEGSGTGSLAFDSASHNLDEYAKGAVNTSVMLGDAVLSTQTFGVLKS
                     MLRAWYADKARAHVKGDSLSPAEIVVDQFWRWISSSTSSMFEPALHRFLHGLMRKTFL
                     QLLAEFKRLGTQVVYADFGRVFLLTSKPDAGSAFAFAKYLVAAANSQELFRHLIIDVA
                     QFWNYLAWMDVANFGGVKVSPETAASREPPAKRFEISMDWNIQSFLPGTLQPVFERNV
                     ASFIFSLYSAKRSSSDGREPLRVIHSLNIDQPGTEATSTMNPTKEKEKKAASKSISQT
                     LTRRLLSDIAAVKRQQAAVHLEPEEAYTLAFPDLPGARSKRINPTLELIKAITEVYSL
                     ASEHSIEVQILKRNLLDLIGVKEFSSDAAFNPPCESIEVPMVICKKCNAIRDVDLCRD
                     PDRLPSVNPDSGEMLEPARKNWVCHKCDSEYDRFQIEQPLIEMVTKTITNYQIQDVIC
                     LKCSQTKSDNLAATCKCGGGFRTTSNRNELKTKLKMIKSVCDYHKLPFAGSYVEETLS
                     RW"
     gene            425234..426616
                     /locus_tag="CNK01440"
                     /db_xref="GeneID:3254611"
     mRNA            join(425234..425591,425648..425995,426052..426616)
                     /locus_tag="CNK01440"
                     /product="expressed protein"
                     /transcript_id="XM_567822.2"
                     /db_xref="GeneID:3254611"
     CDS             join(425306..425591,425648..425995,426052..426545)
                     /locus_tag="CNK01440"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567822.1"
                     /db_xref="GeneID:3254611"
                     /translation="MPLYKFLVTGYRPSLSIFSFDPSTAKVKLVSEFSPAPQNGTRLE
                     LADPTSVSSQGTERNLYWLSDANKGSAVSLKLADDQIEITAERLSHGGGVHIHVMKDG
                     SGIVVSNFIGGSIIFFPITASGALSETSESPLLTLPFVYESQTAPNVKRQEASHAHHV
                     VEGRNGILYVSDLGNDRIWIVKREGESGLAIKGYLQAPPGTGPRHSLISKDGKYLYCL
                     TELTSDILVFPLEDTFETIQPLPDFKCNIIPPSVPAAAHHHLNAAELIFNPTIPNVLY
                     ASNRLELRLPAEFATGELGDAVAIVTLNEEGNKLVDVKFIRTGCNNIRGMRASPDGKY
                     VAVAGRYGGGVEIWSVGDSGVDWRLAGKDENIDSVTDMAWL"
     gene            complement(426561..427947)
                     /locus_tag="CNK01450"
                     /db_xref="GeneID:3254614"
     mRNA            complement(join(426561..426749,426801..426994,
                     427052..427110,427166..427263,427325..427687,
                     427744..427947))
                     /locus_tag="CNK01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_567823.2"
                     /db_xref="GeneID:3254614"
     CDS             complement(join(426713..426749,426801..426994,
                     427052..427110,427166..427263,427325..427687,
                     427744..427754))
                     /locus_tag="CNK01450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567823.1"
                     /db_xref="GeneID:3254614"
                     /translation="MFKKFNPKEDVSSSTSLKSSVQRNIRSSILSQITYLSLPAWKDQ
                     SAATEASIEHAEPAAEEKEKEEPTSGKGKGGKKGGKGKGGKGKGKDKEEKEEKEDDGE
                     GAGVESVLDEFWPKKEALGLTKCHDRISIFTIHSVPIFFQHFDGPFIPTLKLLHKYPD
                     MLPRVQIDRGAIKFLLAGANMMAPGLLSAGGKLPDGLGKDTIVAIQAEGKQHACGIGK
                     LVASSADIKKAGKGVAVETICWIGDDLWKVDTIGL"
     gene            complement(428053..429542)
                     /locus_tag="CNK01460"
                     /db_xref="GeneID:3254615"
     mRNA            complement(join(428053..428288,428353..428618,
                     428670..428899,428947..429040,429096..429267,
                     429325..429359,429449..429542))
                     /locus_tag="CNK01460"
                     /product="eukaryotic translation initiation factor 3,
                     subunit 4 delta, 44kDa, putative"
                     /transcript_id="XM_567824.2"
                     /db_xref="GeneID:3254615"
     CDS             complement(join(428230..428288,428353..428618,
                     428670..428899,428947..429040,429096..429267,
                     429325..429359,429449..429465))
                     /locus_tag="CNK01460"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3,
                     subunit 4 delta, 44kDa, putative"
                     /protein_id="XP_567824.1"
                     /db_xref="GeneID:3254615"
                     /translation="MADSKQSNRDWAADDVDADELPPTTESTDANGITTIVSWKYNAD
                     DQKVKVTRRVRRRLQVSTVTQTMAERKQWPKFGLDKGKPPGPDRKTTIIGENLHFKIA
                     PISKIQRVEPEPETAVKAPTGKAVVCRLCSGQHYTARCPFREQLAAIDNLNADGAEEE
                     QVVVSGTLAAKGAGETGGKYVPPSQRAGATGAGDSMFRARDELPTLRVTSLSIDAEED
                     DLRALFQPFAKNGKLGRANIVRDRNTRVSKGLAFVSFESKRDAEAAMAHLNGRGYDSL
                     ILEVAWSQPRGERT"
     gene            433240..438106
                     /locus_tag="CNK01480"
                     /db_xref="GeneID:3254549"
     mRNA            join(433240..433932,434176..434394,434627..435953,
                     436003..436330,436379..436439,436488..437174,
                     437230..438106)
                     /locus_tag="CNK01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658050.1"
                     /db_xref="GeneID:3254549"
     CDS             join(435413..435953,436003..436330,436379..436439,
                     436488..437174,437230..437820)
                     /locus_tag="CNK01480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513760.1"
                     /db_xref="GeneID:3254549"
                     /translation="MGRTYPRPGQPHTSSSPFSMSPQYERPPTSTHTATSSSSLPVLA
                     TPPSFHLHSFSLIDRGLTGKLDHPLDPLGQHSKVRPTLPALPFPSLRKSHGFLPSIAT
                     QALAHYHFPSNYTPADTSQRISKNLISQAHSPFASPGALSLSPEVGRPKKKTKMDMNM
                     AQTGSMAALPGIQTPLASYVAQMVVWLWYGQFQQQQPLSPISPSNSSIPDPFDPAYQP
                     QRISQLMVQPSAVFSEFVARLLQVTMVSHSVTLVAILYVYRLKMRNMFYSTPGSENRP
                     FVAALMLANKYLDDNTYTNATWSELAGIPLTEISRMETEFLVGLNYELGVEVDEYERW
                     KMLLDEFMLSRGPGNAMPAAKHKWISGQTPFNPNLACTPTFSYNTRAKSASPPRRLRP
                     DYAALPGSRKRSAADAFFPDSVPPPLHDNYLPVPPPSQPYSQEPPLPSLRTRPALVAQ
                     TSNSSLARSASLNRQLARLPSNFGGRRGSTGHVYPAPTPKEPALQYQQPSPSTYGQLV
                     QAAMQTGWDSNRALLAPYDDSLAQPHLVPPEHLMFYSLAAEPQTGTAGQPRKAILRYQ
                     APAVEHSFNYASHPSYPPYNPQASQASYPYQVPPPPDLSPQDVVMFDDHLRPPASYYP
                     PGHADSHSETQGMYTPDPYIAAPVWRTPMQVGPQPAQFANAGPPGYVYNPYMPTTARW
                     AGFTPATHGEPIYPGWTRTSDGVLYYHSEPQVEGPPVWTSRSEWSSPVSRFHM"
     gene            439482..440690
                     /locus_tag="CNK01490"
                     /db_xref="GeneID:36393101"
     mRNA            join(439482..439781,439907..439945,440016..440066,
                     440134..440173,440258..440280,440377..440569,
                     440621..440690)
                     /locus_tag="CNK01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658805.1"
                     /db_xref="GeneID:36393101"
     CDS             join(439533..439781,439907..439945,440016..440066,
                     440134..440173,440258..440280,440377..440505)
                     /locus_tag="CNK01490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514640.1"
                     /db_xref="GeneID:36393101"
                     /translation="MTTIPYSKPRNKADVVRESLAHPANNPYYLSHLSYPTASNSSFI
                     YLMSQRQQGGGMGMGGMGMGGMGMGGMGMGGMGMMNPMMGGMGGMGMMNPMMGMGGMG
                     MASPMMGMGGYGDARWRSWFWSIRDAEVSPRRAFRRLRHGNGSDAWRNDGWNGYDDGR
                     LWDEHGNALGVLRDGL"
     gene            complement(440715..443170)
                     /locus_tag="CNK01500"
                     /db_xref="GeneID:3254512"
     mRNA            complement(join(440715..441381,441434..441532,
                     441581..441672,441738..442014,442068..442125,
                     442173..442249,442303..442397,442448..443170))
                     /locus_tag="CNK01500"
                     /product="expressed protein"
                     /transcript_id="XM_024658051.1"
                     /db_xref="GeneID:3254512"
     CDS             complement(join(441345..441381,441434..441532,
                     441581..441672,441738..442014,442068..442125,
                     442173..442249,442303..442397,442448..443038))
                     /locus_tag="CNK01500"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513741.1"
                     /db_xref="GeneID:3254512"
                     /translation="MLMPSTSAAILLLIFCSSARAVPACVRGTTAAATTLSEPNASII
                     YAQLPTSASGTDQESSLMLNSGKSNSILAATLESHSWSSSYSGGSGSVSNTAAPTRVT
                     FTEQALTSAHLAENSSSSKLPATSAKVATLATQVSNVTVTTGQLMSTKAKVVSSSKGS
                     SAVSATKTGSSFSKMGISWPVQEKDASPIAQFFTSTSTISWWFDWNKNWNQGILNADS
                     VNVSGKFIPMLFDKNFLDNSDTLQKGFTEIMGYNEPDLQTDNGVSSYIDPVTAAGIWK
                     TQITTLRSTYPTIKVQSPVMASDQAWLSTFFATICPPPYSAKDGWGDCPYKPDYVAMH
                     LYTTDPDDFMSTVSAFQKTFGLPLVLSEFACHSFGTNSNPSTADVSTFMQKTTSWMEK
                     QSWLVRYAWFGTVRDSTYLYGVAETNRLMDVTGQLTDLGKQYMNGGQPL"
     gene            complement(443457..445115)
                     /locus_tag="CNK01510"
                     /db_xref="GeneID:3254657"
     mRNA            complement(join(443457..443631,443687..443785,
                     443846..443885,443934..443991,444046..444283,
                     444343..444397,444443..444519,444577..444677,
                     444739..444807,444861..445115))
                     /locus_tag="CNK01510"
                     /product="expressed protein"
                     /transcript_id="XM_567740.1"
                     /db_xref="GeneID:3254657"
     CDS             complement(join(443598..443631,443687..443785,
                     443846..443885,443934..443991,444046..444283,
                     444343..444397,444443..444519,444577..444677,
                     444739..444807,444861..444893))
                     /locus_tag="CNK01510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567740.1"
                     /db_xref="GeneID:3254657"
                     /translation="MSDDGQVQRGKAGISWPAQELTSDPIAKFFQYGSKLSWHWNWTK
                     HWKGPLVPETSDDLEIDAEFVPMIWSPQSLDDGCDLQEGWNLLLGFNEPDLDNEAVAS
                     HRSPQEAADAWIQLAQLRTDPDNQHLVSPAVASNVEWLKEFLSLIPEDTYPAYLAVHL
                     YTTTFDDFVGKMEMYHNEFGLPIILTEFCMQSWDEGVPGPEDQQQVHDYMGQTTKWLD
                     ETDYVIKYCWFGAVRDTANLHDVHPFNRLMDENGEITPLGFQYMYGGHE"
     gene            445335..449776
                     /locus_tag="CNK01520"
                     /db_xref="GeneID:3254616"
     mRNA            join(445335..445649,445712..447170,447219..447539,
                     447603..447828,447883..448150,448202..448909,
                     448960..449776)
                     /locus_tag="CNK01520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567826.2"
                     /db_xref="GeneID:3254616"
     CDS             join(445721..447170,447219..447539,447603..447828,
                     447883..448150,448202..448909,448960..449568)
                     /locus_tag="CNK01520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567826.1"
                     /db_xref="GeneID:3254616"
                     /translation="MSSPTSTSPKSSFVFSPTSFPHAAIASNNVRPRTNLPPPPPPDR
                     IPPPKGRSHQQKFKILRKEKDKDRRQPIDLEDDWTIEDVTVNGDGVEQESQYLDDLQP
                     EENELKPGPRFLEMANREEKKEKTSKSRGLVKKTSRLFGRDKDKDRGKPEEPAVTGSS
                     SSTLAAMRQSSSTSTDSTTSRSITSAFTRQNSIQSRRSPRTSFGQAHSRRASQDSQMS
                     WPAPRSIRSSTTSHDPSSDPQNSASSTGVPIPQRQGASMSSLSRYSLPHPNGGTSRSP
                     DTFPNKMSTWFSHLLPVSSGSPPSSSYETSSSIRKQSSVAASLFNAARQKAVDGVRHL
                     LDSEAQPDKCMDTIWVRGVAHPGWRPITPENSTSNLPALEPGGSGGGVEDRRASLSMN
                     GPSPNSLRPSSWKRNTSLPPTGQPQSPAHVHTQASNQTTSPSKGFTGIWNPSTLSLGM
                     PIGGSPNKEKENGSGAESPSKKKSKEIVKWPEQFYDDFKSTVWFTYRNQYAPISSLSP
                     NLLIPSPEAYYASFGPPLDATSPSSLRVTTPTAAAQQSASGSGGWGWSKEERGLTSDA
                     GWGCMLRTGQSLLVNALIHIHLGRDWRVPSTPASFSEATTTQEIAALKDYAKYAQMLS
                     WFLDDPSPLCPFSVHRMALIGKELGKEVGEWFGPSTAAGALKTLANSFAPCGVAVATA
                     TDSIIYKSDVYTASNLPSDDWNSISPTFNSSKKKRRGDNEAKEEKWGKRAVLILVGVR
                     LGLDGVNPIYYDSIKALFTFPQSVGIAGGRPSSSYYFVGSQANHLFYLDPHLTRPAIP
                     LQIPPLPVHSAKEKGSTESSSIMSTAEEESEEGVMIRTPETPRSTTPSMFSAPEHVED
                     EDQEEWGQGSKYKLDVVDADGVEVEGIDDDKGRNEGKMIREEVPKSSFESNGAAQEQP
                     KKQKGFTSTASIDSQVDSQVDPHMLWYTTAYPDPLLRTYHCEKIKKMPLSGLDPSMLL
                     GFVCKDEDDFEDFVERVAQLPKKIFTVQDEMPSWEEDDDAGLESVSEPDFEGDEFEEP
                     GTAKPRFDSSSPVNEDSLKGPRVVSASTTATPLAAKEEDHLDVEEANSTDDDNESIGT
                     TTAAGPMDIARHLNRVDLSSKREQEGDDDDGEWVGGTPSSQGVLVEPPSLKGTPSKSR
                     SSAFEPRYEQNGETEQERPVFPARNRMESWVEPVCEGKEAPNGDNLL"
     gene            complement(449758..451028)
                     /locus_tag="CNK01525"
                     /db_xref="GeneID:36393102"
     mRNA            complement(join(449758..450038,450100..450156,
                     450219..450446,450509..451028))
                     /locus_tag="CNK01525"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658806.1"
                     /db_xref="GeneID:36393102"
     CDS             complement(join(449845..450038,450100..450156,
                     450219..450446,450509..450611))
                     /locus_tag="CNK01525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514641.1"
                     /db_xref="GeneID:36393102"
                     /translation="MASTFHPIRFGFKATIISSFLVLGHTLLVASAHNSTVNSANPAL
                     PGALSSLSALIFLTLLWQCFTLLESSDLNTYYSFFFDGVVRQDKGVLFGLTFVETVCG
                     LLALIAWFVLREEAEIVLTAFSDIQESALISLTYNLGTYALLFLNIYTMLSMGMHVRK
                     TGVGELMTKNFWLGRMSWWEGRIEIEHDEFEKA"
     gene            complement(451219..453205)
                     /locus_tag="CNK01530"
                     /db_xref="GeneID:3254624"
     mRNA            complement(join(451219..451553,451615..451738,
                     451793..451936,451986..452138,452187..452242,
                     452298..452468,452576..452738,452789..453205))
                     /locus_tag="CNK01530"
                     /product="ribonucleotide reductase small subunit,
                     putative"
                     /transcript_id="XM_567827.2"
                     /db_xref="GeneID:3254624"
     CDS             complement(join(451429..451553,451615..451738,
                     451793..451936,451986..452138,452187..452242,
                     452298..452468,452576..452738,452789..453145))
                     /locus_tag="CNK01530"
                     /codon_start=1
                     /product="ribonucleotide reductase small subunit,
                     putative"
                     /protein_id="XP_567827.1"
                     /db_xref="GeneID:3254624"
                     /translation="MATIRQAPPSHRKLRTASHSSSVCSSASTEGSFGDMPRINDVRP
                     IYDSSNASMEDKRDATRITLPNSIKSLSNERSDSNKGGNPAKEGKVTRKFPEEEEEDI
                     LRESESRFVLFPIKYNEIWQAYKHAQASFWTAEELDFGHDLIDWHDRMTEQERFFILR
                     ILAFFAASDGIVGENIVSQFALEVQIAEARAFYSFQSMIEQVHSETYSLLIETYVRDA
                     QEKDFLFRGMTNIPCIKQKADWALKYITDELPFRTRLVAFACVEGIFFSGSFAAIFWL
                     KKRGLMPGLTFSNELISRDEGMHTDFACLLYNHLKHRCSTDEVHHIVSEALVIEKQFL
                     TDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNATNPFDWMELISLQGKANFF
                     ESRVSAYQKANVSRTGTPSGQKEDERLTRRVFRTDADF"
     gene            453418..455605
                     /locus_tag="CNK01540"
                     /db_xref="GeneID:3254555"
     mRNA            join(453418..454070,454133..454465,454517..454725,
                     454776..454895,454955..455330,455385..455605)
                     /locus_tag="CNK01540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567828.2"
                     /db_xref="GeneID:3254555"
     CDS             join(453656..454070,454133..454465,454517..454725,
                     454776..454895,454955..455330,455385..455545)
                     /locus_tag="CNK01540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567828.1"
                     /db_xref="GeneID:3254555"
                     /translation="MTAPRIISRIAARTLRRSPLHPLPRSALAPAKLSPTAYTSVRLG
                     STLPPRADFTKPTEEHIKELRALLSSNTSLISTIDGSASPDDLQAFNDDWMNKYHGKG
                     PIVVKPKTTEEVSKVMKYCYDKGLAVVPQGGNTGLVGGSNPVHDEIILNLSNLSQIRS
                     FDPVSGIFVADAGVILEVADNYLAEQGFIFPLDLGAKGSCHIGGNVATNAGGLRLLRY
                     GSLHGTVLGLEVVLPDGTIWNGLSKLRKDNTGFDIKQLFIGSEGTIGIITAISILCPR
                     RPSAMNVAVFSLPSYDAVQKVFGEAKTYLGEILSAFEFFDKQSYALVKKHQEENGETR
                     SVFEQEGDFYCLIETGGSNSEHDEAKLTALLEHLLTSDLVLDGVLAQDSTQFQSIWSL
                     RELIPESAAKAGSVYKYDVSVPVGKMYGLVEKMRERLRKEGVLEGDGNPEGPIRAVAG
                     YGHMGDGNLHINIVANKYTEEIEKVIEPYVYEIVAENEGSISAEHGLGVMKAPYIGYS
                     KNETSIEVMKKVKHLFDPKGLLNPYKYIV"
     gene            complement(455569..459014)
                     /locus_tag="CNK01550"
                     /db_xref="GeneID:3254561"
     mRNA            complement(join(455569..457227,457288..457401,
                     457458..457550,457615..457713,457764..457856,
                     457913..457969,458017..458166,458215..458381,
                     458433..459014))
                     /locus_tag="CNK01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658052.1"
                     /db_xref="GeneID:3254561"
     CDS             complement(join(455793..457227,457288..457401,
                     457458..457550,457615..457713,457764..457856,
                     457913..457969,458017..458166,458215..458336))
                     /locus_tag="CNK01550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513774.1"
                     /db_xref="GeneID:3254561"
                     /translation="MLSFKALLNRARTIFSRSCKVMSYDAPEESSLDGQWEVLSKSPS
                     ILYECIQAFPPLEVDTSPVDWSDLGLGPNNGPQTGDVRPNVKLNSKSSLRLIKRKSKD
                     TLASASKESASATPTSKKSFFKSIKIHRLKSKKNVDQIETSPTEAEFVRATAASVHTI
                     TPKTKTPTIKHNVGLFNGSPIGSHRTMSLSENTENDKLLPDLIPRLYFTPLPTIFESG
                     DQKRPIPSAVSERDGNSMILSLKPSFDLLPTIDEVSETSTPATFESHPPFDIATYKDQ
                     FPPSGAPEPLFFRSRDYPLPIGHLASLTFTQIHPDGLVTLYEMVLTWIPHDERLPACR
                     ITVTRGFGSISRFADALFHVYSPEASPHLLALLSEFPGASDGPTHPYKVDCRMERMQS
                     YFDRLFGLQSSDNSNFVLDDPRITPEFFTILPKDRGDYISREKAWTEWQCTLQRMQEI
                     EQRVVGKNEHSKANFAHERTKKYEYYDILMASIVNSGLWSQPSKLQSPSAAKISNKET
                     VEDEDTDVSFTDLNNVFPLHSARALTHPPSSNFSIDVFASVGLFENSLDNISLATVNS
                     ASSIPADRPSSLHSCNFHSSHSSEDTSLFGTPNTSTLDLTHTLLDVKPQEDLSANSRI
                     SSEATLSKTGVKHLQLNDENVISLSLTNTRSYFRSIRILVDFIESWETILSRIYVALQ
                     LSVNNRKLKGGIWAAGTKYVGSPHEKAIGLNSKEAFME"
     gene            complement(459291..461461)
                     /locus_tag="CNK01560"
                     /db_xref="GeneID:3254560"
     mRNA            complement(join(459291..460779,460828..460990,
                     461048..461461))
                     /locus_tag="CNK01560"
                     /product="expressed protein"
                     /transcript_id="XM_567830.1"
                     /db_xref="GeneID:3254560"
     CDS             complement(join(459420..460779,460828..460990,
                     461048..461429))
                     /locus_tag="CNK01560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567830.1"
                     /db_xref="GeneID:3254560"
                     /translation="MTAIIMTPTSPTTPQKRQSYDPYLVQSTSPSLFAAGCSSPAQTP
                     GSAHRSSRSMGSLNNVLEHPVHSSLKGKGVDKSEVDDRRRSMDSPGLRKLGRRSETLP
                     DWLVKGKEKGRVKDINLPGNPKQWAPSELAQYLTYELRTGGPDGTGKILPAPLIADIE
                     SWVLRQRVSGTLFLEGSSEGWGNNTSRAPPFIPLLQTIARRLRRRSLLDPHSLPNSRF
                     PGSSTLLEEDETSYDDATTGVKRMAKAYDARSSASETSFSGDDEGELSRLVAQHTGDS
                     VIERWRRWEETGEALKPSEHEEYIQGYGRKRNLSDVSSLSSVSHGSATSERVGRKSPT
                     MEEMLQDVGENLDDEDEDMGRATIKPPPKAADAILSPDGRLHKQATSEPLQQYDPLVD
                     KLKSPNSNFYSISERRSIRGRASVAPALEHAIRPSGLDVPAEPDSKEVTPSATPSKAK
                     VLPPNELLTNGGHFPENMNRYATLGKSSTNRRHPHQLLSLELNDGDADEQDEGSDEGH
                     WETARKVTLRPTRAAAHDSSKADIRPTDKVKEKEEKKMGEQMAQLMERIKDLEERLQT
                     ATSSNVLPPVVPVNVPPREKKFALLDLLGWSKDEEDDLPRRVKELPAYLFLVGVGVGA
                     IVVGVILRRR"
     gene            complement(461686..464392)
                     /locus_tag="CNK01570"
                     /db_xref="GeneID:3254376"
     mRNA            complement(join(461686..461848,461897..461944,
                     462015..462094,462148..462280,462332..462492,
                     462545..463964,464044..464392))
                     /locus_tag="CNK01570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567738.2"
                     /db_xref="GeneID:3254376"
     CDS             complement(join(461831..461848,461897..461944,
                     462015..462094,462148..462280,462332..462492,
                     462545..463964,464044..464208))
                     /locus_tag="CNK01570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567738.1"
                     /db_xref="GeneID:3254376"
                     /translation="MSKASQVPHQSASLVLQNPPRHHSLRRRPSAREAVDSFVSPLAR
                     LEIEGRIAKGWNTASESHAASSSLHRENLSPGQPPSAPPIPALEFNLFRHNSILSIDS
                     LASECTVTGQQNDDKDEVESPVTPKAISSGDSHLSLGNSTPTNSQSSSKWTSSSTRDD
                     KQMRADHKSMASILPIRSLSLSSHPSTTLSIPSGTSSTHFKLGHVSPRRTKSQSKAEA
                     LTREAPVPLHPKETEVNSDCISVHGEEGSEWGKDESQFEWLDTYGVPQAINGIDGGGD
                     TKTSGPSRRLSKLRATMSRQQGDGGQGKLKKPVVIPKRAPPPPPNSAPAPPIVRRSSR
                     KIPRTPPVQDIRKMNRQASESSIPLRPAHPPYRQRSDTDIIFQPNPTSSQISSSSYLA
                     PRMVPLKNETSSSASLDLPSVGRFSQMSFQSGYSFYDLDGDSTPSASRAESDFAFPRG
                     KYMKVSASALEREKEMRNRVVSEPIVKTPSAPISVTDRSANELVCMGIEARGKGELSK
                     SAYYFMKAAEAGNSTGRIYWGLALRYGLGVGIDDKRAFAELSQACDVSLAEGGLTIHT
                     SPGRMALTAQERKKVTEDLAIGMFEVGNCFLGGIGVKKAPDVALQYLRFAANLGDLSA
                     QEQLGFVLSKGSNGIKKDMKEAAKWYRMAIAQGSSNTVGLSWVWKEKYMS"
     gene            465408..467867
                     /locus_tag="CNK01580"
                     /db_xref="GeneID:3254563"
     mRNA            join(465408..465723,465785..465887,465942..466055,
                     466109..466213,466265..467867)
                     /locus_tag="CNK01580"
                     /product="protein scd2/ral3, putative"
                     /transcript_id="XM_567832.1"
                     /db_xref="GeneID:3254563"
     mRNA            join(465408..465723,465785..465887,465948..466055,
                     466109..466213,466265..467867)
                     /locus_tag="CNK01580"
                     /product="protein scd2/ral3, putative"
                     /transcript_id="XM_567831.1"
                     /db_xref="GeneID:3254563"
     CDS             join(465474..465723,465785..465887,465942..466055,
                     466109..466213,466265..467750)
                     /locus_tag="CNK01580"
                     /codon_start=1
                     /product="protein scd2/ral3, putative"
                     /protein_id="XP_567832.1"
                     /db_xref="GeneID:3254563"
                     /translation="MKSLRRSLNNEKNSSSPQPSPPLPITYSGNPHALGRPAEKVAPP
                     QKVIKALTSHQSTNPQELSYNKGDFWYVTGERDVWFEALNPLTGSRGLVPKLDFEEFV
                     KGGRHPAGQRSVDHGSIRPNTPSHSSGSQKDVPKAGPILSPPASADETRTQKSPVYAI
                     VQYDFRAERPDELEAKKGEPIVIMAQSNHEWFVAKPIGRLGGPGLIPVAFVEVRDPKT
                     GQLIEIEPNSIPMVEEWKKKTAEYKAAAIPLGKLDIAPGQGVTNSPYAPAQTTRISDS
                     YSSMSRTGSMSTTLINPPSGASSSSTTPAPTERSSKQTPYVPVKNEILPLGDLKSMSV
                     PSFHQENGVYWFRLQVTFVPDDLTASAYTFGLYRSYEDFYDFQIALLDTFPLEAGRSG
                     SADGRSTPERILPYMPGPVDYEIDDELTEYRREELDVYVKELLDLKSKGAGFILRHEL
                     FRAFFATRHGDHFEKVSRQDALGELEEQLADVRLEDYGALTNDMRSQSVTSPHSQSPN
                     QYRHSPQAYQQHAVSKSMSSRGASPLPPINTNPHHSSRPDSSAYPTSGRQSATAHYVS
                     GGPSTANTTSSWGMGAGGPSTSTSATTPGTAPQSGPPPYIKIKIYDRATDDLIAIRVH
                     SAVTFAELSDKVRARLGPGVTMLRYRVSMDSGEGYRELMDDKDLKNWLRTEGQKLVLY
                     AEQ"
     CDS             join(465474..465723,465785..465887,465948..466055,
                     466109..466213,466265..467750)
                     /locus_tag="CNK01580"
                     /codon_start=1
                     /product="protein scd2/ral3, putative"
                     /protein_id="XP_567831.1"
                     /db_xref="GeneID:3254563"
                     /translation="MKSLRRSLNNEKNSSSPQPSPPLPITYSGNPHALGRPAEKVAPP
                     QKVIKALTSHQSTNPQELSYNKGDFWYVTGERDVWFEALNPLTGSRGLVPKLDFEEFV
                     KGGRHPAGQRSVDHGRPNTPSHSSGSQKDVPKAGPILSPPASADETRTQKSPVYAIVQ
                     YDFRAERPDELEAKKGEPIVIMAQSNHEWFVAKPIGRLGGPGLIPVAFVEVRDPKTGQ
                     LIEIEPNSIPMVEEWKKKTAEYKAAAIPLGKLDIAPGQGVTNSPYAPAQTTRISDSYS
                     SMSRTGSMSTTLINPPSGASSSSTTPAPTERSSKQTPYVPVKNEILPLGDLKSMSVPS
                     FHQENGVYWFRLQVTFVPDDLTASAYTFGLYRSYEDFYDFQIALLDTFPLEAGRSGSA
                     DGRSTPERILPYMPGPVDYEIDDELTEYRREELDVYVKELLDLKSKGAGFILRHELFR
                     AFFATRHGDHFEKVSRQDALGELEEQLADVRLEDYGALTNDMRSQSVTSPHSQSPNQY
                     RHSPQAYQQHAVSKSMSSRGASPLPPINTNPHHSSRPDSSAYPTSGRQSATAHYVSGG
                     PSTANTTSSWGMGAGGPSTSTSATTPGTAPQSGPPPYIKIKIYDRATDDLIAIRVHSA
                     VTFAELSDKVRARLGPGVTMLRYRVSMDSGEGYRELMDDKDLKNWLRTEGQKLVLYAE
                     Q"
     gene            468080..471120
                     /locus_tag="CNK01590"
                     /db_xref="GeneID:3254565"
     mRNA            join(468080..468242,468297..468377,468432..468539,
                     468583..468862,468917..469552,469605..470917,
                     470971..471120)
                     /locus_tag="CNK01590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567833.1"
                     /db_xref="GeneID:3254565"
     CDS             join(468240..468242,468297..468377,468432..468539,
                     468583..468862,468917..469552,469605..470917,
                     470971..471066)
                     /locus_tag="CNK01590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567833.1"
                     /db_xref="GeneID:3254565"
                     /translation="MRVIVKGGVWRNTEDEILKAAISKYGKNQWARISSLLVRKTPKQ
                     CKARWYEWLDPSIKKVEWSKTEDEKLLHLAKLMPTQWRTIAPIVGRTATQCLERYQKL
                     LDDAEARDNEELGLGAGEDESSKPATDARGLRPGEIDTDPETRPARPDPIDMDDDEKE
                     MLSEARARLANTQGKKAKRKARERQLEEARRLAFLQKKRELKAAGINLRAKPKKKGMD
                     YNADIPFEKQPAPGFYDVTEEQAKVHAAPVGSTLRALEGKRKQELDEIEERKKRQKKG
                     DGKSNQTQQFVAAREAQIKKLKEQEQIIRRRKLNLPIPQVGERELEDIVKIGQAGELA
                     RELVGDGNKATEGLLGEYEALGQAKMARTPRTAPQQDNVMAEARNLRNMMAAQTPLLG
                     EENTPLHGPSVGTGFEGATPRHDVAATPNPLATSARGGVLTSTRTVPGVGTTPLRTPF
                     RDDLNINDDASVYGETPMNDRRRLAESRRALKAGFAALPKPENNFELAETEEDEEEAE
                     EAEPLTEEDAAERDARLKAAREEEERRELERRSTVIKKGLPRPVNVNTYKLLDDLNSA
                     IVEQTDEEMAAAFKLVNLEVAMLMKHDSIAHPLPGTSTPGGLASEYDMPEDDFVAEAK
                     NAIHTELANALGLPGASDEHLRLAIGAAAEENEAAFAEAWAEEREGLVYSPSTRTWVD
                     KTSLSPEELSACYAAMINASRDRVIAEATKAAKAEKKLGKQLGGYQTLNEKAKKAIVD
                     VMEEIHQTKRDMETFLMLKGIEEAAAPARLEKIREEVAVLKKRERDLQARYAELNDRR
                     RENLAAIEQLEEDKIVLAAQVALEAQEGEVADGDVDMNGA"
     gene            471366..473410
                     /locus_tag="CNK01600"
                     /db_xref="GeneID:3254570"
     mRNA            join(471366..471509,471564..471707,471762..472071,
                     472123..472230,472284..472433,472489..473410)
                     /locus_tag="CNK01600"
                     /product="RNA binding protein, putative"
                     /transcript_id="XM_567834.2"
                     /db_xref="GeneID:3254570"
     CDS             join(471407..471509,471564..471707,471762..472071,
                     472123..472230,472284..472433,472489..473368)
                     /locus_tag="CNK01600"
                     /codon_start=1
                     /product="RNA binding protein, putative"
                     /protein_id="XP_567834.1"
                     /db_xref="GeneID:3254570"
                     /translation="MVAMEYTPDAAGQESYILCADCGTVISSANGAGLCVGCLRNTVD
                     ITEGIPKEATLNFCRGCEKFLSPPNTWIAVQPESRELLAICLKKIARPLMKVRLIDAS
                     FIWTEPHSRRIKLKITIQKEVLAHTVLQQTFELTLVVHTGQCPSCTRLAAKNTWKASV
                     QVRQKVTHKRTFLWLEQLILKHNAHKDTINIAEKRDGLDFFYSERNNAIKMCEFLAGV
                     VPVRVKSSEQLISSDTHSNTSNYKFTYSVEIVPVCKDDLVCLPKSLARAWGNISPLTI
                     CSRVGNTIHLLDPMTLQQTDVAAPVYWRQPFDSLTTVADLVEFIVLDVEPSGPVRGKY
                     VLADAQVTRSSSTGNNADDDGMGDDGIYHTRTHLGGILQPGDTVLGYHLTNANFNSDS
                     FEALESGRIPDVILVKKTYPNRRKKSRPRNWKLRSIAKEAEDVQDGTVGRGALGRRGG
                     VDQKNVERDYELFLRDLEEDKEMRAVINLYKADAPEEGEDEAMAVEKKPGSGLHGGKR
                     RNGLAKQAQHGMDVDDDEAVGEEDEDDEEEDFPEIDMDELLENFEELDMDDGAEVL"
     gene            complement(473402..474709)
                     /locus_tag="CNK01610"
                     /db_xref="GeneID:3254494"
     mRNA            complement(join(473402..473875,473928..474210,
                     474259..474709))
                     /locus_tag="CNK01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_567835.1"
                     /db_xref="GeneID:3254494"
     CDS             complement(join(473469..473875,473928..474210,
                     474259..474663))
                     /locus_tag="CNK01610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567835.1"
                     /db_xref="GeneID:3254494"
                     /translation="MSGKSVFLTGATGYIGGTALEAVITSSTPPSKITVLIRDPAKIN
                     RFTSLEIARKHNVTIVPLLGSLEEYDKLRDAAADHDVVVSCANADDLAGMRAILEGMK
                     KRKEKSGHRPLLIQTSGTGVLADDARGEYPTDTIYTDLNPSPATRFGPALHSITEVAD
                     TAPHRNVDLEIVKADQAGIIKSYIILPSTIWGFARGEVFEKGLSHPTSQQMPQLIEIS
                     IKRKRAGVVGKGANIWPHVCIADLSKLYGLVWEKATVPRPIIGHGPAGYYFGISGEYT
                     LFGAASAVGQSLITHKAVPEGTESTPTAFTKDEIDQYFNGSYYSGSNSRGVADRSKSI
                     GWNPRYTDDEQFYNDIDKEVRRISKALSQQ"
     gene            475026..477295
                     /locus_tag="CNK01620"
                     /db_xref="GeneID:3254519"
     mRNA            join(475026..475212,475284..475555,475605..476990,
                     477047..477295)
                     /locus_tag="CNK01620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567836.2"
                     /db_xref="GeneID:3254519"
     CDS             join(475118..475212,475284..475555,475605..476990,
                     477047..477225)
                     /locus_tag="CNK01620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567836.1"
                     /db_xref="GeneID:3254519"
                     /translation="MSKVQLYVYDLSHGLAKSMSLMLTGKQIDGIWHTSVVAFGREIY
                     YGQGVLESKPGATHHGQPLQILDVGETHIDEATFNEYLSSLSGMYTPSKYHLIEFNCN
                     HFTADVVGFLTGAEIPAWISSLPSEFLSTPFGQAMKPQIDAMFRGPTAQRPIPDKISS
                     ANASPAPSIGSSSAPGGDTAAAGPSLSSTLLQSIAAQATAQTTGQSTAANGSSKQPLN
                     PETSPLTLVSSTANFHSILSQHSAVVVNFTNTPSCPPCRVIKPVYESIASYHSAVYGA
                     KGARFVEVELGIGQGREIAGTYGVQATPTFMFFKDGKKVGEMKGAAKRELENKVEQFL
                     EECYPTHPHRRMYLPAVEGLPKRAITVSNLPNYPALLNKLEGFLADKGKTESFMVLKN
                     EVVPFLEGKSLSETELAALLQKWSAATQDLLPALQPTETFPLIDLWRIALQCQPIIPF
                     IGLGLSTASSNAEPITSIISLASNTFSSSPEAIPKPFILTVLRLLTNFTSCVELTNLV
                     LAHDGNVSTSEQLISVLVESLLYPDVGVRSAAAGVAFNIGLWRHHNVVEETPNVDWEL
                     EVVSGLVEALDREEDEDVAHRLLAALALEIYLSPSYEDNVQPMLQVLEASNKIEKRCK
                     VWKRKEVKKVGEEIARKLC"
     gene            478125..481996
                     /locus_tag="CNK01630"
                     /db_xref="GeneID:3254518"
     mRNA            join(478125..478578,478675..478894,478954..479245,
                     479297..479512,479563..479771,479831..481491,
                     481548..481996)
                     /locus_tag="CNK01630"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_567838.2"
                     /db_xref="GeneID:3254518"
     CDS             join(478434..478578,478675..478894,478954..479245,
                     479297..479512,479563..479771,479831..481491,
                     481548..481873)
                     /locus_tag="CNK01630"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_567838.1"
                     /db_xref="GeneID:3254518"
                     /translation="MPSSANAHDGAARQATVTRKRTNGSSTRDEKQYIGQWRIGRTIG
                     KGSSGRVKIAKHAVTGKYAAIKIVPKGLILNSRMSMSEAGAKADKVLLGIEREIVIMK
                     LIDHPNVLNLYDVWETSSELYLIMEYVPGGELFDYLVKRGRLPVSEALHYFQQIIYAV
                     DYCHRFNICHRDLKPENLLLDKDKNIKVADFGMAAWEAGERMLETSCGSPHYASPEIV
                     AGKAYHGSSSDIWSCGIILFALLTGRLPFDDDNIRSLLQKVKIGIFEMPDEIKDPARD
                     LLRRMLERDPERRITMPEILSHPFFISRPPRPIPGRSLVSPPSLDEVERPVNSVDEID
                     PDIMGNLKTLWSGVSDEEIIKALMCKDKTWEKTIYHLLIKYRNKHLENYNMEEEEYAE
                     ARERRQARKQLQSSSSPARRKGVPAQDQSARLAPLGENETVANTPVKRPQAPTPNKAS
                     RKAPPECPTPTKQVSQARSPAGPRPANSRGNSGASNSSQAPAIVLQGATPTKELPPPH
                     TTSSHPRPEMITTPTSPAPLSVPRVEDANLQTFLNQIADQMNRFSVRSSVASQSSTSS
                     SAVLGSDYQACLAFAAGVTPSANPSSSVTESVIEEQGQFEDAADDQTDTEVASIHSGF
                     TASIAPQSPLAGLGLGAPSAAVRPGLHPVAGPNQQRWSYASSAGSSYQGSSVGSYAPV
                     ESPQYIHSPLEVQAPVLQAERSAPRPPPRATRPAPPPISRPLPFSPAQQTYSEPTESL
                     LPRDTSYVIIDNSELPSDASLSSWGSKSSGFKAHRGLDGFGMLKKKKLNVEPVPYSYG
                     NLGSSATSPLNSPKRSWFNNLFNFKPATCTLLSRDNVANTRERVRKILLSIGVRTAVT
                     EIDGHKALKCRLDEVRDNGNVTTKGVRFRVEFTRASTSQTYSTLVTLTQEKGAESSFR
                     ACFAELKHFMDSQPSAPTTLSLNRPSVEQSRSVNSSNLLPAHSYQQQRYSSTSADTPA
                     GAPTSPLLSAPPIRYTASAPTTPVIESSPRFTSPYLQLPVSPQSLQMPSY"
     gene            complement(482753..484426)
                     /locus_tag="CNK01640"
                     /db_xref="GeneID:3254527"
     mRNA            complement(join(482753..483962,484015..484169,
                     484228..484426))
                     /locus_tag="CNK01640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567839.2"
                     /db_xref="GeneID:3254527"
     CDS             complement(join(483114..483962,484015..484169,
                     484228..484309))
                     /locus_tag="CNK01640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567839.1"
                     /db_xref="GeneID:3254527"
                     /translation="MSDIQDISIISTKEVDTPKPHTVYIIQVTTPTRTWAVSRRYNDF
                     VALDAELKSSTGQEPPSPLPPKTWGLSLGKNNRDRARERKPLLEQYLRSILNTKSHLW
                     RSAYTFSDFLSIPSHTGSSSTQKSGTKFTPQSWLLEHAALQTVLRSARSALLKRDALA
                     SMSNATGSRSAGVEAKRHLKEVGNRLEALEKGLSQLRDIGQGELRRREELVEGLKVEA
                     GSLTRMAEAGVRTAPSLSDNGTTGGSGTAGRRGEASPWTLPAQSMPGALPSGRVFGGH
                     QPPQETEQTRPLDDRQLLQLQTNHMAQQDDQLQNLSRVLQTQRRMGEEIHQEIESQNE
                     LLEHIEQGVDKTGRKLGKAKREMNRLN"
     gene            complement(484650..486484)
                     /locus_tag="CNK01650"
                     /db_xref="GeneID:3254528"
     mRNA            complement(join(484650..484873,484930..485316,
                     485369..485378,485433..485485,485534..485613,
                     485669..485761,485818..485857,485913..485923,
                     485980..486100,486168..486266,486327..486484))
                     /locus_tag="CNK01650"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567840.1"
                     /db_xref="GeneID:3254528"
     CDS             complement(join(484733..484873,484930..485316,
                     485369..485378,485433..485485,485534..485613,
                     485669..485761,485818..485857,485913..485923,
                     485980..486100,486168..486266,486327..486353))
                     /locus_tag="CNK01650"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567840.1"
                     /db_xref="GeneID:3254528"
                     /translation="MPPKAKDDKTFGMKNKNKSSKVQKHIATVQKQQEQAGKSKGDKA
                     KEREREKAAEAKAAALAKKKMEAELFRPAQIQKVPFGTDPKTVLCVFFKAGHCEKGNK
                     CKFSHDRNVERKVEKINLYADQREEKSKDSMDTWDEEKLRNVVTENGRKQNNATDIVC
                     KYFIQAIEDRKYGWFWECPNGGNKCMYRHALPPGFVLKSDKKKQEEAAKKDQISLEQF
                     IEVERHKLKPPLTPVTPETFATWKKNRLEKKAAEQEALEKAKATQRAAGKMTGMTGKD
                     MFEFGGELYEHVDEGEEEDEDWDISRMLARYRDDETATTAFDPTKGKFVNPRTGEVVD
                     DPEDESIAEVAKKVEGVKV"
     gene            486750..488409
                     /locus_tag="CNK01660"
                     /db_xref="GeneID:3254529"
     mRNA            join(486750..486990,487045..487068,487128..487149,
                     487237..487308,487365..487423,487479..487590,
                     487641..487711,487770..487924,487987..488409)
                     /locus_tag="CNK01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658053.1"
                     /db_xref="GeneID:3254529"
     CDS             join(486868..486990,487045..487068,487128..487149,
                     487237..487308,487365..487423,487479..487590,
                     487641..487711,487770..487924,487987..488239)
                     /locus_tag="CNK01660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513775.1"
                     /db_xref="GeneID:3254529"
                     /translation="MPIKKETKEKQVKGDEGAPSSDLVMGVASFTNLAQSTIAEEMVL
                     SYMKEMNRPYASADVIANLKNKVPKTTAVKVLATLAEKGLLTVKAYGKQLLYLYNQSL
                     LSVLDKEELSSLDGQIKSVQSELEERKKSLRHLQYELASKTALPKTVELEKEIGRLKS
                     ENAITLSALIPFHGASEGQSTFTPISTEETQRIDKDFMRWRKEWVDRRKVYKDFISQL
                     VEFGQVSNIPEFEEELGVNTDDYIATEVEQGEFCKPSMVVRARPKTSCGKAPNLRLKR
                     MPSLAGAVDEDGKKKKAKKV"
     gene            complement(488586..491051)
                     /locus_tag="CNK01670"
                     /db_xref="GeneID:3254530"
     mRNA            complement(join(488586..488941,489003..489085,
                     489138..489610,489663..490437,490490..490511,
                     490557..491051))
                     /locus_tag="CNK01670"
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /transcript_id="XM_024658054.1"
                     /db_xref="GeneID:3254530"
     CDS             complement(join(488754..488941,489003..489085,
                     489138..489610,489663..490437,490490..490511,
                     490557..491022))
                     /locus_tag="CNK01670"
                     /codon_start=1
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /protein_id="XP_024513776.1"
                     /db_xref="GeneID:3254530"
                     /translation="MRPLPLPLRSLPRSATLGPRRTASADRYLAIHHFFTRHAASPIS
                     RHIPRRLSSSPAKRCLDCPTSQPPPNPDNPTPYPPQGHAQEYAPFIQRLIRQSKAIAP
                     NSPHRPSKEELLEAANGWWQRMRIRLKWFTIRGWRRFNTDDMSAFASWFLVGNTVWIL
                     VGTTTFVSAIFALANSLSLQEYLARWLSDYMTYNTGVTVIFESAIVPKWGSSLITFKN
                     VYVSCRPDEGPSSAPVEGGKKHVKAATAKPPSPIPFLSSAISPETYLAAPPAPPEDNY
                     TMYDVNIDQLEVSLSFMRWLDGKGLVKDVRIKGVRGVVDRRSVWWDLSKPLDPADFRH
                     ATQKGDFEFESFHVEDALVTVYQPGLRPYNVSIFNMIVGPFRKRWLFYDLMSAEGITG
                     QFDNCLFSLHMPQKLGKSVEKEGGMVKRMARFRIDGLPIEHVQYASGYTPPMSWLTSG
                     KLDAVLDIKFPHHPDDQVDLQALFAEIGRNVATISHGVHPDDPDEDKLKGAIESAETS
                     LVGVIPGQHRLARPPLRAPKKGDYGKEEEERKVVVDIDLRFRDLKAAVPLYTTDLTVT
                     NNALIRPIVAFINANKTLVPIHCQVDADLGNFEGSWTLFETGLMTSISDQIYEAMAFH
                     VSSEAANSRRLRQVSVWGIQRSAEVLIDMLRGVVDPVGAQFATV"
     gene            491240..496840
                     /locus_tag="CNK01680"
                     /db_xref="GeneID:3254526"
     mRNA            join(491240..491320,491367..491426,491484..491729,
                     491783..491867,491919..492341,492398..492677,
                     492739..493181,493234..493537,493594..493737,
                     493806..493951,494016..494152,494210..494305,
                     494360..495531,495593..496403,496458..496840)
                     /locus_tag="CNK01680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567843.2"
                     /db_xref="GeneID:3254526"
     CDS             join(491292..491320,491367..491426,491484..491729,
                     491783..491867,491919..492341,492398..492677,
                     492739..493181,493234..493537,493594..493737,
                     493806..493951,494016..494152,494210..494305,
                     494360..495531,495593..496403,496458..496689)
                     /locus_tag="CNK01680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567843.1"
                     /db_xref="GeneID:3254526"
                     /translation="MGNISSMARASTALDSYVAELGNDISYDKSLSSSRFLKTILARH
                     SFGPIVLKIFIKPDAAMSLRVIQRRLKLERDILSELANVNTYQTFVETEKAGYLIRQW
                     IGSNLYDRVSQQPYLANIEKKWIAFQILTTLRDARNRKVAHGDIKSENILLTSSLSVL
                     LTDFSSSFKPTYLPLDDPSDFSFFFDTSGRRTCYIAPERFYASDSKVADRKRASESEG
                     GEWFGRRDGKITEEMDVFSTGCVLAEMWADGRTVFNLSELYAYREGALSLNGMLENIH
                     DVDVREMIAQMLSREPSKRPSFDHILSKYRETIFPEYFYTFLQDYINSLNEKAEASSF
                     RDDVEGGFLQHSAGQSGAKIDRLLDEWEGIATYLGEGPTDNAPALLILNVITSSVRHC
                     LFPSSRLHALRLFLNLLPYLLDEDKIDRIIPYIVELLSDDMPHVRAEACRTLIQVVES
                     VTSVTPQNATFIPEYLLPQMKHLTTDSDIFVRITYAQALVKLANAAMTMLEMSQAAKD
                     GASVHGTESSGIVEPDYDVMVQEIQAAVEEQATTLLVDPASAVKRGILSSISDLCLFF
                     GRQKSNEIVLSHIMTYLNDKDWMLRLAFFDSIVGVGAFIGLRAVEEYVLPLMFQALAD
                     SEEAVVARVIGSLTSLATLGLLARMRLWDTFFAVKGFMFHPNVWIRQGAVGLIAAVAK
                     NLPSSDVWCILYPAIRPMLHSDVKEMEEAALMSALLPPLARSTLIAARVAALQNTPPG
                     FWDIPPATSSTKVDLIKSQKLAQNNPHRLRDSGISALDEKKIEAMKEHIVKQAHAIKA
                     REATDQNLPPEASLVNSKSVSLTDLGVTPQTIFISPRTIGVDAAKVELRRFRPGLEPE
                     SRRTSFTTNRSLRGPVDSPLDEIRRKLAALEPLSRPETPVAKEKATTTPTTTSHTSQP
                     SVDTGASPSESNLPSTLDITAMTRSGKKKKVDSKAAPAVGASHTNAVGTTTIHDEPIS
                     GRTTPIAAALSQITLSGANTPKGQPAAPYTSSYEGHDPGVRAFLEQVDLDNYREPLLD
                     FGPRVGANHRKRNPRVNKASSSSSASTSSSPTNVTMIAHLTHHEGAITGLITSPDSVF
                     FASSSEDGQVLIWDAARLERSVTAKPRLVYKMEAPIVSMCGIENTHCLAVASDDGQVH
                     VLRVHTGGGSGGSSTRYSKVECIRTWNTEESDGHVRFVSHIQDSTLLLLTSMSVIATL
                     DIRSMEIKQRFQHPPELGIITAYCLSTHWLVLGTSIGALSLWDLRFGLLLKSWKAGGG
                     VTSCRIHPSRGRGRWIMVSVSPTWPYALLGPSTDKSEEPQPSKPIVEVYDIESSKLVE
                     VYEIRSRRSSKPSEIVPEPIEIIPNKAALIAELARSTPSLPSHIPTDDFDATNPLPTP
                     PSAVLDLMVGQGWTNLGRPEESILMSVPELRSSDKNGEGQSGPGWMITAGEDRIVRYW
                     DLVKAQDGFVVCGSQKEKDVSFRRMPEGSSPSMFYTLPNVHRQGQGPTRDKERQPLQP
                     HYDAICKLGSLETPFSSCIISADRSGIIKVWRMEGMAGPLR"
     gene            496955..499267
                     /locus_tag="CNK01690"
                     /db_xref="GeneID:3254531"
     mRNA            join(496955..497433,497499..497686,497748..497871,
                     497929..498006,498067..498408,498464..498589,
                     498651..498707,498760..498950,499012..499267)
                     /locus_tag="CNK01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_567844.2"
                     /db_xref="GeneID:3254531"
     CDS             join(497065..497433,497499..497686,497748..497871,
                     497929..498006,498067..498408,498464..498589,
                     498651..498707,498760..498950,499012..499168)
                     /locus_tag="CNK01690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567844.1"
                     /db_xref="GeneID:3254531"
                     /translation="MITTNDTPTASTPLLLHAAQNPSHGSKVYIQRYRSGKRRYPLFL
                     FRLVITPMVLITLVTLLAWDTSPLGHCYMKPICRALKDGNEMEEIWWRNQGPYAPYKE
                     FDHSKNLEYLPRGCEIDQVTLLHRHTSRYPTPNAGRCMLGALNKIRKREVGVPRHHPE
                     LSFIDKADLELKDWQFGGLTNQGRKAAWKSGVHIATAYKSLLDKAVDVFTRSSEGERV
                     LETSRYWLEGFRNHRFAIKKKSDLPKVDVIIPEEPTFNSTLSVHSCPAFESLDPSPGS
                     IAQSDLSPLLSSAIDRLNTALRPRPKLDADDVACLADMCGYDSQSRGTEWKRWSKWCG
                     LFTKDEWEVLGHGKDLKRYYEVGQGSDYGPTMGAGYINEIIARLTDSAPQDNTCTNRT
                     LDADEDTFPRGGERFFVDFGHDNEMLEVMAAAGVLKQSRPLTTTAVPARRTFVLSEIV
                     PFGARLIFERVSCDTGYWEPGSGTAPEGGKEGIKKYVRILLNDKVQTVAHIACEQSAF
                     AEHGLCEVDAFVESQQFATTNVSWDICYNSSHEEE"
     gene            complement(499164..503106)
                     /locus_tag="CNK01700"
                     /db_xref="GeneID:3254532"
     mRNA            complement(join(499164..499441,499494..499556,
                     499608..499818,499871..499924,499986..500297,
                     500348..500469,500523..500612,500661..500806,
                     500869..500960,501020..502515,502578..503106))
                     /locus_tag="CNK01700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567845.2"
                     /db_xref="GeneID:3254532"
     CDS             complement(join(499331..499441,499494..499556,
                     499608..499818,499871..499924,499986..500297,
                     500348..500469,500523..500612,500661..500806,
                     500869..500960,501020..502515,502578..503054))
                     /locus_tag="CNK01700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567845.1"
                     /db_xref="GeneID:3254532"
                     /translation="MVPKIRWGLYRHLRCLPVTQPRAIRSHALVTTARSFDKVTTATS
                     VKPKPKLIKTKARLSDLPATKLGSNGLPQKPLEAWDERDVPPNRSKSPKTVRAAKARS
                     DGARSPVIPCSKAELELLQDAIRQGVIPDTPLAHEVYLNWKRFPDCILLTRVGKFYES
                     YFEPARYLASILSLSLAEKKYGANEAKRSYPFAGFPVHALDKYLKMLVQDLGHTVVLV
                     EEYDTEGAVAHTGKKLTAGSGPKERRVYRVVTPGTMVDESWVDADQSRYLLAIAVGNE
                     GQNGQELSLAYTDASTGEFFTKDTTVSQMEDELARITPREVVLDNSLYELWREHYNYS
                     EMKRKDASQVEELLALLRVLGVRVSFADPCRPPPLYTSASSPTLHPTTPEENAAALLQ
                     HHLQYALRESMPALRRPHKQSNSAFMQIDAATLQALEIRHAFRPGGLIATGETQTNSS
                     PLSAKGTLLSVVSKTITSSGHRLLIRTLTAPSTSPHIINSRLALVQAFMDREDLKTEL
                     RHELKELGDIMRIIQRFRGQRGTGRDIWDVGRWIRGAQRILETIKEEIKIEVGRNNEK
                     AIRKSEGITRLQEFVDSFRDLDRIASKIESSVEESAIMFRSGDDKSIIDEQEAGDALL
                     TSQASSKESEADEKQRIKRERDEREMSEWWIRPQFSPALQLRHDELSALKAEAQKLQA
                     SLIKKYDTPTLTIEKNHRFSYHIQMSAKDAEKVAKARSLERIGSMTGKTAYFAYAPLA
                     ELGTRIEIMMEYLGAAQRRAARELQNMVVEQSDAIQQNSELVDELDLSLSFAQNAVEM
                     NWVRPILDNSTELQIINGRHPSVESSLLSASRNFTPNSTHMASDTHLHVITGPNQGGK
                     STLLRQTAVIAILAQSGSFVPAEYVKMGIVDRVFSRVGARDDLWRDRSTFMLEMVETA
                     GILRHATERSLVIMDEIGRGTTLQAGVSIAYATLDYILENIKCRTLFATHYHELGQML
                     GYDPKRAEGEVIKGRSGIAFWCTDVNEADGAFSYSYKLRPGINYDSHAIKAASIAGMP
                     ESFLRVAESTLVTLQSKSNLITLPSSH"
     gene            504089..506505
                     /locus_tag="CNK01710"
                     /db_xref="GeneID:3254544"
     mRNA            join(504089..504226,504393..505087,505138..505250,
                     505303..506037,506090..506505)
                     /locus_tag="CNK01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_567846.2"
                     /db_xref="GeneID:3254544"
     CDS             join(504639..505087,505138..505250,505303..506037,
                     506090..506247)
                     /locus_tag="CNK01710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567846.1"
                     /db_xref="GeneID:3254544"
                     /translation="MSSSAAATSAAASSAVASSAIASSAATSSEASTAASSAAASSAV
                     ASSAAASSAAASSTATSSAATSAVSSASSSASSSASVSSSSSSSIATSSSTSESVVNS
                     PSSSGSRQISGGAIGGIVVGIIGGLVVIGLLWTWWRSRKTRGEKVPPPPKREMSYNID
                     SSQRRPSMMGTPYNSFSHHRRASTRASLLAPPPPSSIYYHSRHQSSNQISPLVTPNTI
                     PSHDASPPMAASGSSHSPNESPSFPPADTNSSAPQGNMPGEKPFLTPINTGVGTSEES
                     EVQPSRAKSPERPKGRSPSAFAIHQEPYEAGPSIESQTPRDSPHNSPRASLNSLPNNA
                     RGSSMTSLRASAIGHRPTSMNSLGSSKYLHFGPAGGAPHQGRPVALEMPKLLGARPDM
                     NGDFFSSVGVQKLQESQSFGLGLDEMGRMRRPSSRPFNSYMDLTPSPTHSTFPRSATD
                     RQMTPRQLEAGQKRARTSGIQNNRSVLEGNELEE"
     gene            complement(506550..511554)
                     /locus_tag="CNK01720"
                     /db_xref="GeneID:3254450"
     mRNA            complement(join(506550..508868,508923..509106,
                     509637..509830,510083..510257,510305..511398,
                     511460..511554))
                     /locus_tag="CNK01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658055.1"
                     /db_xref="GeneID:3254450"
     CDS             complement(join(506808..508868,508923..508982))
                     /locus_tag="CNK01720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513777.1"
                     /db_xref="GeneID:3254450"
                     /translation="MTMIDMGMNIAWCLACSKQLNNPRDTYCSDACRLEDSQPSGSPN
                     NHVDITAPVPAGFFSASRVEARSDRPSLIPTDVFEEPQAKMSLRDRRAYSFPAELAEP
                     AVKRSGSRRQTQTQETLQFVRKSSGQVLGMNSHRSPNLGPTPVGAGARPKGFGKLSKT
                     TGNNTPIVSDSVFCSNSESSDNEVADGVDYLYRESAILKKRLSKTTDDTLRLPKAPVP
                     RRLSTNLGYEPSSYHSRPSLVPSHSHPLGAKPASPVAHIIATSIGSRSRDDIVSWLNE
                     VKRSPKDTTLDSISRSQADMLTPTQERMEWVEEGKMGTTPQGRLGSALAGFSTLRGLS
                     DIQTLANAPSGSGTVYKALSVPSHASSTAAPISDPEGLALMQASPSQAEVSRVAVMNQ
                     PGGATPTLSTISLSDLMEPLTDAGENVDFMTDEQSASGSSSFARHRLSAVVSGSQRQG
                     RGTGWGDLQGKTAEEEKGAQTPSPLRPLANTAQAIWNLSNYIRSFAPLSIASVFVPSK
                     RSESPTPPASRSATAGPCPPRQESSSSSSSQSQDQISFVTPLPAARQPSDPNQSPIQA
                     MVRSLPMDIANPIGAENGALERKLIREREQELDIDSDWSKSKSRSRVRGSRVRNPSPS
                     RSRSRGRSDGRRSRAREMSKVRGSHSRHGRKISYDADASEGEKAGYELRRGRSRREKV
                     LRMDSTDEEPQVEERRGRDRTVKA"
     gene            512723..514890
                     /locus_tag="CNK01730"
                     /db_xref="GeneID:3254452"
     mRNA            join(512723..513211,513453..513509,513556..513633,
                     513688..513970,514019..514570,514624..514890)
                     /locus_tag="CNK01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_567849.2"
                     /db_xref="GeneID:3254452"
     CDS             join(512927..513211,513453..513509,513556..513633,
                     513688..513970,514019..514570,514624..514835)
                     /locus_tag="CNK01730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567849.1"
                     /db_xref="GeneID:3254452"
                     /translation="MHLSTLFLLPLAFAAPAQKTAKDIPELSVSQWASIQESFGDNLG
                     NFAAWSWNKAENIVGDLGAHKDAGDDKTELTIWQRLKEDPHSFSRLVKIIEFEGKAIE
                     YLDNKDLQITFFAPNNDALKPPHHHHHDDDDDDDGLDALAQAPSLAAISAALESEPSL
                     VGGDDDDDDEEKKRRKEIFRKIIGKVLAYHGLPKAYTVQQLSQNSTMETALKAEDGSY
                     AGLHRRVRIEKCLVPPSVKLNFYAKIVAADRKSGNGYLHALDHPLIPPASILDELFLF
                     PDSFSTLTSSVQKVHLAHALDFGIEHDEDHKNKVHGTPLATLFAPTNGAFRRLPPKLK
                     FFLFSPFGEKALIKLLAYHYIPHTLLLSETLHVEKHEDKDEVIEQFIFTDGDDPSFHK
                     EFKIETALPNATLAIEIDKTKLLPVEGAVTTRIKVNGELVQVIDVPARNGAFHIIPKL
                     LVPPHKHHHHHHHDDKQFTGDDSWENWEQWLPQWANEA"
     gene            515158..518378
                     /locus_tag="CNK01740"
                     /db_xref="GeneID:3254455"
     mRNA            join(515158..515464,515528..516377,516424..517140,
                     517197..517499,517553..517920,517979..518378)
                     /locus_tag="CNK01740"
                     /product="cystathionine beta-lyase, putative"
                     /transcript_id="XM_567850.2"
                     /db_xref="GeneID:3254455"
     CDS             join(515215..515464,515528..516377,516424..517140,
                     517197..517499,517553..517920,517979..518247)
                     /locus_tag="CNK01740"
                     /codon_start=1
                     /product="cystathionine beta-lyase, putative"
                     /protein_id="XP_567850.1"
                     /db_xref="GeneID:3254455"
                     /translation="MTTPSTPGESSLATSVYSLAPKSPVEVHKERVANWRFSTICANV
                     DGKDQYGASSTPIYQTATFKGMDGQYDYTRSGNPTRGALENHLARLYGATQTFALSTG
                     MTCLDTILRLVRPGETVLAGDDLYGGTNRLLTYLGTHGGVDVRHVDTTDVDKVIPHLG
                     PGNNVKMVLLESPTNPLLKIADLQEIADAVHSAAPSALIVVDNTMMSPYLQRPLEIGA
                     DIVYDSATKYLSGHHDLMAGIIAASRPDICKDIAFIINSVGSGLAPFDSFLLLRGVKT
                     MSLRMDRQMATAHLVALYLDSFGFLVHYPGLKSHPKRDIHYKQASGAGAVLSFVTGDK
                     ALSERIVGGTRLWGISVSFGAVNSLISMPCLMSHASISAAVRAERGLPENLIRLCVGI
                     EDPRDLIDDLEHSLLQAGAIVPNLQYTPLSQTKAAELYARDGEAWILERAKGFKRPST
                     QSITVDKLVSGVKQSLGLSTPPKEYKTIEEDIAVSAPGKVILFGEHAVVHGVTAIASS
                     VDLRCFSVLSPRRDGKVGLEVPNIGVELEWEISKLPWNLLPVHANGGRHVADKELDTA
                     LLQAVEGAVNTHVEVGKTGIGACVAFLYLYMMISGEETNALSVTFTASSNLPISAGLG
                     SSAAYSTCVAASFLLARQHLTIPSADRLPKEDTDLVDGWAFLAEKVLHGNPSGIDNAV
                     AVRGGAVAFTRSVGGKQGGMDGLFEFSSVRLLLTNTLVPRDTKTLVAGVSAKRLAEPQ
                     AVNSILDSIQTISDEARSLLGGGKPVERSILVKRLEALIKENHEHLVELGVSHPSLEM
                     IVAATAQAPFELATKLTGAGGGGCALTLIPDDFPESSLNELIQTLEGHGFQAHLTTLG
                     GPGFGVLTTPFKPGNVSEQLRDAVRTHDEGEGMVVPKRAGLREADKEGLHAWAERLGR
                     WVYA"
     gene            complement(518422..519781)
                     /locus_tag="CNK01750"
                     /db_xref="GeneID:3254456"
     mRNA            complement(join(518422..518784,518857..519064,
                     519136..519312,519367..519472,519537..519781))
                     /locus_tag="CNK01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_567852.2"
                     /db_xref="GeneID:3254456"
     CDS             complement(join(518611..518784,518857..519064,
                     519136..519312,519367..519472,519537..519762))
                     /locus_tag="CNK01750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567852.1"
                     /db_xref="GeneID:3254456"
                     /translation="MSFLPSFRHSASLSTATRSATLLSLRYASTITQPKPKSKLTKEL
                     ELEAEEQRQMLARASRSNPGVDLSAQKLPLFEATYDPPRNWPEFWHKTKDAVYERDRK
                     DRQDLTNQSISELIGQGGLEEYKNSPIRFYMPSLIRRGFVWLNPAGSISKSIKNLTEL
                     YYKYMQVQASGTLGQALSISKDDAYSAAQNIIRGRKDKLKWQLVKENKSTKLVWARMT
                     MLDPREDKMAAQIVLAFDTQQAVITQKGSAPPSRRTQHVVENIVFEKIFPSRDDWKIK
                     GRLIPSKTPDVQTVTKAPAN"
     gene            519944..521122
                     /locus_tag="CNK01760"
                     /db_xref="GeneID:3254457"
     mRNA            join(519944..520106,520157..520322,520376..520389,
                     520439..520560,520613..520682,520734..521122)
                     /locus_tag="CNK01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_567853.2"
                     /db_xref="GeneID:3254457"
     CDS             join(520007..520106,520157..520322,520376..520389,
                     520439..520560,520613..520682,520734..521080)
                     /locus_tag="CNK01760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567853.1"
                     /db_xref="GeneID:3254457"
                     /translation="MNVVKTILTRRAPFLSAIAIRTMASPATMSKPRDIQDFLAYYPN
                     VKTNPKASANLKFYSNELPFQPDNLTYEEFMHTYSRDYDELEMNHGYIQWFFPIREYG
                     VNPEAQPLQPHEIEAMQNNPEIVSRLLKSYKMMLGFYGIDFNGGKLKLTSNHKERISN
                     LRSRSHNLLRLTRILKHLSEFPQLQPHAAALVLFFVATHSAGMLDFSQGVMRGDSMDQ
                     WWSNCFRNEGERKEIRKIVQGRGQFGQGTWDWEEYNEWYEQRREVGKVGFSGQD"
     gene            complement(521104..522972)
                     /locus_tag="CNK01770"
                     /pseudo
                     /db_xref="GeneID:3254440"
     gene            complement(523034..524851)
                     /locus_tag="CNK01780"
                     /db_xref="GeneID:3254658"
     mRNA            complement(join(523034..523339,523393..523577,
                     523632..523810,523864..524043,524107..524232,
                     524446..524851))
                     /locus_tag="CNK01780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567657.2"
                     /db_xref="GeneID:3254658"
     CDS             complement(join(523211..523339,523393..523577,
                     523632..523810,523864..524043,524107..524232,
                     524446..524660))
                     /locus_tag="CNK01780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567657.1"
                     /db_xref="GeneID:3254658"
                     /translation="MLRTTLTRFNTSSSLTTLKANMSTTAAINTATGTSRSITKTVYA
                     HEVSEGAGATVRRSIGTRELRNLTPFLMLDHFKVLPGAGFPDHPHRGMQTVTYLFRGI
                     FKHEDFLGYSGTLTPGDVQWMTAGKGIAHAEMPIFDPDPTKAEPVEGMQLWIDLPQKE
                     KYIEPEYQDRKAEDIPVIHPKDGVEITVLSGDSHGTNGSVTPVGGAWYLGFKLQKPGA
                     SVYQPLPEGYNAFIYIVKGKLQIGDDTKTHDKFNLLVLSSKPGESGVTLTRPEDDTDA
                     EEAHFVVIAGKPLDQPIVQYGPFVTCSQRQAMEAIMDYQTGKNGFERAVGWKSKIAKD
                     FRG"
     gene            complement(525591..527200)
                     /locus_tag="CNK01790"
                     /pseudo
                     /db_xref="GeneID:3254430"
     gene            527833..528917
                     /locus_tag="CNK01800"
                     /db_xref="GeneID:3254602"
     mRNA            join(527833..527961,528028..528229,528280..528500,
                     528559..528630,528688..528917)
                     /locus_tag="CNK01800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567659.2"
                     /db_xref="GeneID:3254602"
     CDS             join(527926..527961,528028..528229,528280..528500,
                     528559..528630,528688..528789)
                     /locus_tag="CNK01800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567659.1"
                     /db_xref="GeneID:3254602"
                     /translation="MSKSAAFFEAVIARRSYYNLTNKTTLSNAQLQEIIEKSVKYAPT
                     SFNGQQSRAVLVSGSKHNELWDKITETHLRTLKGDKSQEEFWANKIKDQYRAGYGTVI
                     FFEDQDIVNGFSAKMPAFAQAFPVWSENSAGILQHIVWTALVAEGHGASLQHYAQYSA
                     ETQAAITELVDVSPNWKVTGLLPFGIPSGPPGKEKVYEPIEKRTKFFFDE"
     gene            complement(528886..530633)
                     /locus_tag="CNK01810"
                     /db_xref="GeneID:3254419"
     mRNA            complement(join(528886..529016,529078..529205,
                     529260..529289,529341..529463,529524..529723,
                     529768..529890,529946..530022,530080..530154,
                     530216..530248,530319..530328,530415..530633))
                     /locus_tag="CNK01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658056.1"
                     /db_xref="GeneID:3254419"
     CDS             complement(join(528927..529016,529078..529205,
                     529260..529289,529341..529463,529524..529723,
                     529768..529890,529946..530022,530080..530154,
                     530216..530248,530319..530328,530415..530536))
                     /locus_tag="CNK01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513714.1"
                     /db_xref="GeneID:3254419"
                     /translation="MAVPEEISDPDIYSDIPEGRFGSPQKEHSPFIGFAAGICSGWTK
                     LIVGHPFDTLKTRLQCAPPGTFNGAWDCFKKTVSKEGPRALYKGASIPAISWGITDSI
                     LMGSLHNYRAFLSAHGLGEQVPNSDQKRLSLLGHSVAGLFAGWTNATVAHPTEIIKCK
                     LQLQLVQPEHVPRQFSGPIDVVRQTVAEQGVTGMWRGLGASFIYRSCFAAMFGSFEVF
                     NRLFKSWDGTNWAMSAGLANFLAGGMASNAYWLTALPLDNVKNRIMTDDIKTPRYRSV
                     FDAYRQVWNEAYDGSKGLRWNVLARTKNFYRGFVPVALRAFPTNAAALAVWEGVMRWS
                     KA"
     gene            530811..533778
                     /locus_tag="CNK01820"
                     /db_xref="GeneID:3254585"
     mRNA            join(530811..531379,531441..531921,531979..532277,
                     532336..533778)
                     /locus_tag="CNK01820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658057.1"
                     /db_xref="GeneID:3254585"
     CDS             join(531742..531921,531979..532277,532336..533572)
                     /locus_tag="CNK01820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513715.1"
                     /db_xref="GeneID:3254585"
                     /translation="MHIAYILGLVPLAFAGVIKHDPPKFQPIQSTRIVRLHPNGDKSK
                     CVDLLGNTRQDGQPVQICDCDGTPAQDWVLNAGRGQTKVQLAGTSFCLDATHPYAADG
                     TNMKIWKCLDVQQQDWYWTSDNRIVLRDQGKCLDWATGDRSDFNQLQVWRCSTDNNNQ
                     VWTTGPDYGGNHGGDAGGNPGGNQGDDSRGKTNTGGNPGGNQGGDSGGKTNHIIPDPP
                     GPDPNSEPLNPALEAIVNVTEAAGPWPPMINFDGDYSNDDVTVSDQVPFDYCIGEGSG
                     NPTDDEGQQQGQNFTANVAGIGRDFCLDNFGNPDIRNTISFDNNTSIGNGADTGRALH
                     KRTFADSGATGTPNRWRRGSVISICVERNNNYLVPYASSPVPIRASAIVASAMVRAIN
                     FWNAGLNKRFVSFEFVENCNDAVFHTLAVDQIKSAKEPTVLATAPFPPRGEEGARNRN
                     IFVWNTAFEANFQNVLTFIMSHELGHTLGLAHEDCKSRDQPCEVITDKVAGSVVESRI
                     SGSTTQLFNGPTPLDIAGANEYYSLAAGPNTPENIVLWPATRGPFINYPPLPKCKWFL
                     GICYY"
     gene            complement(535709..538689)
                     /locus_tag="CNK01830"
                     /db_xref="GeneID:3254710"
     mRNA            complement(join(535709..536057,536122..536472,
                     536524..536576,536631..536775,536836..536916,
                     536975..537328,537393..537497,537553..537672,
                     537727..537826,537879..538056,538106..538214,
                     538269..538468,538523..538689))
                     /locus_tag="CNK01830"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_567662.1"
                     /db_xref="GeneID:3254710"
     CDS             complement(join(535791..536057,536122..536472,
                     536524..536576,536631..536775,536836..536916,
                     536975..537328,537393..537497,537553..537672,
                     537727..537826,537879..538056,538106..538214,
                     538269..538468,538523..538634))
                     /locus_tag="CNK01830"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_567662.1"
                     /db_xref="GeneID:3254710"
                     /translation="MPDNLIDIPEIRFNGEPQPVFDYHSLDGQSPAICIDNGAHSWRA
                     GFSSSSTPYIDRINMVSRYKERKFGKNVLLFGGDTDADANSRSNARSMFDGDLLIQGD
                     MLECALDFTFCQLGIDTPQIQHPIVMTERLANPLFSRAMTSELLFELYNAPSVAFGVD
                     SLFAFSRQGKKDGLTINLGHQATTIIPIFDGQALVNRSKRIPWGGSQASELMLKLAQL
                     KYPSFPVKVTQSQATFMYRETCYFSTDYDEELRTLEVPANLAAMTKVIQFPYSKTEAT
                     EKTEQEIAAALERRKESGKRLQELQAKKRAEKLAATIAELEKYKLLLSERPTMRKADF
                     LTKLSEDTPFDTEAQLESWVKRTEADVRKKQRKDLGLEEEPEEVPTFPLLERPDEELN
                     EDELKEKRRQRLMKGAWDARMKAKEEKRKERERMEEEKRKEEEERETNLAGWAAKLKD
                     QQDAVINRMQARKKRKAQLGDRKSAASQSRMKHIANLAAEEKISKKRKKGEDDDGFGM
                     DDSDWAVYRAMEGEEDSDAEEDDNNLLQSIETRLLQYDPTFTEDQTMLGRAEAKNRLI
                     NAFVRGGNSEKFDPEDVRQNHQLHLNIERIRVPEVWFQPSIVGLDTAGVGEVAGWILN
                     GFGEEERKRLMQGIFVTGGGANIPNLIPKLRHVLTPILPFRAPLKVVSSLDGGDPRLE
                     AWRGMAQWSATEEAKQAMVTKAEYDEHGGEWLKEHRWGNVAP"
     gene            538876..543436
                     /locus_tag="CNK01840"
                     /db_xref="GeneID:3254470"
     mRNA            join(538876..539119,539167..539279,539330..539543,
                     539593..540611,540660..540785,540849..540950,
                     541011..541143,541199..541308,541365..541517,
                     541585..541690,541748..541884,541947..542218,
                     542266..542398,542449..542725,542775..542920,
                     542973..543436)
                     /locus_tag="CNK01840"
                     /product="exocyst protein, putative"
                     /transcript_id="XM_024658058.1"
                     /db_xref="GeneID:3254470"
     CDS             join(538945..539119,539167..539279,539330..539543,
                     539593..540611,540660..540785,540849..540950,
                     541011..541143,541199..541308,541365..541517,
                     541585..541690,541748..541884,541947..542218,
                     542266..542398,542449..542725,542775..542920,
                     542973..543335)
                     /locus_tag="CNK01840"
                     /codon_start=1
                     /product="exocyst protein, putative"
                     /protein_id="XP_024513716.1"
                     /db_xref="GeneID:3254470"
                     /translation="MSSIPRTSPQDDVRAHITASLCAQRAPDGTPEETLITFLKVYEE
                     DPAGGTKSRYLILAVQRTGRVFIHKAKRNSNLSFSKGKTWYLEDVRVLEVMGPSDFAL
                     TMTTRRYHWTTERPKDQTAFLTSVVKVYKEYTHGRLPELINFVPPSTQPQPPSQQQMP
                     PHTGLNEPFPIPRVGNSDLTPPQPFGRSYRANSSSSVNSSQTYGSHYQPSHSESSRGR
                     PSLDDDRSPPSSAGAGAFARLPLSDTGRRPSVGDGRGVMSPRAVGPGNGVGMGPPPAQ
                     RKMSDDRAERIGPSALRNVSAASEYDPGAAGDASLRMKKSESDMGVIAEMERERSVLA
                     GDGRKANQSNRIASAPVIREPSSPPPPLPPPPQSTSNPQASEQAKPKPAPPTITTTDL
                     SVPSPGLTTPAAYSSSPASATRPYRRASFHPPPLDTTISRDVLLQSRTGLLPGAAGMT
                     IDESEGDDGVLKNVEEMLEGFDWGMSAGGLGISGEGKKKGADVIENRLLDELTALDSA
                     IIHAFLESDDRTAQVLAHIDEALMELDDIDLQITGYRMQLNAVSDDISYIESQGKGLQ
                     VQTSNQQVLLNELRQLLQIVEVPADDLHTLIKEPPSSEQGVKALERAAASLYKALQAG
                     MDTANAEVAATIARMQEYREQSSKFCKRMSDYLDITFQYQADSTLSEFRKNFKKTMAL
                     ESHQKMGEKLMIYTGLVLYIKEMDDARYQKLCSDYMSRASQLHQSEMRELLTYMASLN
                     VSSGDAGADADFSSAPGANYARPSALQKSKTVIGLGLGNQPKQEKRTGNNVNRAAELY
                     RQAFTQIINQIVIEEDFINAFLRPVDTESTFADYMELDSYFRRQAARHASRARSAGMI
                     QLLRSMMDLIFGFVEVELKNWVEATVEKGPVAIVGIIAVTERLAKEAEEENTSIFFAQ
                     LFDKQLLKQRLIMDMFVNKQIKLIEASKTVIKRRKGIIFFVKHFPVFVERVEQQMDGN
                     GDLPIRVKVNEAYERVMTSVFGSLEQLAKMERAETQANEDKGQLNYHVIMIENLHCFV
                     EDVSQIKSMAMAGFLQRAKARYEENVSMYIKLMLRRTFARFIDFFDGVDRLLQSTPAN
                     EVSLHHSYNRSALKKILKDHGAKDMRKAVETMSRRVDKHFADDEEPNTSTANTALISI
                     IWKELTKEFAKEILRAQGIVAKSYGDSGLGLEFSAADVEATCKKMK"
     gene            543554..545717
                     /locus_tag="CNK01850"
                     /db_xref="GeneID:3254403"
     mRNA            join(543554..544086,544137..544295,544379..544874,
                     544933..545072,545122..545197,545247..545717)
                     /locus_tag="CNK01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_567664.2"
                     /db_xref="GeneID:3254403"
     CDS             join(543830..544086,544137..544295,544379..544874,
                     544933..545072,545122..545197,545247..545579)
                     /locus_tag="CNK01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567664.1"
                     /db_xref="GeneID:3254403"
                     /translation="MPFPQPSQDTESQYVSSSAVPSITRSVATAVEKHGSQFEREPDA
                     SLSISASASQPNNGNMRSGNALVLFTPPIILQKGIFSGKQMRFALTVEQEPVLGRRKT
                     EKDRRPLGPAPIVRLRAVECRSADDDAGVIEEEVDAGTLDAVNIVCAADLCAPMVSQY
                     SAIEETSGVKLLRGSEHQPHGENDTSSANFPGATSSEQASSGPSTQAQKARDQAATSE
                     VDPASLGDRSLAEDVVRGEKAAKEWKRPKSSGEMSSGSATETGSAHRGGAGRGAAVPE
                     RNLYGNLHVGGVKVPDLEGKMGVWFLFTDLCVRQEGSYSLRFRCYDITAVEEEGLPVA
                     QLVECRSQPFRIYSPRQIPMLPKLTELAEHFARLGFKLNTRKNDRTAQSPPPPPPSTA
                     PLSAEAAVSATGSRPQPCPIQPLDPSSHMSSSSSTSNSEKAMKSTSTGQSTSFLTDNT
                     SKTSNSLGGSGVSGAKGASTGDGAVFAADIGEQRGK"
     gene            547310..550642
                     /locus_tag="CNK01860"
                     /db_xref="GeneID:3254564"
     mRNA            join(547310..547616,547683..547770,547827..548165,
                     548220..548659,548706..549029,549085..549788,
                     549845..550642)
                     /locus_tag="CNK01860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567665.2"
                     /db_xref="GeneID:3254564"
     CDS             join(547324..547616,547683..547770,547827..548165,
                     548220..548659,548706..549029,549085..549788,
                     549845..550431)
                     /locus_tag="CNK01860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567665.1"
                     /db_xref="GeneID:3254564"
                     /translation="MANPIPLPTVPEDTLHYVIHLPRLEEPLTAALLVTEHVHSLLPE
                     RWLWNKDPWELKVATDDDHKLEGRMRVGDAVDDEWLVVWLLTQVSKKWPEFIISVRDT
                     DGEFLLIEAANELPSWVSPDNANNRLWLSNGHLHLLPLNIHSPAPPHQLPDDLTFDSS
                     IYLSETDALRAVQTGRYLAPKEVENVVWERIKGYPEAMKTHLHQTKIYLPAGIAKALN
                     RKPELVQKAVEAFYVRDPAQLRAASRMTHFPPSPSILSQLTLTRAAYAQLQGQVFHPP
                     RVFGPEWNVRDPPSLDATEGTYKHLENERRWRDLGVKLATGFEIMYREGGRKSRSGAT
                     GESVDSAEDKGYASFLEGIRKAGWFGNELEGSQKWKEREEKARKGYINAKSADIASQR
                     PSFAYLVDNAIASCSLSLDQLAVSEDAPEDNDDWLQISPDELDSMMLHASGQAKQSDK
                     QDEEQRKRENVELTEEDGKALGDLAKKVQEFVGGQGDLQGAQFVDELSDEDMDSGSDS
                     DSEELQAHKDKLEAEKQARMDSLVPTLPASDWGRKVHISEQSHQLPVAINQSLTSPKA
                     DGKKIDPLEFIPSKMRPPRFAKQEFDGVVSDSESDSESDLPAEGTWGRKVAQMKWSEF
                     PPVDLEDNQQARIEEIEEEDEDEQQRKAKLRLGEDVDLEEEMQRRVWGDRGEDEDEDE
                     DVAAGGEEGVDIDMEDETEEFLKFSREALGINDEMWEGILGDRRARGAFVPQLSGKVK
                     RKDELPAKLQPRDSTSKKVQFAEADFPSKSASQSSATTQSPDQSNTSLNSFETVMRAM
                     DEALARSRDGPSTSQPSQPKSSNKSKNKKSTSSANPLPPTSQTNDVDLDAFSEDDIAA
                     MDRELRSVLKGAGIDPDDSDDDIEEVGELDVNQKREYEMMKNFLESFKSQGGESGVVG
                     NLFGRLSEKH"
     gene            complement(550588..555561)
                     /locus_tag="CNK01870"
                     /db_xref="GeneID:3254409"
     mRNA            complement(join(550588..551062,551166..551436,
                     551481..551558,551602..551648,551686..551712,
                     551765..551773,551834..551962,552044..554344,
                     554395..555561))
                     /locus_tag="CNK01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658059.1"
                     /db_xref="GeneID:3254409"
     CDS             complement(join(550833..551062,551166..551436,
                     551481..551558,551602..551648,551686..551712,
                     551765..551773,551834..551962,552044..554344,
                     554395..555505))
                     /locus_tag="CNK01870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513717.1"
                     /db_xref="GeneID:3254409"
                     /translation="MGSASSRPAKAPQDTMSSKLPASPQQPPPALPPKPGDGSSDILQ
                     LRAAALRSSTARSQDPRPPAPAGIFGAAPPASAAGVSSQQAPALLERISKPKPSLADR
                     IGKPNLSPVAPDDKEEGEISDDEYEPAGGEGSMLARRIGGTRVTPVQAAFNGIRSKAM
                     HHTERSPVSAPSSRSGRPTSTRFEPATASRDDIFPRHRVPSLPVPEPSPPPQTPPPPT
                     NIELPSPRIPTPPLPSTSVHLVPSTPPRSPSLPPQEQVVGAATPPLPLQKEHYHEATT
                     PPLPPQEQIFEAKTPPLGPSFAPSSLPNSPPGTPPLSSTFEFSDSKETWTRPPTPEFE
                     GAAEEEQEDRTWDNEDAIMNEEDRLELESPLAAPASNAPEEENNDYMDIIRNLLYEGV
                     DPEALIARGAPPEHVMAVCREIVQGTRERDGFGEQETPDVGYSREGSMAYAIEPSEAT
                     APSSENMVDDEMLAESPGSEATVEPLAYRVDPAQLLTLASVESPEPEAPRPPEPSFPT
                     PVLSPPSHPIVSPVSQVPLESRPSPRLGSLLAPSLSVPDMPPTSASTSSGDQPAQSTL
                     HTGLASLPPRPTSLLPPSGSTPQPSVPPVQLPVPSSPANKQPSSPANKQQSSKKKKKK
                     KKGNQEEARANAAANASTEAGPGPSTMASQAISQANQTGPSQPPQPSQPHPHPPPPTK
                     PLKMTKKEKKAARAQAAAAAAAAASTSASVSGPTGLPPRPAVYPEPYHAAPYIQDPYA
                     MYPVQPQPQVQAHLQHQYQPQHQRQRQPDLPQVFQQPAIFDINVEVPVTPLAQDQPPP
                     PQTAAPPLPPGSPPADLQTMLSESKRKVLESMRRRKEASVQPSASVTPALEAPALTST
                     RGSTTPAIQSAEVQSTGVSIRTGDLDRSVQEEAAALEREFLGMHMTAASMASHVDPNS
                     VTQSRSMSMEMDVDVDMDIDEPEEGEILVVSPRVSAPAPILTPAPASALPSILSTSAT
                     LPERPASAGSNLPVRRGIKRAHAEDLNESRTVSALAARPPLAARRLFCAPLRPHQLKI
                     SLDEDSDPDDTDDEDDEENRRIEADEKQRKLEEEIARLKAQIAMKKRRKLQSGQASGA
                     TTPIPTDMGSNADTEVQEISVSQDQGNLDIVKSAVIQSIGNPRGEDAFRSSTPADIKQ
                     LTQELAQKEAQKEAHDEVMQVHAPGAGVTASQDSAIAESVIAVPGDENEDLALVVDGS
                     NDHTAVSAASQTSQPSTLSSEQRTSQPQQLSFHAYKPILSYYPQLSRTLIPLSSSSSM
                     AASSSSLDPFLNIDHGLLDSIMLTNRSQRDPSVTLCSAEVGGGKCADRNCLALHLNKT
                     LIPSDEDLVEYVFESITAPQERIGSADKAKEKIRIAVKLAKNSLAAVSGGVERRQDHS
                     AQPDSNEQYKKLLEKVGQILQG"
     gene            556228..561553
                     /locus_tag="CNK01880"
                     /db_xref="GeneID:3254718"
     mRNA            join(556228..556868,556932..557030,557091..557222,
                     557281..557388,557450..557587,557637..557708,
                     557766..557846,557913..558179,558240..561553)
                     /locus_tag="CNK01880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658060.1"
                     /db_xref="GeneID:3254718"
     CDS             join(556287..556868,556932..557030,557091..557222,
                     557281..557388,557450..557587,557637..557708,
                     557766..557846,557913..558179,558240..561446)
                     /locus_tag="CNK01880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513718.1"
                     /db_xref="GeneID:3254718"
                     /translation="MLTAFFGYVTELTCLVLLFATFFLIPSPAPVCTCECKCGRKYRI
                     PAVFPSHRDAPIKQSTTADSENFKSVTEKELEQPAKAPEEQSSHPIEQQQQGRLKPVI
                     VAETPQPIIQSSENVETTDTKPIEFQKSTKSIEPIETPGKEESLVTPVPSGWDASAPI
                     ERQTHNDRSVGRSIGDWQVEREVNEKTVENNYDGRYIEPFKSPTSRILDSWDESTSSH
                     RAVEDSRDGESLEPSRSPAKSETRSEISRPAFNGRPLPPHQVRSTDTFDHGYDYRSSI
                     ETSSYASKRKTELPVCKPCNKQFKSPAALQQHTQAVHSAPLFSKQSRSRVSSPEISTH
                     PPAPGSVTSSAGRPKSSFDDGFHSPYMCEICNEDYHSAYDLRQHKMEKHPWAMLCPEC
                     LVTFTHAHEARDHYELVHGSEPASFTRTQRMLDTIHSSAPSPRAPSASDSASNYAESN
                     YATRAAKPPQYQILASYDSHVVQAEHRCQQCDMVFPNAMDLRAHVNSPFSHGGEKLTP
                     DNFPPLGSTSIAPSSSESVSQHKPITPYASYSQPAWDTSMPSFVLAARPASNRQQFKS
                     AISPEAKLTPDDNPAETEAEEAVPKLVEAKAVMENVPAIEHEDVAREAEEVAEDKNTE
                     HERERPVELETETEIEQVHEQEQRFEHGPGLESDYVATLEPVVADEHHGEVEKFEAAE
                     APAAPEPIMKDRTPQAPIPEAIQDEQNGQIGQIEQAEQVHNHAESSASAVITGSETSS
                     EPAPRDNTFKHKHPLPPQSKAAKKAIARQLYKNAPKQPKQPKKLKAKQKTQELFESDE
                     DVDFELPSDFEQLTGQASEFGVSVTFIDEASRPLKKEINAQDDLTSSNSLPKSLYSTA
                     RAKLDLPPATYQYESDEEEAPGVVVEKEVTAMAPEPSTAAFDEEVIEIRRTIYIPRDD
                     YSDDEEKPEVDEASAEKQTPVIQSSQSKDATQEEEREKDAQTPFTEPTLSSTFEAPIV
                     TDMSEMVESLFVTDANPVDIASPEPSVVAATYGHLPENAHSSNTVDEEPSGPFSGLQQ
                     DQHVSETTMPSNAVEIIRPAEVVEGTEAVDEVTAEQTPVPSDPAFAEIDAENDMKVEA
                     TPPSEATAQPLEAFSGTEHDDLIGEITEANISRDINGEAESQTSPESEAAAAQPVEAI
                     SGTEQEGLIDETTEADTSREIDGNAEGKAPPELSQADSSFTPAAPLRSLSQSSDVPDP
                     KDEFVQPIHTHDQAPDLVDALQSSHPYNSERDAVAHSPEQLAESVQIASSAPPVMEGA
                     GAEAAREEELAAIEAEEAARAAQALAEAEAEFAAAAVAPVITDDEPSMIGNIEFSVPS
                     FAFSESNTAIIANTPLSLSTNEEHEEGQVEARTAESEQPLPSIAPADDDHWAESEEVY
                     RIAIANRARPPLNLAPIRDRDSYEDDSRSFRFPPNRRTNNHGPTRKRNSTGSNGWGPK
                     PIPRPFKNSTNALEKMRSARSEVEDERAKDRERRKGVTSVRSSSFNGVDESGWISMDS
                     KSHHYDRYEGSASRYGDDGDSGWSPNDRQGWGDNRRASFSNSMTMSPPQNNNWGSLPG
                     VADGDTGGW"
     gene            562175..564450
                     /locus_tag="CNK01890"
                     /db_xref="GeneID:3254471"
     mRNA            join(562175..562716,562774..564450)
                     /locus_tag="CNK01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_567668.2"
                     /db_xref="GeneID:3254471"
     CDS             join(562250..562716,562774..564271)
                     /locus_tag="CNK01890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567668.1"
                     /db_xref="GeneID:3254471"
                     /translation="MSFYDHHHYCQPGYGRFSTYSPLGHQPSPVNMFATPTPSYPSFA
                     TQPDYYSLEEEERAALVHLQTIQRRRQAMEEARAREATIRAHAQAQREAAIRAEIAKR
                     IAREQALHARRVEEERKKRAYLELVERKKAEARALREAQYLQAQRERAIRCPKRCCRT
                     VTPRQSPATPDFDEVNALFGALLGIAVKEDCDGESEVKPCCKPQPAAVASPQPKAESK
                     PQPKPETKLESKPEVKSEPTSASTTKSATSSPSSSEEASLDLNKLLNQFLGLQIEPLS
                     SDASTSTASKSNKVPKGLNEFLAQFGLVFEPEEQIAERSCEGTCADKCQCNATDSCGG
                     SCKKSKGKQVAEGEKKPTPALTTSKAPTTASTDDAVPAPDPSTSLSALQDIERQLDAL
                     QSGFTFPERLSFAHSVPGAHAPPLLFNRLNSAYHAQTNALLQLLLQADSIVSNGESQV
                     RRKRKELVKKVEHEIQKLEKQRDEKWEEVRKRRLDGEESEPEDDDRSWSESSSESGKD
                     IQDCGTVDENGEVKEVPSNQPAAGSTARVVSAFDGPTASTAAVVPQSSESFTSVEDAI
                     TTPANTSEEVPSTPVGEQEQEGSCDVPAATVQSHQSPAESEPAAIHASTPVSPVHHPV
                     TVEDAEDEADKKEEGKKEKQEAKDEGYEMI"
     gene            complement(564354..568087)
                     /locus_tag="CNK01900"
                     /db_xref="GeneID:3254546"
     mRNA            complement(join(564354..564890,564944..565008,
                     565061..565383,565434..565499,565556..565697,
                     565750..565831,565887..565985,566042..566215,
                     566275..566492,566549..566656,566714..566791,
                     566844..566935,566986..567100,567156..567308,
                     567371..567576,567626..567790,567846..567871,
                     567921..568087))
                     /locus_tag="CNK01900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658061.1"
                     /db_xref="GeneID:3254546"
     CDS             complement(join(564539..564890,564944..565008,
                     565061..565383,565434..565499,565556..565697,
                     565750..565831,565887..565985,566042..566215,
                     566275..566492,566549..566656,566714..566791,
                     566844..566935,566986..567100,567156..567308,
                     567371..567576,567626..567790,567846..567871,
                     567921..568051))
                     /locus_tag="CNK01900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513719.1"
                     /db_xref="GeneID:3254546"
                     /translation="MPRQQSEDELRIRGQAPRSPRSSQGDPLERNSKLEDEEELDLIR
                     RYEDFSTVDWIQDSLHERTFQNKAPRSRIIAQLDRSDGAVGHLWRLIRRALEEGEAYV
                     VISLVGVIIGVSAALISIITTWLSDIKMGHCTTGWWLTRKFCCLEVSDEMEACAEWKN
                     WGGVEPFQWIAYVLFAAAFSFAAAYLVKNFAPYAAGSGISEIKCILGGFIINGFLSVE
                     TFFIKGLTLPLAIASGLAVGKEGPSVHVACSVGNVVAKWFSRYERSHLKMREIVTASS
                     AAGVAVAFGSPIGGVLFSIEEMNQTYSNRTMWRSFVCALVATFTLASMDPFRTGKLVI
                     FNVSYDRDWHYFEIPAYILIGIFGGLYGAFVIKFNVQMASFRRKHLSGHGIFEAVALA
                     SITAIIGYLNGFLRIDMTEMLSVLFRECEGGGDYNGLCQASSQWRMVNSLLLATIIRT
                     VFIIVSYGCKVPAGIFVPSMAVGATFGRMIGILVKAMYNSYPSAPWFAACAPDAPCIT
                     PGTYAFLGAAAAMGGITRLTVTVVVIMFELTGALTYILPAMIVLLVTKAVSDQFGGGG
                     ISDHMIKFNGYPFLEKEDKEDPTDHAFIEPIANVMKKDLIILEATGVPLNHVVDIVQH
                     TNYQGFPVVKSHEDQTIVGFVRKNELRIALEKTRRVRNLSFNTTCTFQCIRAIPEDAH
                     ELLERPDILIPSQGGIMTVNTGAENREDNGSEISHVDFGQYVDDIPLTVAPKMPLELV
                     MQLFRRMGPRVILVSDQGRLTGLVTVKDVLRHELSEAHHRSRSTHTPLTPSHPAYAQS
                     NGWDTEWTVDDERGHGLEIALEEGLEWTRSKATWAYGAALERWRGIRGQDRRTATFDY
                     ELDEGIQG"
     gene            568276..572314
                     /locus_tag="CNK01910"
                     /db_xref="GeneID:3254424"
     mRNA            join(568276..568590,568695..568920,569398..569527,
                     569581..570478,570529..570622,570671..570802,
                     570851..571329,571387..571492,571541..572114,
                     572170..572314)
                     /locus_tag="CNK01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_567670.2"
                     /db_xref="GeneID:3254424"
     CDS             join(568561..568590,568695..568920,569398..569527,
                     569581..570478,570529..570622,570671..570802,
                     570851..571329,571387..571492,571541..572114,
                     572170..572218)
                     /locus_tag="CNK01910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567670.1"
                     /db_xref="GeneID:3254424"
                     /translation="MPALPTYIRTAINPKDLGLTIQAMSDQRKDAAAAWERLLSNGSV
                     SLPPDILEAVRRQHVVPRTPLDNQNLQNWSPFLQRQPMAQQDPAASIAGHATPQQISN
                     ALELPQGTHMLHSANPPLYSSIQPPTSQHPGLTHHTFQSSITNLPQSVNPALLSIAQP
                     LPTGISSDPPFISQASLPPFPQQERTQLPFVQPLYAHKRPSNSPLPTSSAVKKQRTVE
                     VVDLSQSPPANSQHPLTSAASQSSVDSRQARSPLKQATGPPPTTQGTLDPYLAAPGEN
                     GHYQAFTGKHIPPPFSHEPSVEEAKKAEISNGAVASSSKSVPSKALPAPNSIVDMSTI
                     RSLINTEILKKSNSPGSLFKHLRMRGEDDKEPPSFTPNPDELLEILSQLRDHAPGAYL
                     AKMADNDRYVQVWQRWLKQCRKEPEIWEKVMVPLLEVLSRTEMPLETAKEYGLNKHAM
                     SLPPLAKKKNLSSADAIQTAFDKYSKYLLAVHKRHQEANAKAKENKSTESSNAGTKRK
                     ADQVIKDDGKVKEESSTKRPAIKTSNSSTKASSVSGTPKSSTKLSTVSDMSFFSAPAA
                     SQTPKPKPKPTSSSSKPIASQASAVSSSAKSFTLGNFLATMNNKQGTAQNPTTEIKKE
                     SKEPRYTTKGRLIRSVRWKEDAQLEDVREFSPAAWEKELMGHGPKVSVHELDMQEGAM
                     LAMNRNRGDIDWYEPTMYLEKPSNFPIITEEVQYQLERERGILSVQYLAGEVIPDPVE
                     DNVRTVEEDESTRRMNPAVVAEDSQKSIMLESAPTATSVQSLLANLQGIPLQQSHIHD
                     QPHYSGAGQPAMAFTANPATAFPAYYAEQLSTGWGAPPVPASSTAGVEQYWEQRDPYD
                     HSQSSSKGKGKKKRGSWQIEKKGTKTCQYWLQGDCKYGDSCHFAHTTDL"
     gene            complement(572283..573233)
                     /locus_tag="CNK01920"
                     /db_xref="GeneID:3254607"
     mRNA            complement(join(572283..572922,573016..573233))
                     /locus_tag="CNK01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_567671.2"
                     /db_xref="GeneID:3254607"
     CDS             complement(join(572442..572922,573016..573122))
                     /locus_tag="CNK01920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567671.1"
                     /db_xref="GeneID:3254607"
                     /translation="MSGFVLGTGSGVLTAAAVYYTLSAHLTQTTASLRSDLHSSSNLL
                     NASFDPTIPPAQAALIGPSSTSPPPPSFSQVLRQRWNDTLVSFIGNVRQSDWELIGKE
                     VVEVGRSVVDRLGENGSTGQMVQKGEELADALNERASTIIDQFKGVGTSVDNGAESIK
                     KAAEGIDLHKDNVGIVGGPREEMKKRVTEAKGRLV"
     gene            573294..573396
                     /locus_tag="CNK01930"
                     /db_xref="GeneID:3254513"
     tRNA            573294..573396
                     /locus_tag="CNK01930"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3254513"
     gene            576861..578993
                     /locus_tag="CNK01935"
                     /db_xref="GeneID:36393103"
     mRNA            join(576861..577069,577132..577188,577273..577460,
                     577517..578519,578579..578993)
                     /locus_tag="CNK01935"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658807.1"
                     /db_xref="GeneID:36393103"
     CDS             join(577177..577188,577273..577460,577517..578519,
                     578579..578776)
                     /locus_tag="CNK01935"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514642.1"
                     /db_xref="GeneID:36393103"
                     /translation="MTSMSPEDVRIDVQDSALSITDAIIPSMSDIKSRAKQAKLSLRT
                     SVQDLKKRKEPSYKGDNGRSGSHLSPPSVFPIVNRPHDLQKANVSTSGFGIRAFLRRL
                     TGGQPSPQITKTASPTQQVGDRTPIGGEKEKDVLKELPEELRSDIRDDQIKLDPCNIP
                     LPPSPTTTPSSLPEELSPEIRDDQIKLDPCNIPLPPSPTITFSSLPEELSPEIRDDQI
                     KLDPCSIPLPPSPTITLSSLPAISSSAEPQEEEQIRPRSESAKPEENRSPDQHFSVCL
                     PAANDLLACQTSGSDGRSHQPPPMLSISPLTIQETCPSPDTSPTVSPVEDEIIVSPVS
                     FQDSESGLMMDWADSQERVDLDGEVQQPAYSRSRSASPAFQKAEFGLSGEKRGNNKSW
                     RRSMRNLSEALNRRSSFKPPPTSYDAYMTHQRRMADRRQGCAPTVYRTGAQAVLEAIN
                     NLEEEDEMMAEKFFMS"
     gene            579334..581462
                     /locus_tag="CNK01940"
                     /db_xref="GeneID:3254707"
     mRNA            join(579334..579769,579816..579919,579977..580033,
                     580092..580406,580464..580774,580821..581228,
                     581282..581462)
                     /locus_tag="CNK01940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567672.2"
                     /db_xref="GeneID:3254707"
     CDS             join(579412..579769,579816..579919,579977..580033,
                     580092..580406,580464..580774,580821..581228,
                     581282..581399)
                     /locus_tag="CNK01940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567672.1"
                     /db_xref="GeneID:3254707"
                     /translation="MPPPSLTSSSTRFRVGLFVFLLAVSLSLTYRFAPSFSSRRSIFP
                     NGKTRPSEYIIDVDVEKLQGQTGKRIAIVGAGASGSSAAFFLRRAASVVERRAGLAES
                     SLISDIIVYEKEGYVGGRTTTIYPHDDDRARPQELGASIFVDSNLNLMKAVKEFNLTL
                     VDPDFGGSGIGIWDGRKFLFTSSSSSWITSARALLRYGPLSPFRTRRAVSSLLKKFLR
                     LYDPSWLHDRGVMYSVEDFAEVVGLGSEYTTRSGESWAKEVVGAGERWIGEVWEGSTR
                     VNYAMNIDKIHALAAGVSMATGGASQVEGGNYQIFQSMLADAGAKLYLGTTVEDIVPQ
                     EKDASRKFIVKTNRTELASEEVDHVFWAAPWGLQRMKSLEKEFTEPVPPTPYVRLHVT
                     YLTTTQKHPSPSFFGLPAGSTVPNTILTSAHPPRSPNAPSLPPPRFQSITWHGESFPG
                     SNEYAVKIFSLTRLSDRLLREILGDEPTWVKRKEWNSYPKMEPTARYAPVTLTEGVEY
                     LAGMERWVSTMETQTISAREAVARVAHKWWGLGLGECEDGDSWDWTCS"
     STS             579539..580387
                     /locus_tag="CNK01940"
                     /standard_name="Bam10"
                     /db_xref="UniSTS:470693"
     gene            complement(580861..581998)
                     /locus_tag="CNK01950"
                     /db_xref="GeneID:3254434"
     mRNA            complement(join(580861..581604,581657..581873,
                     581915..581998))
                     /locus_tag="CNK01950"
                     /product="mitochondrial ribosomal protein s19, putative"
                     /transcript_id="XM_567742.2"
                     /db_xref="GeneID:3254434"
     CDS             complement(join(581589..581604,581657..581873,
                     581915..581957))
                     /locus_tag="CNK01950"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein s19, putative"
                     /protein_id="XP_567742.1"
                     /db_xref="GeneID:3254434"
                     /translation="MHPTALALRRSTWKGPFFTAFPSLSHHLKNNTPIFTKSRASTIL
                     PNFVGIKFMVHNGKDYLPVTVSEEMVGHKLGEFAPTRRPWTYRKTKN"
     gene            582174..584550
                     /locus_tag="CNK01960"
                     /db_xref="GeneID:3254552"
     mRNA            join(582174..582250,582295..582356,582404..582483,
                     582534..582664,582712..583344,583406..583586,
                     583633..583960,584025..584153,584211..584550)
                     /locus_tag="CNK01960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567673.1"
                     /db_xref="GeneID:3254552"
     CDS             join(582214..582250,582295..582356,582404..582483,
                     582534..582664,582712..583344,583406..583586,
                     583633..583960,584025..584153,584211..584333)
                     /locus_tag="CNK01960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567673.1"
                     /db_xref="GeneID:3254552"
                     /translation="MAMPGGMPMVVMNTGPERQSGRKAQTANIVAAKTVADVIRTCLG
                     PKAMLKMILDPMGGILLTNDGHAILREIDVAHPAAKSMIELSRTQDEEVGDGTTSVII
                     LAGEILAYSLPLLERHIHPVVIIRAFKAALNDALETIQRVSIPVDITSETEMLALIKT
                     SIGTKFSSRWSDLMCKLALEAVRTVAVTAEAENGLVGSGEGGDKVNIKTVDLKRYARV
                     EKVPGGEIEDSRVLSGVMINKDVTHPKMRRRIDNPRVILLDCPLEYKKGESQTNIEIS
                     KEEDWNRVLQIEEEQIKAMCGKIIEFKPDLVFTEKGVSDLAQHYLLKANITALRRVRK
                     SDNNRIARAVGATIVNRVEDLRESDVGTQCGLFHIEKMGDEYFTFLDQCQNPKACTIL
                     LRGPSKDILNEIDRNLADAMSVARNVVFNPTLTPGGGAIEMAISVSLGEKAKLLPGVA
                     GAPYKAIADALEVIPRTLVQNCGGNAIRTLTELRAKHAEGQHLYGVDGETGKVTDMKE
                     YGLLESASVKIQTLKTAIESATLLLRVDDIVSARRPGEEGGAGAGVQTMGEAGPEGME
                     M"
     gene            584715..586186
                     /locus_tag="CNK01970"
                     /db_xref="GeneID:3254467"
     mRNA            join(584715..584879,584931..585381,585439..585566,
                     585631..585753,585806..585875,585940..586186)
                     /locus_tag="CNK01970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658062.1"
                     /db_xref="GeneID:3254467"
     CDS             join(584718..584879,584931..585381,585439..585566,
                     585631..585753,585806..585875,585940..585977)
                     /locus_tag="CNK01970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513752.1"
                     /db_xref="GeneID:3254467"
                     /translation="MTNLFVVVDRSLNNCYFHCSLAFGINNFHLDISIMAASTPLLSR
                     GTLIKQGAEAKVYALPSLFPEPTTYHPGSSSSFSAASPTPVILKHRFTKTYRHPTLDA
                     YLTSQRLTFEARALARAAKAGVTVPKVVWVDEKAGVIGMERIEGWSVREILGGGAEGE
                     VEVIEEQEIEEDVENKAEDSAVREEPEGPESEGLKALKNLGVTQEHLMRSIGAALARL
                     HKTMIIHGDLTTSNMMVRLTPGGSGPYEIVLIDFGLSSQAQFPENYAVDLYVLERAFA
                     STHPRSEKLYAGVLETYAEGLGEKKWKPIQIKLKDVRRRGRKRDMTG"
     gene            590083..593822
                     /locus_tag="CNK01980"
                     /db_xref="GeneID:3254572"
     mRNA            join(590083..590274,590431..590683,590754..590844,
                     590908..591999,592051..592134,592198..593822)
                     /locus_tag="CNK01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658063.1"
                     /db_xref="GeneID:3254572"
     CDS             join(590929..591999,592051..592134,592198..593361)
                     /locus_tag="CNK01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513720.1"
                     /db_xref="GeneID:3254572"
                     /translation="MDGDRYSRPLSDDLQHSDLRPSDPSLYSNQVQTYPRESWREPNM
                     AFQYPSGPSSYRHHPSSWPPSSSSSPSSSFGRETRFPLPSSGRSSYLAPPPLAPYVAP
                     STGRFVPPFHEQPLNSDDRHPTLRVDGHSSAFVQRPSPEHGATAAEGESHSLPPLRSA
                     SGSYSYENTAYSPRTGEAYSSSQKPTMTQFSKLTTGEQEKVNAGLPPPHEVEVSPQGC
                     QSELVTSSTSERTRTGRTRPDSLANTANQSIQQAPATFSSYCRRTKSRSLSQSSQPSQ
                     NSRLSHQSRRSSHSQAEPMSREYSVSSNESSHAAGSAAPSEDLYSKKAPLPGKRRGRE
                     KKKRTRALMTHLQQAGLMRLWKKTKFPTSGDREALGQEIGLTSRQVQVWFQNQRQKSR
                     KALLENGGIPEGEDPADYEDLQKSPRSRRLSMDREENVLPWIGVRNEPSGSAYDRTGA
                     NIGLQSEDQNLHKPKGGLDPLNELSNRNSMSPHRRSRYYSGADSYPAHHVTSSNPYQS
                     PRPLRPHTYPYHHPPPFPSTISWQHAQYPSVSESPRSTTGSFFFGDSHYSHIPYDASA
                     LPGGHRRTSEGTSSSQTTMVSQPFEPQPARTQQRNEHLYYRRRSVCPEHLSTVGSPIG
                     VPSSMPATSSHATFMRGADAPSFSGQASACSDSSEYSTRPRSNTWLGLPPLRKHLNSS
                     QATDAVASHLPPTLARVAISGPIDGSEELPAIALGMTMDKDPHTFVTGEEAGSPRKRS
                     SFWGAEGRRVRSRGREVEGDNKVSVNWDTAPL"
     gene            complement(594645..598243)
                     /locus_tag="CNK01990"
                     /db_xref="GeneID:3254427"
     mRNA            complement(join(594645..597373,597440..597615,
                     597712..597929,598068..598243))
                     /locus_tag="CNK01990"
                     /product="expressed protein"
                     /transcript_id="XM_024658064.1"
                     /db_xref="GeneID:3254427"
     CDS             complement(join(594853..597373,597440..597570))
                     /locus_tag="CNK01990"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513721.1"
                     /db_xref="GeneID:3254427"
                     /translation="MAGPVIYDTPFDPAMPNSLGQELMTDWNPTLGSFAGSSRRRKNN
                     MTDHTIRSPYQNSPDSPYLQGQGQTVIITNPTPYQLPYPTISGSHLQPVAPPPHRHPV
                     SPLAQPQNYYHHPSDDARAYAAWQSGSPNGFAESSFHHPMTSGIAMPFHYAANEEKMS
                     KKKKGKQPMREIEAVNRSSALKRMRSEDSLRSSKKLRRDDGTQSQLLTPPSTSGGDIA
                     LTPAASHLQVHAEDMMTPIDEAPEILVERESAHTQNDVSDPSAESSHRPLVITRHHEE
                     GRKLGLLGIARGELEEGKSPEEETKSPRLKTIDVVETDESGKASLATKEVLETEVPWF
                     EERGKVTPPSSPARPQLQTPAEIPTTTRAEEADDLPEISSQKVARRLQSFFDSPVNII
                     EQPLVSTRIEMFGRVAVRKSTALSFLQLSTTDSAVEETKMGEESWGENLQISPVRAAL
                     RPMWPDDEAPWALAGGAMKDRLRREEGEKEALLRRYLEMSSDDSEDEEYEPVYPFSLP
                     STTAKGKWGRGRGKSVVRLMPEEIRERRRRRDDGSARAALLGSLRSRPLPLLPQGVVA
                     CVCGNNNANGMGSMVSCAACKTWHHLVCNGIDDISKIGPNWWCSSCNASASGMRTPVH
                     AYTPTRSHSTLGDPRSSAVKSDIDHIALAPSPMFVNNVSSARTPVSRTLRSPQRPHHS
                     RILSYGSDMWAFQEDVVPPSTPVPVLQDRYSTPRINDTPFDVTSTPSRHLDFNFGQPS
                     LFALTPLGGRSRVPSTMLIDGTPVLRATPRNVSGPGGPFEPMSVPSRSDFFRELNKGN
                     APHSAGPTLSLHASGAATAGAGDRENTHAASSPRWPSLLSAHNLSPSPFGGAGHRRTL
                     SGNKLSSIRSSSRSGLGMGVPEEKEEE"
     gene            599089..600840
                     /locus_tag="CNK02000"
                     /db_xref="GeneID:3254483"
     mRNA            join(599089..599371,599477..599900,599967..600562,
                     600618..600840)
                     /locus_tag="CNK02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658065.1"
                     /db_xref="GeneID:3254483"
     CDS             join(599489..599900,599967..600562,600618..600713)
                     /locus_tag="CNK02000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513722.1"
                     /db_xref="GeneID:3254483"
                     /translation="MSLRILTGSQVDSILARLPLDPALESQANVFRALTRQAKGVTNI
                     QQGAASIQTPHRLTVNSDKFSMLFMPSRAPTGASGQTGGGGKEQTTTACKIVSVPSGS
                     SAEGLPASTIIMDEVSGKAKALINARKLTALRNACGSAVFLSLFPAVTTKHLLLFGSG
                     AQCVSHALLFLRLHPFSQVTFVVRSINQRSQSSASAIQSQFPAARVSLSVHSSPSDEL
                     SQLVATADVIVTATSSLTPLFDSSPTCPKPGARVIMIGSYKPEMHEVDQALMKRAAKV
                     VVDSRKACEREAGEIIDAGIKVAGGAGLVELGELLEEAGLPGAVKDSGDTFEKEVIIF
                     KSVGLGIQDVAISKVVLEQAEINNIGTVIEDYD"
     gene            600996..602375
                     /locus_tag="CNK02010"
                     /db_xref="GeneID:3254620"
     mRNA            join(600996..601141,601207..601271,601393..601519,
                     601596..601683,601754..601784,601834..601866,
                     601929..602064,602141..602375)
                     /locus_tag="CNK02010"
                     /product="proteolysis and peptidolysis-related protein,
                     putative"
                     /transcript_id="XM_567677.2"
                     /db_xref="GeneID:3254620"
     CDS             join(601105..601141,601207..601271,601393..601519,
                     601596..601683,601754..601784,601834..601866,
                     601929..602064,602141..602334)
                     /locus_tag="CNK02010"
                     /codon_start=1
                     /product="proteolysis and peptidolysis-related protein,
                     putative"
                     /protein_id="XP_567677.1"
                     /db_xref="GeneID:3254620"
                     /translation="MSSFSVHKAALEGQIGLARSLLNDDPKLINSKDEDGRTPLHWAA
                     STSNLSVLQLLLNYHPDLEARDTMGWTALMIASAAGHPEIVRELIGAGAKVDAVNEKG
                     QTALHYAASKGNVSIGRLLINHGADINAKDRASQHPLHRAATTGNNAFLQLLLNPPEG
                     RPKTRLNTADRAGNTPLHLAMESGHGDAAVVLIEAGADRERSNSEGQMAEEIEGVGGQ
                     EQNKVREYVASKVGRRSE"
     STS             601978..603179
                     /standard_name="D1S3691"
                     /db_xref="UniSTS:474269"
     gene            complement(602361..605150)
                     /locus_tag="CNK02020"
                     /db_xref="GeneID:3254521"
     mRNA            complement(join(602361..602677,602730..602955,
                     603007..603292,603348..603527,603582..603669,
                     603720..604167,604232..604286,604335..605150))
                     /locus_tag="CNK02020"
                     /product="hexose transport-related protein, putative"
                     /transcript_id="XM_024658066.1"
                     /db_xref="GeneID:3254521"
     CDS             complement(join(602518..602677,602730..602955,
                     603007..603292,603348..603527,603582..603669,
                     603720..604167,604232..604286,604335..604451))
                     /locus_tag="CNK02020"
                     /codon_start=1
                     /product="hexose transport-related protein, putative"
                     /protein_id="XP_024513723.1"
                     /db_xref="GeneID:3254521"
                     /translation="MAGGNFAFNTVPNNTAASWWNDPGLRKLVFFMAICTISAVGSGV
                     DGSLINGLQIIDSFMDNLGDISDNYLGLVIASFSLGALPALPISAYCMDRFGRRSSLL
                     LGCISVIVGGIAQSFTHGANAFLGTRFVIGFGIALTGTSAPTLLMELAHPRMRGQASL
                     LYNCSWYIGAVIIGWITYGTLVGMTGNWSWRLPCLLQITPEILLAVITVTLMPESPRW
                     LISKGRNEEALNTLAKYHANGDKEDALVKLEYDEIVEALELEKTSQHGTSYLTLLKTP
                     GNRHRLIICILVGFMCQWSGNGIVTYYLSPILTTAGVTSSATQALINVCMNIWNYPWA
                     IAGALSANKLGRRPLFFISTGGMLICYIIITALAAEFTKTGKPAVGYAQVAFLFFFFA
                     SYDFGFTGLQSAYPIEVLPYSLRAKGYSITQFCIYLAMFFNQFVNPIGLSNISWKYYI
                     VYDCILVLFLFLQWLLFPETKGRTLEEIREIFDKEPLSSTEGMGANGSEALDDGGKAE
                     EAYVENVGSRV"
     gene            606111..611449
                     /locus_tag="CNK02030"
                     /db_xref="GeneID:3254522"
     mRNA            join(606111..606412,606463..608127,608178..608579,
                     608630..608958,609016..609211,609266..610426,
                     610489..611025,611102..611449)
                     /locus_tag="CNK02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_567679.2"
                     /db_xref="GeneID:3254522"
     CDS             join(606299..606412,606463..608127,608178..608579,
                     608630..608958,609016..609211,609266..610426,
                     610489..610914)
                     /locus_tag="CNK02030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567679.2"
                     /db_xref="GeneID:3254522"
                     /translation="MSDSQPQQPRPAPLVIDDERKLEMFKNMDPGRIANIRKRITELQ
                     SAGSSKESSTELAKLKMILDMYARAMQLEQERAAAANKPDGPADTSTAASTNGQAGPS
                     NPAHVSMNPTQIAQLRTQAAAYQHLSRGQPVPSYLLAAAQGTPPPGIGGQPPVPTGLN
                     GIQGKVADKTVEAVVEDSIEAKKAREKEEQQDKTSEGPDGAAPADGPSQPPYAMEFDE
                     TSIIYPYNAYTDPSFYSKRKFDEEVINPLHKRQRLITPSIMPRGLDPYLLMEERNRFI
                     ETRMAWRMKELENMDSTAGLGQPGAGDVPNVIESEKPGTPMGVRARIELMGLRLLGKQ
                     RLLREDVVRAMHGASQIPADRSQFRRFRTHTLRDARATETAERRQRTEREQRGKQRHL
                     AYINSICEHGQALIGAGVSTARGQGADKMKRLGRAMMKLHAETEREEQKRIERIAKER
                     LKALRNDDEEAYLALLGEAKDSRISHLMDQTDQYLETLAAAVVEQQNDDVHRDAIMAV
                     PFEQEEGVASEEMFGAKRQDGEESGAERRAGKVDYYAVAHKIQEKVTKQASILSGGTL
                     KDYQVKGLQWMISLYNNRLNGILADEMGLGKTIQTISLITYLIEKKKQPGPFLVIVPL
                     STLTNWTMEFERWAPAVRTLILKGSPAVRREAYPRLRAIDFQVCLTTYEYIIKERPLL
                     SRIKWIHMIIDEGHRMKNVKSKLSQTLNEYYSSRYRLILTGTPLQNNLPELWALLNFV
                     LPKIFNSVKSFDEWFNAPFANTGGEKMEMNEEEALLVVKRLHKVLRPFLLRRLKKDVE
                     SELPDKVEKVIYTKMSALQWKLYESVQKYKTLPTDMSVAKPQKRQNLQNALMQLRKIC
                     NHPYVFREVDEDFTVGNTTDEQIIRVAGKFELLDRILPKLFKTGHKVLIFFQMTEIMT
                     IVSDFFDFRGWKYCRLDGSTKAEDRQTLLSTFNDPNSPYQVFILSTRAGGLGLNLQSA
                     DTVIIYDTDWNPHADLQAQDRAHRIGQKKEVRVLRLISSGTVEELVLARAQRKLEIDG
                     KVIQAGKFDEVTTGAEYEALLQKAFETSAEEDNEETNELDDDELNELLARGDNELGIF
                     TAMDNERKERKIAEWRASGSKGELPPPLMQESELPPFYRRDIGQELAEELANEEEQGR
                     GRRNKGEVRYTDGLTDDQFIAALENSDDDVEDAADRKRKRAEKKAERKRMNEVLVQAE
                     AEGRPLDVVATKEVVEPIKKKRGRPSSSVTPSVTGDEVPTKKRKMEKVQGPEVQLMTK
                     LFIEVNKLKSDLGEDLNQFFLVPVNRKDYPDYYRIIAQPIAMSQIKAKIGKPSYNLAS
                     FRNDLHLLWNNARTYNQEGSWVFNAAEDMQEAFDKMWDDEVPQFLASQAAGAENSVGE
                     TSAGASGSSTPMFKPVGDKTTAPKIRISMGKKKIEAAMDGDESMDGGEDDDY"
     STS             606711..607480
                     /locus_tag="CNK02030"
                     /standard_name="Pst28"
                     /db_xref="UniSTS:470694"
     gene            611640..613801
                     /locus_tag="CNK02040"
                     /db_xref="GeneID:3254642"
     mRNA            join(611640..611968,612024..612314,612362..612408,
                     612456..612613,612667..612825,612884..613138,
                     613188..613235,613286..613801)
                     /locus_tag="CNK02040"
                     /product="expressed protein"
                     /transcript_id="XM_567680.2"
                     /db_xref="GeneID:3254642"
     CDS             join(611713..611968,612024..612314,612362..612408,
                     612456..612613,612667..612825,612884..613138,
                     613188..613235,613286..613520)
                     /locus_tag="CNK02040"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567680.1"
                     /db_xref="GeneID:3254642"
                     /translation="MVASPPTATPSTALLSLIHSLRALPTRLIQSPPTQPRRASVAII
                     IRLRPAEELVFEGHEPEGWTGDVVSREDWGEGLELEDFMKLSWVNHPNTVPEILFIRR
                     ASPSSLPPPGAHHRWASHIAFPGGRQEPDDQSAYYTALRETWEEIGIDLAEKEFLNVG
                     RLDEREVTTSLGKRLLMILSPFVFIQTTPISPTPELQAAEISSVHWVPLSLLTPPFSP
                     SRWSHVEIDVSTRLSPRNKFVRWCLRNLIGKMKFGCLLLPDEPAVTAENFDPLDFDET
                     LEGSGSWTDAADGSRFLRLWGLTLGMTLDLISHHPSAPSKLLAEGQNLSTSQPSTPVM
                     EYKPQLAPRTPVTTHSTFEDQWEAARKALAEEEKDRAIEKAAQGRRRRGVGPYMTAVF
                     PRFTYPDVNFWIWVFSRRYRQVLKSWELSAIGPSRAADRRINWSGQALATFYTAVRQA
                     LVVTLIIRALGLGVGLAGVGYLAFKVMGGGEL"
     gene            613921..616580
                     /locus_tag="CNK02050"
                     /db_xref="GeneID:3254675"
     mRNA            join(613921..614411,614485..614567,614663..614819,
                     614885..614966,615021..615177,615239..615377,
                     615440..615529,615586..615607,615658..615752,
                     615807..615963,616020..616122,616180..616257,
                     616311..616580)
                     /locus_tag="CNK02050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567681.2"
                     /db_xref="GeneID:3254675"
     CDS             join(614039..614411,614485..614567,614663..614819,
                     614885..614966,615021..615177,615239..615377,
                     615440..615529,615586..615607,615658..615752,
                     615807..615963,616020..616122,616180..616257,
                     616311..616364)
                     /locus_tag="CNK02050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567681.1"
                     /db_xref="GeneID:3254675"
                     /translation="MPVPDNTSPRYSLQPPCGLPAPFRLPLRQLEDNGANQVGDIGSV
                     RRSTATDNDGSGDTLMSCFGTLTIPSLPLKDESAEVVGSAHDNHTGVQTKCYPGPKLS
                     DRATQGPDAGPLIDRFSCLFQDQYDCRFNPKGIVSLGVAENFLMQQQCMELFSSALHS
                     NITPLDLSYGDSLWGSRRINKALSAFFNEWFNPAEKVLPEQIITGVGCSAVLDQLFYT
                     ILDENEAVLLAAPYYTGFDRDLISRGRVKLIPVHLSPERAFGPESLELFEEVYDKITA
                     QGITVRAVIVCNPQNPLGRTYPRETLLAYAKFCQNNDLHLVSDEIYALSVYNNKDFPE
                     ALPFTSMLSLNVQEELGINFDKSRLHVVYGMSKDFCANGLRVGSLVSQHNPFLLRSMA
                     NTSMLMKLSSPADVIWSSLLHDKIALKKFITTNRQLLGEAQAFIRKWFEDRGVPVADH
                     NAGNFVWVNLGAALEFDDVTTEKQIFQKLLDGGVYIAPGSAYHYHIPGWYRVTFSVAR
                     DNLLVGLGRIEKLLGLRLVKS"
     gene            complement(616455..620981)
                     /locus_tag="CNK02060"
                     /db_xref="GeneID:3254595"
     mRNA            complement(join(616455..618857,618909..619211,
                     619260..620185,620243..620887,620938..620981))
                     /locus_tag="CNK02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658067.1"
                     /db_xref="GeneID:3254595"
     CDS             complement(join(616662..618857,618909..619211,
                     619260..620114))
                     /locus_tag="CNK02060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513724.1"
                     /db_xref="GeneID:3254595"
                     /translation="MATLSDAPARMLSSITELTAPNSFHTLALPPGDAGAEQDGSRNK
                     STVNKDSEDIVRQSRPPKSFPQVDGSVQSSAVSVCSHLTESRSQIPQPASPSSNQRSF
                     IPIRKLLGDVISPTTASCTTFSSLKASSPGGLLPPPRSVYSSKPKLVKSIAPPSSPSP
                     YGVISDEARRRYLERYYPHSKQAKALGEQEIKEKESTEKATKVKEMRDKQIEKMLKDK
                     KMKVKFGDQQAQGQSNPTSGIDLTVNAPYVDTNEKAARQRTINTSNRSYFVSPPNSRP
                     HSHASRSSLDTNSHRSAAASPGVLHPTLHNIPILTDDMKFDTKLVKEDVLPTRRRHSL
                     IKRRPHSFHVHRPTPQKMASYNGAPSQKGIPTVVTVTSNVSEQDQNKHSDAQPFDSLL
                     VPEKDILHPACPSSTPGSAQSYPSRSSSIKTSGDTKNIVTLTRVSSILSSIFGSNNSD
                     NSPDSRSSMKERLAIRRLSKRVQKQGNSSAKSSQGSTPCQSPGSRSPLTLLGELRPEE
                     PTEEITKPVQVFRTSGIFGIRDDGSEDYDAQEHEQAHAFSSTGFKSIPERAGSPHTQS
                     DGVRRILYVENHVEEQDDRYKDNGQEKAEEVLFRTPLGPEGPVESQPEGDATANGPSP
                     QTLTTDDVLGSSHDASFSPSVAHHASSSSHSSTVNGYDRSFSLQHVLVTTSPDRRHSA
                     THTTPGMFDESIPTSLPPSPALSPHPSSETPAFQTLASVQPQIPIPASSSGSPTFAQD
                     SIILAIASHLLSAHAKALLKYSSTIKDTGEAMHKMAEESLEWGNVLMRLAGKVENEDT
                     TSRERDNNLEGLHRSGTPLMFDGHRRSTSVYSHGKPTTKEVRDDHMRAAGLSTRPYGN
                     DPSQDRKRRGVSLPTSMLSELHELGALGLMNVHKAEETWRNAIDHLAEVMEKGQGAQK
                     GQEVPDDRQTTAVTNGLSANATTGSGSEMVEPSPAIASSYPGIHYDAIHQQNSFYGHP
                     LDPYSTLRQREVKATMEHPSVHAYAAPENWAVAPASPTVPQVADPGNINEQLQLQSPS
                     HHAPIFHELSSDIKFAEVINNKQSGSNITAASGTALGRGGMWGKAVAGSKVEGRKLKK
                     VQEQGSGFSENGTLNKKKHWWSRRSSIIS"
     gene            complement(621136..623759)
                     /locus_tag="CNK02070"
                     /db_xref="GeneID:3254504"
     mRNA            complement(join(621136..621442,621496..622322,
                     622370..622514,622566..622865,622920..623497,
                     623558..623759))
                     /locus_tag="CNK02070"
                     /product="trp-asp repeats containing protein, putative"
                     /transcript_id="XM_567683.1"
                     /db_xref="GeneID:3254504"
     CDS             complement(join(621188..621442,621496..622322,
                     622370..622514,622566..622865,622920..623497,
                     623558..623726))
                     /locus_tag="CNK02070"
                     /codon_start=1
                     /product="trp-asp repeats containing protein, putative"
                     /protein_id="XP_567683.1"
                     /db_xref="GeneID:3254504"
                     /translation="MANHHDHDKPLRSALDPISSPYFSSLNGTLSIAKEVLIGPFQGD
                     HRRSESARILSDLAPSLMQPRFLNAASSSQQSLSKSSHPGAPYPLLRLPTNLPFNKSS
                     RPTASSLAILEAVDNLASLSLGDVSHPQNGQNSPSLIRGFKATIPSSELAKQRRRMVR
                     GGIVDEDLGGKIGLKKLGDRARGLLTEKGEDEEDGELGVGRHAVKKRRKKRESRRFTE
                     GRHLEGKLRLEDLAKQADEIGQDKENLHVRQSLIQSEIAEVGAKIDALEDIRRHLEAS
                     LLHLQEEDLELDDELEGVQELMASPAIKAAAGAKSLPLSSSGAGISNKSSRRRKGPAF
                     LPSEHDELPSGVAFMTLNGHTAPITALDFDEPYGMLVTAGQDDVVKVWDLCDGEEIGQ
                     LRGHRGTVKALQVEDTLCLTGGADGNVRLWDLRMVEDYEERLHTQLAELARQDPLERI
                     AEQRAHEEDGEHAEQDDELPDGTLQDPQPGDGSPCVRTLEGHSKSVTSLYYEDGCLVT
                     GSSDKTIRQWDVATGQCVLTMDILWAISNPPPPPSSVPPQRPPRLSHRSSTSFGSNTY
                     EDILPSPGASLVGMSGAALLGAATGQNFAVPTPPYADGTWEMYQDFVGGVQFWGYALA
                     SGSGDGGVRMWDMRTGQAHRTLIGHTAPVTCLQFDEQYIVTGSLDRTVRIWDLRMGSV
                     SEVHKYEYPVTALQFDSRKVVACTGENGVEVYNRTTHAHSRLVVNGHTKPAEKMRFID
                     KYLVSGGRDGCAKVWAM"
     gene            623897..625148
                     /locus_tag="CNK02080"
                     /db_xref="GeneID:3254534"
     mRNA            join(623897..624145,624194..624354,624405..624481,
                     624533..624692,624744..625148)
                     /locus_tag="CNK02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658068.1"
                     /db_xref="GeneID:3254534"
     CDS             join(623974..624145,624194..624354,624405..624481,
                     624533..624692,624744..625073)
                     /locus_tag="CNK02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513725.1"
                     /db_xref="GeneID:3254534"
                     /translation="MALVTITGFPCSGKSTRAQQLKQYFEKRLKEPEYDGPALEVVVV
                     DDESSHVPRSTYDSSAQEKPGRASLFSNVNRSLGTDTITIVDSANYIKGFRYQMYCAA
                     REAHTRVATIHVVAPPDMCRKWHEKRGECSYKQATFDNLIMRYEEPSSMVRWDSPLFT
                     VPWDEDPPFEDIWNAIIKGDKKPPTSAVLQRSKPPPNTLQTLTATTSLINSSLLSHLT
                     SLPNSTTFPIPSPPAPSSSSLVLHLPAKKITLSEMSRLKRQYETVQVKAQASGGLAAA
                     GNWTEGDVATGYVRFLEQTWETG"
     gene            complement(625085..627408)
                     /locus_tag="CNK02090"
                     /db_xref="GeneID:3254523"
     mRNA            complement(join(625085..625218,625282..625820,
                     625875..626086,626134..626264,626317..626341,
                     626389..626692,626748..626929,627008..627408))
                     /locus_tag="CNK02090"
                     /product="expressed protein"
                     /transcript_id="XM_567685.2"
                     /db_xref="GeneID:3254523"
     CDS             complement(join(625163..625218,625282..625820,
                     625875..626086,626134..626264,626317..626341,
                     626389..626692,626748..626929,627008..627268))
                     /locus_tag="CNK02090"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567685.1"
                     /db_xref="GeneID:3254523"
                     /translation="MPLGRLIPRPTSCTFSCAQHVSRTAKISNSRTYAARTANKQVPV
                     GGSSLVETLVEQDPYQRIWFIRPLSLMMFNTESARAAHLNSIWRNYRYHETHIIPFWT
                     LCILSDLRSEAIHRHTGGQDYANVAQRFCTEIGLNIAAVPDSHWCSGLYFREVLRMRQ
                     GSIEKLLNGSMISLSDFLPSPTPAPYVRDFKNVGAPAPLHDNNQFDPVTSPKFAWGPP
                     KLERSDMENIISAHDATFGEWEDIHVRVRDTKLFAIPTYRLLYKVYLPSGEIAVTDGE
                     LNDNGHNLVVDWPKGKAQSSNHVKHNNGLIFSRTWLDHPERGIGYCLMGDQGSSSVVS
                     TLFNAMRRGGPIRKETWEDDKIIPLIGSATVPHLQSLMEYTGKVLCGQGQAFSEPSFP
                     IEKKATTTSSSSLFSKVDPTIRTKRSAASNVSPASSLSSRLFGPSSINSSAWTSSGSH
                     SSKRQAVYEKFARAKAEKIGSSIYGPSEQYALRKLHDRNGYYAELGVENLAVELLDKS
                     KEKEVNSILKEKYYTLCKIKHSDIGGAEEDQVRLNRAYEQVETYEQRRNYQLKPENCP
                     SLD"
     gene            complement(627626..628915)
                     /locus_tag="CNK02100"
                     /db_xref="GeneID:3254446"
     mRNA            complement(join(627626..627771,627819..627878,
                     627924..628012,628068..628517,628568..628586,
                     628637..628694,628759..628915))
                     /locus_tag="CNK02100"
                     /product="mitochondrion protein, putative"
                     /transcript_id="XM_567686.2"
                     /db_xref="GeneID:3254446"
     CDS             complement(join(627718..627771,627819..627878,
                     627924..628012,628068..628517,628568..628586,
                     628637..628694,628759..628826))
                     /locus_tag="CNK02100"
                     /codon_start=1
                     /product="mitochondrion protein, putative"
                     /protein_id="XP_567686.1"
                     /db_xref="GeneID:3254446"
                     /translation="MRPTLPSLINILVPVKRSIDYAVKIRVASDGKGVDTNVKHSMNP
                     FDEIAVEEAIRQRDKSGEKVESITALSIGPPKAADTIRTALAMGADTGIHITTPENTI
                     VEPLSVAHAIKAIIERSEKAGKKFDLVFMGKQAIDDDSGATGGMLAGLLGWGQASFAS
                     KVVIEKGGRIEVTREIDGGLEVVESKIPMVVTTDLRLNEPRYASLPNIMKAKKKKIET
                     LKPEDLGLDFTPRLETVSVSEPPKRKGGSKVETVQELVAKMKEAGVL"
     gene            629060..630908
                     /locus_tag="CNK02110"
                     /db_xref="GeneID:3254641"
     mRNA            join(629060..629251,629307..629411,629469..629563,
                     629611..629674,629725..629886,629941..630353,
                     630404..630476,630529..630664,630716..630908)
                     /locus_tag="CNK02110"
                     /product="membrane glycoprotein spo14, putative"
                     /transcript_id="XM_567687.2"
                     /db_xref="GeneID:3254641"
     CDS             join(629120..629251,629307..629411,629469..629563,
                     629611..629674,629725..629886,629941..630353,
                     630404..630476,630529..630664,630716..630786)
                     /locus_tag="CNK02110"
                     /codon_start=1
                     /product="membrane glycoprotein spo14, putative"
                     /protein_id="XP_567687.1"
                     /db_xref="GeneID:3254641"
                     /translation="MTRTAHHPHPTPSFPVYCLDWADDANLVLGGGGGATRSGIQNKL
                     KLCKVSKDGKYLSYLAELPLSNDEDAPMTMAIDKETKRIVTGINGSSSAVQAGNNDHC
                     RVYSFSDNRIELVGGQKTIEADWSDDYPYQKFTVLSSSSKLLAVGSTDNRVSILHFPS
                     LEPAAPAFSTDSELVDLDWGGPEGEWLCVATTNALLIYLRPSAGTAMTLKQTIYPPSF
                     DIVPAIFRSARFSRNPSTPLNIHAVLNSTKPAKRGAARKAWVCTFGVVAGPSQAKLTE
                     EEKATAKIEEEKGKEKETASDPQEDVGKWDVLIKREVAGKPVTVFDVSSDGRLISYGC
                     SDLSIGILDSKTLAPLLKILHAHSFPPTALKFNPSASLLVSASADNTVRAIVVPAKFG
                     GLSTPMVILLLALLALILALALKR"
     gene            631170..632243
                     /locus_tag="CNK02120"
                     /db_xref="GeneID:3254533"
     mRNA            join(631170..631309,631373..631464,631522..631728,
                     631790..631862,631937..632037,632101..632243)
                     /locus_tag="CNK02120"
                     /product="copper ion transporter, putative"
                     /transcript_id="XM_024658069.1"
                     /db_xref="GeneID:3254533"
     CDS             join(631250..631309,631373..631464,631522..631728,
                     631790..631862,631937..632037,632101..632146)
                     /locus_tag="CNK02120"
                     /codon_start=1
                     /product="copper ion transporter, putative"
                     /protein_id="XP_024513743.1"
                     /db_xref="GeneID:3254533"
                     /translation="MDHGDHSKHTMPDMDMPACSMNMLWNNQVADTCVVFRSWHISGT
                     WTMILSCFVIIGISVFYSYLLHYIKDYDRHIAAAIYSSTQPGRRDRDGSPAETGLIPP
                     IPTAYGGIEVGALNKIGVTRLPLRLRLMRAGLYAISVAISFWLMLVAMTYNTYLFSSI
                     VVGAFFGHVMYEGEMDIGAVLSGTSGKGLACH"
     gene            632439..633641
                     /locus_tag="CNK02130"
                     /db_xref="GeneID:3254537"
     mRNA            join(632439..632801,632860..633196,633258..633641)
                     /locus_tag="CNK02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658070.1"
                     /db_xref="GeneID:3254537"
     CDS             join(632627..632801,632860..633196,633258..633564)
                     /locus_tag="CNK02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513726.1"
                     /db_xref="GeneID:3254537"
                     /translation="MTDKKPWLGPETFPTIWIWICLASNLTGIAALITLIIAEFVVLV
                     NDYSNYHAQYGYNYQARGYQGSTGCGQVEYTNAPKHLGSAIWMLFYQLSIIVLATLVI
                     ASDLAWRASSYNAWGGRWISTFYATGITEGSMHPGLYYYVAANAFLKLFLVVLYMNQS
                     FYGMRGHSSHASPYSNDGDNSHYYTGTSSSSASSSSSSSSSSSISQYSWKRGNGSSVK
                     IYGVEAWVYFAGWIALCSIIPSMVAFLYLAAWGKKKVEEGEGGEGGAEVGGGKG"
     gene            complement(633632..634597)
                     /locus_tag="CNK02140"
                     /db_xref="GeneID:3254540"
     mRNA            complement(join(633632..633747,633797..633836,
                     633901..633933,633987..634054,634111..634189,
                     634240..634344,634403..634597))
                     /locus_tag="CNK02140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567689.2"
                     /db_xref="GeneID:3254540"
     CDS             complement(join(633689..633747,633797..633836,
                     633901..633933,633987..634054,634111..634189,
                     634240..634344,634403..634474))
                     /locus_tag="CNK02140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567689.1"
                     /db_xref="GeneID:3254540"
                     /translation="MSAITLPAAFPVVGIPIFATFLLNTWQQILVMKARKESGVKYPT
                     LYVPEAEAAADAKKMKFNCCQRAHANTLENIPYVLAFFGFLSVFHPKIASAAMLMWVI
                     GRVQYTAGYASGDPAKRIGNIYRISYLGFFTLAFGTLGVAVQKSCSVLF"
     gene            634824..640206
                     /locus_tag="CNK02150"
                     /db_xref="GeneID:3254637"
     mRNA            join(634824..634974,635027..635176,635228..635360,
                     635408..635565,635620..636108,636164..637352,
                     637403..637496,637548..637927,637978..638126,
                     638180..638229,638284..638413,638471..638785,
                     638840..639340,639389..639593,639652..640206)
                     /locus_tag="CNK02150"
                     /product="vacuolar acidification-related protein,
                     putative"
                     /transcript_id="XM_024658071.1"
                     /db_xref="GeneID:3254637"
     CDS             join(634879..634974,635027..635176,635228..635360,
                     635408..635565,635620..636108,636164..637352,
                     637403..637496,637548..637927,637978..638126,
                     638180..638229,638284..638413,638471..638785,
                     638840..639340,639389..639593,639652..640142)
                     /locus_tag="CNK02150"
                     /codon_start=1
                     /product="vacuolar acidification-related protein,
                     putative"
                     /protein_id="XP_024513727.1"
                     /db_xref="GeneID:3254637"
                     /translation="MALRLRQAIPGQPSHYSTQNTAGIVVNDAAYIVYPSASNVVLLT
                     PQQKLVETLQFWLALPHRASSSLTGTVQGVLGSSDDGYILAWSSVYIVLWKHQPRKAK
                     AHTDWTVHSTVVASSPVSCMDFRDGTLALGTKKGIEYWRMNPTSEVVVWDRLWEQSLP
                     APASVRISPASGHLAWFSQNQRSGYILTIDGKGQPVGAAQEIRHPREMQWIGWRNSAP
                     GNDPFLYTITSNSVLRIYSPVLDDPVWFQLLYSLDHRSFNRDAHETPPKTKGKEPQSN
                     PYGVMWVWDAKVLKIVARKELEKVKDGGEIQKVKDGAKILESMETEESDIIAWIGPDG
                     SITLRSIINMDRKPPTLLKSLPLAKSILPSVSNPSHWSPQAQLLYIPSTSPSFTIILP
                     PTHAHNRISSLHVSLAELLSSKSQSISSTSSSSLGEVSHIQLENNISSFVRTPNGRGL
                     LAMADNGEIATWYKQQLNVRPRQWHIAPKSLLGKGHWHSTTPPSQAAMFSKGRGIVFY
                     TNPPDAPPTITLQHLDPGSSAPCESVILPHFSPQDNDEIEMLLAVSDIDDGFDHRGRR
                     TQRAIIMAATRSGEAWVWRVISRMSTSEMQAEQSDEPDEKPAILLVSHYRLPVKSVPR
                     MIIPVDPMGWHQNVIDWETDTPLQDMILTVSEDGDLEFWTPKLGQHLIGKDIEKGFNG
                     DAVPHPDRACEMKGDGHTHEKQGGGEDEPWVRTGVVRTGRKNAIMARCSSRKKTVLIC
                     ELEDGRNEMTIWDSKVSEFSTGLELTKIYDLGEKVQDLDWTTTSDLQSVLAVGFPHRI
                     LLICEQRMSYVERTPGWAPFLTIDMFSYTSIPINDSIWLAGGSLAVGTGNQIYLFSRF
                     LDREDKEEDGEAEDIFQLIAQENGPLWDYHPILLGQCLLWDKANVVKSILLRLVEALK
                     QCEEEGKKRLTFERLDPTEFYTTKAVARRAKTGARKYDGLFASTPTVEEDTQDDFTEK
                     VVIALEERLCGQVHIPIAAADKSFLATVARVTLEVDRQRRSLDISGMRYLISIRMYVN
                     WDRLNNTSGTVTPSSDTELRQMPKPKGASHFSFRNIVWAMHSDSQELLLEAATQCCKN
                     GKMLWEDAKKLGVFLWLKSAETTRSQLEVVARNRFMADDNRDPTSCSLIFFALGKTKV
                     VHGLWRQAPGHKEQNLMLKFLANDFTLDRWKTAAMKNAYALLSKQRYEYAAAFFMLAG
                     QPQDGINVCLRQLNDWQLGLALARVVEGSTDGPIYRRIVSETVLPLAFKGGHRWLGTW
                     AFWMLGRRDLAVRVLISPMVDVANDYSPEKPMRVGNPENDDPSLLLMFQHLKSKSLQT
                     AKGISEVSTKLEFDFVLHNARVFFRMGCHDLALDLLRSWSFERPFFPVRFRRISSIPP
                     TPATVTSMASVAPDLKKEPFITPSHRRRPSFLLSSASGRPHGSLFMDMDVLAESGGSS
                     RVSSPPVNDGGKVTTPPKILNGDIKMEEPTTIVEEKKEPSLSPKAERKIGNLMKDLKQ
                     DVQQGGMDFNMDDFF"
     gene            complement(639581..643251)
                     /locus_tag="CNK02160"
                     /db_xref="GeneID:3254496"
     mRNA            complement(join(639581..641332,641388..641779,
                     641842..641984,642042..642181,642233..642874,
                     642936..643068,643128..643251))
                     /locus_tag="CNK02160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658072.1"
                     /db_xref="GeneID:3254496"
     CDS             complement(join(640313..641332,641388..641779,
                     641842..641984,642042..642181,642233..642874,
                     642936..643068,643128..643189))
                     /locus_tag="CNK02160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513728.1"
                     /db_xref="GeneID:3254496"
                     /translation="MTTDQLHERDVFPRPSHHDIQSTWEKLFSDPLISLTRLKSRSLD
                     KAGLGPAGPDGGVILRSVYWRFYHSLLPPPTSLDLFPQALEASRESYNALRRRYLIAP
                     DGRWASDCSGFDESLSPTSPTHRTSPRIASPVHDSPLQPSDGWDPLSLSTSSPWKTWF
                     AHTELRATIRQDVERTFPDMPYFQLERVQRCMTTALFIFAVLNPDVGYRQGMHELFAC
                     CFMAVDRDSLKVVNKADGQQKEAMIKTLDRRYVEHDAFELFLAIMKNAKAFYEWRAEE
                     GPIRSRTATAPQAPIIVRCNNLHTSLLRRIDPQLYERLETEGVEAQIWAIRWIRLIFT
                     RELPFNVAMRLWDGIFAEDPGLQLLDHICIAMLLLVRNELIDADYPSLLTNLLHYPAP
                     SSAYPFEPFLILAQALFLRSDTSPAAGVEIVIQNQDLLDVKAAPKNQEMDVNGPRSHN
                     SRFADGRGNGRTMSGTVKERLQKGGMGGLAQGLFERAQAAGLDKAFISTVNDFRKNLP
                     DSTTAYSYLPNLPFSPSHSPGPRTSSPFSAIPNSASALPSRSFLSHSPSTTNSIPPSR
                     PALQSRSSTDSHASQISVKTIKDAEREMAELRLAMLGMGKAMSEWLDVLNNPEQHLEK
                     SERENAWKGLERVKETLIDAAGKEVDEIVKEWGWHEGLEASSSRSSTPAPSIMVPPLE
                     APVTEPEPSPATVVAASGPSNIEFEEATPTPLSVAVMPTTPRFLSASRHSVSPASQDN
                     SSATSGGEKRSLTQTVRGDGPISGLPRVPHTAPINSESTKYRPEEAGRPASAGLGIIS
                     VDEEEHSKDQLPANVDPLAGLGTKVRNSRRQAGAGVDPLLGMDIQ"
     gene            complement(643388..644793)
                     /locus_tag="CNK02170"
                     /db_xref="GeneID:3254644"
     mRNA            complement(join(643388..643789,643858..644136,
                     644191..644306,644356..644419,644490..644793))
                     /locus_tag="CNK02170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658073.1"
                     /db_xref="GeneID:3254644"
     CDS             complement(join(643447..643789,643858..644136,
                     644191..644306,644356..644419,644490..644788))
                     /locus_tag="CNK02170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513753.1"
                     /db_xref="GeneID:3254644"
                     /translation="MPLYACTTIGTMRISIVLLGGSQTELSVHPWNSVRDVKAKYELQ
                     AEIQGKHSLQPDFQRMFYQGRQLEDPWLLSECNIQHGSTLHVCPELHRELHFKVELRL
                     GEKLADSTVNVIACFDERTFKAVRPRMNRETDPNKSCSFTNIVKRKGIDMPWEQEFGH
                     QPTTIPSRLIVPVPASASSSQSSAAARLPRAPSPPDILAPRVSRNKPIAPSRSVHAVA
                     TASRPRQSNRKQPTDKEKSALVVAKSTTITLRVQNLQHQTSYYDVMADDPVEHLRAKI
                     TWKEGVPLEGLQLCYGRNLLNDGRLLKDYKLRKNSIVRMNREVGEPGLRRTRGLVINV
                     SDGHDDDEEEEEEEEKEQKEEERRRKRARFDT"
     gene            644916..647056
                     /locus_tag="CNK02180"
                     /db_xref="GeneID:3254682"
     mRNA            join(644916..645041,645091..645129,645183..645243,
                     645295..645554,645611..645960,646006..646798,
                     646855..646907,646962..647056)
                     /locus_tag="CNK02180"
                     /product="GMP synthase (glutamine-hydrolyzing), putative"
                     /transcript_id="XM_567692.2"
                     /db_xref="GeneID:3254682"
     CDS             join(644979..645041,645091..645129,645183..645243,
                     645295..645554,645611..645960,646006..646798,
                     646855..646907,646962..646977)
                     /locus_tag="CNK02180"
                     /codon_start=1
                     /product="GMP synthase (glutamine-hydrolyzing), putative"
                     /protein_id="XP_567692.1"
                     /db_xref="GeneID:3254682"
                     /translation="MATEEIHSLYDTILILDFGSQYSHLITRRCRELNVYCEMLPCTQ
                     KISDLSWKPKGVILSGSPYSVYAPDAPHVDPEVFTLGVPILGICYGLQEIARVHGGTV
                     DAHTHREYGYAKIEVVKTGKKEQDALFEGIEMEADGGLQVWMSHGDQLTSLPPNFVTI
                     ASTPTSPYTAVAHESKPIYGVQFHPEVSHSPKGKEVIAAFVKNVCSVRDGWSMESFIP
                     KEIARIRQICGEKGQVIGAVSGGVDSTVAAKLMHEAIGDRFHAIMVDNGVLRKDEAKK
                     VHKMLTVDLGVNLTVVDASELFLARLKGVEDPERKRKIIGNTFIEVFEAEAAKLEAAA
                     EKELAEKGGEAKGKIEWLLQGTLYPDVIESISFKGPSATIKTHHNVGGLLEDMKLKLI
                     EPLRELFKDEVRALGRLLNIPEHLVGRHPFPGPGLAIRILGEVTREQIAILQHADDIY
                     IEEVRAAGLYDQISQAFVALLPVKAVGVAGDARTYDQVVAVRAVSTEDFMTADWFVFP
                     PQVLKRISSRITNEVKGVNRVVYDITSKPPGTVEWL"
     gene            complement(646948..648589)
                     /locus_tag="CNK02190"
                     /db_xref="GeneID:3254685"
     mRNA            complement(join(646948..647303,647368..647450,
                     647513..647827,647884..648178,648235..648353,
                     648425..648589))
                     /locus_tag="CNK02190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567693.2"
                     /db_xref="GeneID:3254685"
     CDS             complement(join(647078..647303,647368..647450,
                     647513..647827,647884..648178,648235..648353,
                     648425..648565))
                     /locus_tag="CNK02190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567693.2"
                     /db_xref="GeneID:3254685"
                     /translation="MSKVHTVGQWESQNTSYVDLFCIYGMSQNKILRVAVVGCGEVAQ
                     IVHIPNLVLASDKYKLTALCDVSVKSVELCGSRFGVRNLFTSVTEMLTSSVPIDLVFV
                     LTADQFHADNIIECADAGKHVMIEKPMAQTLTEYDAVEEARVRNGVVVFVGYMRRYAP
                     ALERLKEEIKGKTVKYVRVRDIIGNNSYFTSQSGMHQHYYKDFPSSASSELVARRASN
                     LKENLGAKADLDPRNANSWALLHSLGSHDMSAMRDIIGMPEKCLCATRSDDGDSSWWW
                     TALFQYKGFKAYYEMAIDEVAIFDAQIEVYTNDSRVKIQYDTPYVKGLPIKLIIQRQL
                     PNGDFSEQVIRPTYVDPYTLELDLIYDAVANGKEYKTTPLDAKNDTILAKMIMEALVD
                     "
     gene            complement(648709..651003)
                     /locus_tag="CNK02200"
                     /db_xref="GeneID:3254562"
     mRNA            complement(join(648709..648916,648969..649130,
                     649182..649559,649609..649680,649727..649755,
                     649807..649990,650047..650100,650152..650214,
                     650266..650384,650436..650530,650582..650646,
                     650699..651003))
                     /locus_tag="CNK02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_567694.2"
                     /db_xref="GeneID:3254562"
     CDS             complement(join(648812..648916,648969..649130,
                     649182..649559,649609..649680,649727..649755,
                     649807..649990,650047..650100,650152..650214,
                     650266..650384,650436..650530,650582..650646,
                     650699..650935))
                     /locus_tag="CNK02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567694.1"
                     /db_xref="GeneID:3254562"
                     /translation="MFYAMRTLASLAILPLVLSLQLPHFPTPQDTLELAESFIHSGHA
                     HAGDHAAEVEMVHANDMRLSTIGDEHVILTHKKYPNHKVRIKSTTGWCDPDVKSYSGF
                     LDVGYGKNLFFYFFESRSKPSEDPIVMWINGGPGCSSSLGMLMELGPCSVKDDPKGVN
                     DTERNPYAWNEKANVFFLDEPIGVGFSHANNGQTVSTTEEAAIDVQAFISIFFETFKE
                     FEGRAFHMAGESYGGRYLPVFASAVVDGNKQLIKDGKTPINLNSVMIGNGVTDYFTTT
                     ESYFPFQCTVHGDLTEPVQSIGACVAMAEAVPKCHKLAKKGCLETHDYTTCSMAINYC
                     EEVLGETFLSAGVNPYDVTMPCTVEELADSLCYPVTKKIGTYLDLPDVRHTLGVEKLR
                     SNWSSCDGPVFTRFTQSLDNTGKTWLYVAGLLERGVRVLNYVGMLDFICNHVANELWM
                     ERLEWSGKEGYNAAQFSDWVVDGHRAGEFKTYGNLTMLKIRGAGHMVPYDKPKEALSM
                     VTSWLDAAALDQ"
     gene            complement(651240..653213)
                     /locus_tag="CNK02210"
                     /db_xref="GeneID:3254680"
     mRNA            complement(join(651240..652241,652302..652342,
                     652400..652433,652580..653213))
                     /locus_tag="CNK02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_567695.2"
                     /db_xref="GeneID:3254680"
     CDS             complement(join(651321..652241,652302..652342,
                     652400..652433,652580..653041))
                     /locus_tag="CNK02210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567695.1"
                     /db_xref="GeneID:3254680"
                     /translation="MSSKTPEVAAFDTPEHQPEQQPAQGNGQPMIDPSLMEIATQSAV
                     AGQQSPKVDAAPSHQEAPETHDERLHTASADDRDFLFSEPHTLGITESIAQAPDPKPG
                     DFMPPRLGEDEGIDLEALESQVDDDMPGSPTAKLMRAIAPPLALQSQPIWPAPPPNSS
                     VNLFIGRALLSNGNDNWPLKPNDIVNWIRKHYPSEWDGDEGRCSAHRVRTYLARKGAD
                     MYYEKLNQGCIAGWRIRQNHLWRFENGGFQGRGMKQEEAIANAQKESEAIATAARKAA
                     AAEALAAGHPNVKVSMSQPGVSDGMPSLKRPRVKQSLRRRPIKTRDLPAHLGMDALGH
                     PDQYAFDPSPHHHDVHEPQTLYSTLDQATAGPSTSTSNSSHAQHTPTDHEHALQQLHE
                     QHQAEHHHEHHDHHTDTLSFEGLTSGNESSVDINMVQQAMQAAAGQMDDLEMGMQLPI
                     EMQMHSTEHDDDVEQREYDFGPGAFGTGQGYTYNG"
     gene            653344..654312
                     /locus_tag="CNK02220"
                     /db_xref="GeneID:3254612"
     mRNA            join(653344..653632,653715..654312)
                     /locus_tag="CNK02220"
                     /product="grpe protein, putative"
                     /transcript_id="XM_567696.2"
                     /db_xref="GeneID:3254612"
     CDS             join(653402..653632,653715..654170)
                     /locus_tag="CNK02220"
                     /codon_start=1
                     /product="grpe protein, putative"
                     /protein_id="XP_567696.1"
                     /db_xref="GeneID:3254612"
                     /translation="MNPRSLTTAVRSFTRRVPLRPALPAARSFAPQLQARAYSEEKEF
                     HEKEDKRIADLEAAKAESDKKAAEFEEKVKELTKEMQYLRADVQTAIRRTAEEKAKAS
                     EFAISSFARALLDTADVLSTALKHVPQPIPAENKDLQSLHTGVELTHKALLKTFESHG
                     VKKLESLKGEQFDPNVHEALFTVPQAVAPKKENGEPHGPNEIFDVSKEGWTIGSRVLR
                     PAQVGVVASE"
     gene            complement(654311..656779)
                     /locus_tag="CNK02230"
                     /db_xref="GeneID:3254655"
     mRNA            complement(join(654311..654568,654625..654759,
                     654807..655047,655097..655685,655748..655830,
                     655878..655962,656008..656779))
                     /locus_tag="CNK02230"
                     /product="protein-lysine N-methyltransferase, putative"
                     /transcript_id="XM_567697.2"
                     /db_xref="GeneID:3254655"
     CDS             complement(join(654404..654568,654625..654759,
                     654807..655047,655097..655685,655748..655830,
                     655878..655962,656008..656644))
                     /locus_tag="CNK02230"
                     /codon_start=1
                     /product="protein-lysine N-methyltransferase, putative"
                     /protein_id="XP_567697.1"
                     /db_xref="GeneID:3254655"
                     /translation="MFSFFGDESKLPASTVMVSRMTVKKQAVARQQSSGPMAGPSKPS
                     NVTPKHSHGSLKGTPRSASEKGTPKQGPSSSSKSTSKVKQEERIRLSTIPRTPASSSS
                     PGRLKRKTPKVQVVESESSSGSESSDGALDSKPKRPKVTRKETGIDMTPLPGEEVVGR
                     RVFCWDKVDMRGEWGRGWAGFVGCDEVVRGNVQGWANGGGGDGSKNLGKYRAFFPQEG
                     FDRDGDFLPSVEVLYPAKGCREKFVLMVPSSDREFNPIGELRNTLRLILEHYIPPSHR
                     HIFGTLAESLDISNPLSSLPSRMTTPLPNSLVTPPPDPASPSPAFAFEISATSTPAPS
                     TERQETIADLIRKSLAPNRRDGPLFVTAIERYNSAMQAIQEDGTLQQWLDEGMNGGKG
                     IKVREWAALVDFVHDQAYSRVVGGYSHELEHHPKHPEEVSKAISGKEDAYGELRHAFM
                     SKIIEQTKLGPDSVFVDLGSGVGNCVLQASLQAGSRSYGFELLPVPAHCARLQVREVQ
                     RRWAMWALKGNLDVEVHEGDFRVHKEVGRRLREADVVLVNNEVFPSSLNMDLADMFLD
                     LKEGAKIVSLKPFVPEGFRMNESNCDSFAAILRSTQHDYYRDWVSWKGEWGNYYVAVI
                     DRSRRIKFEESMKGRASRRR"
     gene            complement(657609..659214)
                     /locus_tag="CNK02235"
                     /db_xref="GeneID:36393104"
     mRNA            complement(join(657609..658056,658108..658473,
                     658525..658611,658672..659214))
                     /locus_tag="CNK02235"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658809.1"
                     /db_xref="GeneID:36393104"
     CDS             complement(join(657748..658056,658108..658473,
                     658525..658611,658672..658839))
                     /locus_tag="CNK02235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514643.1"
                     /db_xref="GeneID:36393104"
                     /translation="MRRSHTKRKRLSNSDPSADYNPKARGHKAATGGKNRATKKRRAL
                     RPGVCHNCGCTEAETTLWRSNPDRLGKGDRTSMLCNACGLWRAEHGFNRPKDYQGRSK
                     AAQLFSANTCQSSPLTSPVSLNQPELPLEIPNNKKRKGSSFTSTTSTTSSSWSSDSYN
                     DSSIVVTASTNDRKAEGNREGSGDERINPDDTMEVLYAAMGLVYLANKLPFDRLHTIT
                     QRDGAYLVVAPGAVGSEAQIYQLHPGSLALYPYEVLKEVDRDELGSDTMTNSPEFVME
                     RERSKKKILPSTRVTENKLFARERPFRPWIDSF"
     gene            661295..663017
                     /locus_tag="CNK02240"
                     /db_xref="GeneID:3254568"
     mRNA            join(661295..661415,661468..661520,661671..661764,
                     661818..661980,662033..662401,662448..663017)
                     /locus_tag="CNK02240"
                     /product="large subunit ribosomal protein L3, putative"
                     /transcript_id="XM_567698.2"
                     /db_xref="GeneID:3254568"
     CDS             join(661367..661415,661468..661520,661671..661764,
                     661818..661980,662033..662401,662448..662892)
                     /locus_tag="CNK02240"
                     /codon_start=1
                     /product="large subunit ribosomal protein L3, putative"
                     /protein_id="XP_567698.1"
                     /db_xref="GeneID:3254568"
                     /translation="MSHRKYEEPRHGSLAFLPKKRAARHRGRCKAFPKDDPKKPVHLT
                     AVMGYKAGMTHIVRDLDRPGSKMHKREVVEAVTVIETPPMVVVGAVGYVETPRGLRSL
                     TTVWAEHLSDEVKRRFYKNWYRSKKKAFTRYAKKHSENSGASVARELERIKKYCTVVR
                     VLAHTQISKTGLQQKKAHLMEIQVNGGSVADKVDFARSHFEKTVDVGSVFEQDECIDI
                     IGVTKGHGYEGVTARWGTTRLPRKTHRGLRKVACIGAWHPSNVMFSVARAGQRGYHSR
                     TSMNHKIYRIANGASGSSGSTEFDLTKKDITPMGGFVRYGVVKNDFVMIKGTCVGPVK
                     RIVTLRKALRTHTSRAHTEKVTLKFIDTSSNFGHGRFQDAAEKNAFLGQLKIKSDA"
     gene            complement(663087..665873)
                     /locus_tag="CNK02250"
                     /db_xref="GeneID:3254701"
     mRNA            complement(join(663087..664165,664218..664423,
                     664474..664684,664739..664944,664996..665156,
                     665209..665379,665428..665873))
                     /locus_tag="CNK02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658074.1"
                     /db_xref="GeneID:3254701"
     CDS             complement(join(663257..664165,664218..664423,
                     664474..664684,664739..664944,664996..665156,
                     665209..665379,665428..665852))
                     /locus_tag="CNK02250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513729.1"
                     /db_xref="GeneID:3254701"
                     /translation="MPTGFQPAESFISFGQPASPPYKGNEASSSSRKGKRKASDTPAP
                     GEKQTKKNKKDKKKKGSKKSQPVDEPDKKDGLPGLSKKQKKALKEQEHKARKSDRKRD
                     NSRGIEAGPRNKKEEQKAAERHAPWTELVDVDLCRDPVDLLTEEINAFYKYVSPTREE
                     FEVRLFMIELITRTINKLWPEAEVTPFGSWQTQLYLPQGDIDLVVAHKYLSDANKQRL
                     LAELGKAMRQANITDVVAIIARARVPIIKFVTLEGKINVDISLNQANGVTAGKIINQY
                     LDALPGARQLILIVKYFLSQRSMNEVYTGGLGSYSVICMVISFLQLHPKLRRSEINPE
                     LNLGTLLIEFFELFGRNFNYNDVGISIRRGGFYFSKASRGWMKGQSFLLSIEDPQDKD
                     NDISGGSFGIRQVRNTLGGAYELLSMRLFERAEEMSRNARSGRRSTSWKDKEGDDWSI
                     LGGVMGITKETLKQRNELTRIHLEGRLHHKLSIPLGADPKPFVQNYRPPPIISVPSVT
                     DHGRGASSPPPPAESSKRNKKDVGAIMVEDDELESDDDSDSDASSYSSSDSDDSDSDP
                     VAISPRTANSRSTSRVPRADISDTESDGIIEISQPFESSGRGRKPLGDSEPSEDEIEV
                     LSNPPEESRYAGGKGRGKAKVKDAFRPPTPPLPGQEGQLSDLSRPPTPPLPPGEEEEE
                     IDSDEEALRRILAESDGDLGSEDEIGKEWQGAIQVDSDSDEEEKKGRKKRKRGVRSEE
                     RRAFWAAKGGNRLGQSSGDMSD"
     gene            666009..667372
                     /locus_tag="CNK02260"
                     /db_xref="GeneID:3254468"
     mRNA            join(666009..666858,666909..667372)
                     /locus_tag="CNK02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_567700.2"
                     /db_xref="GeneID:3254468"
     CDS             join(666232..666858,666909..667286)
                     /locus_tag="CNK02260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567700.1"
                     /db_xref="GeneID:3254468"
                     /translation="MLAPPQRPKRPRSPSPSLEPEISDLASPLDILLKRRKKEQHQHF
                     GLPDSPHSGALASPVHTYDQDYFNYYQNTQAESSSTPQIKTGLEMGVERRRTKQWDKI
                     NAPPSGAYQHQQQYHYPQGHLATPITHPAQAAPSSAAYPFPTPLPVPHASNAAPLMSS
                     SPIRNQPPSSSPFREKAENMQEEQWIDEEEMRREWGEAYTEQNSLLHNLHLARLNATI
                     RPPSSPRSHSHPSRAYRSPNPSSSTIFSPARTSTSPYIQRTPYPQSSPYTPARPPPPH
                     HTHSYTSYDGMNEKMGDDEDMNDETEAEIEVRKRYEEANRLLGQLAVVRRQRWGEAEV
                     "
     gene            complement(667387..670555)
                     /locus_tag="CNK02270"
                     /old_locus_tag="CNK02290"
                     /pseudo
                     /db_xref="GeneID:3254502"
     mRNA            complement(join(667387..668223,668276..668357,
                     668408..668475,668523..668829,668878..668946,
                     668999..670555))
                     /locus_tag="CNK02270"
                     /old_locus_tag="CNK02290"
                     /product="expressed protein"
                     /pseudo
                     /db_xref="GeneID:3254502"
     gene            667413..670520
                     /locus_tag="CNK02280"
                     /pseudo
                     /db_xref="GeneID:3254454"
     gene            complement(670559..671952)
                     /locus_tag="CNK02300"
                     /db_xref="GeneID:3254690"
     mRNA            complement(join(670559..670747,670800..670886,
                     670941..671008,671060..671597,671653..671742,
                     671796..671952))
                     /locus_tag="CNK02300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567703.1"
                     /db_xref="GeneID:3254690"
     CDS             complement(join(670656..670747,670800..670886,
                     670941..671008,671060..671597,671653..671742,
                     671796..671913))
                     /locus_tag="CNK02300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567703.1"
                     /db_xref="GeneID:3254690"
                     /translation="MTANAKSIHNNADEKGYFNRQVSSFRDAIQPGGQFPPEKGRYHL
                     YVALGCPWAHRSLIVRRLKGLEDFIDISIVHPHLHEGGWHFVTPEAAANPAPVSQHSD
                     DSFPGATQDHLFGFSHLSKIYYKANPDYNARFTVPVVWDKIAGTIVNNESSEVIRFFN
                     TGFNELLPEGKAKNLDLYPEELRGEIDELNEWVYHDINNGVYKSGFATTQEAYEKAVI
                     PLGKALERINERLSDGREFLVGGRLTEADVRLYTTIVRYDPVYYSHFKCNTGLIRHDY
                     PHINRWLKNLYWNYPAFKDTTNFDHIKDLYWYSQVNLNPTRIVPIGPKHNVEPL"
     gene            672341..675334
                     /locus_tag="CNK02310"
                     /db_xref="GeneID:3254643"
     mRNA            join(672341..672436,672530..672648,672702..672808,
                     672864..672930,672995..674336,674388..674697,
                     674753..675334)
                     /locus_tag="CNK02310"
                     /product="5-methyltetrahydropteroyltriglutamate-
                     homocysteine S-methyltransferase, putative"
                     /transcript_id="XM_567704.1"
                     /db_xref="GeneID:3254643"
     CDS             join(672377..672436,672530..672648,672702..672808,
                     672864..672930,672995..674336,674388..674697,
                     674753..675039)
                     /locus_tag="CNK02310"
                     /codon_start=1
                     /product="5-methyltetrahydropteroyltriglutamate-
                     homocysteine S-methyltransferase, putative"
                     /protein_id="XP_567704.1"
                     /db_xref="GeneID:3254643"
                     /translation="MVKSAVLGYPRIGVNRAMKKAIEAYWAGKISAEELQTTAKNVRK
                     QRWESIKNAGVDTVPSGEFTLYDHLLDHSFNFGVIPERYVSQKLDPLDTYFAMGRGRQ
                     DRSKGIDVVACEMGKFFDSNYHIVKVDHSPETEFKLNNNQALSEYKEAKEHGITTRPV
                     LFGPITYLSLVRKANSAPAEFQPLDLLDKLIPVYKELLSQLKEAGVEEVQLDEPILVM
                     DKAESQAELFKKTYEALAPVAPKITITSAYGRVGKSIEFLKDLPVFALHLDLDREPKQ
                     LDEVVAAIKPTKLHLELGVVSGRNIWKNDLKASKALAEKAIAELGADRVSVSTSSSLL
                     HTPISVKVENKLTAEQLSWLSFAEEKCEEVAALAQALNGTEGATFEQNTKDIAARREF
                     ERTSDSAVRDRVAAITEEQLKRKSPFPARREAQKKHLNLPKFPTTTIGSFPQTKEIRV
                     ARAKFSKGEITQEEYEKAMENEIKAVVDFQEKCGLDLLVHGEPERNDMVQYFGEQLNG
                     FIFTQLGWVQSYGSRYVRPPIVVSDVSRPTPMTVKWSSYAQSLTEKPMKGMLTGPVTI
                     LNWSFPRADVSKEIQSKQLALALRDEVVDLAKAGIKAIQVDEPAIREGLPLRKADWDN
                     YLTWAVDSFRLSTSGVEDDIQVHSHFCYSDFGDIFPSIQRLDADVISIEASKADLKLL
                     DVFKSYGYSNEIGPGVYDIHSPRVPGEQEIKDRIAAMVKVLPADLMVVNPDCGLKTRG
                     WKETEESLANLVAAAKWARETYA"
     gene            675536..677646
                     /locus_tag="CNK02320"
                     /db_xref="GeneID:3254473"
     mRNA            join(675536..675693,675773..676076,676138..677646)
                     /locus_tag="CNK02320"
                     /product="RAD57 protein, putative"
                     /transcript_id="XM_567705.2"
                     /db_xref="GeneID:3254473"
     CDS             join(675624..675693,675773..676076,676138..677560)
                     /locus_tag="CNK02320"
                     /codon_start=1
                     /product="RAD57 protein, putative"
                     /protein_id="XP_567705.1"
                     /db_xref="GeneID:3254473"
                     /translation="MSFTSFPIETLDLPNNFRDAALKANLTTSTILLSPIPKLTELLK
                     CKIPFAQDLVKAVSQALAPKPVTVDVSFDDDYGQGACERGTGEEMAGKGKGKWISTGD
                     EGLDECLGGGLRRGCLYEIAGESAAGKSHFALTLALCCQLSSLTSSPGGSLILTSERE
                     LSTDRLIQLGEPLLAVHEPRAEERPEGEIDPRVKGLLDNILSNRVSDIDALEHALSYV
                     IPALLESRLKTSSSSSSQPFPSRSHLKPIRLIILDSLTALLRGGSASSPSTRPAATSS
                     SSLTERSKHLCVVADLLKALAARYDLAVVVINQVSDVFPRQQHSSSSGVVAAYSSPLM
                     LAGTPPSSAWDQTQPFGPGMAQQQQQGTSNASGGDPPMLYASQSRWFSGQSDVLNKEA
                     SLGIVWANAVNVRIMLSRTGRRRMLDQDDLRPVKRRRPREDDDDEEEDEAGIGAGADE
                     KGERRSRIQIDKAKPTLIRRMHVVFSPFCPSGTVDYAITPSGIHSLPGSYEPINIVEN
                     MRKVWGSGKGMQGPAGVMAGTGDVGMGWGGIQKEEGGGLGGDVFDDYGELPAEYWDAV
                     IAGETTAPEPSVTEETDERVVNEADVVEETGP"
     gene            complement(677671..678988)
                     /locus_tag="CNK02330"
                     /db_xref="GeneID:3254599"
     mRNA            complement(join(677671..677877,677931..678310,
                     678372..678587,678648..678988))
                     /locus_tag="CNK02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_567706.2"
                     /db_xref="GeneID:3254599"
     CDS             complement(join(677744..677877,677931..678310,
                     678372..678587,678648..678949))
                     /locus_tag="CNK02330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567706.1"
                     /db_xref="GeneID:3254599"
                     /translation="MTTLIEIPDCSVFHLPTPASDLLPLSSGTLTLVLLPANPPTQKT
                     ETLTLTVGASSFPLSPKLPVQKLRSKDEHPWYSFSPAPPAPDGSKPVGQVRITTEHST
                     SPEQWEATEASLRSFEAHLRTHNVWDERTLFVDDEWETGGEAKAGWGESFAQTIIGAG
                     HSLASRIHGYTDRHIASTDPEQPAPPSETTANAARSAKETTDTLSTKAEAASTVIGNT
                     VHAGGSAAASYLPDSVRPGDQPVEEEEKSDFRKMAEEGWEQVGFAAKGVVEAASTVGG
                     AISGNSHKAVEHNFGKEAEGVAQDIGQSGANVGSSAASAFKGTSIAVQGTNVGSGIAT
                     GGKPTEPEA"
     gene            679116..680602
                     /locus_tag="CNK02340"
                     /db_xref="GeneID:3254669"
     mRNA            join(679116..679299,679357..679446,679502..680039,
                     680108..680175,680228..680314,680395..680602)
                     /locus_tag="CNK02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658075.1"
                     /db_xref="GeneID:3254669"
     CDS             join(679182..679299,679357..679446,679502..680039,
                     680108..680175,680228..680314,680395..680489)
                     /locus_tag="CNK02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513730.1"
                     /db_xref="GeneID:3254669"
                     /translation="MSTDKKDITSWASKDGSFKRQVSSFRDFIEPGGKFAPEKGRYHL
                     YVSLACPWAHRTLIVRKLKGLEDFLDVSTVHPHMLEGGWHFVPKDKASAKPAPASAHD
                     NDTFPNATSDPLFGFSHLRDLYFKAQPDYSARFTVPVVWDKKENTIVNNESSEIIRFF
                     NTAFNGELPADKAKLDLYPEDLKKEIDELNEWVYNDINNGVYKSGFASTQEAYEAAVK
                     SLAKALQKVEDRLSDGREFLMGDRLTEADVRLYTTIIRYDPVYYVHFKCNFGLIRHDY
                     PNLHKWLQRLYWNHPAFKDTTDFDHIKEHYYYSHAQINPNRIVPFGPNVNIEPLK"
     gene            complement(680590..683470)
                     /locus_tag="CNK02350"
                     /db_xref="GeneID:3254517"
     mRNA            complement(join(680590..680891,680966..681340,
                     681402..681618,681709..681861,681932..681970,
                     682030..682475,682539..682659,682737..683010,
                     683074..683167,683222..683470))
                     /locus_tag="CNK02350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567708.2"
                     /db_xref="GeneID:3254517"
     CDS             complement(join(680719..680891,680966..681340,
                     681402..681618,681709..681861,681932..681970,
                     682030..682475,682539..682659,682737..683010,
                     683074..683167,683222..683411))
                     /locus_tag="CNK02350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567708.1"
                     /db_xref="GeneID:3254517"
                     /translation="MALRASRTLISLRVSSRSTVARIAPRVWGAAASRVHIRGNATAT
                     LTPREIKPFEEQVTLKAHYGPRPKITHDIADLSPSLVDQKVVIAGWLFSQRRASDNLH
                     FFTLRSPSSSSAVQLVSRDKNVSKDVMEYPLESVVLVQGTVKARRQKAKAISSAVDEI
                     ELEVQGVTLLNPADQTLPFYPNRPEVANEDLRAQHRYLDLRRQDLADNLKTRSKVAHI
                     IRNYLHDQGFTEIETPILLNSSPEGAREFLVPTRSPTPEGGQPTFYALPQSPQQPKQL
                     LVSSGAIPKYYQIAKCFRDEDGRRDRQPEFTQIDLEMGFVSGAAEQPKGEGEMRSTWA
                     IGGQEVREVVEGMIKKIWKEVKGVDLEGWFRVMPYEVAMDVYGSDKPDTRFDMYTLPI
                     GYYPTLSDDSLDKVLLDQNPYTVEWMVTPAAQAAGLDIPSIAGNNSFIDYVKITSANT
                     HSWLGESVLTASLGLSLDKSLPGGVNPGDVIWLSRRKKIAEGGWTHLGRLRVQLMEAL
                     VAKGLMTLPTQPHFLWITQFPLFTLADEDKIHLSRGRYSSTHHPFTAPMYEDLADLKA
                     GKIDGVRGQHYDLVLDGQEIGGGSVRIHDARLQEWVMKEVLQLDEQEMGRFDHLLRAL
                     KCGAPPHGGLALGFDRLVAILCGAKSIRDVIAFPKSTTGQDPVFKSPSVSGNEVLKEY
                     GLQSLKREEKE"
     gene            683529..684829
                     /locus_tag="CNK02360"
                     /db_xref="GeneID:3254600"
     mRNA            join(683529..683896,683963..684341,684419..684692,
                     684752..684829)
                     /locus_tag="CNK02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658076.1"
                     /db_xref="GeneID:3254600"
     CDS             join(683591..683896,683963..684341,684419..684636)
                     /locus_tag="CNK02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513731.1"
                     /db_xref="GeneID:3254600"
                     /translation="MSLRTQILHGAIPHLPTHSFTRPALILALSQLRPAVSDPEAVID
                     TIFGPGGVTPVRALVESWEEEGRVVMKGEGEGKGKKGLERVLGRRLQWSAGVGEHLVE
                     AYANLTTPQATHSIPLPLTTLQTILSSLPSLPPAYTPPHSPQRPISRPLFPQFPTSSL
                     PIIRANPLGPLAYAWRIADEALYLTEDQLATTKAKQSDVKRGYWNEPVGPGPEWYGHR
                     VGLGLVYLAAESHLLQAYPAGFTPGSPNPHLPAALASLRTNLGRYEQLAKSVEDTEQN
                     VGDAMGFVDYVARSWQGLIKSRYW"
     gene            complement(684681..686345)
                     /locus_tag="CNK02370"
                     /db_xref="GeneID:3254631"
     mRNA            complement(join(684681..684964,685026..685283,
                     685345..685579,685650..685845,685952..685971,
                     686050..686089,686147..686157,686239..686345))
                     /locus_tag="CNK02370"
                     /product="aldehyde reductase i, putative"
                     /transcript_id="XM_567710.1"
                     /db_xref="GeneID:3254631"
     CDS             complement(join(684789..684964,685026..685283,
                     685345..685579,685650..685845,685952..685971,
                     686050..686089,686147..686157,686239..686304))
                     /locus_tag="CNK02370"
                     /codon_start=1
                     /product="aldehyde reductase i, putative"
                     /protein_id="XP_567710.1"
                     /db_xref="GeneID:3254631"
                     /translation="MAPASHFTLNNGKKIPSIGLGTWQSEPGQVAKAVESALKSGYRH
                     IDCAWAYGNEKEVGEGLKASGVPREEIHITSKLFELHHHPEHVELACKDTLKNLGVEY
                     LDLYLLHWNINFQVDAPKGTVPTFDHAVKADNGKIKLDVALADNVMPTWREMEKLVEK
                     GLVKSIGISNFNIHRTEKLLKEAKIKPVADQVELSIQCPQHELVAYLKSKDILPQGYS
                     PLGGTGKSNLRENDVVQKIADKYKVQTANILLSWLVMRGINPVPKSVTPERIANNLKL
                     VDLSQEDFKELEKLAESHPPKRVCDQSEDFEPKYDIFQENDPEFSDKAQFAKLGLKL"
     gene            complement(686771..689544)
                     /locus_tag="CNK02380"
                     /db_xref="GeneID:36393105"
     mRNA            complement(join(686771..687230,687285..687664,
                     687714..688302,688360..689368,689436..689544))
                     /locus_tag="CNK02380"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024658077.1"
                     /db_xref="GeneID:36393105"
     CDS             complement(join(686910..687230,687285..687664,
                     687714..688302,688360..689367))
                     /locus_tag="CNK02380"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024513732.1"
                     /db_xref="GeneID:36393105"
                     /translation="MSEVTETPVPPLSNVTEPPRSPNPLNPATDAQGENIQPLAEREP
                     QNDVPGVTAAPDQPPLPVDAPLPPSPAASDEPPPSLPSSAIPTAVPTPTVITVGEDKP
                     EVPAGAPLSTVTQGSASMDLDEATPQPVKRAGEELDGEREEKRLKEDGPAVEAAAEAG
                     EATGEAIAVAVQSDVPLVGPDGQPLPPPAWLSYVPPAPKFAGPNTPLTLTQHKYMLNA
                     VRSLKKRLPDAYNFLVPVDTVRFNIPHYHTVIDTPMDLGTVETKLIVSDPRGPPKDKS
                     KMSKWDTSKGKYNNVAEVTEDVRRIWENSRKFNGKEHPVSQMATRLEEAFERSLSNLP
                     AEPVIASPASAGPSHVRRSSISQPPVVRRSSDDTRPKREIHPPPPKDLAYEESPGSAR
                     KPKRRNDPQLQWASRAIKSLEISNKYYVAVSPFLYPVDKIIEEVPDYATVIKRPIDFN
                     IIKNKLAENTYEDVNQVDDDIRLMVANAQKFNPPGHEVHTSATQLLQIWEEKWRTVPA
                     KVETRDSSEDPMAEAFDDYSSDEDNAQLRSLESQVIALNQQISALRSKMTKRRAARGS
                     KSKSKPKTAPRKSSVSKPSPNINGNSQPKKSKKAPKEANLMYREDDDESEEEEDISHL
                     SHAQKQELAEKIGQTDGETLSKVISIIQQSTNIGGSNQEIELDIDSLPPATVIRLYNL
                     VCRGGRGSGSKRGRGGVVKKAGGTGRKAMGGVSRRSVNEREEAERIRRMEQQLQAFES
                     SRPVPQAVGYEEEESSSEEESSEEE"
     STS             687670..688532
                     /standard_name="Pst10"
                     /db_xref="UniSTS:470695"
     gene            complement(689650..691615)
                     /locus_tag="CNK02385"
                     /old_locus_tag="CNK02380"
                     /db_xref="GeneID:3254670"
     mRNA            complement(join(689650..690196,690247..690515,
                     690570..690649,690701..690949,691008..691615))
                     /locus_tag="CNK02385"
                     /old_locus_tag="CNK02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_567711.2"
                     /db_xref="GeneID:3254670"
     CDS             complement(join(689803..690196,690247..690515,
                     690570..690649,690701..690949,691008..691548))
                     /locus_tag="CNK02385"
                     /old_locus_tag="CNK02380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567711.2"
                     /db_xref="GeneID:3254670"
                     /translation="MGKHGKTKTTSKGAQRPAPYQKKAKVDVTFDTGVKPSKAENKPK
                     ATNGKAKKDKETSKPSKAKQPKEKKEETAKVSSPKPTKSDKGKGKSILPPTVGPSTFI
                     VIAGSYEKLLYGLEGSYPTGSTAPVLEPIFIFPAHLACVKAVAASPGGKWLATGSEDE
                     FVKVWDLRRRKEVGSLSQHTGSITSLHFPTPSHLLTTSVDSTLSLFRTSDWSLLKSLK
                     GHSGRVNHVDVHPTGRVALSVGKDQTLKMWDLMRGRGAASLPLGSEAELVKFSQQGTH
                     FAVLFPRKIQIYSLTLKLLYTLETKSRFNHLLFHLLPASTEDGEETEVLCIGTEKGVV
                     EIYRITLGEGEESEDEEDDDEEIEKETKGKGAELERIATLVGHTNRVKAISSLPFLAP
                     TSTGDVRKTILLTTVSSDGLINVYDLCAATTDIEKGEENKVEPVASYDTKGTRLTCVY
                     LADGQDGTKEIKVKEEEISESEDEVEDIYGSEQASDDDEDDDGMEVEFEDEEEEIEGE
                     EE"
     gene            691824..692698
                     /locus_tag="CNK02390"
                     /db_xref="GeneID:3254535"
     mRNA            join(691824..692065,692116..692218,692283..692389,
                     692454..692698)
                     /locus_tag="CNK02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_567712.2"
                     /db_xref="GeneID:3254535"
     CDS             join(691991..692065,692116..692218,692283..692389,
                     692454..692630)
                     /locus_tag="CNK02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567712.1"
                     /db_xref="GeneID:3254535"
                     /translation="MAEQQVQLTDLNAVQLQEVKKQLDQELDHLTTSYSQLKQAQTKF
                     KSCIANVNELSPTSKGKEVLIPLTSSLYVPGKLTDVENVVIDVGTGYYIKKTKAEATK
                     HYTSKSEFVQTNLDTLQQSIETKQNNVQSVQQVLAMKMQQAQAAAAGGQKA"
     gene            complement(692675..694336)
                     /locus_tag="CNK02400"
                     /db_xref="GeneID:3254495"
     mRNA            complement(join(692675..692938,692986..693080,
                     693143..693198,693247..693353,693410..693431,
                     693485..693548,693607..693759,693818..694336))
                     /locus_tag="CNK02400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567713.2"
                     /db_xref="GeneID:3254495"
     CDS             complement(join(692756..692938,692986..693080,
                     693143..693198,693247..693353,693410..693431,
                     693485..693548,693607..693759,693818..694211))
                     /locus_tag="CNK02400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567713.1"
                     /db_xref="GeneID:3254495"
                     /translation="MAPKSLLPVILAADNFPDYPLPPAPPPSPYVPFHLTLSDYQAHL
                     QPLGLLRPDVVRAMQSYNSSLIEAGKGSIWGFVAEGKGDEGGKWQTHFLAVYFKENVA
                     SQGKDGLSRVMKECVESWKKDGLFPGPLAGWRNELYAIYASPQSSALKNSVDKPFGNV
                     AFHLERAACALFGLATFGVHLTAYEGTGQDMKIWVPRRSKTKPTWPGRLDNSVAGGIP
                     AGMTPIDSIIKECDEEASLPEDLVKRYIKNVGVATYFYITADGFLQPEIEYLYDLPLP
                     PQNSEEYVRPAPYDDEVESFALLTIPELIDALHSGDMKPNCGLVYVDFLMRHSFVTPE
                     NEPHFLEISTRLRRRLGVALPSA"
     gene            complement(694509..696038)
                     /locus_tag="CNK02405"
                     /db_xref="GeneID:36393106"
     mRNA            complement(join(694509..694743,694794..694881,
                     694940..694999,695056..695162,695217..695302,
                     695352..695513,695566..696038))
                     /locus_tag="CNK02405"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658810.1"
                     /db_xref="GeneID:36393106"
     CDS             complement(join(694561..694743,694794..694881,
                     694940..694999,695056..695162,695217..695302,
                     695352..695513,695566..696034))
                     /locus_tag="CNK02405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514644.1"
                     /db_xref="GeneID:36393106"
                     /translation="MSTHAKSLLPILLHADNLPVYTSPFPTVHPLTKKRIVPFYITFK
                     DFQHGLPPVGLVTMDVVKMLSKEKGIKLFQNAREVKSCSQADREGNGKACPDGNCRKK
                     EHEGGKTKKAFKLTIKSVYFTDEVNAKGKKGRTECVTRILNSWRAEGKFPQAMKLWMD
                     EMFPIYASPKSFIFNTCKPAAHEPFSNIAFEMERAGVPLFGCQAFGIHLTAYEGQGEN
                     MKVWVPRRSANRYRSPLKYDSSVAGGLPVGHTPIQGLVKECEEEAGWPDKLIRKYARS
                     AGIVTYFEIKDEHILPNAEYTYDLPLPARDSSDYVLPKPNDDEVDSFELLSVPRVTEA
                     IRNGEFKPSSAVVTVDFLIRHGFVSPENEPNYEEVVRRCHRRCGVSGPGI"
     gene            697914..703207
                     /locus_tag="CNK02410"
                     /db_xref="GeneID:3254666"
     mRNA            join(697914..698143,698327..698598,698690..698761,
                     699153..699560,699617..699820,699878..699960,
                     700012..700111,700161..700240,700291..701959,
                     702013..703207)
                     /locus_tag="CNK02410"
                     /product="general transcriptional repressor, putative"
                     /transcript_id="XM_024658078.1"
                     /db_xref="GeneID:3254666"
     CDS             join(699170..699560,699617..699820,699878..699960,
                     700012..700111,700161..700240,700291..701959,
                     702013..702791)
                     /locus_tag="CNK02410"
                     /codon_start=1
                     /product="general transcriptional repressor, putative"
                     /protein_id="XP_024513733.1"
                     /db_xref="GeneID:3254666"
                     /translation="MPESRMVHPHSHHLHSAHHHSSHPHSYQHPPPPNYSSSHPSYPH
                     HHHTPRHVSNGHSSQVPLSGPPPPQMPIAGPPADPVGPPAIATSNAGSTRSRSVPPMS
                     SEARAAKEKMDNILAQLAAANENTWMLIGAVAEGMNDQDRALSAFENALRHNPSSVLG
                     LNAVASIARGRDDFDKAIEYFQRILNANPENGEVWGSMGHCLLMKDDLPKAYTSYQQA
                     LYHLANPKEPKLWYGIGILYDRYGSFEHAEEAFSSVLKVDPNFEKANEIYFRLGIIYK
                     HQRKYKSSLDCFRYILNNPPRPLTSWDIWFQLGHVYEQDRDFEAARDAYMRVLSHQPD
                     HAKVLQQLGWLYHQPGAHFADQEKAVSYLTKSLETDPSDAQSWYLLGRAYMAAQRYNK
                     AYEAYQQAVYRDGRNPTFWCSIGVLYYQIAQYRDALDAYSRAIRLNPYISEVWYNLGS
                     LYESCNNQMADAMDAYSRALELDPNNTVIKQRMALLQNPNGGPLPPVPPPIDVHPSQY
                     TATPTAQPPAGSPNASPSHQLPSDAHAGGRDLPPPPPGGDIARGHSPGPFRNGAAPPP
                     LNHVDEPRGPVPGMTQLARMETEPRSAEIRDERYNGRYDPADIRRHNGSPLSPRASRR
                     ESQAFPSQPSYFPSNGAHARDREREEWDRSRGGSRAPQGHSPRLGDRTPGADPRVPQE
                     YRDYPGYYDPRTAYPAPLGGPPTPSAMPGRFDPRREAEEFRRREEDREVNGAKLASSA
                     RQENRMPSPAPSIASSKNGRKRGEGTRKAKDKEEKALNKKEGGRKGKAAGLKAGEEIT
                     GQSPRGNVKSPSVSVHNTPQLNTARPIPPSAPAPVPLMSRTVDEDYDEGAADALMVLA
                     GDRSTTTLPLPVRHITPTPSGPMSPPPPAPNTGPATGAKRPGPEANSPEQANKRVKAE
                     KSQSPVDSASGSASSRVPKRMVIEVLNTPSIASPLPRTSSAVNEEKQSRASQERREER
                     REGTISGTEIDERTAQTSTPLPPPAPLSPANRLAPSSSAHTPQSPPRQASSPPPEAEK
                     EASRPPTPPLPDEPPSPAAPAAAVRVESSRDSDPRTPPLPPSQTFESSSMKTPTSAGD
                     RGDVDMADAGTER"
     gene            complement(702989..703711)
                     /locus_tag="CNK02420"
                     /pseudo
                     /db_xref="GeneID:3254579"
     gene            704198..708232
                     /locus_tag="CNK02430"
                     /db_xref="GeneID:3254543"
     mRNA            join(704198..704524,704583..705337,705402..705611,
                     705670..706006,706055..706489,706544..708232)
                     /locus_tag="CNK02430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658079.1"
                     /db_xref="GeneID:3254543"
     CDS             join(704322..704524,704583..705337,705402..705611,
                     705670..706006,706055..706489,706544..707777)
                     /locus_tag="CNK02430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513734.1"
                     /db_xref="GeneID:3254543"
                     /translation="MSGQGRRRSALPLQRQEVASTSAQTLAAIQDASEAGSKLGNSKC
                     TTAQYEYRKRVFKQWTADNQIETGEQVNGAVLLHFMWDYVFTRPKNSRTKGFTSQAPS
                     TTSVISLPILPNSNSSQHSAHSSNSNVSRLRNGSLAGRVCFGPESVRENGTPSTELAG
                     LVELEEEDIDDSDDESSDNDREMEDDGVETSVRSIRDGPDLAAYLQVTVNDNSSDEDE
                     EDENEVPEGLMRDVNDRIIPIGADMSKKKRNSAAKKSAVQGKNRSNMDETLQKKGEKR
                     RTAEKRRLQPDPSLTQVELDETLNNVVEKHGNLSAATTREERIQLGLERIRNCQLSPA
                     AVKTWYYAIVSLWTEQSVTNSGTGHPWTKQWHNLFTALHRVTEQRRKEKHVDKMMDTI
                     FEGYQTRNEIQRSYGYYFQKGTPEALRDMVSQSFGLYNLFRGDSQKMVTLSELAALVL
                     EEEGPTKCVAIVAVSRAGKRNTKGLAQYGAMLRAKDVFACPVWALSAWLFVRFNILPN
                     RPPSSQSSFPSFAERKDWYDLPLLSQVRDPTKPISYKTQQEAMINALLAAGVFPSKST
                     HENRRTGARLAEKGELSIDDIARAGGWATVTLETTYLSAFPRKSMRVIAGHPKKKGFF
                     VLPRAVVVPDTLKGQVFPEIKKWKTYLQQKNEELADGADAAGQKRKRGPKKMSGRHDF
                     TAEMLLQLLEHLAESFLQDAVHWKARYPDHFIWRHPLFQSPEWLEFEQYARRQTALAE
                     EDLVALPPSIKQAMPELLQGFQMLPSNQQQFQTQLDASFNRLREEVVDSIRNGFGDIS
                     KTLSAMESRNVSAMQESEARSRVEMARMLQRVFGAAAQSAGTTAHFYASQLSSPVPPS
                     SMPQTSLSSAPEASASSTSEPGPPVMPSASFSMSPASFSPPPTTFAVPSFCVPPMGAM
                     PSIPSTSYSLPAPCSNLPRLGSSCSSSGTVNKVLVMSKDVKTVTELWKEYDQGLPNSY
                     PLRYIETGQYTFQDDPSASSSKNRKFFQRRLPIIQFIKELHRTRGWSCEEAAERLEEY
                     RSREVIGLQKLGERIKQKTDAERTQML"
     gene            complement(707719..709827)
                     /locus_tag="CNK02440"
                     /db_xref="GeneID:3254449"
     mRNA            complement(join(707719..708307,708356..708962,
                     709012..709346,709437..709827))
                     /locus_tag="CNK02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658080.1"
                     /db_xref="GeneID:3254449"
     CDS             complement(708466..708876)
                     /locus_tag="CNK02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513746.1"
                     /db_xref="GeneID:3254449"
                     /translation="MGQERKRRKGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEG
                     EGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEGEG
                     EGEGEGEGEGEGEGEGEGEGDEHRWVRPHYVKLC"
     gene            complement(710086..714395)
                     /locus_tag="CNK02450"
                     /db_xref="GeneID:3254582"
     mRNA            complement(join(710086..712064,712121..712408,
                     712458..712721,712773..713372,713423..713977,
                     714032..714100,714156..714171,714222..714395))
                     /locus_tag="CNK02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658081.1"
                     /db_xref="GeneID:3254582"
     CDS             complement(join(710202..712064,712121..712408,
                     712458..712721,712773..713372,713423..713977,
                     714032..714100,714156..714171,714222..714367))
                     /locus_tag="CNK02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513735.1"
                     /db_xref="GeneID:3254582"
                     /translation="MQEFDGREDSPMPVMPSYGVLATLTHVKRQSGQDLNTFPIDSEK
                     VTIGRDWDSDLRLYYSDVSKLHAEIILDLVSGHASLHVHGKKGVVHVPEGGQPTTYQP
                     PSVIPLAENDCIIIRKKLFRFNYGPMEDVGAASEFMSPVPQSVQPRSPAPGTPVRRRP
                     TVSFSPVPNTIRKRASHRMSLVPADKIFHPCSPARNRRHSTLGLGNMKMGSSKSQLGQ
                     EVVVEEQEDADQSIIGVAEGEDGDKIYLEITEEVEEKDEETPEPASSIDSNPFLTPQQ
                     KGRAPLRNTSAVPRTRKFSAPETTEDSAGKPALDKSTPPPSSPHKDPQSLPVTPVPVP
                     AHVALSTPKGPATLRKALLLRSARKVWHETHATGLDGAIQDGFVETTRRKSTSPRGGR
                     KSTSPQETNPQEAVVDNDVEMDVDAEPEPPNNEAGENQFEWVYEDGQAEISFDSESSN
                     MDSFDADVSLDIPGQSVMQLDIRTEEEEEYLNNPHHEDEEKVEPKAEYEEYEVQVQGS
                     DNEDVQGEEVEMAGNVEHTEGEVEDEDEQDDMPTSLPGTPLARPTLTNTFLTPQVSRS
                     TAFGQIRRSLGPPVRLPMTPNSLGTFTSTRTPGSLGKPSRRLDLNAMKKESEEEEEEE
                     VQTVEERKPMATPRRSATAIAETKRLHDALATPRTLPLPPASGFKNPIPESRFTNLLS
                     TPAHPALAPRTPEPESEDDREPDEKAKVPGTPLDDLKKRLNQMRRQSVQRSSTRPAER
                     RATVGFVLPGTPAQRPALGHSASYSVAPIRRSGQVLRTPIFPPLKREPMETIVSPDSM
                     DVDEKIESPTPASYAHAVTSPTPQFNTTAKTDPSTPSGASSHMLNLPSPWRTLTRLDS
                     GRALTSPAKISNSPAAIENATSPAKGTQQTPDFTGLKTMFAEKKIAATPNMVGVKKLF
                     GELKVSETPNMEGLKEMYKEEEEQKEEEGVEELVGALEEEKGRNDAASGQVQEQDEIG
                     VNGKGKAVSTKLPRFAGSTSTRTRRAVASEEQAPAPAPAKATRATTTRTAIRSTSSAT
                     SSTTETASRPSRRKATPSAVVETPSVPEPTSRSSRSRRAPSNEPSTGAGMSRSTRGKS
                     TAEPEEKPIVEEEPPVHLVPAVASTRSRSTSARSTRKASVEVDEKPEEVVSKPTRGKK
                     ILSQIEEQPAAETVAEKKSAPTRAKRAIPTASATSTTSTTTTRRVVSAPSRTKTSTAA
                     SSASTDEKVSVPTRRKGKTAEKENDETFVQEKEEKPAVKRRATTAGGSNLPVASGRTT
                     RSRK"
     gene            714573..716749
                     /locus_tag="CNK02460"
                     /db_xref="GeneID:3254487"
     mRNA            join(714573..715173,715231..715287,715340..715527,
                     715590..715827,715878..715886,715938..715987,
                     716040..716389,716446..716596,716653..716749)
                     /locus_tag="CNK02460"
                     /product="transporter, putative"
                     /transcript_id="XM_567717.2"
                     /db_xref="GeneID:3254487"
     CDS             join(714805..715173,715231..715287,715340..715527,
                     715590..715827,715878..715886,715938..715987,
                     716040..716389,716446..716596,716653..716689)
                     /locus_tag="CNK02460"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_567717.1"
                     /db_xref="GeneID:3254487"
                     /translation="MPEQPDYGTTSPPRPSSSASMSQHPLHDPKNGHASVVSSVSNLS
                     NTILGAGALAFPSAFAAMGLLPGILSCAFSGVTAIFGLYLLSRCATIVGTRPGDEGKK
                     ASFNEIAKLTFGKGWATKAFDLAIAIKCFGVSISYLIICKTLLPQVCYTIAKLVKQPL
                     PDDSILLASHFWLIVWMAIITPLSFMRTLDSLRFTSQIALLTVVYLVLVVVGWYTLKG
                     PSPERGQVVLFRFGKSTLSSFPVQVFAYTCSQNLFPIFNELKDRTQKKMNTVIGSSIG
                     TAIGVYQVIGIVGYLTFGDRVSSNVIAMYPATTMLVAIGRLGIVLLVGLSYPLQLLPC
                     RASLYHLTHSLFHHHDVSGAPTNGRSIQDDSDTDMEDEEIGPLVPKAHEDHAHHKHDM
                     PQLQFLVLTLGILISGFLIAYNVHELDIVLSFVGSTGSTIISFILPGFFYFRLFRDEP
                     GTMKWWALALGIYGLGVMGFCLTFNIIKLVQH"
     gene            complement(717227..722206)
                     /locus_tag="CNK02470"
                     /db_xref="GeneID:3254627"
     mRNA            complement(join(717227..719139,719199..719836,
                     719886..720060,720113..721374,721428..721822,
                     722020..722206))
                     /locus_tag="CNK02470"
                     /product="protein kinase, putative"
                     /transcript_id="XM_024658082.1"
                     /db_xref="GeneID:3254627"
     CDS             complement(join(717374..719139,719199..719836,
                     719886..720060,720113..721181))
                     /locus_tag="CNK02470"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_024513736.1"
                     /db_xref="GeneID:3254627"
                     /translation="MNNSPSLGSPIPIIPNLTPSPSPRRNTGPSSPLLPRTGLLPAIP
                     SVRRSSGEFESSSPSPPPLTSSRPNVVMGFSPAATHQVLSAVPESSSTSPRSAPLGLN
                     TAATRRMNTRSPPLSTPIDQVFQLAEGSPRPQPSSPRMGGGLSNDYLPRSRRNSAAIV
                     SISLSSRSRSGTPQGGSGSTTVPGQISGNDTPNKASGAPTPRGNEQPPLQMSESWAPG
                     VDELDDWQPAGGMLLDHGDDEVSAVDDYMDDYDDKVEQVWSGFSDSSPVVEDVLTPGM
                     VIGEGLKFQGEIIVPAVSRMAMADGSDVGLPLRRGGSEATKVLRQDGRYEKKRYEVVR
                     RLGTGSYAVVYLVKERGGKKEYALKCLSKQDLKEEQLETQLFEAHIHLSLPIHQNIVT
                     LHQTLQTRRWLFLMLELCPGEDLFYWLEKSRDASPQAVHASLPDEHGALSSSKLSSSS
                     IPFSSSQMFSNLNSMSFSQSPGAAFSQSHSHFGASPASLLFAHHNGGHYSSHFMPSQT
                     PPTPSLLSAFSANTLLSQRRLRLIASMFSQMCEAVAVCHDAGVSHRDIKPENFICCDS
                     VELEAAADGEFGEDEGQSAKPVNFGPQAKRKVIVKLTDFGLATTDYESGDVECGSKPY
                     MSYECRNNLGPSYLPAPADVWSLGIVLINMLFHRNPWKDPTHGDPNFDNFLMDPIGFI
                     LSKFTGIGREVASYLADHVLCIDVDQRVSAKEFGAWIKGLPEMIGGRKAMHSLKLSRL
                     DTHKAASVDKGMFIKSPMENSDAGKKFSKSALTSAMSSSTAGFGSTPTLSELPPPSSL
                     LEEDEAELEHESPVEEQLEVVEPEPILPTPPLESDGMYSAATSATVDEQTTPTDESAF
                     PSPSAAPSSGIPDEQDDSRDCVDSDTRSLSTHKRRKRGVRKGKAAQAAAAAAAATDPL
                     SQSSRDALLSELASASQSLAREMSKLHKPSVDVNRIEDFPPLGVTAAQVAAEKKSKWK
                     DMMKLSQGNPELAALAKRVNERDSNGSLNLSAPAQLQGGKPGGFGAETGKGRHAYTYA
                     TMSSGSSAVSSFGQISSATSTGAEDELSGRDAAHRPRKQGGDDSRSRKAAQAAAAIAG
                     GMEPMGSFGRPSHIKPASHHAHTTGSIDYGILSSAPDSNSIYTQQAQPTPKKDSHAIP
                     SAPQKSAIKPALSSVDSATTIRTATVASESASSSGTMTIAPTSPNKPKLKGQISTLAK
                     MLSGLKTKGKD"
     gene            722424..723736
                     /locus_tag="CNK02480"
                     /db_xref="GeneID:3254547"
     mRNA            722424..723736
                     /locus_tag="CNK02480"
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /transcript_id="XM_567719.1"
                     /db_xref="GeneID:3254547"
     CDS             722435..723601
                     /locus_tag="CNK02480"
                     /codon_start=1
                     /product="mitochondrion organization and
                     biogenesis-related protein, putative"
                     /protein_id="XP_567719.1"
                     /db_xref="GeneID:3254547"
                     /translation="MSLDINWSLLSQPDESATDQLSESLIALLNAQLAEAHRPSFIGP
                     ITVTAFDFGNAGPDLEVKDIRDVWRVFDQGDDEGDFAEEEKQREKEREERDKLRNEAL
                     KSSLDGERYELVDRYSSTEGTSSFEYQPEYDIHEQHGDDYRIRGRRPLSYTFGYPHDR
                     LAVHRSSSSRSFIPFPFDHPPPALHIPSTPGLNPSLVSHPISARFSRRPMSIAASAAP
                     RPTPRRRPIEPSSTSPSPPAHPAGLPPKVSSSSIPSLQLHLRLSHASDLHLTLLTSLQ
                     VNYPSALFMALPLKLSITGFQLNADIVMAYSGEKNRVHLTIVDDESNPAHKEDKQIPL
                     GQRLLSNLQIESEIGHADAHVLRNVGKVERFIVDVVRKTLVDELVFPNFHTVAL"
     gene            723929..725662
                     /locus_tag="CNK02490"
                     /db_xref="GeneID:3254379"
     mRNA            join(723929..724269,724520..724884,724956..725662)
                     /locus_tag="CNK02490"
                     /product="expressed protein"
                     /transcript_id="XM_567744.2"
                     /db_xref="GeneID:3254379"
     CDS             724967..725560
                     /locus_tag="CNK02490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567744.1"
                     /db_xref="GeneID:3254379"
                     /translation="MTNGPCPIIKNNGAVFPPSVVQITISPLTLIFLQVLLSSSRDKS
                     LPCNNSATRHGLTVFLLGYARRRQLFFVHASLSCRRYPPIPGCLTIRPFHLPSTHITV
                     ESCSPLRRSMMSLFRRQLMISHPGINTMPSVHHIPLRSNYVSIPWPTRLSLVLISFIM
                     HCVWLDLQTCLRIILHNNANTVLRLLCAARGDKRCRR"
     gene            726317..729687
                     /locus_tag="CNK02500"
                     /db_xref="GeneID:3254672"
     mRNA            join(726317..726637,726714..726818,726899..727015,
                     727073..727290,727333..727434,727482..727636,
                     727688..728605,728654..729069,729119..729303,
                     729354..729687)
                     /locus_tag="CNK02500"
                     /product="protein serine/threonine kinase, putative"
                     /transcript_id="XM_567720.2"
                     /db_xref="GeneID:3254672"
     CDS             join(726503..726637,726714..726818,726899..727015,
                     727073..727290,727333..727434,727482..727636,
                     727688..728605,728654..729069,729119..729303,
                     729354..729486)
                     /locus_tag="CNK02500"
                     /codon_start=1
                     /product="protein serine/threonine kinase, putative"
                     /protein_id="XP_567720.1"
                     /db_xref="GeneID:3254672"
                     /translation="MAEQPAQAPAAAPVKKEKIVPPSPPLKIRDRDRGYEYMRVGFLG
                     EGGFARVYEVQDQRASRRAVKVVSKASIKTKKNKTKLWAEIKLHQMLAHPNIVRFDDC
                     FEDEENVYMILELCHHGSLMDLLRRRKRYTEPEARYYLVQLIAACQYMHQTNVIHRDL
                     KLGNLFLDENMDIKVGDFGLAALIEKPGDRKKTICGTPNYIAPEVLFDTANGHSFEVD
                     VWSVGVILYTLLIGKPPFQTKDVKAIYKRIRENRYEFPPEKEISPSAQELITLILNTN
                     PDKRPNLDTILSHRWFLDGPFPAYIPASANDFAPDYRHISSSQSRRNFAALCHKSKIG
                     VAQSINVEPARSRSALGPSIMQQERDFKNAVQPDSPISALLNSARQPLIQASASAIKE
                     PSLLRKLSAAGAASTLSPVRKGAIGKENHELGRRPVAMERVGEESEEERDAEEVKPKY
                     NGITRESELAAQKARIVSQMAAAERQVYAEAMEKASESAASGKRPVYQESRSRVAAAS
                     RGTLPLAATTGQATVSTFSAASSDTVSKSGSRYVAYESSRPEKTRDFKTSLFETFGQN
                     LSTALVMAQTEEGFTSPSIEAKPQPPRVFVVSWLDYCTKYGMGFAMTDGTVSVHFNDS
                     TSLVLAPGKRYFDDIRPAGADDLSQNIRRNYSIERYPSDLKNKVYLLKHFENYMLDKL
                     FGDQPYTFENKELTTEMVFVVRYLRMKHVILFRLSNDVLQFNFYDHTKLILSREGLVV
                     TVIDRHSVMRTWSLEELLRPLDDDLSPKDKKRIEGIVHKVQYAKDVLAKIKSHTSSSK
                     AAAASSSVPVSANTRSAAAIEREMGRPIR"
     gene            729773..731217
                     /locus_tag="CNK02510"
                     /db_xref="GeneID:3254553"
     mRNA            join(729773..730830,730877..731217)
                     /locus_tag="CNK02510"
                     /product="uroporphyrinogen-III synthase, putative"
                     /transcript_id="XM_024658083.1"
                     /db_xref="GeneID:3254553"
     CDS             729921..730820
                     /locus_tag="CNK02510"
                     /codon_start=1
                     /product="uroporphyrinogen-III synthase, putative"
                     /protein_id="XP_024513737.1"
                     /db_xref="GeneID:3254553"
                     /translation="MSKNAQFQPPEATPVILFKTPHPSPSTDPYHHAFSESASSSSNS
                     AEKYQTHFIPVLNETYHLQEIVKIIEEGPDQWEGVIVTSRRGMEGWVKGVQTYLGGTG
                     KGKEGEGAWDKLPLFSVGHASTEHLAAANIPPSFKPRPVPEMESNPPKSAGPLSELVL
                     RTLPRRSTGASEVSHGPYLFLCGDKSLDEMPTALRSEGRTVKEVVVYTTSARHDFQQG
                     LRRLETPVRHKGWLAFFSPSSAAIVMPQIKQDNGRWDGWRVFAIGETTKKYLEEEAKM
                     EVHAVADRPDAIGTFEAIMKAGR"
     gene            731324..734798
                     /locus_tag="CNK02520"
                     /db_xref="GeneID:3254509"
     mRNA            join(731324..731524,731616..734010,734060..734260,
                     734311..734386,734444..734488,734544..734798)
                     /locus_tag="CNK02520"
                     /product="signal transducer, putative"
                     /transcript_id="XM_567723.2"
                     /db_xref="GeneID:3254509"
     CDS             join(731620..734010,734060..734260,734311..734386,
                     734444..734488,734544..734608)
                     /locus_tag="CNK02520"
                     /codon_start=1
                     /product="signal transducer, putative"
                     /protein_id="XP_567723.1"
                     /db_xref="GeneID:3254509"
                     /translation="MSSPHRRRNQQSITVQSIRSHAPLTPRLLDLNTNVPTTRSRARL
                     LSSRSNLKLNDENSRGPAPGFNKSLRSRGPLKENPLKMNVLEDKKMIIGKRKMVDGDE
                     DQRKGKMLKTDERLVRRMGPPLKTVGSNNGLHTRHTLAPVVSPQRLPERTQTLAPPTP
                     AREILRKGMLEAKQGDDEAGGAESKTFSVVARPPTPPRMRERPLEIKRDEDTIIGKSP
                     RFIARPPTPPRPHQTAAIAKSPTPLSNDAPVSLVSPRPLHSLIPSTPGRSQPSHTTFK
                     SPPTRQLSAFFPTPRTSQNQPTAAIPAYNVSTTPDGIPPTASVFTPNNRPTMASPLTN
                     RRIALAVRVAREQTSLDDLVLKATPVKQEIQPCVVEAPKKNVTAEKLEEAAEAKENVD
                     VDMAVVDETTGAESVLGVNMTTETGKAGAVCEARPHVPSHTKVESDTKMNVDEPAPEA
                     KPEVQPAPDIISTSAEIVSTTPQPVQVAVPAIPECPITQPAVDIQLRKTSSGRSLLCM
                     GAPSRIPISTRHVPAVSAIDKSHLPSSTMRKMASGLGVGSLPERRPGGQPEMTGSDSS
                     APAQGPSSSTAKRRPSYPASLGSGPLARPTARVVSNPIRSSAIASESSSAAEMSQPPI
                     AESNRSVSDPVPIPESARPSRLSLSTNRREGMSLETSRSLAGLSEALEKLKSKKRLSG
                     ASASAEPPRKPTIPSVTVTAPAPNVPKKEINGLSASASSTTMAPLANHRARSSIHPGD
                     SSISSDTAGEKSILEMLSSTKGVKCFQGVVAFVDVKTSEGSDSSQFFSDILKSGGAKV
                     LTRPTLSCTHVVYKSGRPATLNWYRRQDKPPRLVSIKWVTDSKKANKKMEEDKYLVDP
                     NEEPIFEKRRKSMEPKALSAYRSTVSNSAKRQALLAVAEAKNKGMSYAPKLPSPLKKT
                     YINLPFSDDNK"
     gene            735425..736904
                     /locus_tag="CNK02530"
                     /db_xref="GeneID:3254506"
     mRNA            join(735425..736073,736122..736904)
                     /locus_tag="CNK02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_567724.2"
                     /db_xref="GeneID:3254506"
     CDS             join(735467..736073,736122..736831)
                     /locus_tag="CNK02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567724.1"
                     /db_xref="GeneID:3254506"
                     /translation="MSNGKISFSFGAKPTPKPTTAAPTTAPAPKSNLELLMAKSKAKQ
                     PPSKAPPAALFNDEDEDEDKPSSGPPDLLVGSSKKKAPVTQTAQLSRAERRAQAAAQA
                     IDQSIFDYDSHYEQMKAAERVAEEVKKKESEERKPKYIENFLASAQTRKLDKLRAEEK
                     MLEREREKEGDEFEGKEKFVTEAYKRQMEEVRKAEEEEKAREEALRKGQKGPGLTAFY
                     KTMLDSEESKHAAAVAATSKPVMGPSLAIRPPAEPSKPVYDDEEEYDPFLAREAKESA
                     SASAENRLGKAGTTMMDKESGKQVEINDEGEVVDKRSLLKAGLNITKKPKAEIPNSLL
                     TSQRSGQLSDGPYVSRAVGAAASYKERMERERRRLAEQMREVEERKRKEEEERLRREE
                     EEARRRREGENGEAERKRAEARERYLARKREREEAEKGGNKKAKEE"
     gene            737116..739857
                     /locus_tag="CNK02540"
                     /db_xref="GeneID:3254663"
     mRNA            join(737116..737553,737603..738004,738059..739585,
                     739637..739857)
                     /locus_tag="CNK02540"
                     /product="vesicle fusion-related protein, putative"
                     /transcript_id="XM_567725.2"
                     /db_xref="GeneID:3254663"
     CDS             join(737272..737553,737603..738004,738059..739585,
                     739637..739738)
                     /locus_tag="CNK02540"
                     /codon_start=1
                     /product="vesicle fusion-related protein, putative"
                     /protein_id="XP_567725.1"
                     /db_xref="GeneID:3254663"
                     /translation="MSSANPSSLIAEVLRQPDDLLKLAAYRKKLLKEKSALDTKLSEG
                     VKSQLDATRDALLKLQNSRAAVTLIREEMLAVEKLMGEEAGGEAFDKITRVSTVHRNF
                     AQTSKMVQNLRSMSEKVDYLSSLLDSDKNHPDGAAGPSPNLLPIHFQLQQLEAFRNET
                     LHEAKKSNPQDRETLVKWFEKVDKVAADFEAWLWEIAGSVVELLRKGNGGTVVRLLKI
                     IEVEGKEDEKAVAMRLVRKVTTTDAASKFKSMQANARVIKNYRHKFLDVMKSTVQRSF
                     EEYFLDNQHDFLGFIEGLGWVYKDIIRIKDDIEPLFPADYEITAFLVKAYHKSLNETL
                     IKVVKSAPEAKVLLELHAWIKEYRVSMKELEIPPAWIQPPLLDGKSQDLIEDYVKLIV
                     TKLDEWTVNLMREETGKFSWRTREPEQSDDGLFGMEGVVDFFQLVNQQCNLALDSNQG
                     AVLARVVTESAKVMRRVQDQWLKLLADEMKAQTEKKPEEVLPGLVEYVIALANDQLKS
                     ADYAEALSARLEPLVSDKYKEIISARLNEAIDGYIDVAKRCLSCLVQFVFHDVRVATK
                     ALITPAWYTEQLMGQIMETMKDYMSDYQAHLHPSVFEILVDNLLDAFLISYLSALRRA
                     STNSLRMPIAIQKIKSDISSAFQFFSQYKPSPGLEENFEVLNMIVNMLAASPEMVFMD
                     YWNFAKIHGPQLQFAEALMKARDDLDRDGVKEIMETLRRKAKEEDIGEPEEPTIMVKV
                     QATSGGLLSNLTNLAGTYASNFAAAGLRPS"
     gene            complement(739812..743029)
                     /locus_tag="CNK02550"
                     /db_xref="GeneID:3254511"
     mRNA            complement(join(739812..740050,740104..740131,
                     740182..740436,740488..740592,740648..740781,
                     740833..740968,741021..741198,741252..741403,
                     741454..741791,741843..741960,742012..742100,
                     742154..742243,742294..742399,742451..742535,
                     742592..742709,742760..742790,742846..742848,
                     742907..743029))
                     /locus_tag="CNK02550"
                     /product="NAD+ synthase (glutamine-hydrolyzing), putative"
                     /transcript_id="XM_024658084.1"
                     /db_xref="GeneID:3254511"
     CDS             complement(join(739898..740050,740104..740131,
                     740182..740436,740488..740592,740648..740781,
                     740833..740968,741021..741198,741252..741403,
                     741454..741791,741843..741960,742012..742100,
                     742154..742243,742294..742399,742451..742535,
                     742592..742709,742760..742790,742846..742848,
                     742907..742929))
                     /locus_tag="CNK02550"
                     /codon_start=1
                     /product="NAD+ synthase (glutamine-hydrolyzing), putative"
                     /protein_id="XP_024513738.1"
                     /db_xref="GeneID:3254511"
                     /translation="MHLVTVATCQLRQWSLDFEGNCERILRSIAIAKSRGATLRVGPE
                     LEVPGYGCLDHFLEGDTMLHSWEVLAKILQSEEAKGIVCDIGMPLEHKNNNYNCRVII
                     FNGKILLIRPKMWMANDGNYRELRHFTPWHKHRQVEKHSLPHMIRIVTGQTYVPFGDA
                     VIATEDTVIGVELCEELFTPASPHILMGLDGVEIFTNSSGSHHELRKLNRRVELIKEA
                     TMKLGGIYLYANQQGCDGDRLYYDGACLIAMNGQILAQGPQFSLSEVEVVSATVDLRA
                     VRAHRTTSSRRMQSAQAEAYERVVADTRLDGGEQIKVGLRETKGSMDVRYHTPEEEIA
                     LGPACWLWDYLRRSRTQGYFLPLSGGIDSCATAIIVHSMCRLVVEAAAKGDEQVITDA
                     RRITNEPEDSTYIPEDPREFAGRIFHTCYMGTENSSSETRERAKNLADAIGAYHVDLN
                     MDTAVSAVKGIFSFVTGKTPQFKAHGGTNAENLALQNIQARLRMVVSYMFAQLLPWVR
                     GKNGGLLVLGSANVDESLRGYFTKYDCSSADVNPIGGISKVDLKRFIAWAQVKFDLPI
                     LYNFLHAVPTAELIPIGPDNIIQSDEIEMGMTYDELSVYGRLRKVEKCGPFSMFGKLV
                     QEWGSFLSPKEIAEKVKHFFFMYAINRHKMTTITPSVHMESYSPDDNRFDLRPFLYPS
                     QFTHQFRKIDELAGKLPDMAQKPKVDTNEVD"
     gene            complement(743307..746955)
                     /locus_tag="CNK02570"
                     /db_xref="GeneID:3254463"
     mRNA            complement(join(743307..745369,745415..745673,
                     745725..746038,746093..746308,746356..746660,
                     746733..746787,746849..746955))
                     /locus_tag="CNK02570"
                     /product="expressed protein"
                     /transcript_id="XM_024658086.1"
                     /db_xref="GeneID:3254463"
     gene            743454..745683
                     /locus_tag="CNK02560"
                     /db_xref="GeneID:3254539"
     mRNA            join(743454..744490,744543..744626,744678..745049,
                     745113..745121,745177..745683)
                     /locus_tag="CNK02560"
                     /product="expressed protein"
                     /transcript_id="XM_024658085.1"
                     /db_xref="GeneID:3254539"
     CDS             join(743592..744490,744543..744626,744678..745049,
                     745113..745121,745177..745636)
                     /locus_tag="CNK02560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513744.1"
                     /db_xref="GeneID:3254539"
                     /translation="MCSDAADDDQLSDVGFDWTALLDDLDDRVQTSHLPTPAQTPSTG
                     LSRDHTCFDWLDLWDDIRDPKAQSTPSTVVPPTPESLPKPIQLPSTPKTFFCLVSPSS
                     PLPLDATLPSPQSYVIQSPLSNTDRKPYIPSLDRKSIVKQAPVQDDNPFLVSSPCLRK
                     PVVPAPRQRPVLAVPYDWSFDTPTPVRFHPATVEELPPQPVFTSTGQNILWLTHLSTS
                     GGLTPSLKRISLPYYPYPKVKGVSMFINHPKRRVHEQIRVKEDVKNGQDIFTATMDSV
                     MDNDWRKTSMVHGVYTVNLLSEDQEIRERSKRSVMEEMRQVKALGMSTLVIHLGSAGK
                     DDPSYKHVQLTRLVSDLREITRAVQGITLALENTVHPSPHSLTTLSSLCTILTHFPPS
                     QLKLCLDLSHLHVSEFDLNSESGRKEMWELLETAGKARVVGVHVSDNYVAHGGKGDRH
                     ANIGFGHIALSSFRTILSNPFFHNIPHLLETPPYFKHFRPPNTIHCKPPTYAQKIIEL
                     ESERASLERLLLDRIVSMSDPEWMTYQSKLWAMYKKARKVVEARMYKVLFKQGGSLWR
                     KFRKERKKVGSRLRQAEGQKRKAKNMFVKDERVTITRCCEL"
     CDS             complement(join(745734..746038,746093..746308,
                     746356..746660,746733..746787,746849..746894))
                     /locus_tag="CNK02570"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513778.1"
                     /db_xref="GeneID:3254463"
                     /translation="MSVPRLLVVGGNGFLGSAICKAAVGKGWEVSSMSSSGKPFTTPA
                     GHTPAWVPKVSWHSASAFSPSSYSSLVSSSTAVVHTLGILLEDHGYKKAVREGDLISL
                     AGGFLKGLGGGDGNPLKTAEEKRRGYDGMNRDSALEVLNTMLSTAPHPSAPNEAVKEK
                     TFVYISAADAFRPLVPKKYIESKREAELEIAKRCSDTSGVRPIFIRPGLMYHPHTRPL
                     STLPAFLIDLSSKLNAALPAPLQNIPSLFSPQSAIRGALEGARTFPLHVDHVASAVLK
                     CVEDGEKRGVVEVDEMRRWAGFKYSNDAALEY"
     gene            complement(747434..749182)
                     /locus_tag="CNK02580"
                     /db_xref="GeneID:3254461"
     mRNA            complement(join(747434..747938,747991..748403,
                     748456..748550,748602..748745,748805..749182))
                     /locus_tag="CNK02580"
                     /product="ribonucleoside-diphosphate reductase, putative"
                     /transcript_id="XM_567858.1"
                     /db_xref="GeneID:3254461"
     CDS             complement(join(747664..747938,747991..748403,
                     748456..748550,748602..748745,748805..749083))
                     /locus_tag="CNK02580"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase, putative"
                     /protein_id="XP_567858.1"
                     /db_xref="GeneID:3254461"
                     /translation="MAAVETPSKVAASALANIDLNTAKKASEPTLLSKLQAAAPTKPV
                     VEEAQAAPEDDVEEYRKRFVGDLDCEEKDEPLLKETNARFVLFPIKYHEIWQMYKKAQ
                     ASFWTAEEINLAPDLHDWENKLNDNERYFIEHVLAFFAASDGIVNENLVERFSAEVQA
                     AEAKSFYGFQIMMENIHAETYSLLIDTYIKDTARRNFLFDAIDTIPCIRKKADWALRW
                     ISDKRSCFGERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTD
                     FACLLFTHLRRRPHPDTIARIIKEAVTIEQEFLTDALPVSLIGMNAKLMCQYIEFVAD
                     RLLVAMGNEKIWNSTNPFDFMEMISLQGKANFFESRVSAYSKSGVNQAVGAADHNAIK
                     KGFSLDEDF"
     gene            749642..754262
                     /locus_tag="CNK02590"
                     /db_xref="GeneID:3254458"
     mRNA            join(749642..749833,749904..750276,750327..750492,
                     750538..751043,751093..751335,751381..751542,
                     751593..751937,751986..752207,752258..752471,
                     752527..752650,752700..752814,752868..753372,
                     753423..753518,753568..753813,753869..754262)
                     /locus_tag="CNK02590"
                     /product="mismatch repair-related protein, putative"
                     /transcript_id="XM_024658087.1"
                     /db_xref="GeneID:3254458"
     CDS             join(749811..749833,749904..750276,750327..750492,
                     750538..751043,751093..751335,751381..751542,
                     751593..751937,751986..752207,752258..752471,
                     752527..752650,752700..752814,752868..753372,
                     753423..753518,753568..753813,753869..754161)
                     /locus_tag="CNK02590"
                     /codon_start=1
                     /product="mismatch repair-related protein, putative"
                     /protein_id="XP_024513779.1"
                     /db_xref="GeneID:3254458"
                     /translation="MAKEPSKPAKQATLAAFFGAPKPGPRPSQPRSSQPKSSPASTLR
                     TPSTSVAGSSPVQAKSSRPAPSSSIKRSSPLKQPEPSSEITAIEDEDDELTPPPKSDV
                     SDATTVGESSSGKKRDEDEEMDDDEPPIVTGRRAKRKVVYVDPDSDDDSEGEVKPKAS
                     NGRRPRKSLKEDSEDEYMFDEADDAAMAAALDDFEANKLSPSKSPSPPRKITKAKATP
                     SASSKKPTTTPIRPGPKPVANKGSESNSFLTAAERKKIQAKEDKRESEQCFDFLVNIR
                     DKEGNRPDDPDYDKRSILIPKKSWAEFTPFEKQFWEIKQNHYDTVLFFQKGKFYELYE
                     DDALIGHQEFDLKLTDRVKMKMVGVPEQSLEFWIAKFLGAGHKVGIVDQAETAIGMEM
                     RTKAGQKTGGREIVRRELARVFTNGTIVDSGYLNSDDPNHLVSIKESSGSPEGISSFG
                     ICIADASTGEFSISFFEDDVCRTRLETMFRQIRPKELIHAKGNLSVTTTRLLRNILPS
                     STAWQSFRDGKEFYTAEDTLNLLPSIFSNEQGQTTIPEAITSLQDNALAMESLGGMLF
                     YLKSLNLDKDLFSQRNFNIYDPIKEGKNLILDGKTLGHMEVLVNNEGGIEGTLAELLQ
                     RCVSPSGKRLFKVWLRSPLRDADAINARLDAVEDLMNHPRFSGDFTQLCKGLPDLERL
                     ISRIHAGSVKQSDFLQVVESFSKLQKGIDNLIDMSESLESTGVKALLRSAPDLSGMIQ
                     HIRGMYTIEQNEKTIAILPNPGADEECDAADAEVERIEEELNEILEEVKKTLKCKEAV
                     FWHSAQGGKEIFQIQVPASVKAPARWTKASGTKSHNRYYTPETIPVIRQIQEARETQA
                     AAKKNFFKHLMDEFSKDRETWLITVRVIAELDCLVSLAKASSDMDEPKCRPTFVSSSS
                     AFIDFRDLRHPSMCLRSDFISNDVQLGGDQPRQVLLTGPNMAGKSTLLRMTAAGVIMA
                     QLGCYVPASEARLSPVDKIQTRMGAYDNMFASASTFKVELDECSRILREAGPKSLVIL
                     DELGRGTSTYDGMAIAGAVLHHIATHSLPLGFFATHYGSLTDDFAYHPNIRRMHMQTH
                     VDDEQKQVVFLYKLIPGVAESSHGTHVARMAGVPLDVVLRAESVSQQFFSAFNDKLVN
                     RRQSKMPIVAQADFAWLMRVVKGLEGAVAGSQDKKGILGGHEATLADQLDIVERCAGG
                     YEIAEA"
     gene            complement(754237..755472)
                     /locus_tag="CNK02595"
                     /db_xref="GeneID:36393107"
     mRNA            complement(join(754237..754985,755032..755472))
                     /locus_tag="CNK02595"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658811.1"
                     /db_xref="GeneID:36393107"
     CDS             complement(join(754325..754985,755032..755444))
                     /locus_tag="CNK02595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514645.1"
                     /db_xref="GeneID:36393107"
                     /translation="MSSKQSSASASSSRNPSPAPNTQQIDPYRTISSHLKRPLAPLLP
                     QTEPLLPNLLSLNASIYSSRLSGKTLLTTPDKPSTTSSVLVQGRKRNRGNAFEKKKAR
                     EEHERNVKTREELGLEGMRKVRRRLGGVVGKGNRISYNALIPLNHLHINYICQLLALP
                     PLPFPVPNTLPSLNPEPLQSKISKADFTGIYLSVLAAKNDSLKDQRGIVIEETAETFR
                     LVGQDDKVRVIPKVGSLFRLSFPAYSPRSNLNDESPFPPDLTDHLKTCPRLEMDLLGS
                     AFAYRSADRAGRKFRPAQGGGGGSGWGEDWVGRVGEMGKTLIEMEATVGGEQPVREKV
                     NGGKRKRNKSRRKDPPAWGNPAA"
     gene            755997..760053
                     /locus_tag="CNK02600"
                     /db_xref="GeneID:3254432"
     mRNA            join(755997..756327,756381..756485,756537..756616,
                     756666..758476,758532..760053)
                     /locus_tag="CNK02600"
                     /product="cytoskeletal regulatory protein binding protein,
                     putative"
                     /transcript_id="XM_567860.2"
                     /db_xref="GeneID:3254432"
     CDS             join(756187..756327,756381..756485,756537..756616,
                     756666..758476,758532..759913)
                     /locus_tag="CNK02600"
                     /codon_start=1
                     /product="cytoskeletal regulatory protein binding protein,
                     putative"
                     /protein_id="XP_567860.1"
                     /db_xref="GeneID:3254432"
                     /translation="MSKNISYPVPQQEPYQSQPTVRNGNGYYRTSSGFTQRHGRQTSG
                     SRSYPSALDSSITRLLVTTKQLLQGLDQWSHGLISEIDVSDIYVRLGNGFETCVQAFS
                     RVGIDTRELSSIPQDLRNCLEHCLSQDPSPDSLDRFLPEIRNIIQYLLQGLKQKQMQY
                     KRLQERNRQYESSSSLAGTTSTVGDGSQASVAHSQPVGIPGQRRPSEDYPSDPRFSAR
                     SGTSTSSASPPVSSQLSQLSSTQLTAQPRSASNPALAERERRPAPSRPPPPDAFRPAR
                     PPGPRRPSSPVGSQTPQENIHSVMSRGGESQQSHSPSYDIPTIAIVPDSRSNSGTGPN
                     PAAPSPPPAKPNLTINTDKPIPPRPDRFARDSYGRPISRFSVDSDASAGSPVVETGAV
                     ETGAVDVQSRAMDSVPEEGERKSAELKRRPRASVDRSSRASGSGSSDRGHQTQQSECT
                     APSLPMLDFPRNISLHPATPPAVRNPLPATSTHAPTLPPPESLPIPEVPPETRATLAA
                     LERSDALERRASKRFSSYTFNNLNSSSSPRASPQRPTRRAVNNAREQLASGGTLPEGV
                     GLGMGLHERAGSRGGSPKLERVREAGEEPEGSGATIEPSSPTGSVRVLKTPPLSPSAT
                     PRPPSHPAFSDPNRMNVFLQIGRKTKRHVLELPITLEALKLVFMERFEYDPGKEDFPD
                     VYIRDRDGMEYELEGVEDLREGCTLCLNIEPLDQVKLHIDSTFATLVQEMKELRQALD
                     KERETTKRLSVLASPSVAGDPASLTPSTSPLQPPASAISLPAPTPLVVGPSEDHLKQI
                     QEQHEELESLRRELAITRQSHAEHINESSAIISSLKDEIAQIKKVTSTNPNSNRGLVD
                     RSKAELDTQCTETIKAVEDITDIVDAARIDAYKRFVTPSKQQMATIQSDLQKARQLVE
                     DFTSAVKIADPTWRGTWQTELHRVMEEQKLLHHQTKLCGDLKKDLEDAESMLGNVQTF
                     VEQRVAGTRTARIRVGADAEVEGGGISSLLMEIRTKDSDPEQRLRAIEAQQRARARER
                     ANKVDEFEAELKGFVGGKRLKKTGGAEEVDRLRGRKDEVLRVQLTGSSGVGAITPQIT
                     GQSAKAISPQGTGQSVNTVISGSGSAPTTPAKVEGKEKEPEEMLVKSSSAASLASSNA
                     APEGVSPGVSPAKDQPLVETKEEADV"
     gene            complement(759998..761266)
                     /locus_tag="CNK02610"
                     /db_xref="GeneID:3254374"
     mRNA            complement(join(759998..760897,760951..761069,
                     761112..761266))
                     /locus_tag="CNK02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_567861.2"
                     /db_xref="GeneID:3254374"
     CDS             complement(join(760203..760897,760951..761069,
                     761112..761221))
                     /locus_tag="CNK02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567861.1"
                     /db_xref="GeneID:3254374"
                     /translation="MSISLPNGTLLAASSSSHLQLSAAVTRILHLANFSAELKTRDLQ
                     LMFKEWDNDKGGYRIKWLDDTHALVVFADANVAKRAYLSFLLHPPPSFTGSIRPYDRP
                     DAAQVIQSLASRALGHRSSMSNAANGGGAPFPFPANNDPAAPQVHSRAMSVTNIHHSK
                     TGSISGALPGSSSGPHAGGLAAPTQRRGHHRSGSGSSSWARTSLSGGLGGLAGLAGGA
                     LSFPTNASSRPTLPTHDESSGGPPSRSGSSSSGEAVVLVDPSAMTGMRVTSNGGPKDG
                     VDGDKKRRDSVSADKALREVQKALASVETQG"
     gene            761546..763565
                     /locus_tag="CNK02620"
                     /db_xref="GeneID:3254378"
     mRNA            join(761546..761580,761921..762119,762171..762626,
                     762679..762976,763030..763565)
                     /locus_tag="CNK02620"
                     /product="ATP-dependent protein binding protein, putative"
                     /transcript_id="XM_567862.1"
                     /db_xref="GeneID:3254378"
     CDS             join(761942..762119,762171..762626,762679..762976,
                     763030..763471)
                     /locus_tag="CNK02620"
                     /codon_start=1
                     /product="ATP-dependent protein binding protein, putative"
                     /protein_id="XP_567862.1"
                     /db_xref="GeneID:3254378"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
                     ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
                     LRLRGGQ"
     gene            764474..766407
                     /locus_tag="CNK02630"
                     /pseudo
                     /db_xref="GeneID:3254601"
     gene            complement(766260..768291)
                     /locus_tag="CNK02640"
                     /db_xref="GeneID:3254436"
     mRNA            complement(join(766260..766745,766806..767099,
                     767156..767260,767316..767466,767521..767614,
                     767727..767865,767932..767999,768056..768073,
                     768154..768291))
                     /locus_tag="CNK02640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567863.2"
                     /db_xref="GeneID:3254436"
     CDS             complement(join(766713..766745,766806..767099,
                     767156..767260,767316..767466,767521..767614,
                     767727..767865,767932..767999,768056..768073,
                     768154..768229))
                     /locus_tag="CNK02640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567863.1"
                     /db_xref="GeneID:3254436"
                     /translation="MSDLEPLDPTLQNILDQKSLKWIFCGGKGGVGKTTTSCSLAVQL
                     AACRESVLLISTDPAHNLSDAFSQKFGKDATKVNGFDNLYAMEIDPNGSLQEMIESSD
                     QTGGMGGMMQDLAFAIPGVDEAMGFAEIMKHVKSMEFSVIVFDTAPTGHTLRFLSFPS
                     VLEKALGKLSTLGGKFGPMIQQMQSMFGGGAPQEDMFAKLESMREIITEVNNQFKDPE
                     KTTFVCVCISEFLSLYETERLIQELTSYEIDTHNIVVNQLLFPKAGDNCEQCSVRHNM
                     QQKYLKEAYDLYEDEFHIVKLPLLTEEVRGVEKIKEFSKMLTQPYTPPQ"
     gene            complement(768465..769557)
                     /locus_tag="CNK02650"
                     /db_xref="GeneID:3254448"
     mRNA            complement(join(768465..768785,768849..768959,
                     769011..769018,769069..769193,769283..769557))
                     /locus_tag="CNK02650"
                     /product="expressed protein"
                     /transcript_id="XM_024658088.1"
                     /db_xref="GeneID:3254448"
     CDS             complement(join(768563..768785,768849..768959,
                     769011..769018,769069..769193,769283..769490))
                     /locus_tag="CNK02650"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513780.1"
                     /db_xref="GeneID:3254448"
                     /translation="MSPGKSVLPAPYFYFFWLLEPILTVAGGVSAIYDPISFGGNTIP
                     RNIERATLKMGSTVRGQIVVSELGSCFMLLAMISFSLFYIFKKHLEDKPVLQEKLVKG
                     LLIPLAIADLLHIAVTLLALPMSHLENPSQWTYILHSTVWITSGLFIVRLAWLLGIGR
                     ATAKSKLQSRLSPTRQARLPLPKGNSEAMVEQVIQTEKPSEFTAIESPTATKRRGRAK
                     KIVDDD"
     STS             769982..770146
                     /standard_name="AAC18"
                     /db_xref="UniSTS:470696"
     gene            complement(770147..772380)
                     /locus_tag="CNK02660"
                     /db_xref="GeneID:3254453"
     mRNA            complement(join(770147..770356,770416..770654,
                     770714..771574,771665..771876,771935..772018,
                     772138..772380))
                     /locus_tag="CNK02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_567865.1"
                     /db_xref="GeneID:3254453"
     CDS             complement(join(770304..770356,770416..770654,
                     770714..771574,771665..771876,771935..772018,
                     772138..772287))
                     /locus_tag="CNK02660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567865.1"
                     /db_xref="GeneID:3254453"
                     /translation="MAAVDDKVSIEHVESGDHYTKHHVTQEEVKHGDNALKYIGDERV
                     EVTQEDDARIRRKTDKYILSLLAWVYFLQILDKTVLGYANTFGLSEDTNLVNNQYSLL
                     GSINAIVQLAWQPFSSYLIVKVPARYLMPAMVFGWGAAQACMAAAHNFGGLMASRAIL
                     GLFEAGCLPLFSLLTSQWYRRSEQPVRVAVWYSTNGLATIVAALLSFGLSHVDSPHIK
                     SWQLIFIVCGIITCVTAPIVYMFVDADVASARFLTEEDKAKGIERLRANQTGTGSNEF
                     KVSHVWELFCDPKSYLFLAISLLLNVGASVTNIFGPTLIKGFGFNSRITSLLNMPFGF
                     LQFVAILAGCYCAYKFKLKSAVLAVFIIPVIIGLALLYVENAAAVLKQAPALVGYYLL
                     AFLFGANPIIVSWIVANTGGQTKKALLMSVYNAGSSAGNIIGPLLFQDKDKPHYLPGI
                     KATLGIFCALMACVGITAALLFALNKQRQRQRVAVGKPQYIKDTSMSNKYEAYGADDV
                     DGRLGQNALLDLTDFKNDEFVYVY"
     STS             771392..772234
                     /standard_name="Xho18"
                     /db_xref="UniSTS:470698"
     gene            complement(774464..777181)
                     /locus_tag="CNK02670"
                     /db_xref="GeneID:3254505"
     mRNA            complement(join(774464..774893,774945..775119,
                     775171..775494,775546..775853,775907..776084,
                     776139..776975,777022..777181))
                     /locus_tag="CNK02670"
                     /product="peroxisome targeting signal receptor, putative"
                     /transcript_id="XM_024658089.1"
                     /db_xref="GeneID:3254505"
     CDS             complement(join(774706..774893,774945..775119,
                     775171..775494,775546..775853,775907..776084,
                     776139..776975,777022..777114))
                     /locus_tag="CNK02670"
                     /codon_start=1
                     /product="peroxisome targeting signal receptor, putative"
                     /protein_id="XP_024513781.1"
                     /db_xref="GeneID:3254505"
                     /translation="MQSFLNGADCGPSNPLKQVAQREAADHSLFKDRLVPQSSTQLNT
                     FRSSPSFNPQGQAPIARHANPTPHPFNLSHLSAALAESSRSGSASPMPAASHLPLGSS
                     FEAGWNEAMSNGLKSPPFITQAPSRAPVQWVPPPSQESNWINGYEEWQSSQEKGKQRA
                     IGSGHQMAHNPPYSSDMPSASMGMSQGMGINYQPSFSRMYGQNLQRPPASSLSPEVQL
                     DPKQMEALFARAEEDWKATDAATSQTAEQMDAKGKGKEREMPAAEETVEETTVDNAEE
                     IKEAKGDFEKVWESLKPEAERLNKLAEWERDFSQFTNDEDDLFDVLNESLNQPDVGQA
                     SLDQQTDFLQDERLAMGQGLAARDDGIPLIGSYDFSSPSQHLASLSASYLWTEANHLL
                     ASGGSLSEAAIMIEQFITRSTPQERIQINVSLTEAWATLGRVHAMDEKEEKALEAFQA
                     GSKALEQEGITGKEGVAGEMLTNLAISYVNESLDLAALSTLHRFLSLTHPAYAGPAPT
                     TSSPLLTSSTASPWALHQQMADSFLALAREQYQKGEKVDPDVQVGLGTLFYMMGEYDQ
                     ARDCWVAALKERPEDYLLWNRLGATLANGGSSEEAVDAYRRALELKPGFTRAISNLGV
                     ACLNIGVHREAAEHFLAALSLHSSQTEGHSQQISNDSAALWGTLRKSLIAMDLPDLAA
                     KARPGTNLEVFRAAGFDF"
     STS             775279..776048
                     /standard_name="Bam15"
                     /db_xref="UniSTS:470697"
     gene            complement(777327..778407)
                     /locus_tag="CNK02675"
                     /db_xref="GeneID:36393108"
     mRNA            complement(join(777327..777934,777986..778083,
                     778160..778407))
                     /locus_tag="CNK02675"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658812.1"
                     /db_xref="GeneID:36393108"
     CDS             complement(join(777418..777934,777986..778083,
                     778160..778336))
                     /locus_tag="CNK02675"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514646.1"
                     /db_xref="GeneID:36393108"
                     /translation="MFPRGSLALKIPVEVCRKERLRCFASSARSAARSKGSHYDALML
                     PKNATKQQVKAKFYELSKKYHPDKTGGDISKFHEINDAYATLGDESKRRQYDLSITPA
                     SQSPRRPHASNPAHHSSFHPNDPYLHRAAQGPHRAWHGQHASSHPPPGWRPKTETYNP
                     FGHRTPPNWQYSPGYNYSYAPNARTTDRAGWGKRRPSQGDKEEKHAGGGGIWRFVITV
                     GLIFTVISLGGSLTANTESEEDWAIESQGEDEEINSSRPSYRRAT"
     gene            778557..781569
                     /locus_tag="CNK02680"
                     /db_xref="GeneID:3254574"
     mRNA            join(778557..778703,778750..778772,778846..778999,
                     779047..779107,779158..779517,779570..779896,
                     779946..780002,780062..780204,780256..780395,
                     780453..780493,780553..780600,780655..780706,
                     780756..780765,780814..780861,780921..781164,
                     781219..781569)
                     /locus_tag="CNK02680"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_567867.2"
                     /db_xref="GeneID:3254574"
     CDS             join(778636..778703,778750..778772,778846..778999,
                     779047..779107,779158..779517,779570..779896,
                     779946..780002,780062..780204,780256..780395,
                     780453..780493,780553..780600,780655..780706,
                     780756..780765,780814..780861,780921..781164,
                     781219..781386)
                     /locus_tag="CNK02680"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_567867.1"
                     /db_xref="GeneID:3254574"
                     /translation="MAMSSSKLADLRQLMKEQGVDAYVVPSEDAHASEYLAPCDARRA
                     YITGFTGSAGCAVITHDKALCWTDGRYWLQAEKQLGEGWALMKSGLPEVPTWAQWLST
                     EVSPNSLIGIDPTVIPYSEALSLLSSLPSLSPAPSAASPSRLIATPNLIDSLWVPPSR
                     PLRPSQPIFHLADRYTGEPVSSKLRRLRDKLIRIGSPGTVVASLDEIAWVFNLRGADI
                     PYNPVFFAYTIITPDDCTLFVSPSSLTIEVRSYLHSNGIAVLDYSHVWTSLEAWKKRV
                     KFDQENKSREQRDGVKRARLEEEAKKEEEGERLKKTDKILIGNKTSWAVAKAVGEDNV
                     EVRRSLIEEMKAKKNATEIEGFRQCHIRDGAALVRYLAWLEEALENGESWTEYDAATK
                     LEDFRKENKLFMGLSFETISSTGANAAVIHYSPPAEGSKVIEKKQMYLCDSGAQYLDG
                     TTDVTRTLHFGTPNEDQKRAFTRVLQGHISLDTIVFPQGTTGYILDVLARRALWSEGL
                     DYRHSTSHGIGSFLNVHEGPQGIGQRPAYNEVPLQEGMVISNEPGYYKDGEWGIRIEG
                     VDVIERRETRENFGGKGWLGFERITMCPIQTKLVDSSLLTIEEKDWLNEYHAEVLAKL
                     APVLKEMGDERAGKWLERECQPL"
     gene            782136..784244
                     /locus_tag="CNK02690"
                     /db_xref="GeneID:3254711"
     mRNA            join(782136..783429,783484..783573,783625..784244)
                     /locus_tag="CNK02690"
                     /product="expressed protein"
                     /transcript_id="XM_567868.1"
                     /db_xref="GeneID:3254711"
     CDS             join(782554..783429,783484..783573,783625..784098)
                     /locus_tag="CNK02690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567868.1"
                     /db_xref="GeneID:3254711"
                     /translation="MSALAPHHARSASFDNSAPSLVRTDSTDSPLSEGIVTPLHSGSS
                     SPVIRSSTYQCNCSRGPGHDDPARFLDECNPFLVADNDEDHEEKGAGTKHTPLFSPPA
                     SVRCTVTNVQKVACSPTPPNTLAGSPSPFLHATITSTETTRPNQPSSAPQPSQRLTDT
                     LSSLPLPFCANKSSHRPHLHISVDSEEESSRSSVLTTPITLSRPPLPFGVSAYYLAKP
                     ELAKRRRFGDSKQDVALSAVLLNRESKAYTAPVKFKIEAQLDGSLLERDLKDVPSKRR
                     NVSLPVYECKQGVQDQETPDESTAMGRSKVFVGKKRVQFASDGVCETVNSQSNASLIA
                     SWQQSDLSTSSSQCTLNDYNDDPQYALERQTAHQPPLQEAEDESKDHMSIVSDMSVTV
                     FLTVLHQIEVDMVKQFGQKLIPSWLVGWMRWVKTVSESQSQSQTQTQSQSGCCDKVNL
                     EEDDEAFVMECFSSFEGRCLSPGLELQVA"
     gene            complement(784245..788443)
                     /locus_tag="CNK02700"
                     /db_xref="GeneID:3254708"
     mRNA            complement(join(784245..785844,785897..786062,
                     786125..786625,786679..786747,786797..786980,
                     787030..787854,788072..788443))
                     /locus_tag="CNK02700"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_024658090.1"
                     /db_xref="GeneID:3254708"
     CDS             complement(join(784590..785844,785897..786062,
                     786125..786625,786679..786747,786797..786980,
                     787030..787830))
                     /locus_tag="CNK02700"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_024513782.1"
                     /db_xref="GeneID:3254708"
                     /translation="MRILRDEDQHVAGPSSRPYVYQSIPVPTVSLRPSIQCSTSCPFL
                     DTFPADPIDARKPQVTQAAMRRLNGSKLKNWEVTRRQENEGDLHGSSSSTYNESVAST
                     FTSDYYPATTASFTNSSYSYNPSSTSTYSEYNASTSLFNASEPYYTSNRTSTSVWSSK
                     TSSTHSTSTKQAYTPSFTSLWSYSASKKTDTATASKSTSSAYVPGVVLNMTMGGTSDT
                     QAVYSVEMAFGHDDDNSRRKRAFRKGALYEEDGSTQYVNLQVDLGSSDMWVATTDCSS
                     SDCRNSPYLFDNSLSLDSGVDANLTYQSGSVEGTIFWEEVNLAGFGIGFQAFVGATDV
                     ENEDLEGGNFSGVLGLALPASSTILDEIGGTTSSNPDGATFLDNLFGSGPSAPSKRLF
                     ALSLERRQDVRTSSTFGIGAIDPTYCPSPCNLTYTPIIAQPNLGSTGYLHWRVEMQAL
                     TVTTFSNEQSGTGATTKRIALGASKVYPSRNYPLAVLDSGGVQILVSSRSYADSIYSA
                     FGITSSSDGLYRMRCTQQLALTFTIAGQEIPVHPLDMTYADPADMSQKTCIGMIQYSD
                     NLGDSGDFILGSSFLKNVYSVYRYPDTEKHKTWQPTVGLVPLTNASVASQDFYSVRVL
                     HESLGTVSSDQAQSSSGGSSSTNSGGSNASEGDTSKRAISSAVIAVISVIGFFVLAAA
                     AFCAWWFWLRRKFGASGVVEYQTAGRRRRPSPQGRNSDHSTSTLRSRKHVDTLRQKSM
                     IEGYDIYNDQESWVSGTEGADSIRLGYIPEALEEEEEGGGMEGTGRRSSRGSSIARSL
                     ASKSVGGEDEGAGVTLVDNVDPLSPGVESTTPGTRGRSPGRTSAGAGASASTSYSPFV
                     DPPTSSASDSFPATGPATTGPYPSPLPSSYPKSHSHSHNKSPSLGMSGPFPSPPSNRF
                     STMNLDSSPMYDIRTSDYFSVPGAQRGKDGKRSSSSTTGRENGHRMASPSKASGRGLM
                     DNTLVEEPGDEEENQKESK"
     gene            complement(789722..791613)
                     /locus_tag="CNK02705"
                     /db_xref="GeneID:36393109"
     mRNA            complement(join(789722..790103,790159..790565,
                     790756..790928,791002..791218,791270..791613))
                     /locus_tag="CNK02705"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658813.1"
                     /db_xref="GeneID:36393109"
     CDS             complement(join(789924..790103,790159..790565,
                     790756..790928,791002..791218,791270..791444))
                     /locus_tag="CNK02705"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514647.1"
                     /db_xref="GeneID:36393109"
                     /translation="MSSSSDTSVDVYIGPSSPLLAYTPSRNGASGSAWFQNEDGSSEC
                     EGSSTFAVQIDSLYFGDIAFYWSSSASYSVQAGLDGSLQSCSTSSGVAALTSSFGSHS
                     ARLECAGDGSSSGFELTGVKLNTQVVSYGSPYNSTLDDASSEVTYSGFASTSSSQSTV
                     PVIKGGSFYQDTVSYTSSADASASFTFQGSAIYIFGMTGPEFGCFSISIDSITIGIYN
                     ASTTFETYHTLLFFTTYLDASNEHTVKITNENDGMLLALDYFVAVQPGTSNRSGNTTI
                     SGSTTTSLAKGSTATADFGDGNTNSNQGSGGDSTAAIIGGILGGLGALFLIWFFWAYW
                     RWKKAGGQGELFGAICGGRRKKPGPPPPSEPKQYPLWPMVLSRPKYAVG"
     gene            complement(791881..793515)
                     /locus_tag="CNK02710"
                     /pseudo
                     /db_xref="GeneID:3254490"
     gene            793658..799155
                     /locus_tag="CNK02720"
                     /db_xref="GeneID:3254489"
     mRNA            join(793658..794474,794525..794623,794680..798505,
                     798578..799155)
                     /locus_tag="CNK02720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658091.1"
                     /db_xref="GeneID:3254489"
     CDS             795204..798491
                     /locus_tag="CNK02720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513745.1"
                     /db_xref="GeneID:3254489"
                     /translation="MEPYPSYEEGLPSEYLSPEYIDPLYIPTPEYLPSDEYPPPARYD
                     IPMDYGHPEGYQPPFQPVYQFVPQGYKDSDALDGIIIDDHWIDPNIDDEDDVWSEESW
                     IPYSSHAVPNLRDSAVSPTSQSGNQQVVIAPLTNWYPTPSDLRQHYCDLHQSECLHQQ
                     MPVETNSTERSNTTLEDDLTQGTDLKHIDWSGVGLAFTLLLIILFAIHASWSGDDEEE
                     GENKGKDSPGSRSHSKDKNESSKKKGETKKEQKESRSDKDNEKKEAGRKNGDEKDNDK
                     DKKKSSSRISSKNDAAEGNDDKGSLKGKGEGEKKKDGSSSKSKKPNDDKKSSEKSDKV
                     DGDKKSDPKKDDKAEGLEKKDVKKKSSSSDDKKEDKRGSGGEKKEERNKKEERNKEDE
                     NKASRGEKKEDKNSNSREKKDDKKAAGDKKEDKKATGEKKDEKKAAGASRNKDDKKSA
                     TGEKRDEKRAVGAEKKDDKKVAAADKDDKKAAGGNRKDDKEATGAEKKAAGAEKKDDK
                     KAGDTKAERKVEKKEVEGERKKDDKKVGEKKHDEKVAEGDKKNDKSQSGRKKHDEKVG
                     EKKHDEKVAGGDKKDDESQSGRKKPSSGDKEGGDKRLDHKKTDKKNNEEKDDKKAGEK
                     KSGSKEGDKKPGDKKGDKKAENRNEEAGKKPANEKEAVNKPGEKKEMDKNPKDNKEMD
                     EKLAGDKKNDGKSEKKGKGSVLEERGGEGKGDKKESKKSGNDKRKHEKKYEEDKEREG
                     TKEEGKKDKSEQKDDPKKDGKGSLTSGSSKTKNEKDDERSWFSSHILIGLLLLLPLLA
                     MTGRSRMPIIYDPAANRPSILTGSGLGDILASPVMAASKGLKRATTSPRASSSGARWV
                     VNEQPEPKAHIHINNVNSQGNGNPINIREPSSEPAVEITVEESSLAAEQLLNRPHSPP
                     VLEEERIWEPINFRFTGPANPDRLWNMIFACFIVALPLIVDQVMDYPERRYSQPDYLP
                     PASQLILLSASFLICAVIGDWHFGWSSTIAPFAEVSISGAQRGLTPLIVGVVETGESL
                     IWSLEDVMFGDGRVLLGMGLAALGVVLFSQRQPSLDVPKTDYASSTVQAMYFLGALLI
                     GMFVWNA"
     gene            complement(799205..801838)
                     /locus_tag="CNK02730"
                     /db_xref="GeneID:3254704"
     mRNA            complement(join(799205..799604,799659..799780,
                     799836..799878,799928..799959,800014..800244,
                     800302..800690,800745..800847,800898..801032,
                     801095..801423,801480..801838))
                     /locus_tag="CNK02730"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_567870.2"
                     /db_xref="GeneID:3254704"
     CDS             complement(join(799365..799604,799659..799780,
                     799836..799878,799928..799959,800014..800244,
                     800302..800690,800745..800847,800898..801032,
                     801095..801423,801480..801493))
                     /locus_tag="CNK02730"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_567870.1"
                     /db_xref="GeneID:3254704"
                     /translation="MVGFGSKRLRQEAMEASMVPTSDSERRPWHAHSRAYLLASVGFL
                     GIFLFGYDTGLGGGVIALSSFATSFNITGTSDEIADLQGNIVAILQGGAFFGAIIAAW
                     VNDWLGRKYSLMVGCWIFIIGACFQTAASSQLSWVYGGRFTSGFGVGLMSAVCPTYAS
                     EIAPKEIRGRITGMFQVIVVIGVAFSYWINYGVTFMDQNRGNIVWRIPIGFQLVPVGI
                     MVMLLPLLKESPRWLATKHKDERALANLAWIRKLPVTDQSVQLEYAEIAAAIREEEEA
                     TKGASWREVFAKGNPIRFIIAFVVFTLQQWSGQNSISYYAPIIFQSIGIRGSKSGLLA
                     SGIYGIVKIIATGTFIAFGIERFGRKKPLLLGVSLMSLFLWIIGAIFNTHLPDKNATT
                     TSAASIAMAVMIYLFVIPYCFSVGPLPWVICSEIFNNRTRHYGLMTAAATQWLWNFAV
                     TKATPLMVIHMPKGGIFFFFAAINIISFCLAMFLPETSGVSLESMDVIFGSVTKEERE
                     AEIARRAVELEGRTLDEEEKHGAEHLEHFDEKEKERV"
     gene            804603..808683
                     /locus_tag="CNK02740"
                     /db_xref="GeneID:3254698"
     mRNA            join(804603..805113,805214..805565,805617..808034,
                     808101..808683)
                     /locus_tag="CNK02740"
                     /product="protein kinase kin1, putative"
                     /transcript_id="XM_567871.2"
                     /db_xref="GeneID:3254698"
     CDS             join(804971..805113,805214..805565,805617..808034,
                     808101..808205)
                     /locus_tag="CNK02740"
                     /codon_start=1
                     /product="protein kinase kin1, putative"
                     /protein_id="XP_567871.1"
                     /db_xref="GeneID:3254698"
                     /translation="MTSFNPAPAQIQAAQDHTYGSMPTPTYMGMVDTGAQWDYVGRRG
                     SSRSREPSASPQRAATESGIPRTSTHAASASASSSYAPVAGASGQASSAPHEPTIREE
                     ATAVVDRSMRAHQQTTGPSNGNGNSQPKKSKVRMVGDWQLNKTLGAGSMGKVKLATNI
                     VTKEKCAVKIIPRYTDANRKEETTRTPEEVEKQRLKDESKEIRTIREAHISLLLHHPY
                     ICGMREFISHQNHHYMVFEFIDGGQMLDYIISHGRLRERAARKFARQIGSALNYCHQN
                     SIVHRDLKIENILISKNGNIKLIDFGLSNLYSPSRHLSTFCGSLYFAAPELLNARPYT
                     GPEVDVWSFGIVIYVLVCGKVPFDDQSMPALHAKIKRGVVEYPSWLSAEVKSLLSRML
                     VTNPAERATLAEVLSHPFMTKGYDGPPDSFLIRRELLRAEEIDMNVVEAMEGFTFGDA
                     NTIYRNLHSILTSEDYLHCVATFEAHREKLRTSSPGVSTNDPSDSPKKKRFSGFDLKK
                     RLFKEDKKVEEAPFKEKVRDPTKGYDPLISIYFLAREKIERERVFGPGFFASSQLSLD
                     TFNTSQGYGMAVPNLPPPASTHVMGHDSSRGPDFASEPRPRSDDVPNPVMAHPSADRE
                     QSKLADIPSAVHRRQPSLSQPPLPSSMPAAVERSADEGLTKKFSMLGRGPRPPSAGPA
                     GPSRSASTKRESMTASPSMPIQEHRRATTVVHSDKSKQERRVSVGSFTNSVSKASGLA
                     RRASQRDRPPATPPDSRWLNAPAEAEEYHQVETSVRPSSTPREPEPDTANEPQSYDDV
                     KPSYLKGIFSVSTTSTKPANVLIRDIAMVLDRIGIKHRPIKGGFECVHMPSIDLASVV
                     NGDEASTSLSNVPSHASGARRKQSLRRKGSKVNMNGISSNGAGSRATSPGPHRVLTGN
                     SSGTVSGGDVAHLSVPSGKNRHHVGTVEEDEVDAWALAQSGGAGSSLIVRFEIFVVKV
                     PVLPLHGIQFRRVGGDGWQYQMLAKAILREMRL"
     gene            809866..812739
                     /locus_tag="CNK02750"
                     /db_xref="GeneID:3254694"
     mRNA            join(809866..811548,811601..811706,811763..811880,
                     811953..812115,812197..812739)
                     /locus_tag="CNK02750"
                     /product="fmHP, putative"
                     /transcript_id="XM_567872.1"
                     /db_xref="GeneID:3254694"
     CDS             join(810041..811548,811601..811706,811763..811880,
                     811953..812115,812197..812575)
                     /locus_tag="CNK02750"
                     /codon_start=1
                     /product="fmHP, putative"
                     /protein_id="XP_567872.1"
                     /db_xref="GeneID:3254694"
                     /translation="MLHSLQPQNFPDDLGRSNSVYSSLSPATNSLPSSSFSARPHSAF
                     ETTTPRARHSFLLPAVDRSPSSDGHSPQQSQALRRPPSLPNAAILLEHSPVRNSTLCR
                     SHSTRSARTKSIRRKPVPAMVLPAADKEVTIGVGLPPNHPFANVASQAMTRSSSSYGY
                     EDMRYGTEKIHNRLGTSSQLANRAVSAGVMTPVPPHRVTSRPHLERACASSPSTPIRN
                     TQPPFPPSFSVHRSADPPPKPFPRRDTSPHLPEQYGQRLHSRFPEYTLSVDRPLPPAP
                     TDTASIRSTDTAPPSAATHGGRSSADSARIMTPIHGSTHEQVGHSRESSCRSGHNVSL
                     SVPPIMPKRLMSDDIVVRSKGSKKVQQKIKVPKKVILLGGETLADVEFSVDKLVSRDR
                     VLEASTCFVRDENGLPVCFGDLLPPPGPVEAGKPTPKTVVFFIRTFWCGQCQDYTLAS
                     ISVLSPEALEKAGIKVVIIGHGSWKVLKAYRRLFKCPFPIYVDGPKKLYSLMGMTKGA
                     PKTAPWGHFWKGRAEYHQRAVPGQLVHGISNALFKMPVKPPGDLTQLGGEFIFSPGSV
                     CEFAHRMTHASDHMEAPEVIRLAGCDHPTVEETKAVELAESQKEELEKLRMEMERWKK
                     ERAAELEGIKMRKAARRGIPYSRSLEIGPQMVQVYDFEYDFEDGLQVAYEEGNEDEAE
                     AVDMGEHWDERFGKVMSPEQQVGRKEEKETFAGIGTRAMETRLRHEARGQQRDDEVEM
                     VSPEGSGNLNVHIGPVS"
     gene            complement(812715..815328)
                     /locus_tag="CNK02760"
                     /db_xref="GeneID:3254691"
     mRNA            complement(join(812715..813469,813528..813668,
                     813726..813771,813838..813942,814000..814279,
                     814363..814495,814572..814660,814760..814858,
                     815032..815328))
                     /locus_tag="CNK02760"
                     /product="Alpha-amylase A precursor, putative"
                     /transcript_id="XM_567873.2"
                     /db_xref="GeneID:3254691"
     CDS             complement(join(812888..813469,813528..813668,
                     813726..813771,813838..813942,814000..814279,
                     814363..814495,814572..814660,814760..814858,
                     815032..815275))
                     /locus_tag="CNK02760"
                     /codon_start=1
                     /product="Alpha-amylase A precursor, putative"
                     /protein_id="XP_567873.1"
                     /db_xref="GeneID:3254691"
                     /translation="MLVPFSISLSILPLLLTSLSSSALPQSELRHRSVYQLLTDRFAR
                     PDQQIAPCDVAKKEYCGGGWKGVEQRLDYIKGMGFDTIWISPIVANIQLDPGARSFHG
                     DPYHGYWGSNIYELNHHFGTPQDLLDLSQALHNRGMYLMVDVVANHVGAQDHVSFVPS
                     SDYGPFSSPSDFHEYCQPDWDVQEEIEQCWVGSQTPDLNTESPHVISTLNTWIHHLVS
                     TFQIDALRIDTVKHVRKDFWKGFIESAGVACLGEVLNGDPTYLALYQREAMGSIFDFA
                     TYWHIQRAFQSPLGSISELVNMIKLLHRLFPDPSSLGSFLDNHDFPRFAGKTDDQALI
                     RNAMVYPFINDGYPILYSGQEHNLQGGDDPYNREAIWLFGYDESSPTYNMIKSLNNAR
                     RIASSSPSFPALLRPFQHGNHTIVMSKAPLLSILNNHGSSSCHITGGARAIPMHIPPS
                     QTGYKGLLPVINVLTGRIYSTDPYGGLTITIVRGEPLVFIPLILYHSPNPVEVPDSEW
                     KGVLINEKGKGKRSGKDGEGDEDRPEMTRRWSPAGPWSPRMMSGFGGWMGWWRGWGSG
                     GGNGDL"
     gene            816139..819484
                     /locus_tag="CNK02770"
                     /db_xref="GeneID:3254689"
     mRNA            join(816139..816316,816388..816607,816667..816752,
                     816803..817749,817797..819484)
                     /locus_tag="CNK02770"
                     /product="beta-1,3 glucan biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_567874.1"
                     /db_xref="GeneID:3254689"
     CDS             join(816440..816607,816667..816752,816803..817749,
                     817797..819079)
                     /locus_tag="CNK02770"
                     /codon_start=1
                     /product="beta-1,3 glucan biosynthesis-related protein,
                     putative"
                     /protein_id="XP_567874.1"
                     /db_xref="GeneID:3254689"
                     /translation="MPFLQSISSLFSGNSSKSNPNRYNNRRSVMDSTRDAFSLPTTNA
                     GNIHYGNGYNDGPQLDSASSSPGPSRRNSNAYNNNYPPRDFSANPNSYPPLTHTFHRL
                     RKTLAGSFPELLETLNPPVNPTLLATFEAEIGCPLPRSVRESIQVADGQDLETTGNIS
                     GSGGLFFGLYFLPLEEVMREWAFWRYAEDDPTVGGNPAILATMASVPPQWIKTVYACK
                     GWIPLLSDRTGNYVGVDLDPGANGAWGQVIVFGRDFDRKCVLWNGDGEGGWGKWLAAF
                     VDELESGEGWEADKAASSDEEEEIGYSSYNGGGTYGEVGSGLRLAGQYRGWNVLEAWW
                     DRSVRKWESLGLGLDIEEVERGLEEARRLTGYGVSETEGKGKGKGKGREGTNGNTSNS
                     NSPLQESLGGSQHLAAVPGTPVTRDSDVLLPPSSPEQPSIPKIRHPSPSPVRVITPVT
                     STIDHPLKPGPPSTVSGSGSGSGYLSPPTHSPSRRKRAPAPAPTPIDLPTRADIQAMS
                     AIAQAETSGLRGGWVMNLDTSVGSAARRASRLSSLGSGSQGRGSMDAEMVDIDLEGGR
                     AVPFGSPNMTEDELERQREEERMAHAGLEHRRSPVMLNSRTPSPLARSPHSSHSPLSP
                     HSPSFHSPHSPYSSRPPSFETRTAIITTEDPSREKTPKASLRSPNAPSPLDVTAIPQS
                     VLDATSMIRPPPPVANNSSLTIRGYDGEERDRSLVRANSGASNGQRSPRPERSGTTPI
                     PGSGPTQQRSMTRGQRESSVISTDSHDGLLESVSYRRSVSPVSVSDASALEGEEVMES
                     PSTIKSMESENQIKERKTGIEEGFQEVSL"
     gene            complement(821104..821615)
                     /locus_tag="CNK02775"
                     /db_xref="GeneID:36393110"
     mRNA            complement(join(821104..821205,821266..821281,
                     821344..821445,821503..821615))
                     /locus_tag="CNK02775"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658814.1"
                     /db_xref="GeneID:36393110"
     CDS             complement(join(821169..821205,821266..821281,
                     821344..821445,821503..821599))
                     /locus_tag="CNK02775"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514648.1"
                     /db_xref="GeneID:36393110"
                     /translation="MSYPPTTTYQHPTQPSIDAPVVAKQPISQRVMDIRNAGSRESIQ
                     EKQQDEEVMRLRGGCPGHLCGLPILPCRCDICIIPIPCC"
     gene            821879..823421
                     /locus_tag="CNK02780"
                     /db_xref="GeneID:3254683"
     mRNA            join(821879..822081,822137..822221,822292..822413,
                     822468..822665,822718..823421)
                     /locus_tag="CNK02780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567875.2"
                     /db_xref="GeneID:3254683"
     CDS             join(821969..822081,822137..822221,822292..822413,
                     822468..822665,822718..823378)
                     /locus_tag="CNK02780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567875.1"
                     /db_xref="GeneID:3254683"
                     /translation="MAQRTTSLSGSSRLSLSVDKIPAATQISVAGRHPLRQDWSISYV
                     HRPPNAKVDYEKEIRRVATFGSIESFLHLYSHLTPVNELPPVTDVLVFVSRIGRPGVW
                     EEMRDGGRFTIRLVHPIVPVLYESLLFSLIGDQFDEADNVVGCVLSMRQAEGILSVWV
                     EDEGENVRNGSLRAKILSLLNLPPSTTCDYRANRTLLENANKPAYISTNSTNNVNGIS
                     TNGEGGGHGHGHGHGHGHGGRGDRGEREHEGGNPGGERRTHGTGRERGERIGGDREHE
                     YHPRPHGGRYDHHHHERPHRERSERAERMSAVAAGSTGGDRPERPDRERGEHAHSNVG
                     GQGHERVGSSHWGTTGGFRDRESQPGQRRTVVTPGAAAAAGLPAAPGAAAPGNGAGVW
                     "
     gene            823454..824693
                     /locus_tag="CNK02790"
                     /db_xref="GeneID:3254678"
     mRNA            join(823454..823710,823828..823880,823965..824122,
                     824229..824332,824435..824501,824564..824693)
                     /locus_tag="CNK02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658092.1"
                     /db_xref="GeneID:3254678"
     CDS             join(823880,823965..824122,824229..824332,824435..824501,
                     824564..824584)
                     /locus_tag="CNK02790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513783.1"
                     /db_xref="GeneID:3254678"
                     /translation="MPLNIDHFQIHHPYVNPQELPFPTTTLPGGGRAAIYPAVKTRWA
                     GPNVGFGAGLMGMPHPLGTPLAWEVGTGIDNTAAAWRRYYGLGGLLTGYPLHYRLPGR
                     PGLGGYFGGWEIRD"
     STS             824842..825736
                     /standard_name="Xba7"
                     /db_xref="UniSTS:470701"
     gene            825225..826591
                     /locus_tag="CNK02800"
                     /db_xref="GeneID:3254548"
     mRNA            join(825225..825383,825442..825585,825634..825726,
                     825796..825873,825931..826194,826263..826382,
                     826437..826591)
                     /locus_tag="CNK02800"
                     /product="expressed protein"
                     /transcript_id="XM_567749.2"
                     /db_xref="GeneID:3254548"
     CDS             join(825303..825383,825442..825585,825634..825726,
                     825796..825873,825931..826194,826263..826382,
                     826437..826499)
                     /locus_tag="CNK02800"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567749.1"
                     /db_xref="GeneID:3254548"
                     /translation="MRFVALSNENSSSQKSVTTNNSNSHCHPQPSVNDSLVIEGMITC
                     LQNQLVLNNKLFEKFLIADEARQSRYEKQLAAQDSELQDLRDRLDKLENARFLMESSY
                     EQESFTHKGRVYELENQIIGLKARERGREQQKDYTVSQLKQQQKAFEDQLEAQRKGFE
                     ARIREQQEGFEARIRVQHEELMGRLKMGQKEVMARMEKLESAAAIVKEPKPKKSVNFS
                     EMATVRTFNPPQYASPNLGKQISDDMECSGASGTSARSSALVRGASFATARSVVPAKA
                     KMKT"
     gene            827415..831359
                     /locus_tag="CNK02810"
                     /db_xref="GeneID:3254510"
     mRNA            join(827415..827720,827781..828171,828232..828666,
                     828733..828869,828933..829027,829091..829371,
                     829426..829769,829834..831217,831274..831359)
                     /locus_tag="CNK02810"
                     /product="expressed protein"
                     /transcript_id="XM_024658093.1"
                     /db_xref="GeneID:3254510"
     CDS             join(827535..827720,827781..828171,828232..828666,
                     828733..828869,828933..829027,829091..829371,
                     829426..829769,829834..830436)
                     /locus_tag="CNK02810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513747.1"
                     /db_xref="GeneID:3254510"
                     /translation="MVSIPRGRPNPSPISSNTSREDRGNSACSDVSDGNNNSPKKRRR
                     NEDSVPKALQACDRCRTKKIKCHPAESSEFCHSCTIASLSCTYDLPITASRTKRIQRG
                     LSTHPQTSQQLPSFSSGQADVPPPNTAEHVLFDPETMASHGPVETHQSRDTNASERRE
                     IESQFTTGVALRRRGRTVGLTQGRASSSVRREGATALSYILHSTPTLPVASLSEFDRA
                     NGLSMCFSSSDTSMDGDGFMLITTECTTFETIDDQAVEPPPYVFEALHSPSWKEVINR
                     LAMTFIDHISPFIPVVIRTEMGEVGQLVLYAMAGVAAARRDCPKEIFDCLRYIIKQEI
                     HDRDALSNPTRENVQILLTTCLVDELALDCGTAAPPSVQRTRLSAAICMARDLNMDQP
                     ARGTTLGESNARIWQCAVIIDQWNAARYGVRPLILDFLSSSSSATISRDLTDNKFFQH
                     LYSLSAILRRIIDKVYGVEGLKNTEDEDLLQIAEEVSRWKKELHRDLHFTGDSSSLPS
                     GILHILHTAIMILLYRPFMRWSFIVPQSLSLDLNLEVWTLICPAARSSLEWAANREDP
                     FEFLFFGPYALGLSCLIQYHSYARRREWDGVVVLERLLMNGIGKWAPSWAHLPLQAAQ
                     LSVVQLLYSSTQRTLPSSFHHPNTSARGLNPTPGIFNRLPETAVNGITFLRDPSHPEG
                     GVLVATRQAAREIKDLPPGTVIIGGPLSPEEMDGDPVVSGRTQTRPVGGNEVEMSLSN
                     GGGEVVPVDDGRGMTGMMPLTNIPGLSALPNSESATVLDSFARLAGSQFANHYMPDLS
                     VDGAITSASTADWEAIVSSLTYPGF"
     gene            complement(830413..833238)
                     /locus_tag="CNK02820"
                     /db_xref="GeneID:3254679"
     mRNA            complement(join(830413..830701,830750..830820,
                     830880..831207,831263..831328,831378..831870,
                     831937..832161,832222..832311,832374..832803,
                     832877..833238))
                     /locus_tag="CNK02820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658094.1"
                     /db_xref="GeneID:3254679"
     CDS             complement(join(830553..830701,830750..830820,
                     830880..831207,831263..831328,831378..831870,
                     831937..832161,832222..832311,832374..832803,
                     832877..833112))
                     /locus_tag="CNK02820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513784.1"
                     /db_xref="GeneID:3254679"
                     /translation="MRTSASFLIVFAAAISLAAPYQQKTFNNGALSSSGAFSENTGLP
                     WQDVVSIPIIDTWTLNPAGDASVIRTATIDVETDIPSYDLHLLAINAQYTVPTALHGP
                     THPAALYSFITNDIFVTLLPSQSSFGSWDLTLQVLNYTTLPPAWAPTASEPTILKTVR
                     LGNRRPESMLYSAGPKILSIVLGGGSKDEFAGSLGPLTLLSISKLDEVWTVEQLTVFL
                     ENDLIIDELAANDSAIAFTAHKPVIRPNNATRSILYFLDLFSPSFAVQISSGSFGAVF
                     SPALSSNGQIAWLEQRDNGNWGGRKDLWMYDGHTPWKVPFKDWDLSPSRVIFSENSEA
                     LNLLTLNDQDTSLFHIWTPTRSSPPSTPVRIPSNGTIHSVYHVGITPLDHSHLIGVMS
                     SLTSAHELWVISHSPHDDPTYNYENIRLTYFSEPVLQGRQLNAGESIEFVNELGLTVK
                     GKVFLPSKNKSQEKVPVVLLLHGDGNSEGWRNQWMQYWNQNALTSEGYAVVTINPTGS
                     EGYGNYFAQSGRFNWGNQTINDISRGLFHSFNLFPNLNNTSVTAMGYGAYGGFVIHWI
                     QGHSTAFVASNGEPVRWKGLVVHDGVLSPRWWAAETSCPAKVEWEFGEVSYDDESPFS
                     LWDPERSSREWAIPELVIHDGRNDCDAGPLSQSYASFALLQSRGVNSEILVSDRWAFS
                     KWHRAIFDFLESL"
     gene            complement(833414..834521)
                     /locus_tag="CNK02825"
                     /db_xref="GeneID:36393111"
     mRNA            complement(join(833414..834091,834143..834269,
                     834323..834521))
                     /locus_tag="CNK02825"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658815.1"
                     /db_xref="GeneID:36393111"
     CDS             complement(join(833479..834091,834143..834269,
                     834323..834404))
                     /locus_tag="CNK02825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514649.1"
                     /db_xref="GeneID:36393111"
                     /translation="MSHQFSINNLFSVNGLDVLITGAGTGLGLYMAKGMAMNGAVTHI
                     AGRRREKLEEAKVTILELNPEAHVHIHVADISDRPSITSLVASLSKLDVLINCAGIVL
                     PDTPCNQFTPLPELQAALLASPHETWSRTFSTNVESLFFLSASALHLLAAAPAGGRII
                     NISSIGSTMSDPVISQPAYQASKAALNHLTLLQASKFREHGIRVNAISPGYFPSQMND
                     PSNPKSMLARAHELVPLKRGGKEEDIAGTAIWLASQAGSYVDGQVIVLGGGREWA"
     gene            834668..837362
                     /locus_tag="CNK02830"
                     /db_xref="GeneID:3254676"
     mRNA            join(834668..835114,835188..835333,835389..835533,
                     835584..835681,835739..835945,836007..836237,
                     836287..836606,836671..837362)
                     /locus_tag="CNK02830"
                     /product="multidrug transporter, putative"
                     /transcript_id="XM_024658095.1"
                     /db_xref="GeneID:3254676"
     CDS             join(835027..835114,835188..835333,835389..835533,
                     835584..835681,835739..835945,836007..836237,
                     836287..836448)
                     /locus_tag="CNK02830"
                     /codon_start=1
                     /product="multidrug transporter, putative"
                     /protein_id="XP_024513785.1"
                     /db_xref="GeneID:3254676"
                     /translation="MSERTPLVPKISQKSSGFLSNLDYVLILPALLSNNFFAAFESTI
                     AASTQGAVGTEFNSSDHVAWVAISYLTVSTAVQPLYGRASDLFGRTRLYVLSLAVFAL
                     GCLGCGLSNNLGQMIAARAICGIGGGGLITVSQVCAWDVLPMRLRPLYQAANNVTYGL
                     GAALGASLGGILSDSIGWRFAYFFPVPLTIFSIVVFLCRASPKLLEIQAGKTNSFQKK
                     DIDSLGSVLLMTSITLFMLVINLGGSTIPWSSSANPILLVFSVITTLAFFQHEKRVKL
                     PVLPINLLTNRRMVPQVGLNLFGAMTIFGTLYLIPVFFQTTLLTSASVASRRLLYPTL
                     TAPIASIVTGIFLHCHRRATARSY"
     gene            complement(837442..839152)
                     /locus_tag="CNK02840"
                     /db_xref="GeneID:3254674"
     mRNA            complement(join(837442..837683,837748..837887,
                     837961..838021,838078..838291,838343..838609,
                     838669..839152))
                     /locus_tag="CNK02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658096.1"
                     /db_xref="GeneID:3254674"
     CDS             complement(join(837544..837683,837748..837887,
                     837961..838021,838078..838291,838343..838609,
                     838669..838992))
                     /locus_tag="CNK02840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513786.1"
                     /db_xref="GeneID:3254674"
                     /translation="MPIATETYPIPPFDRPVPTTEDLDWADLTELPLDLFYDPKGRAQ
                     LVESVKHALEVDDLGFWSVTNAGFSDEEIDHQFAIAQAFFNLPIEERKSNAIDAKNGG
                     YLGYRAPYERTIADTDVLDNMELVNIPKYTDDYKDYPRHDIFKSHETVIADFHRKCWQ
                     QIAKPLFVLFALAMELPENYFVERHEYNKPSQDHLRYMQYHPRTPEDDAKCNNLWSWA
                     HTDYGSLTLLFSQTVSGLQVKFSDGTYHDIKYKKGSVIVNIADTLSFMTKGYLRSTIH
                     RVTVPPGIQSSIHRIGVLYGCRPNDNVPVITAPSPLLERLGLISDADRNAKEEDAVTA
                     GEYVAARVKAVHGSNTYGTAPGTKFTHKNLEVLENFADTSSGKKGAI"
     gene            839347..841742
                     /locus_tag="CNK02850"
                     /db_xref="GeneID:3254673"
     mRNA            join(839347..839803,839862..839948,840008..840256,
                     840319..840407,840466..840853,840906..840952,
                     841016..841094,841152..841742)
                     /locus_tag="CNK02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_567880.1"
                     /db_xref="GeneID:3254673"
     CDS             join(839636..839803,839862..839948,840008..840256,
                     840319..840407,840466..840853,840906..840952,
                     841016..841094,841152..841550)
                     /locus_tag="CNK02850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567880.1"
                     /db_xref="GeneID:3254673"
                     /translation="MFDHQQMTEEEIALERKVVRKVDAILLPIMLVSYGLQYYDKSVL
                     GTAAVYGIIKDLDLQTTVNGVVSTTRYSTATAAFYYGYIVGVLPIAFLFTRLPLAKAT
                     AFFVIIWGLVCILTVVCTNYPGFTAQRVLLGICESAVSPAFVAICALWWKPQEQAKRI
                     GVFYSATGVFSMFSSLVNIGLGKTGGTHPWKSMYYFVGALTIFWGFVILLILPDHPLR
                     PGRWFTAEERTVLARRFAQNQAGASQQPIKPYQILEAVSDIKTWLYLLMAASIYICNG
                     SVTAFGAKIITGLGYTSLQATALLVPGGAMTVITIAIFSYLADKYTNIRTLLLPISCI
                     PVVVGAIVIWTAPWKPTAGPLIGYYLVASFGAPYVLLLTLASSNTAGATKKAVTTGFI
                     FIGYNAGNIASAYLVFAKEATIKYRSTWISVIVGMAFASAASLVLRWLYVRENKKRDK
                     EELAGKQSELSTEPDEEKGAPKGSVDSLDGLATLLVSDRSDKKTPGFRYTL"
     gene            842702..844020
                     /locus_tag="CNK02860"
                     /db_xref="GeneID:3254632"
     mRNA            join(842702..842875,842926..843153,843203..843453,
                     843504..843747,843797..844020)
                     /locus_tag="CNK02860"
                     /product="2,4-dienoyl-CoA reductase (NADPH), putative"
                     /transcript_id="XM_024658097.1"
                     /db_xref="GeneID:3254632"
     CDS             join(842785..842875,842926..843153,843203..843453,
                     843504..843747,843797..843813)
                     /locus_tag="CNK02860"
                     /codon_start=1
                     /product="2,4-dienoyl-CoA reductase (NADPH), putative"
                     /protein_id="XP_024513787.1"
                     /db_xref="GeneID:3254632"
                     /translation="MFSIDYSGKIVFITGGGRGIGLALTEAFAEAGATIVVTYNSRDP
                     SEYVQAVSKKFRVPIHVYHCPAEDSKRIDEVIELASREVGEVDIVIANAGMSQWVEMI
                     DMKDADLHKMFDVNLVAPLFLARAFTRHWLGLPATISENDTAQGSRKDVVKLNKRIVF
                     IASISGLVNMSPQYQVAYNASKAGLAMASKSLAGEWAKYGITVNSISPGYVSTDMIKN
                     PPPGEGERWVARWNEMTPVGRFADPKEIGDTLVLLCSDKASTFMTGHDLVIDGGYTTY
                     "
     gene            844660..848067
                     /locus_tag="CNK02870"
                     /db_xref="GeneID:3254623"
     mRNA            join(844660..844963,845025..845054,845101..845186,
                     845279..845438,845489..845984,846073..846325,
                     846375..846586,846637..846721,846773..846839,
                     846891..846950,847003..847499,847554..847865,
                     847918..848067)
                     /locus_tag="CNK02870"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_567882.2"
                     /db_xref="GeneID:3254623"
     CDS             join(844766..844963,845025..845054,845101..845186,
                     845279..845438,845489..845984,846073..846325,
                     846375..846586,846637..846721,846773..846839,
                     846891..846950,847003..847499,847554..847865,
                     847918..847975)
                     /locus_tag="CNK02870"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_567882.1"
                     /db_xref="GeneID:3254623"
                     /translation="MSSSGEPSETRQRLDRNRRRSTSSDRSAPAQNGKKAKTTEESNQ
                     SNEKNNEDGSRPNEDPVASSRSCKECRRLKRKCNRQLPCSVCTRFGKKCAYATEPLRK
                     NQEYIMGLERKVDYLQHLLETSHSSHGGGVPPARSDQGLNVGSPASQSQSLHSEEHVV
                     PMRQPPLLPIQYQPSPAPTRIPMRPPLLAGQTHLSTARTPETRSFTPSHIPSYELSTA
                     PGSASSSSAIMRPESMPTTDNAARPLINGAENPNISSSSTMGPSHSMATIPVDFKYDL
                     PPASEVLERQPSSVSGYEWNERWATKGLGGNDGYASLSIEPDGQGYLGFASGSTLLRI
                     LQLCAGSVSLASLESDLSAAPPPPRPQGWTPTMSETVSCVDAYFEHYHPQYPLLHEPT
                     FRAQWNDLVPQPLASEWDFLLNIVLAIGAFCVSRPTYVIDYFLEAAISQLSVEYLEKG
                     SLTLVQAFCLLSNISQKRNKPNSGSVYMGIALRLAIGLGLHRELPFWNISPFDREVRR
                     RTWWVVVSFDSGSTITFGRPILEPHYPAESDVYMVHNVHDRAFTPAARLPPVEVNEPT
                     IYTALINQASFHASTNRIYTRVMSSPAPSATETLALDSDLLSWYATVPEHLHPQNEPV
                     SPHWLEFAQYKMFWRYCNLRIILHRRAFLERALKALPLWVTDEDIEDDDNTVAEIKCT
                     RLCQYNASDTIHSMSRFFSMHQRMSRLESWYGLHFLFHASFIPLIALHVDPNSLRRPV
                     WEEEVSLAREILVSLKDDPLVGRCLSIIDALVPHTSSTSIGPGQMGFQDTSTMLYEML
                     QSNPSWQNSLDVPDDDLAPNLLPVADLATLSSLWPYRSS"
     gene            848101..850267
                     /locus_tag="CNK02880"
                     /db_xref="GeneID:3254654"
     mRNA            join(848101..848851,848914..849125,849183..849378,
                     849428..849683,849736..849792,849858..849923,
                     849975..850267)
                     /locus_tag="CNK02880"
                     /product="L-iditol 2-dehydrogenase, putative"
                     /transcript_id="XM_567883.2"
                     /db_xref="GeneID:3254654"
     CDS             join(848586..848851,848914..849125,849183..849378,
                     849428..849683,849736..849792,849858..849923,
                     849975..850124)
                     /locus_tag="CNK02880"
                     /codon_start=1
                     /product="L-iditol 2-dehydrogenase, putative"
                     /protein_id="XP_567883.1"
                     /db_xref="GeneID:3254654"
                     /translation="MCSSHATAVESVSPAPRKSQYEVKYDPDLVLKSAEFKELKQGDK
                     ELEDPKANLACAYDEKHNVKMINKPIPKARQDEVVVHIKATGICGSDVHFWKHGQIGP
                     TMIVTDTCGAGHESAGEVVEVGPGVEQWKVGDRVAIECGVPCGQASCGPCVTGRYNAC
                     PQVVFFSTPPYHGTLTRYHAHPASWLHRLPDNLSYEEGALCEPFAVALAALERAGNRL
                     GDPVLICGAGPIGLVTLLASHAAGCTPIVITDLQASRLEVAKKLIPTVKTVQIERSWT
                     SKETSEAIKEAAGTGIRVAIDATGFESSITAAIYSVVFGGKVFVIGAGPSEQKYPFGY
                     CSANEIDLQFQYRYAHQYPKALRIVSGGLINLKPLLTHTFPLNKAVEAFHVAADPTKG
                     AIKVQIID"
     gene            complement(850237..852166)
                     /locus_tag="CNK02890"
                     /db_xref="GeneID:3254598"
     mRNA            complement(join(850237..851023,851077..851893,
                     851954..852166))
                     /locus_tag="CNK02890"
                     /product="expressed protein"
                     /transcript_id="XM_024658098.1"
                     /db_xref="GeneID:3254598"
     CDS             complement(join(850676..851023,851077..851893,
                     851954..852147))
                     /locus_tag="CNK02890"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513788.1"
                     /db_xref="GeneID:3254598"
                     /translation="MATPTCQIPNKGKENPVATIHGNSKTIRAQSKMEKSAPKQASSD
                     KSGLSKDVQKAVLASPLTIPWPDIPRHLQTTLVHLLRELIPSDVADYHVSRARCYSKE
                     KRVRRAQKSKEAKAASEKSGSSNKVDQEPAGKAADEDAEMKDPESATGQKRKRSSNDL
                     ESEIKRPERPEVLSHLVLGINEVIKSLEHQIGALKTQIMTMGDALNGDQPGKLNANNF
                     LPTAPRSPSPSSSDDEATEGQLRPILSPSAPINFIIIPLLSINPQSLVSPILQYCATY
                     NAHVYQHTQLAKILRTRLKKSQWADVTGDDREEVAVVPLGAVEKDLADMVGLRRLACL
                     ALRKSHPNIERVRTLLPKSILHPPRFSLTLPIPTSTLKVHTCATPSVSKSETSKENGA
                     PIPHVHYVPLHVKGIQTKVPVDNASRKAKRLQEVRLKRAEAKIKKKESKEKAKKAAKK
                     KN"
     gene            852384..853945
                     /locus_tag="CNK02900"
                     /db_xref="GeneID:3254590"
     mRNA            join(852384..852554,852730..852829,853092..853318,
                     853372..853945)
                     /locus_tag="CNK02900"
                     /product="ribosomal protein 22 of the small subunit,
                     putative"
                     /transcript_id="XM_567885.2"
                     /db_xref="GeneID:3254590"
     CDS             join(852522..852554,852730..852829,853092..853318,
                     853372..853404)
                     /locus_tag="CNK02900"
                     /codon_start=1
                     /product="ribosomal protein 22 of the small subunit,
                     putative"
                     /protein_id="XP_567885.1"
                     /db_xref="GeneID:3254590"
                     /translation="MVRVSVLNDALNNIVNAERRGKRQVLIRPSSKVVIKVLSVMQKH
                     GYIGEFEIIDDHRGGKVVIQLNGRLNKCGVISPRFNVPVDSIENWVAQLLPARSFGKI
                     ILTTSAGIMDHVEARNKHVGGKILAFVY"
     STS             853498..854304
                     /standard_name="Pst27"
                     /db_xref="UniSTS:470700"
     gene            855188..857422
                     /locus_tag="CNK02910"
                     /db_xref="GeneID:3254621"
     mRNA            join(855188..855306,855369..855411,855474..855484,
                     855540..855555,855610..855690,855742..855753,
                     855808..855994,856054..856158,856214..856272,
                     856323..856354,856402..856502,856562..856659,
                     856729..856919,857001..857071,857127..857422)
                     /locus_tag="CNK02910"
                     /product="aryl-alcohol dehydrogenase, putative"
                     /transcript_id="XM_024658099.1"
                     /db_xref="GeneID:3254621"
     CDS             join(855279..855306,855369..855411,855474..855484,
                     855540..855555,855610..855690,855742..855753,
                     855808..855994,856054..856158,856214..856272,
                     856323..856354,856402..856502,856562..856659,
                     856729..856919,857001..857071,857127..857141)
                     /locus_tag="CNK02910"
                     /codon_start=1
                     /product="aryl-alcohol dehydrogenase, putative"
                     /protein_id="XP_024513789.1"
                     /db_xref="GeneID:3254621"
                     /translation="MTSENKMRYVRLGKSGLKVSKIILGCMSYGDPEWHEWVLREKEG
                     IEHIKYAYANGINTFDTADIYSCGASEEILGKAIREIDCSREDVVILTKLFMPVTHDS
                     RAPPPPFPDLDKSGYTNQYGLSRKHIFAAVQASLKRLNVEYIDVLQCHRFDYNTPIEE
                     TMQALHDVVQKGWVRYIGMSSCWAYQFHAMQNYAINNRLTPFVSMQNFHNAAYREEER
                     EMIPTLQMFGVGCIPWSPLARGFLTRPWKDSATLRTQSDALYKARGFADPAVAKQRIN
                     EAIEQIAEKRGISMAQVALAWSLSKEYITAPIVGTTSLDKLKDLLAAVNLELTEEEKK
                     AIEEHYVPQEVTGHQ"
     gene            complement(857448..859805)
                     /locus_tag="CNK02920"
                     /db_xref="GeneID:3254567"
     mRNA            complement(join(857448..857749,857831..857860,
                     857920..858003,858088..858258,858314..858375,
                     858432..858811,858882..858960,859013..859028,
                     859086..859368,859433..859501,859568..859805))
                     /locus_tag="CNK02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658100.1"
                     /db_xref="GeneID:3254567"
     CDS             complement(join(857511..857749,857831..857860,
                     857920..858003,858088..858258,858314..858375,
                     858432..858811,858882..858960,859013..859028,
                     859086..859368,859433..859501,859568..859711))
                     /locus_tag="CNK02920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513790.1"
                     /db_xref="GeneID:3254567"
                     /translation="MKDTIAIDASCAAINEVCDHGTNLNTLVIYEPSSEHTDIIQPMP
                     WGAKWRSSAWFITLVVSLGTCTEALTYTIIIPVLPYRLQNTGYSNVSTLTAWLLFAYS
                     MGILFCTLPVAYFFHRYPFRRIPLVIAIIILELALVLFMLVNPFWAMVLSRFLQGASS
                     TVVWSVGFALICENVDEEHIGRQVGFAMAGVSIGTTVAPPIGGVLYSKLGWHAPFIFC
                     IIICFIDLIMRLFVLERTDLRKWEERRLNLAPGSLQPKVVNGEVIMPAQAETSPFIHL
                     TTAEKARLSGVELSPWQVLVALASSPRGMTSFIQMFAYGTIIGALEPTLTLHVQSLWG
                     KDSDFVGLIYLAAAAPTFFCGPIVGALADKYGAEWLMLPAMVLTLPWLPLLLLKKSLS
                     AFIVFFAFSDIFPNCAMAPTGLEVTMVARNIDGVSEIHQFAAMNIAFAISSAIGTIVG
                     GQMYDHVPNGWAATIWFCFGMAVVVIPFLFFFAGNRSLYQRLLHIRKKKGEDVEMEEA
                     KGISKRDYTG"
     gene            complement(860348..862645)
                     /locus_tag="CNK02930"
                     /db_xref="GeneID:3254719"
     mRNA            complement(join(860348..860739,860799..860940,
                     861000..861246,861310..861514,861581..862645))
                     /locus_tag="CNK02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_567888.2"
                     /db_xref="GeneID:3254719"
     CDS             complement(join(860397..860739,860799..860940,
                     861000..861246,861310..861514,861581..861684))
                     /locus_tag="CNK02930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567888.2"
                     /db_xref="GeneID:3254719"
                     /translation="MWKALQSSFKLKLFTRTMPQQLKFQDISVPVPGFGCMGFSQSYG
                     PADDNVSKVTLKKAVDLGCTFWDSAVVYGKGHNEKLLGEFFKESGARDKVFIASKCGF
                     DCLEPGSEGLGNVTNKASHINKYIEGTKERLGSYPDLYYLHRIDPDTPLEESIAALDG
                     LRKAGKCKYIGLSECGVATLRKACSIAKIDALQIEYSPWFTDHEDNGLIDAAKELGVN
                     IIAYSPLGKGILSGKYRSPDDFPENDIRRTIPRFSKENMPKNLQIVDEFVKLAKAKGC
                     TSGQIALAWVISQGAIPIPGTKTSERLEENFAAGKIELSETEIAEIRELVQRAKPVGA
                     RYGEAALKMVGH"
     gene            862004..863590
                     /locus_tag="CNK02940"
                     /db_xref="GeneID:3254501"
     mRNA            join(862004..862336,862390..862608,862665..863114,
                     863176..863590)
                     /locus_tag="CNK02940"
                     /product="alcohol dehydrogenase (NADP+), putative"
                     /transcript_id="XM_567889.2"
                     /db_xref="GeneID:3254501"
     CDS             join(862222..862336,862390..862608,862665..863114,
                     863176..863495)
                     /locus_tag="CNK02940"
                     /codon_start=1
                     /product="alcohol dehydrogenase (NADP+), putative"
                     /protein_id="XP_567889.1"
                     /db_xref="GeneID:3254501"
                     /translation="MVADNEFKGWAGLDEKACDGHMSFQEFTPKKWDEDDVDVKILYC
                     GICGSDVSSLTGEWGPVKDICPQVCGHEIVGEVVRVGTSPENGLKIGDLVGIGAQSDS
                     CRECEWCKEGKENYCATQTITFNYPYNRGPNGKGSIARGGFAKYWRGPSKFAVPLPSG
                     LEPDVAAPMLCGGVTVYSPLARFEIGTKRKRVGVIGVGGLGHMAILFAKAMGAEVTAI
                     SRTDAKKEDAFKLGATDYFATGGDLQEAVKARTRSLDFILCTINPESFSISDYLPLLT
                     PAGVFCIVGVIPTPLQVPAFPLIMNSACVAGSNIGSPKEITEMFEFAVKHNIKPWIQK
                     WNFDDINKALPSFQKGDPRYRFVLVNADNGGKL"
     gene            864011..865400
                     /locus_tag="CNK02945"
                     /db_xref="GeneID:36393112"
     mRNA            join(864011..864400,864465..864854,864920..865061,
                     865137..865400)
                     /locus_tag="CNK02945"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658816.1"
                     /db_xref="GeneID:36393112"
     CDS             join(864055..864400,864465..864854,864920..865061,
                     865137..865338)
                     /locus_tag="CNK02945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514650.1"
                     /db_xref="GeneID:36393112"
                     /translation="MPRPTLKTFLLLLFYPLFILLHLTFSVFSLLLRIYQALTTSLSS
                     TIDIEHVLPPKHIGLVLVPTLRSGGVRWRAGGVSGKDRRKREREGLVESVRRVVEWAG
                     ERGVQEVSVWDGQGLTQSALPIFLRTLSSTSTLPPSPPLSPPTEPTQDTSSLSTESTK
                     SNERRERREPVISPTHTRRPSSEFIVGAGVTSITVWPGGKGREMAIHLLPPSSSAPAI
                     ASLTRSYAAEQVPLEDITVKRVDEDMRQHLHFTNYPDLLILHQLSPPPFYSALLPRRA
                     PELWGYPFWALRITEIYQHPTPIPFLHHLTPLITALRTSALPFVRKIGHSISIPDRPA
                     EEVLSRDEWDGAMRAWVKVEQRLGR"
     gene            complement(865430..866614)
                     /locus_tag="CNK02950"
                     /db_xref="GeneID:3254500"
     mRNA            complement(join(865430..865708,865761..866142,
                     866197..866528,866582..866614))
                     /locus_tag="CNK02950"
                     /product="endopeptidase, putative"
                     /transcript_id="XM_567890.2"
                     /db_xref="GeneID:3254500"
     CDS             complement(join(865595..865708,865761..866142,
                     866197..866528,866582..866596))
                     /locus_tag="CNK02950"
                     /codon_start=1
                     /product="endopeptidase, putative"
                     /protein_id="XP_567890.1"
                     /db_xref="GeneID:3254500"
                     /translation="MAISNHPALWKQPAPANSAFNDYNTFPLGQTQRHNTSSHHGPMS
                     HTQQPLVTGTSVLGIKFDKGVMIAADNLGSYGSLARFRDIQRLHPLGKHTLLGVAGDM
                     SDYQWLKRELDGLLREESALSLTDSHPSLSPSNIYTLLSNLFYARRSKVDPIWNAVLV
                     GGWDDTKKESFLAYVDLLGTTYSAPTLATGFGAHLAQPLLREAYEAKAGIDGKGPLLT
                     QEEAEKLIDDCMKVLFYRDARSINKYQVATITDEGVKISDSRSAPTEWKFAEGLRGYG
                     AQTQ"
     gene            866762..867826
                     /locus_tag="CNK02960"
                     /db_xref="GeneID:3254375"
     mRNA            join(866762..866836,866884..866968,867024..867082,
                     867148..867414,867500..867826)
                     /locus_tag="CNK02960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567891.2"
                     /db_xref="GeneID:3254375"
     CDS             join(866801..866836,866884..866968,867024..867082,
                     867148..867414,867500..867661)
                     /locus_tag="CNK02960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567891.1"
                     /db_xref="GeneID:3254375"
                     /translation="MSEQQFFETITKSFTDVTITERGVDTAEFLEAAEGLVKIFNLFG
                     NPAFAVVQNDLTGNIAKIRAYLAKDPASAATLESLLASEKANIPKAKDRVATDALMWL
                     LRGLKFTSLGLKINLENKDEELSASFTKAYEQSLKKYHGMMIRPVFYLAMKACPYRAT
                     FYPKLGQPQEEVMPKLEAWLKALYEIVEKEEGVFKAGSYGEI"
     gene            867907..873062
                     /locus_tag="CNK02970"
                     /db_xref="GeneID:3254443"
     mRNA            join(867907..868993,869063..869256,869327..870157,
                     870226..870341,870426..870562,870634..870706,
                     870769..871320,871401..871591,871648..871836,
                     871894..872214,872272..872414,872474..872600,
                     872654..873062)
                     /locus_tag="CNK02970"
                     /product="mitotic chromosome condensation-related protein,
                     putative"
                     /transcript_id="XM_567892.2"
                     /db_xref="GeneID:3254443"
     CDS             join(867977..868993,869063..869256,869327..870157,
                     870226..870341,870426..870562,870634..870706,
                     870769..871320,871401..871591,871648..871836,
                     871894..872214,872272..872414,872474..872600,
                     872654..872989)
                     /locus_tag="CNK02970"
                     /codon_start=1
                     /product="mitotic chromosome condensation-related protein,
                     putative"
                     /protein_id="XP_567892.1"
                     /db_xref="GeneID:3254443"
                     /translation="MAEFTLQEHLLALSDPPLYQISAELDIPSLRTSSIDSSLSSAIE
                     EIAGDPESIVNSSPSTFDVFRSILKHADQPNVDSGILTKLLDVIVSGLSYHSSTVMAI
                     VNGQGFGAEADMDAPMVHKQPLEMWAFLLQWFVNAAERGAGKTNDEPRQAMTGRGKKK
                     TTKTAGGAGISTSFVFSDHLPLVLGTMHKTLRIPTSRLWRTSSEREAFISCFVKPAYQ
                     LAETEAYLKISEIRLGIFKVICLAVKFHQHAFGAQTSIMQNLTYFEHLSEPMAELLAI
                     LEKEFDFSQLGEEVLRDVAGKSFAHNDAKGPRSFSRFLVRLTELSPRMVQKQMPLLLA
                     HLDSDAHPMRMAIVEIIGILIKDISSSDEGDEEQKTKQIQRFFELLMERFLDLNSWVR
                     CKVLTTLIKLCDLPAKFPKQRHQITELTIRTLEDKTSSARRYAIQLLCKLLETHPFGA
                     LHGGTLNLQEWQERYEKVAEELKKVDAQELEMAKREVGVEDDDEEGEDDEEQKEDEEG
                     TKFNKEKEDGDKEEDDEAQNESTPKPKKKKPRQSQLDLSAIQSEQASIDPNLITKLRL
                     TKKYYGDALRFINQLESAIPTLCQLLVSTTKTEVLESMRFFRVAYEYDIASAEQGIKT
                     MLHLIWTKDNNATAGEEGEGKGIRGSVIECYRSLYFDVVPDLSPKQQVNRITKNMIER
                     TYGATLAELTSLEELMRTMMGENMVHTDVVNKLWQVYSTEQEIPKAQRQGAIIILGML
                     ALAKKEVVTEKVDKLLKIGLGPLGMQDLVLAKYTCIALQRLSGSAKKVKGSLQDKTMR
                     LPMDNPIFTKLQDIIEFSPKSPQWFSMAEQAVNTIYLLGEQPDRLCTKIIKDLTAKVF
                     EAPEKEMEVEKEKEREEEKNGELENGKLDNGKQEITENGDVSVRADSEPETVDDGETS
                     QTQSQLAPTNEEVALLKAQASSFRIAQMVFIVGHVALKHIVYLELVEREFKRRKDEKA
                     KEKAAAKAAEKDQNDLDAVAGNAEDDIGDLISTMKEKELLYGDKSLLAVYGDLIAHIC
                     ASPKKYKYPSLREAATLSLSKLMCVSSQFCEQHLPLLFKILETSKDPVVRSNIVIALG
                     DIAVCFGNLIDDNSERLYQGLADTDLVVKKNTLMVLTHLILNGMIKVKGQLGEMAKCL
                     EDPDQRISDLAKLFFTELSTKDNALYNNLQDVISHLSIGAHAVDEGTFERTMRFIFTF
                     IEKEKQAESIVEKLCQRFRQATEERQWRDISYCLSLLPFKSERSVKKLIEGLPFYQDK
                     LHEETVFRRFTEILAKARANKASNKPETELQEFERILNEHQAKGLEDQALEADVLRKA
                     KAAKRRAAKRPPAATARTTRRKQVIEEDVEEDEEETPTVDEEEAEEEEAFAPRKKVTA
                     RKAPPRRGGRRKKVVESEDEDEEDEDEDDE"
     gene            complement(873209..875627)
                     /locus_tag="CNK02980"
                     /db_xref="GeneID:3254717"
     mRNA            complement(join(873209..873584,873649..873950,
                     874007..874372,874436..874612,874665..874856,
                     874912..875007,875068..875627))
                     /locus_tag="CNK02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_567893.2"
                     /db_xref="GeneID:3254717"
     CDS             complement(join(873302..873584,873649..873950,
                     874007..874372,874436..874612,874665..874856,
                     874912..875007,875068..875448))
                     /locus_tag="CNK02980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567893.1"
                     /db_xref="GeneID:3254717"
                     /translation="MKEQLFFLSSTVLYLTIPGTPFRLTWFKKTKQFDTPTMSELPRT
                     KTNDTVCTLTSPISGAPSPEKTAVDVDAICKEKKLDSKSIDELSPPSTNTEVHLEAQT
                     QEESSLTKLSPSRKWFLLLVFSVAQYLDVCSVSALFVLTDAIQKDLGIQYEASSWIIT
                     SYSVTFASFLLFWGRVADLYSAKAVFAYGFLGLGATNLVISFMPNQFAYFIFRALSGI
                     AGAATIPSAFRLILALFEPKELNIALTIFGLSGAIANVTGLVIAGFFGFITANDQQAG
                     WRWFFRMMAIVIVPFGVSALTLIPQSAGKLVEQLSPRDKLKRLDIVGCFMMLASIILL
                     ILGITLGASYGWKKPGFLVPFLLSWPIFIAFFIYEARLPESYALIPPSFWKIPNMTLL
                     IVFALGIYPWWCVSQLPLIERFIDYFNEPAIIAALRVFPQGASGLFVAFFVPRLLQKV
                     GSARIPLAGGMFVGAAMYLLIIFNDGKLGSDYWRWLFPAFIIGSGAAMISFLSTNITV
                     MTSVPPEISGVAGAMLQVSLQVGAAISLTVQAGLLTLNPGGMTNYANVQASLWFQFGW
                     LVLNALIIIVFFRQNKMPKISEEEGAGAAFGA"
     gene            876994..879908
                     /locus_tag="CNK02990"
                     /db_xref="GeneID:3254445"
     mRNA            join(876994..877311,877570..877722,877784..877899,
                     877950..878096,878477..879908)
                     /locus_tag="CNK02990"
                     /product="protein binding protein, putative"
                     /transcript_id="XM_567894.2"
                     /db_xref="GeneID:3254445"
     CDS             join(877269..877311,877570..877722,877784..877899,
                     877950..878096,878477..878902)
                     /locus_tag="CNK02990"
                     /codon_start=1
                     /product="protein binding protein, putative"
                     /protein_id="XP_567894.1"
                     /db_xref="GeneID:3254445"
                     /translation="MSIELSPSTQLGFPRPFTSVVKRSLLIHNPNYHPVAFKVKTTAP
                     KQYSVRPNSGRVEAGESVEVHIMLQPLAQEPPPHAKCKDKFLVQSASITPDEEMHSLA
                     ELWSQLEKTNKGAISEQKLKVVYLPAEDGSTNNQGIPEEDEANEASRVEEPAIFSHAQ
                     TSPSHEKPFSPLEQPKSVDTTAPALAPTQPPLPSLSPAAVNSTNSALEQSLAATTSDS
                     EKLAVALKEIESLRAQLEEAKGPQVSGLRKRGMAGGANEPANKPAQAVATAQQQGVPL
                     EIVIGLMVGVFVLTYLFF"
     gene            complement(879127..880039)
                     /locus_tag="CNK03000"
                     /db_xref="GeneID:3254713"
     mRNA            complement(join(879127..879597,879655..880039))
                     /locus_tag="CNK03000"
                     /product="ubiquinone metabolism-related protein, putative"
                     /transcript_id="XM_567895.2"
                     /db_xref="GeneID:3254713"
     CDS             complement(join(879154..879597,879655..880005))
                     /locus_tag="CNK03000"
                     /codon_start=1
                     /product="ubiquinone metabolism-related protein, putative"
                     /protein_id="XP_567895.2"
                     /db_xref="GeneID:3254713"
                     /translation="MRPCPRLLTRKLNYPGHIPLSPAQNALLAVGSGVVGVLDVTRGD
                     LIASLSESTAGIFLPALHEKMKMTPEGRQIMKDRPEITNKTIEKLKELKRGTLGREYV
                     EWLGGGGLEPESRAPVQYIDSPLLAYTMLRYRQTHDLYHTLFSLPPTLPHELSLKVLE
                     FSNMSLPVALLSSVFGPLRLKRKETWTRDWVPWALRTGREGRSLVTVYWEKRWEQGIG
                     ELRRELGVERNDAEGVEARWGGYRKIREVERELRRKGEWVDEPEDW"
     gene            complement(880199..884843)
                     /locus_tag="CNK03020"
                     /db_xref="GeneID:3254716"
     mRNA            complement(join(880199..880634,880697..881153,
                     881208..881437,881497..881583,881638..881661,
                     881715..881808,881860..882041,882090..882162,
                     882214..882261,882319..882416,882466..882926,
                     882979..883010,883067..883210,883262..883544,
                     883585..883715,883768..883911,883964..883978,
                     884032..884108,884158..884214,884264..884843))
                     /locus_tag="CNK03020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658102.1"
                     /db_xref="GeneID:3254716"
     gene            880265..882239
                     /locus_tag="CNK03010"
                     /db_xref="GeneID:3254714"
     mRNA            join(880265..880479,880541..880646,880702..881053,
                     881116..882239)
                     /locus_tag="CNK03010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658101.1"
                     /db_xref="GeneID:3254714"
     mRNA            join(880265..880479,880541..880646,880702..881091)
                     /locus_tag="CNK03010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_567896.2"
                     /db_xref="GeneID:3254714"
     CDS             join(880297..880479,880541..880646,880702..881045)
                     /locus_tag="CNK03010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513791.1"
                     /db_xref="GeneID:3254714"
                     /translation="MSYTSAELLDAFLSTTDDKIIPLTAAGVAAGCKVFGAAILRKSD
                     LSVVVVATNNETSSPLLHGEINCIQHFYALPADQRPLPSECVFFATHEPCSLCLSGIT
                     WSGFDNHYFLFTYEDTRDAFNIPHDIRILEQVFKVPASSELPSEFANRPLYNKSNEFW
                     TARSVAELIEDLEGDEKEAMKTRAQEVKYKYNGLSKVYQDGKGNAGIPLA"
     CDS             join(880297..880479,880541..880646,880702..881045)
                     /locus_tag="CNK03010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_567896.1"
                     /db_xref="GeneID:3254714"
                     /translation="MSYTSAELLDAFLSTTDDKIIPLTAAGVAAGCKVFGAAILRKSD
                     LSVVVVATNNETSSPLLHGEINCIQHFYALPADQRPLPSECVFFATHEPCSLCLSGIT
                     WSGFDNHYFLFTYEDTRDAFNIPHDIRILEQVFKVPASSELPSEFANRPLYNKSNEFW
                     TARSVAELIEDLEGDEKEAMKTRAQEVKYKYNGLSKVYQDGKGNAGIPLA"
     CDS             complement(join(881244..881437,881497..881583,
                     881638..881661,881715..881808,881860..882041,
                     882090..882162,882214..882261,882319..882416,
                     882466..882926,882979..883010,883067..883210,
                     883262..883544,883585..883715,883768..883911,
                     883964..883978,884032..884108,884158..884214,
                     884264..884513))
                     /locus_tag="CNK03020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513792.1"
                     /db_xref="GeneID:3254716"
                     /translation="MSASYNGIEAPIPRDQATDFPIQTFYASTESPELDQKQEDNVDL
                     EKNESTDNVEVKVESIKDPGVELTPNEAFRWNVDGDQSPFPEVAACVPNTDDPSIPCN
                     TVRAWILLTVFVVLFAGVNQFFGLRYPSLTIGYVVCQLLVFPIGRAWEKLPKWVVPLG
                     PFSFYLNPGKFTIKEHALIVICVNLTASTAYAMGSLVAIISPVYWNSDFGAGFSFVYL
                     LTTQALGFGLAGLARRWLVYPAALIWPSSLASTVLFRALHEPQSRSPANGWTITRYRF
                     FVYLTIGAFIWFWFPDYIWTSLSTFAFITWIVPHNQKVNTIFGMNSGLGLLPISFDWT
                     QINYAGYPLTTPFYITCNAFAVVVFFYLFLSPILYYKNVWHSAYLPLLSSSTFDNTGS
                     SYNISRVVDEKLDFVLAKYQEYSPMYISMSYSLTYGLSFAAVTSIVFYTYLYSGKEIW
                     AKFKDAKHGGEDIHKRLMSSYKEVPDWWYGVLTLVVLGLGIFTCRYWDTQLSVWGFIV
                     VCFGMGLVLIVPEGILEGTTNQRIFLNIITELIAGYAWPGKPIANMLVKCYGYNSVKH
                     GMDFAQDLKLGQYMKIPPRTLFWAQIYSTLLATMTQTGVLRWMIGNIKDLCQPTNSDR
                     FTCAGAKVVYNASLIWGTIGPQRMFQAGQVYNGLMYFFLIGPVVTVLVYLVYRRYPSS
                     WVKYINVPVFFNAAGNIPPANTTQYSLWFIFGFIFNYLIRRRAFAWWKRYNYLTQAAM
                     DTGTALATIIIFFALSYNGVKLNWWGNTVGSDTDDAKGTPWLTVPSGSYFGRGPGEF"
     gene            complement(886092..888811)
                     /locus_tag="CNK03030"
                     /db_xref="GeneID:3254520"
     mRNA            complement(join(886092..886705,886764..887912,
                     887963..888811))
                     /locus_tag="CNK03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658103.1"
                     /db_xref="GeneID:3254520"
     CDS             complement(join(886495..886705,886764..887912,
                     887963..888636))
                     /locus_tag="CNK03030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513754.1"
                     /db_xref="GeneID:3254520"
                     /translation="MPQTANVEQNSKPQNHHNTASTDTQGSMPSTMSPTSAPNPEYFG
                     EVQSKWPDFSPASHWTPRLLWSSNAHPTADSAKYQTQRKIVDLDTGVRSDNLMAKKLQ
                     QEEANPASNMTPQAQSLYPPSPFITLSKRHAHSPFENPSATPDEIDYFTERRNFRLKH
                     AMEEDGCGMMSCSAPPTMLTKITGEVWKELPPTLDTKTGSLVLDSQSQTTVGLREAQE
                     VYDRDRYESYAARAIGLETGYRYDQLLRAKLDKPSSQGQSAPTSEHSTHFSRTDLGDW
                     TTRNHTTMPTPSPYQLTTDLQQMRTYFPLLPHSAVPPVPPLNEQLAAAEWQLPVVLSH
                     TDYLPSPQAFLDVSVPAVNHPASIFSPFAGELPAVPQPVIPHPPRMAPCVAQVPSEKS
                     IPPTADQLRDCSQIHIHPDLVAPLPSHPIFFSKVVSTHGELQVSYGISASEDKAGQYH
                     SISATNDGNHPPPNYINGSYPSPSPHHVPPPVMTSHRHSFSVPGQGFYRNDTSPILKM
                     HAHQTEGMHLIGVDVPHPAPQYSYNPLEEGLTSVPPLPKKKRGRPRRSTYPNDLVEKR
                     IGEGRQESRPEECSGQEGLEFGKRFLPKTAIACNFCRLKKLKCNGQRPACSHCKRRSD
                     SECVYQKAPNGRRSSRQRRQKEVNRDIPFTSNVLLPSTGRYSEKPMRQVWAES"
     gene            complement(890002..894254)
                     /locus_tag="CNK03040"
                     /db_xref="GeneID:3254606"
     mRNA            complement(join(890002..891091,891143..891192,
                     891251..891590,891640..891711,891759..892003,
                     892053..893349,893401..894254))
                     /locus_tag="CNK03040"
                     /product="zinc metalloprotease precursor, putative"
                     /transcript_id="XM_024658104.1"
                     /db_xref="GeneID:3254606"
     CDS             complement(join(890517..891091,891143..891192,
                     891251..891590,891640..891711,891759..892003,
                     892053..893349,893401..893488))
                     /locus_tag="CNK03040"
                     /codon_start=1
                     /product="zinc metalloprotease precursor, putative"
                     /protein_id="XP_024513755.1"
                     /db_xref="GeneID:3254606"
                     /translation="MLNLRQWRFWPMRAAWIILVTIVSFTVVDCRSPHPAPLRKITTT
                     SSHLAILPRRANSGINPRYISALPPPPSTLKHSDSIVLSLDLAELLPFELKLLVKPSE
                     HIFHPDAQSVYCNGQKSVTERLIEEDWRLYTGEVVHPSYIDRFATLHAAGAHQPVSER
                     SQVLGSANVMVHDPGNLYGQGAIWEGSFSVNGELYNVMTKDNYQRVKTKKDINAEGVG
                     QMVVFRQSDAYNHEAEITTIPLCSHDSLEYNNLSNPIHNTSSTSDTSSHPFFGTLNSL
                     WKKDDIGGGLTNPSNFINSINDTRGCPNTQQIVYMGVALDCNYVAAYGSPERARIQTL
                     NNWNQISSLYKSAFNISLGLIEIQVQDMACPKTVVEGEEWNIGCDHNISLDQRLSDFS
                     GWRGQRGDDGAGLWHLMTACPTESEVGVAWLGTLCRTDSADQAGSMVSSTGVSTATRT
                     EWSLIAHEIGHGFGAIHDCTSGCSLSGSCCPLTTTTCNASGRYIMNPTTSSTEHFFSG
                     CTVGNVCSNIGNRGILTSCIQTPSARTVISLQQCGNGIVEDGEDCDPGANTTSPCCDS
                     STCKFVSGAVCDPSSSACCTASCQYASANTTCRAAVDDICDYPEYCNGSSPHCPEDRT
                     ASDGTSCGNDGLKCAGGTCNSLDRQCSMAGQSMGLSQACGRKNDRTCMVNCRNPTSIN
                     NCVELQTALVDGSPCGYAGHCYNGTCHPGSWQDTAASWYRQNLRISIPVTVIVAIVVL
                     ILFTIIGCICCSCIRHRRTSQMAQLPSTGDNPIHPPSSASKMSPTASQVGHNPILWGS
                     SGSESLGAPSAVEFGRRDSDYESTDMEQPPLTQVDPYASSLPRHHDSSNAQSVNPTRG
                     EVGLHSWVDDKQWNGPNHGRPETFGRFRLDAL"
     gene            894913..898332
                     /locus_tag="CNK03050"
                     /db_xref="GeneID:3254712"
     mRNA            join(894913..895464,895514..895565,895614..896865,
                     896915..897964,898016..898332)
                     /locus_tag="CNK03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658105.1"
                     /db_xref="GeneID:3254712"
     CDS             join(894964..895464,895514..895565,895614..896865,
                     896915..897944)
                     /locus_tag="CNK03050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513793.1"
                     /db_xref="GeneID:3254712"
                     /translation="MENTIRAPSPRKHSALLAVTDDFDTPSQAPTPTPPATLTAHPHL
                     AHYIHSLLNNVHFPPPRSALVAQHPLSVSSSGGSDGSDSDDDHHGDVSNVSQSGSEAA
                     STSGASGVTKSSQEAGVAKSDDGSARKATTAEKEELVKKIVELLDNDQEEEIKGTLKP
                     YMGELGKDDLLMDQVCLDCMHKRRDDIEGLPYAPHLTPTRARASPGIGSRPFTPTRVP
                     SFRSRTPLSRTHSPVPPIPSHSSVTVPPKPASSSGYSPAPSPLASPRMLNAKASTFNP
                     SARVVSGMNASAPGFIPSDAWRDAPSADQPPRAGSPFGAIGAPSMTRTGSNLAIASPL
                     FSDQQSPFHSPVGTPQRTPVKMPDLFSSPAQRAAASKSIVPDDDDDDEFSPFGKGLPK
                     LHHHDTSLKADSKPFNPYFFGAPLGPALNASAGEYTPNMAMSDTSTSYSSSHIGTSDV
                     LDESTTETGSGMTPLDVLCSVFTSVPRPELEDALHRSGYDFEAAMSMLVAAYTNPRSG
                     ASTPQRVSSPRPYIGMGRGGRDGYFPTVSSRTLRRDISPTGGTRSPAGANGGKMCRYF
                     LAGECRRSDCRFSHDLDRAMCRFWLRGHCAKGPNCEFLHNFPNNLDVSALQSAMSRVE
                     LSQDEYARPDSPGNWHQPPEEFPDLTTARSARAPRFDPSRNRFANAIKRAAPAPPRDF
                     PSTQVQPAHSQDYLSDSSTSSVPALPRPSMRIKLRPPTLLPTLKTGTAANEQYLASRS
                     TSIRLGHARNACLARAADAFRRGDGAAAKRFSREGKALNQRMLNEAAEAAQGLVKERQ
                     AEAMEAVKERPAGWSDDPADRSQRGQACAGGLGVILGVASVSRLPPGANASSLTSEER
                     TEALLDLHTLHGNEAADILGQFLAELERERFRGLAYVVIGEEKHVGTQDEKRGAGKVR
                     LGASVKSALAGWGYAWNESAGIICVDPCRT"
     gene            complement(898398..903672)
                     /locus_tag="CNK03060"
                     /db_xref="GeneID:3254720"
     mRNA            complement(join(898398..900246,900302..900464,
                     900525..901169,901216..902100,902162..902939,
                     903079..903133,903208..903250,903318..903672))
                     /locus_tag="CNK03060"
                     /product="C2H2 zinc finger protein Zas1A, putative"
                     /transcript_id="XM_567899.2"
                     /db_xref="GeneID:3254720"
     CDS             complement(join(899753..900246,900302..900464,
                     900525..901169,901216..902100,902162..902939,
                     903079..903133,903208..903250,903318..903491))
                     /locus_tag="CNK03060"
                     /codon_start=1
                     /product="C2H2 zinc finger protein Zas1A, putative"
                     /protein_id="XP_567899.1"
                     /db_xref="GeneID:3254720"
                     /translation="MAAFAFPTSLVAENSVAKPFADTDITPSGAFAGGVGPGKAEDEQ
                     ERETFACTFPQCFQIYSRVEYLKRHLRRHENDRPFPCKDCRKAFTRSDVLLRHHRRCH
                     PNPPSADISSSSPVSNNAQGNMLAYSSRIDAREASPSREGPRKPGRHRTRKEESVLAQ
                     FDPTLRNDLDDKDKGRNHSGACHSDDTIGNYPNYSPQLLPSSRGNRTNLALDDSNQLD
                     ETSALLNMAYATDIASNNVQPREGSGLPLWGDDPAVNLIMAAAAGGDNNSSNHGGSDP
                     STVGAQPHSIAFTSGNSRASISSLIGSESELSGQGNVDSTLPNFGGFDSTVWSSGIET
                     QGGTNVADGGSDSFSWTMIQSPKSTPPPATSHHLPSITYSLPSHSSNSSTKSRSQRNV
                     HYQSPQWQPQDVLQILDQIAMYDVPQTAANPNPERPLLRVAHTELAHRVGNGIDPRSR
                     FYLPTDRFNGGYQIPHWTLPPLRTLSLMACRTFHTVLNHFSIVHLPTFRLIDTTPCLA
                     FAICTVGGIRTGKSSIHNHHLWEPPTNNGQPDPRKVTSLDGPVVPDQSWESLYEKNWY
                     HENGSVRVNEVPSWKNAPTVRNEKIHMLVKSFYLARGVSMTEFNVTLLQALILYHTPN
                     FLSEDERERASSNMFTGTIVNVSRRIGFFAPENDHFTPIIRLPDEPYTPNELGRCWRE
                     WIQLESIRRTAYLVYELDTISALEANIPCLLSPYELAHIPLPAPDTLWKAPDAETWLE
                     SVKGFRPMTLDEAMRRTFCLPASGKFDQMHEKSDKEAFQLLRGSNYGPFARITLIITL
                     LRGIIDIGEGKRDRGDWRDLTDLWVRDTFFRPGKMMLDQDGINMGLITMKRLKDMFRL
                     ALQTWREGWDYDSLCVPAAMTPLNNRSMMSHSESSWSEGSLDTIEEEEMPKKTVNYCE
                     DALPLYWLAQTLQNLLDSNSSQSAGTNIFSSLRYNDMLKAARRFARTGEGLPIGASNS
                     SSSFRIRRDDTNRPVGHTKIEATHDIPKTHPMSHRSTASLPIGSYPVDRISGSAHMND
                     GSFGGFMHMTGLGSEEIGMPVGLQTSGYGFGFNSASADGSSSGDVRLV"
     gene            complement(904202..908937)
                     /locus_tag="CNK03070"
                     /db_xref="GeneID:3254497"
     mRNA            complement(join(904202..905274,905335..905494,
                     905547..906191,906257..907129,907192..908089,
                     908470..908524,908596..908638,908695..908937))
                     /locus_tag="CNK03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_567900.2"
                     /db_xref="GeneID:3254497"
     CDS             complement(join(904637..905274,905335..905494,
                     905547..906191,906257..907129,907192..908089,
                     908470..908524,908596..908638,908695..908868))
                     /locus_tag="CNK03070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567900.1"
                     /db_xref="GeneID:3254497"
                     /translation="MAAPISATGESPIVAKSTPSTISGPPAVTSTTGGGGRGRGKDGK
                     EKETFACTFPGCGQTYSRMEYLKRHQRKHQDDRPFQCKDCSKAFARSDVLLRHRRRCH
                     PTPPPVDHSTSPPALNRIYNGMPVSSSRTDAREASPSHHRSRKHPRQSHGDEERDHSR
                     ARIDPALRDDYNESSGERYRDSGHDSNDMYGQYYNASANDDHPNYSSHLMPMFNQDQS
                     YHSLNDPNHLEDASVLLSMAYPGGVPGNDRQSQEQRDLPEWASNPTINLIMETAVANR
                     EREDANKTPSNDNDNGTGPNPSPIEVQPQTVAASAGDSVTSVPEQTEMSAPVSSAPEV
                     APSGQQEIDPRLQNDSAPESTSGTAEGFLNAMSWLSGMDNQGVFNKTGNTPDTSNWSL
                     LRSPKNTPFSISSLFSPSAYGLQSDFANDSTSNDNSNNQQSSPNVLHILEQLAMYEVP
                     QTAANPNPERPLLRVHHGEIATLAGDEIDKSSRFYIPADQFKGCYQIPHWALPPLRTL
                     SMMACRTFHTVLNHFSFVHLPTFRLIDTSACLAFAICTVGGIRTGNSSISDQYLWQPP
                     TGDGRPNPERSKALDGPVVPDQSWESLYEENWYRCNEPVRARQVSDVTNWKNGLVVRS
                     EKMNMLVKSFSLAKGVLMTEYNVALLQALILYHAPNFLSEDERERASANMFLGTIVNV
                     TRQIGFFTSENDHYAQTIRVPEEPYTPNELDRCWREWIQLETRRRTAYLVYQLDTISA
                     LESNIPCILSPCEVAHIPLPAPDTLWKAPTAEAWLKAVKKYRPMTLDEAMRRTFFLPT
                     YGAFDKLHQKADTQFYHLLNESDYGPFARMAMVITLLRGVIDIGEGKRDRGDWRDLTD
                     LWVGCAWLRPERVMLAQDGTDLGVITRDSLKDRFRQALQKWREGWDFDSLCACPTSGV
                     TKCTNGMVSPENSGSEGSPNSDENEIPKETLNYCDDGLPIYWLAQALLNILYASSQSP
                     GTNVFSGLHYGDMLKSARTFTRTGEGVPIKIKNMSASQARDGNHRNSYSENPVSIQLT
                     SGRKQSNPPTPAQTSSNPPSVGSTNFNPPEAELSALSTGMNEGTFAGILQALAANSGE
                     FGMNIGLNVDGYPTQSGSGSDSGPGSGAAGDSSTAVTSPQANVGASNIVSSSGGNGNM
                     ELTENDLAKHLGFMI"
     gene            909133..910010
                     /locus_tag="CNK03080"
                     /db_xref="GeneID:3254447"
     mRNA            join(909133..909465,909521..910010)
                     /locus_tag="CNK03080"
                     /product="50s ribosomal protein l36, putative"
                     /transcript_id="XM_567901.2"
                     /db_xref="GeneID:3254447"
     CDS             join(909154..909465,909521..909532)
                     /locus_tag="CNK03080"
                     /codon_start=1
                     /product="50s ribosomal protein l36, putative"
                     /protein_id="XP_567901.1"
                     /db_xref="GeneID:3254447"
                     /translation="MLAILRRIPQLARAGPSNPTQRFCSTCPPRPLASTLRPSVPSLS
                     THLASRPTLASQATNVGRGNFQVRGMKVRSSVKKFCDGCLIVRRKGRIYVICSKNPKH
                     KQRQG"
     gene            complement(910025..913883)
                     /locus_tag="CNK03090"
                     /db_xref="GeneID:3254377"
     mRNA            complement(join(910025..910433,910528..910849,
                     910921..911131,911185..911423,911477..912044,
                     912098..912164,912214..912476,912525..912656,
                     912707..912940,912991..913296,913540..913883))
                     /locus_tag="CNK03090"
                     /product="helicase, putative"
                     /transcript_id="XM_567902.2"
                     /db_xref="GeneID:3254377"
     CDS             complement(join(910223..910433,910528..910849,
                     910921..911131,911185..911423,911477..912044,
                     912098..912164,912214..912476,912525..912656,
                     912707..912940,912991..913296,913540..913767))
                     /locus_tag="CNK03090"
                     /codon_start=1
                     /product="helicase, putative"
                     /protein_id="XP_567902.1"
                     /db_xref="GeneID:3254377"
                     /translation="MSTVTPSLANSTAATSPMSQSPSTRSASPSKEEVKIVSSSERDA
                     AADGADVDGQEGIADPKKVVEELKEEGQHDPEAAARAARLNFLLDKSTIYAKIIGDRM
                     ARQQIEKRKAEARAEIRKANKEKKEAEAKEIRREGVGDKRKPKRAEIESKDEGRGKRK
                     RQNIGGRDEKKAKVDKDEVDVDERPPEQVSEQTQSVHAEQDGEEEDDGDVQYSFKQPE
                     LVTGAKLRDYQLAGVQWMISLYENGLNGILADEMGLGKTLQTISFLSHLRSKGTWGPF
                     LIVCPLSVLNNWIMEFEKFTPSVPVLMYHGNPDHRAELRATRLQTPTASDAGSSKTKG
                     RKSNSNLAGNNTSTFPIVITTYEMCMKDKQFLSGIKWKFIVVDEGHRLKNLDCKLIRE
                     LKSYTSANRMILTGTPLHNNLAELWSLLNFILPDIFDDLDSFQQWFNFDEMNEGQTTE
                     GLLNKSNVVASLHAILKPFLLRRLKVDVEKELPPKKEYLLYAPLTQMQKDIYQAIVSG
                     QIREYLIDKVSSSGSGSNTPKEETPELEAAVEATDGRGQRKKKKVNYKIEENDNKYVR
                     DLEEGRIRPEDGPTGLEEKSAAEVGREWALKQATKHVNNMRLQNLVMQLRKISSHPYL
                     FDWPSDPATGELVVDDNLVNASGKMLLLNRLLDALFQKGHRVLLFSQFTTMLDVIEDW
                     ATVYKGWKVCRIDGSTPQESRREQMDEFNGGKDDPNACKLFLLSTRAGGLGINLVSAD
                     TVIFFDQDWNPQMDLQAQDRAHRIGQTKPVLVFRLVSAHTIESKILAKAGNKRKLEAL
                     VISQGKFGRVVDENGRVLLGRKSTKKAEAKESVTEMAKALLDLEGEEINVASKDDQII
                     SDADLEILLDRSPAAFARQKGWSAGLSKAGAHGRAEQLKKGEKTTFEVFETAKDDGQG
                     LSGMFGGDGDAE"
     gene            914093..915558
                     /locus_tag="CNK03100"
                     /db_xref="GeneID:3254469"
     mRNA            join(914093..914180,914507..914593,914659..914778,
                     914831..914963,915017..915558)
                     /locus_tag="CNK03100"
                     /product="60s ribosomal protein l23, putative"
                     /transcript_id="XM_567903.2"
                     /db_xref="GeneID:3254469"
     CDS             join(914168..914180,914507..914593,914659..914778,
                     914831..914963,915017..915080)
                     /locus_tag="CNK03100"
                     /codon_start=1
                     /product="60s ribosomal protein l23, putative"
                     /protein_id="XP_567903.1"
                     /db_xref="GeneID:3254469"
                     /translation="MSIKSAAAGTKFRMSLGLPVGAVMNCADNSGAKNLYVISVIGFG
                     ARLNRLPAAAAGDMVMASVKKGKPELRKKVMPAVICRQRKPWRRRDGIFLYFEDNAGV
                     IVNAKGEMKGSAINGPVAKECADLWPRIASNAGTVV"
     STS             915433..916204
                     /standard_name="Bam9"
                     /db_xref="UniSTS:470702"
     gene            complement(915754..918397)
                     /locus_tag="CNK03110"
                     /db_xref="GeneID:3254638"
     mRNA            complement(join(915754..916017,916077..916317,
                     916428..916497,916561..916956,917022..917120,
                     917187..917249,917305..917385,917446..917557,
                     917611..918397))
                     /locus_tag="CNK03110"
                     /product="prenyl-dependent CAAX protease, putative"
                     /transcript_id="XM_567754.2"
                     /db_xref="GeneID:3254638"
     CDS             complement(join(916895..916956,917022..917120,
                     917187..917249,917305..917385,917446..917557,
                     917611..918213))
                     /locus_tag="CNK03110"
                     /codon_start=1
                     /product="prenyl-dependent CAAX protease, putative"
                     /protein_id="XP_567754.2"
                     /db_xref="GeneID:3254638"
                     /translation="MDPSLSLPPALSSGLPLSTAHALSFLFTTSYVGSLYISQHFFGT
                     STPNPRKAPFPNTVRSQTEPLPPISATDADGLGVEHDLGPELGSRDHPITIKRRMRAV
                     ACSTLLSVGGVCYVVKQLGHYSWKEAISPTMALLGVPTGFVVPSRALPYLLTPGLMIG
                     PLYAMYLSGEVPVIGWRKKGETLWSTLKREFGLVEVRNYIVGPLTEEMVFRSTILAVS
                     LLGRLSLKSLVFGTPMWFGIAHAHHGFEMYKRNGRNGAAALQAILTTLFQLTYTTLFG
                     WFASYLYLRTGSVLPPLSAHIYCNVMGIYLPTVAVKRYPKRKALILGTYLAGIVGFYF
                     GIKVL"
     gene            918768..920017
                     /locus_tag="CNK03120"
                     /db_xref="GeneID:3254705"
     mRNA            join(918768..919422,919476..919540,919631..919754,
                     919817..919901,919969..920017)
                     /locus_tag="CNK03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658106.1"
                     /db_xref="GeneID:3254705"
     CDS             join(918838..919422,919476..919540,919631..919754,
                     919817..919901,919969..919976)
                     /locus_tag="CNK03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513749.1"
                     /db_xref="GeneID:3254705"
                     /translation="MSNFSSTPNASTPPQFQQQRVQPQQQAAPSQNQAVPFTTLSASS
                     SVPTPVASAVGVSSPTSGSISSQSVVGGPTGSPAPPPISSNVNGSATPASSSTPVPVP
                     NVSASDTQAAITSAPITTSIPNAQSNTSAPISSSGPTAGLAGNASTSAAAATQTEPQP
                     SNQDTFWAARREEEIARRDRSLAELLVMLDGYKPLIPEEVTEYFLQRSGFDCSDPRLK
                     RLLSLVAQKFISDLSRDAFHFSKLRVNGATAGRGRPAAGVDRNRVVLTMDDLSLALGE
                     HGVNLKAPDYYL"
     gene            complement(920132..921652)
                     /locus_tag="CNK03130"
                     /db_xref="GeneID:3254575"
     mRNA            complement(join(920132..920723,920783..920937,
                     921087..921228,921342..921652))
                     /locus_tag="CNK03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658107.1"
                     /db_xref="GeneID:3254575"
     CDS             complement(join(920177..920723,920783..920937,
                     921087..921228,921342..921379))
                     /locus_tag="CNK03130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513756.1"
                     /db_xref="GeneID:3254575"
                     /translation="MLLYLVRHGKTSLNNSNLVQGTIDAPLSLGGYIQAQKLAEHLRL
                     VPFTEAWTSPLTRAQETAKVILSQQPSRKAQLHVDDRLGARYMGTAEGKHWDEVKDDL
                     EAHKAEDGDVVKARLHEWLTELLNTHAPSISAPRSPTSPLSPLPPLSSFSPSSYTSST
                     GNFNPFDLIHALPRPGFPRRPSSRSSSGATGLVGGSGSGVILVLTHQECLERFGEMCN
                     RDESVVKNGEREAKAKVPLSMYVSEGIDLKSSPMGNTSVAILRVWWQRIDSGAEMGSV
                     LEARGRLEAWGMEDHLD"
     gene            complement(922165..>923954)
                     /locus_tag="CNK03140"
                     /db_xref="GeneID:3254542"
     mRNA            complement(join(922165..922518,922590..923397,
                     923451..923765,923822..>923954))
                     /locus_tag="CNK03140"
                     /product="Sulfide:quinone oxidoreductase, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_567904.1"
                     /db_xref="GeneID:3254542"
     CDS             complement(join(922398..922518,922590..923397,
                     923451..923765,923822..923954))
                     /locus_tag="CNK03140"
                     /codon_start=1
                     /product="Sulfide:quinone oxidoreductase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_567904.1"
                     /db_xref="GeneID:3254542"
                     /translation="MHFISILTHTSPTKMVALPKSLPSLARLASTSAGGKHKVVVIGA
                     GAAGLSAANQVYNAFKAQGKTLADGDVAIVDANRNHDYQPGWTLVGSGLASKETYRRP
                     VSSLIGNQFAHIPQNAAGFEPGANQVVLADGSKIGYDYLIVGAGLQINWDNIKGLSAA
                     LADSSKSRVSSIYSYETVDKTWDLIRDFKGEGEAIFTQPFGVIKCAGAPQKINYMADY
                     WWKSQNQKNHSTFITGMPTMFSVPHYSKALDALRQEKGIDALFNTNLVEIRPESKTAV
                     FEVLAGEEKGKKIEKEFGLLHAVPPMGPLKAIKESPLADSVGWVDVDQGTLQHKKYEN
                     VFSLGDSSSLPTSKTAAAITGQSPVLTHNLVTLMETGKIGDAIYDGYTSCPLFTGRGS
                     LLLAEFKYGAERKETFGKFVDQSVPNRFFYHLTKDVIPRAYFSKMLKGEWYGPRSVFP
                     PQYLPQSQ"
     gene            924417..927088
                     /locus_tag="CNK03150"
                     /db_xref="GeneID:3254586"
     mRNA            join(924417..925126,925178..925202,925256..925286,
                     925423..925934,925993..926189,926249..927088)
                     /locus_tag="CNK03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658108.1"
                     /db_xref="GeneID:3254586"
     CDS             join(924486..925126,925178..925202,925256..925286,
                     925423..925934,925993..926189,926249..926870)
                     /locus_tag="CNK03150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513794.1"
                     /db_xref="GeneID:3254586"
                     /translation="MDQPKAPPALPINTTATVFHLPHLAKLSQRPPLPAPPLSSSDTD
                     KETAGIMGLVARGGKEVWRRSLGGLWTTESRPKDDLSSRSSRRASVDSALSTGSRTKS
                     LLCAQSVDTSSILYPTLTVHPPPVPHNILIVSLAHVPSAPQTLSNDELFQIVLRRLEP
                     WVGEEGEGGYVLIILSAERSPEEKMAFDDKYKAEARKLPGVAWWIWKWKRLPRKYRKN
                     VKRLYIIHPSYFTRSLLPFIVPLLSPKSYSKLYPVPSLLALYYEYGVTLKGIDITLPV
                     LEAESQALKGDPDLLSFALTLSQVPLGEVSRPMFNRSSSSQSSSLWGLQALSSVVSTA
                     ASYVGLSRTSFNDSAERRRVVASEGYWKRDLTALVDECGGKVPPLLLTLSRVILSAGI
                     STEGIFRRASNSRHLELLVALLSLPLEDQGNPSWFQLAHADPLLPPKILCKFLAELAS
                     PILRSELYDVIRSIVEPGDIKERLFPLLPPSHILILHYLTYVLHRLTAFEDSTKMNAL
                     NLAIVVAPTLISGPDPLEDAGMCLESGKKLPLAMLVAAGKAPEESVKGKEVETSGQGT
                     VVGMLELWIREYPSVSGDLVPEKMVCPVSPAGLAAAAKRKEAGERRSIGERESYPKAR
                     KRRSGSVRNSFLGALFAGSGGNKESSGMEDAVEVREGVVGGPSSGSGSSPS"
     gene            933753..939556
                     /locus_tag="CNK03160"
                     /db_xref="GeneID:3254604"
     mRNA            join(933753..934178,934858..934943,935017..935097,
                     936006..936076,936180..936232,936866..937289,
                     937347..937673,937728..937930,937980..939556)
                     /locus_tag="CNK03160"
                     /product="cAMP-independent regulatory protein, putative"
                     /transcript_id="XM_024658109.1"
                     /db_xref="GeneID:3254604"
     CDS             join(937032..937289,937347..937673,937728..937930,
                     937980..939075)
                     /locus_tag="CNK03160"
                     /codon_start=1
                     /product="cAMP-independent regulatory protein, putative"
                     /protein_id="XP_024513795.1"
                     /db_xref="GeneID:3254604"
                     /translation="MSAPPSPPCNLDPPFRGYIETTFDALLVFEAARRGMIPRVTRRL
                     IERERAMVQSGAVFVFDEHESGIKRWTDGLVWSPSRILNNFLVYRETDKRSANAKNSG
                     SPTTQTSPQNTSSALSKSVGSTRSDAQSEVSSTNIGSDTTSGMVDPPPLGQGALARPR
                     SASEGGGSIDRLKERQLVGSLTNSYKFKENGLVKKTMSVSVNGFAQHVVSYYAIDDVI
                     SGKLRTPSSIPELASLEISPEYLHKQNFRFPPQVEVGPDGIPRYRGEPEEPQSPHTPA
                     SNYSFQTFHQQQQQPPSTTSEYYEVPSYNAGSIPAHQQMHRIGSPRNRPMSVPMPIPL
                     PSPAHSIQGSSYMGPGSAGSGFYESPSVNGMHYAPPLVRQSSSSSVTSSTSAIRPGSS
                     ANRRYAPYGGGPAGPGNRGSTGPMQYQHGHQRRQSGSDSQDSSYPIDGNNPASYDVKP
                     SIAPYYTGPPSGGSGTFTFYPPENASSIEPPMASPTYASAGYGPWQSMHPSQNTRFMP
                     ARHDYAAGPPSIPLGPPPPGHGHMHEAPSSAGSGSSDGQQGQSQDQGQGQSQPSQVHA
                     PPQLIHSQHQQQQQHRSWASQSHVPHAPGWELSGTPSPSYGMPSAIHQGHEDWRQNAG
                     AIA"
     gene            complement(939971..941574)
                     /locus_tag="CNK03170"
                     /db_xref="GeneID:3254706"
     mRNA            complement(join(939971..940397,940460..940548,
                     940602..940689,940745..941008,941075..941149,
                     941254..941343,941478..941574))
                     /locus_tag="CNK03170"
                     /product="transaldolase, putative"
                     /transcript_id="XM_567910.2"
                     /db_xref="GeneID:3254706"
     CDS             complement(join(940061..940397,940460..940548,
                     940602..940689,940745..941008,941075..941149,
                     941254..941343,941478..941506))
                     /locus_tag="CNK03170"
                     /codon_start=1
                     /product="transaldolase, putative"
                     /protein_id="XP_567910.1"
                     /db_xref="GeneID:3254706"
                     /translation="MPTSLEALKASGTTVVADTGDFSSIDEFKPQDATTNPSLILAAV
                     KMPAYAKLLEPAIKYAKSKGGDIEVQSENAMDRLLVEFGTEILKIIPGRVSTEVDAKF
                     SFDTQATINKAHQIIALYKEQGIDKNRVLIKIASTYEGILAAKQLESEGIHCNLTLLF
                     GFGQAVACAEAGVTLISPFVGRILDWYKKANPDTTYTAETDPGVQSVQKIYNYYKQHG
                     YKTIVMGASFRNTGEIAALAGCDFLTISPKLLDELNKSQDDLPKKLDASSTGEPIPKT
                     SYLDDEAKFRWALFEDVMAFDKLHEGIRGFAKDGASLKQMLIEKLKA"
     gene            942639..945471
                     /locus_tag="CNK03180"
                     /db_xref="GeneID:3254703"
     mRNA            join(942639..942810,942973..943107,943164..945471)
                     /locus_tag="CNK03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_567911.1"
                     /db_xref="GeneID:3254703"
     CDS             join(943026..943107,943164..945004)
                     /locus_tag="CNK03180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567911.1"
                     /db_xref="GeneID:3254703"
                     /translation="MTLPPIGRVGLAGAPHQSIVKRAVQERASCDLAAGDLYLFPNSS
                     SVIDATDPVTFKWNTACDVATSTVDLYLYESAGLIKAWSDIDFSAGEYTVQLQPKWWN
                     DTTTASLQLNILDHGADSWDTSYLAGPVFTVDYAASAMFQTTTSNGQVITSTAAAAAT
                     ESRDAVFQDVSGTNGGDKNNISKGAIAAAVVVPIIVVAIIIAVAVRFWRMREAEKRKR
                     WSQALSTHSNLEWEKGAIPGEKPPSVLGRPSMGGRLSMGTRPSMSSYGGNPRPTSSVY
                     AVENNMAGAGAGSAMHFRPDTHPEMSSLRSKSVDNLSAAGRSSVVMSDGQVRQPRISF
                     ADQARPDRVSRASFGGDIRPNVSSSSLFRLPGASKSANDLAVSTNRRSAAYATGSAVD
                     DEEEHISVSPSQQDGPLGFAEADMRRVSQGQRTGRRSLLSLGGGRDNKRQSVASALSG
                     DDFRSAASARGSVDELRDMENMVLHRRSMMSQASPSPNFEAAYDADAVESLQDPEPMA
                     MPLPSPIPAGQDPDQALAMYAAQRANAMSPTNNNSLPPNPSRSNSAMKIPFFSKKSAS
                     SSNTSGFSPGASANPEQGEVPTMGPPVEMRSYVHLNSGTVSADVVNALPKPGPPATTR
                     ASGASDASKYSEEESK"
     gene            complement(945521..947108)
                     /locus_tag="CNK03185"
                     /db_xref="GeneID:36393113"
     mRNA            complement(join(945521..946307,946404..946545,
                     946652..946875,946938..947108))
                     /locus_tag="CNK03185"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658817.1"
                     /db_xref="GeneID:36393113"
     CDS             complement(join(945964..946307,946404..946545,
                     946652..946875,946938..946986))
                     /locus_tag="CNK03185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514651.1"
                     /db_xref="GeneID:36393113"
                     /translation="MVRACPILLALSLAGCALAQDSSASASDYTIQTSPPEPTSATSS
                     ETSSAASSSSDANSSTTATTTSVDPASTSAFPGTCSSDCQVIADALSSCGVGTTLNTT
                     CLCTVDVEQSYRSCLQCALAMDPTIGNQSTYQAMLDTYINQCASASSNPITLPPATIT
                     LPANATTTGSTNGTNGTITSTFSNSTSATVNTSPTTSIVSTTSSSGASSSAATSAAST
                     ADAATSSGAASSAEEKAVYNLGVGLVGLMVAVLV"
     gene            948054..951844
                     /locus_tag="CNK03190"
                     /db_xref="GeneID:3254702"
     mRNA            join(948054..948144,948188..948500,948567..949089,
                     949182..949255,949331..949502,949557..949636,
                     949702..949956,950019..950132,950184..950228,
                     950281..950661,950724..950901,950959..951844)
                     /locus_tag="CNK03190"
                     /product="carbohydrate binding protein, putative"
                     /transcript_id="XM_024658110.1"
                     /db_xref="GeneID:3254702"
     CDS             join(948333..948500,948567..949089,949182..949255,
                     949331..949502,949557..949636,949702..949956,
                     950019..950132,950184..950228,950281..950661,
                     950724..950901,950959..951791)
                     /locus_tag="CNK03190"
                     /codon_start=1
                     /product="carbohydrate binding protein, putative"
                     /protein_id="XP_024513796.1"
                     /db_xref="GeneID:3254702"
                     /translation="MLSSRTIWIWLAPCLCLSNLLGVWGMTDARRIQLRDETAALFRH
                     GYEGYIKYAYPADELRPLSCAPLRRSKNAADFGINDLHANVSLTLLDVLSSLPLLHPH
                     ALPSALERITTQVSFDQDVKVQVFEMTIRALGGLLSMYQYLDDLPDSPYEQARVLGVV
                     REGKEGWLGLGLGAQEKVDKVDVKKYKPRILELAEDLGRRMLPAFNTKTGLPYARVNL
                     KHGIEKGESVETCTAGAGSLILEFSLLSRLTGDDRYEQLARNAYYSIWNRRSDHNLLG
                     NTIGATHGHWLMPGLSGVGAGMDSFFEYGVKAGIMLGDDSFYDIFYDSYAAIQTHVRT
                     TDGFIYRPIHTRLLQIPSPTTIDSLSAFLPAIQVLAGDIPSAIRSHLVFWNLWRKFGA
                     LPESWRWQERRIEWAGWPGRPEFIESTYYLYQATKDPFYLRVGERVLKDLARRTKTSC
                     GFATIKNVLTSELEDRMESFMLSETLKYLYLLFSDTPFPNQNKVFTTEGHPLYIPQPL
                     LQPSTNARKSLHKGEWLTCPAYQSPFAIGGIDFHGTDKVGNRVEKVGITVGIEGTSEY
                     EYARALVFGWGEEGLKVEDQKRMWFDGGVCSIQEVPKFAFDIVLTSPFNETFPEDPSP
                     GSDKVYQNTTTGDYVISNIAGIRLGVRWRLDGQGYDVSSIGPHRVRTGQQVTVIDSSM
                     RNHFPLPSLAPGPPQPQYEPTEVILRFVFLSPVVVKDKHVEASTVFLHALGATATFGK
                     DFGASATSPRMEDQQGWQLSGGALPILVLPNPSDGCSPLTLSTPDYPFILLLDRGNCT
                     FAEKAQNAETIGASGLLIVGYPHPPEGGVTQGDQTVYAAPEEGLVRPSAEPNEAEGLD
                     SMGIVYMEHLVGELVRNASQKGEIGAAIMRIEGVGEEAAGSSGFPQAGSGATKKHWES
                     DSRIREGRLAVGDWEICNLVVVDTSV"
     gene            complement(951917..958547)
                     /locus_tag="CNK03200"
                     /db_xref="GeneID:3254699"
     mRNA            complement(join(951917..952275,952339..952443,
                     952492..952685,952735..954495,954545..954604,
                     954652..954779,954828..955036,955083..956406,
                     956467..958273,958340..958547))
                     /locus_tag="CNK03200"
                     /product="bacteriophytochrome histidine kinase, putative"
                     /transcript_id="XM_024658111.1"
                     /db_xref="GeneID:3254699"
     CDS             complement(join(952199..952275,952339..952443,
                     952492..952685,952735..954495,954545..954604,
                     954652..954779,954828..955036,955083..956406,
                     956467..958266))
                     /locus_tag="CNK03200"
                     /codon_start=1
                     /product="bacteriophytochrome histidine kinase, putative"
                     /protein_id="XP_024513797.1"
                     /db_xref="GeneID:3254699"
                     /translation="MPDGSTSPREPANSAYSTHEPQSKRHSSPQSVAMPAAPRFHRQH
                     TSSQDHGSSSTPISPAASSTGPLSPSIPPGSFVFPIRSVFQGMVHSDSSNGITEGHQQ
                     RKKDGLQRSSGSSSPLRSPALSDAHRFSTDAAGALHDEPDAGIQTIAQMLQQDGSAPL
                     KEKGKHQPGVATFVGKAERDRNGSGGGETLKPSSPDASGHLGNSPITHSSSDSEHQKQ
                     QDVAKSSRSEEGTNDSPESSHGSGGTLKQATRTDLPAALQRSSTVKGKVSASGLTKTS
                     PSNYRHFPSEHHSGQRERRFSTVNKVNPPSRNSSSHPVDASHPPNPELQHPVPRRNTR
                     QQHTQDAEGNNRTSSHGSRTSLEVDESGMRSLISDMSGIVLLGEAGSWGSMGGSGVSG
                     SKGTDGGTGTTGTVDSASIDSGHATGGRGQGDERQVTKASLAAKHGARQTSRQDSVRS
                     FIQSQAGTTNLQDPNAPTLSPMPSGSPPAEGSQDATVSMEDSANNEKQREQQQEEGEA
                     EQQGEEENGQVEQPVAASAEDAENPDEPAVTMRFEHVVTEEGHHIVAGREGRLRRCQD
                     EPITTPGAVQGFGVLMVLEEDYETGNLEIRQVSENSTEILGLSPKYLFRLDCFTRLLS
                     SDQETILRDTLEYLPESYGGSNSVEDSGPSVFLLSGFGEPGSGVEEGETEGGPETEVR
                     STASSAGGKRKEWTCWVAAHRPEHRGWNKVNEIGEPIPPPDWIILEFELERDVYNPLV
                     HPSENAETSTAAANSNARSLRPDSTAASVSASGSNSNSNTLSASTRSGERTLDSLTST
                     LAGGRAGVSAGLGPGTASSDASPGDLGSSASDFTSVPKQEARMGLDGLEMHIPLEKIL
                     ESTTNHASPLRALERMRGTTVNASNEARSRGRGRGRGRGGRQRPIRTESGGTGTMDIF
                     AVLGQINDQLVAAPDLDTFLKVAVGLMQDICRFHRVLIYQFDEQMNGLVVSELVEWGK
                     TTDLYMGLRFPATDIPPQARELYKINKVRMLYDRSQTTARMVLRNKEDLDQPLDMTHC
                     YLRAMSPIHLKYLGNMSVRSSMSISIMAFGQLWGLIACHSYGQHGMRVSFPVRQMLRL
                     LSDSISRNIERLSYAQRLHTRKLISTIPDRSHPTGYIISDAGDLLQIFGADAGLLVIG
                     DGCKLLGHNEQGQAMLAIAEYLRIKRFDNLNASSSIQRDFPDLVLPRASDTIAGLLYV
                     PLTAKAGQDFIVFLRKGQVREVQWAGKPYKDDKASEEASLEPRKSFKAWTETVTGCSR
                     AWTDHQLESAGVLALIYGKFIQVWREKQTAMASNQLTAILLSNTSHAVRTPLSQIINT
                     LELALAGNIDDDVRKMLENSHQASRALLFHVHDLLDLTRIETGNETAFNDPFDIRQSI
                     SDAVRLYQTEVARRGLEFRVNMAEDLPQYVVGDSRKIKTVISNLVANSVKFTEKGFIE
                     VYCGIQRPFDGESSQTSLTESKEGNTITIEIVISDSGCGIPTVQLEEMFFTLEGAEPL
                     QKNTGVGLGLAVVARIVEQLEGQLRAESEVGVGTRFYFNVPMVAHPSGRPGSRQSSHN
                     SRNTNSSQLRTRTGSSGSKSDSVVSLRSDGSGVPEIESFVQDFGGSHLPAPVGDDDPR
                     LLEAQERMSRLGTFPVTDSSYPVRATKVNTDDQHVKSPKPKKPRFTAIGSSERSTSRH
                     NTTSSKTSSASQSPAFSRPSSNSVQGPKRNKKGPNGKTVMRIMVVEDDPINSQILQKR
                     LKMDKHVVVAVTNGQEAVDQLEKDRDIDAILMDIQMPIMDGRTSAKEIRELEARTPQP
                     DDIEPFKVDGRTPIFAVSASLYEDDRANLAENFDGWLLKPLDFSRVRAILEGLESSEK
                     RVAEVYQQGNWERGGYLKAAPLPASSSASTPSTTQSSPCTSTS"
     gene            complement(959334..962589)
                     /locus_tag="CNK03210"
                     /pseudo
                     /db_xref="GeneID:3254618"
     gene            959623..962108
                     /locus_tag="CNK03220"
                     /db_xref="GeneID:3254697"
     mRNA            join(959623..960480,960539..960939,961003..961547,
                     961628..962108)
                     /locus_tag="CNK03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658112.1"
                     /db_xref="GeneID:3254697"
     CDS             join(959927..960480,960539..960939,961003..961547,
                     961628..961978)
                     /locus_tag="CNK03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513798.1"
                     /db_xref="GeneID:3254697"
                     /translation="MSITSATYTGLAPVSQHTKDNLTYYPYVLHSIFGNQFTAATADP
                     YIPAETIKLNTGPVGLQARLKGEDGALVETARKSDGSGNAIVRITGSWYLKPDQKNKT
                     NVHLTADTGDSHTVSSSPPTDSPNALLSPIKSSKSPQGGTVSPHPPPPKSPAKRLVDK
                     AKKGLHRLHDFPTVLSRSGITGQFAPLIAEAVTPNKNQYFKEVPCFGLFSTQYIATKF
                     IPQGQTILVEQPLVTISDFFKNSEKDTQDYYDRADKALKQRFDKMLNLHPKEGFYGTL
                     LTNAVKLKETGDRAMIFEKALKFRRSCDANITIACHGGGPAAYCIALTDIRPGTELLQ
                     RYIPSDASPFQLRQAQILEEYNVICQCRLCTLPLIERERSDDNRVRRREILDNLDRDM
                     KRNPTVALARVEEAILLAVQEGLWEGLFSDFEKACMICCGWGDEESAEKWREPAKRAA
                     TLSWGDQISKILSSTIIDVEPKKTKIWDTFRVAAKTEMTQLRGPDPAFLRQALRIFAF
                     MNPRTGKMDPLFDVSNIEDVGRAITITGPDTTIHQPQKADMMNEKNDPNILQAPLNSN
                     PMRPAASVSPSSPTTSPLNPKSLLGPGSLSPNKMNYRKKSMGIMRKKSHF"
     gene            complement(962598..963884)
                     /locus_tag="CNK03230"
                     /db_xref="GeneID:3254693"
     mRNA            complement(join(962598..962891,962951..963084,
                     963139..963251,963314..963389,963446..963507,
                     963675..963884))
                     /locus_tag="CNK03230"
                     /product="40s ribosomal protein s5-1, putative"
                     /transcript_id="XM_567915.1"
                     /db_xref="GeneID:3254693"
     CDS             complement(join(962748..962891,962951..963084,
                     963139..963251,963314..963389,963446..963507,
                     963675..963763))
                     /locus_tag="CNK03230"
                     /codon_start=1
                     /product="40s ribosomal protein s5-1, putative"
                     /protein_id="XP_567915.1"
                     /db_xref="GeneID:3254693"
                     /translation="MAAIQALPTEVQKIANEGTVKLFGKWESEGVEVKDISLQDYINV
                     NHAVYVPHTAGRYAKKQFAKGRMPIVERLVNALMMNGRNNGKKIMAVRIVQHAFEIIH
                     LVTEQNPIQVLVDAIINTGPREDSTRIGSQGTVRRQAVDVSPLRRVNQAISLLTIGTR
                     ESAFHNSKSVSECLADELVNAAKGSSNSYAIKKKDELERVAKSNR"
     gene            965171..966464
                     /locus_tag="CNK03240"
                     /db_xref="GeneID:3254661"
     mRNA            join(965171..965464,965868..966002,966143..966225,
                     966302..966464)
                     /locus_tag="CNK03240"
                     /product="cytochrome c oxidase subunit V, putative"
                     /transcript_id="XM_567751.2"
                     /db_xref="GeneID:3254661"
     CDS             join(965227..965464,965868..966002,966143..966225,
                     966302..966349)
                     /locus_tag="CNK03240"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit V, putative"
                     /protein_id="XP_567751.1"
                     /db_xref="GeneID:3254661"
                     /translation="MSILKLRSALAPLSARRFATAAPSVSVTSTRSNASAPLLGNIEA
                     SWKTLPAEEQYEVYQQLEQLQKKNWKELTIDEKKAAYFVAFGPHGPRTPANEPGHSLK
                     VFVGVAALVGTAYAVFELARSQAAPPPRTMTTEYQEQMNEYMRSQNMNPISGVSSEGY
                     KGKGMVQ"
     gene            complement(966159..966444)
                     /locus_tag="CNK03250"
                     /pseudo
                     /db_xref="GeneID:3254439"
     gene            complement(966735..969811)
                     /locus_tag="CNK03260"
                     /db_xref="GeneID:3254619"
     mRNA            complement(join(966735..967249,967345..967868,
                     967925..968331,968388..969811))
                     /locus_tag="CNK03260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658113.1"
                     /db_xref="GeneID:3254619"
     CDS             complement(join(966992..967249,967345..967868,
                     967925..968331,968388..969613))
                     /locus_tag="CNK03260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513757.1"
                     /db_xref="GeneID:3254619"
                     /translation="MLFTSKTFYHPLDAPPYPSDNISANASEDEDEINSQSSAPAFLP
                     NVHQHRRTRPNIDIGETAEDIVPRPESAPALIGTSVSRKDEEEEVDRSSSIGLAPQTQ
                     PKGPAISPFTCVFSSNASATNQPSKEPQPGKTKQLKKLIATYKKKAMRELEEQRSSQQ
                     DGGVSIQPSFSGKGHLHTGAAWKMGNSTKATKTIKGTMGPAFPQVEERLVDKEEVQFD
                     EKEEKLDEPRKRPINKGNRTESVLEEPKANALISKPLHNKALSSDLSQPHESNSNVEG
                     NGTGERLDTLAQVATDTSTLNLSIEFIPEDTSSTMSGGVDDKKDDSPCLKTDESPTLG
                     KPEEDITEKDDTTTPSSPHDEWKIESQKSTEPVLPQASKKSKGQRRREAARAKKIAEE
                     AEHEKGKLIPEFQLRQRPPDQVAQVVYKNGIPGVPFYRAEVVPGRTHKQLFANRFIPR
                     GKTFLWEPPLITLSGGFTTKEAEEVYASCTPDIKTRINALANARPEMGLYGRMSTNRI
                     PLGDMGRVGVFEKIPQVAYSCEANVRFLWAQDRFLGFLVALVDIPEGQKLSVRLEYAF
                     HPSAIRREKISQINATPCTCRLCSLPPLSRRYSDENRLTYHRLLASYPIISSSEPLSA
                     LFQIERTIELITLEGLWEALFDRFVDGFEICVRWADAKSAAEWAEAARDAAMLCQGDL
                     FGDSEFKERFTRDPELYDGWSKFGRTKLRGPTEAILKAAMGDYDFETAQIQARADRAA
                     RRAHIAAMSSHVQSSSSNFPKQPLINNTLPIDALVAAIEGKGEGEEGEGREGQGVTKW
                     KKVSKK"
     gene            970240..971618
                     /locus_tag="CNK03270"
                     /db_xref="GeneID:3254499"
     mRNA            join(970240..970431,970484..970852,970923..971037,
                     971112..971618)
                     /locus_tag="CNK03270"
                     /product="expressed protein"
                     /transcript_id="XM_024658114.1"
                     /db_xref="GeneID:3254499"
     CDS             join(970377..970431,970484..970852,970923..971037,
                     971112..971148)
                     /locus_tag="CNK03270"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513748.1"
                     /db_xref="GeneID:3254499"
                     /translation="MRTLTLLLSFGLLTSAIAAPAAHPRIPAFFLKDPLSIHRKSSIP
                     PPAAGDDELIKTAIKSLPYDLETEFTDDSGLVRFASPSSTSASSSSKSPVVQIEMDAY
                     EAEDAETEDTCANVCGVTRVEGAKSEQEALCSPAGLKATYACALCMDKVWSDKTWENS
                     ALAEYERIASACEGGDSSQRPIRRRSSPGSA"
     gene            complement(971800..975581)
                     /locus_tag="CNK03280"
                     /old_locus_tag="CNK03290"
                     /db_xref="GeneID:3254508"
     mRNA            complement(join(971800..972011,972093..972622,
                     972676..973109,973161..973750,973801..974058,
                     974121..974930,974987..975581))
                     /locus_tag="CNK03280"
                     /old_locus_tag="CNK03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658115.1"
                     /db_xref="GeneID:3254508"
     CDS             complement(join(971916..972011,972093..972622,
                     972676..973109,973161..973750,973801..974058,
                     974121..974930,974987..975310))
                     /locus_tag="CNK03280"
                     /old_locus_tag="CNK03290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513759.1"
                     /db_xref="GeneID:3254508"
                     /translation="MPLKLSRFFNPNLDKRPSKSNAGDECRLETSSLTSSHNSHQSAP
                     GFIPTMFSRRLLMTKRTDDTRLSRSKSALGTKVQKSPKKRSRVGLKEKYKWNKEYDMM
                     EDEMHEELTKQVSPPANDTLSVQSQKPNGSSSNNSHPLYHPVTGPPVGCPGYAWDPSQ
                     QTWIYIMPYGQPYSGPGWAPPKKAFQTLYPQAQGPDDYTGQGWYMPHKIQGPPIVKPL
                     PIKKEISYYYPTAIQMGHRHSYNQLTVDARPAQMASSLTYRVSTSNITYNQSSYYGQN
                     WEPPQAPSGANKPHFTRRPPKTHAKHASGFSVSQYNPSTFRRHQTDQVYQERLHSSSF
                     TNAEHSQQPSAHVFRKKPKSFYEGPSLSDIPDHDISPLLIGVNQIQDGQCSRESLNEL
                     RVQEFPPNDEKVYNHPPVTDDKEVKIEKTFIEQSAEEANRAQLTPNDKDMADHEAVIE
                     PGDIEAKQDLPSDKPQVTLLGVTTSPSITQGTFSTSASEAPDTASNVDQLDVTIITPI
                     SPLSQAAESQAPFSNEDEQRLETKDDEEEEWQYQRHQRKKMKNNFKTEPLTKPQDSKS
                     VLKDIDDEVSEPGKSTQGHDARVSIELENRQLDNISSCPEDAIEDAEEGGLTAHQDLT
                     TLKKSKGQKKRARAKAKKLEADGADNGEGNSPRRQKSSDASKFTRIAEGQRFSNNPWF
                     KEVHRGTGARYIAKRDIPRGQTIMKELALINLPYYQPRDSKQMDYLFEETEPRTRTKM
                     NNLRNHFPSIDSRLSRIKGNSITVNMEDGGYRLVVFENILRISKACRPNVRFIYLDPH
                     NPEVTIAYLVAIDDIPAGHELFIRYGPTFFGDRNQRQRLLLQETGSKCQCKDCSSQSP
                     AMVERSASNFRNYSWTMGRILRDGGGDYPSITLSRLEESLAIIAEERVWEHLFERFRN
                     AWELCGLWGDAESTRAWMRLGRYAAVYSLGDEVGPMEYEECAKDPVTYPWFGSRGRAK
                     LHGPSKDLLLRTLGPIAHAQINPLTGKEVTLDELVAEIEGW"
     STS             973800..974567
                     /standard_name="Bam8"
                     /db_xref="UniSTS:470703"
     gene            complement(975671..975753)
                     /locus_tag="CNK03300"
                     /db_xref="GeneID:3254571"
     tRNA            complement(975671..975753)
                     /locus_tag="CNK03300"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:3254571"
     gene            976588..977819
                     /locus_tag="CNK03310"
                     /db_xref="GeneID:3254688"
     mRNA            join(976588..976825,976895..977207,977264..977414,
                     977490..977819)
                     /locus_tag="CNK03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658116.1"
                     /db_xref="GeneID:3254688"
     gene            complement(976673..980151)
                     /locus_tag="CNK03320"
                     /db_xref="GeneID:3254460"
     mRNA            complement(join(976673..978371,978428..979744,
                     979804..979997,980055..980151))
                     /locus_tag="CNK03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658117.1"
                     /db_xref="GeneID:3254460"
     CDS             join(976780..976825,976895..977207,977264..977414,
                     977490..977654)
                     /locus_tag="CNK03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513799.1"
                     /db_xref="GeneID:3254688"
                     /translation="MRSVTLLPILGAISVTAMDIIEPRHMSLISRQLDSSTIPAACQS
                     TCQSAMSIYSDCTSGDTSGCRQVCQQSIFNEFIDCLDCTSEQLAMTTSEQSLLNSAVE
                     QLKDVCGQTGSSVTGTLAGVSVTTSPIASGSAAASATSAVSDILSFTSAASGITIGSG
                     VSGTASEAVTTTSSSPGVATNAATSGANSGAVGEASAAYPVMGGKLVGSGVAAFVVIA
                     GALFVL"
     CDS             complement(join(978296..978371,978428..979182))
                     /locus_tag="CNK03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513758.1"
                     /db_xref="GeneID:3254460"
                     /translation="MRIPSTHDAAVCNAFDPRDRSPLLTKLKWDILLQGIPPENIIHL
                     VSNPTKDEPLYYNNLLKVWVQSFFMDINNYLAKNQDSPLLQQVMYLGFDLEVVSDKRM
                     RNLNDKTVENYSQLFFKLLLFLIRYHITDTHPDIKLDLTSTQQDHIDKLLDVLSEGDT
                     SSSSKEAGLQVILDLGYSLLQQGTTSVNNSSWDQIIYKFLVYTSVREGGVFEEATNIA
                     PRVTRLLWLFRSVVIKKVMTELKDFKGTPEEIHEVSMSYTKSTQQSTPWTLPDTSVSR
                     "
     gene            980644..982622
                     /locus_tag="CNK03330"
                     /db_xref="GeneID:3254687"
     mRNA            join(980644..980870,980931..980977,981038..981356,
                     981452..981603,981670..982175,982234..982622)
                     /locus_tag="CNK03330"
                     /product="prephenate dehydrogenase, putative"
                     /transcript_id="XM_567917.2"
                     /db_xref="GeneID:3254687"
     CDS             join(980820..980870,980931..980977,981038..981356,
                     981452..981603,981670..982175,982234..982499)
                     /locus_tag="CNK03330"
                     /codon_start=1
                     /product="prephenate dehydrogenase, putative"
                     /protein_id="XP_567917.1"
                     /db_xref="GeneID:3254687"
                     /translation="MSDEQCQPVVGIIGMGDMGRMYAKRLHAGGIETIYVCDKPDSFE
                     ALEEEFKGTGIHVLRNGHAVSRLSTFIIYSVEAAALPAVVREYGPSTRVGAVVAGQTS
                     VKAPEREAFERWLPEDVGITSVHSLHGPSVTTEGQPLIIIHHRGPEENVKMVEDVFRS
                     FKSRYVHLSYEEHDKVTANTQAVTHAAFLSMGTAWQKSSSYPWETTRYVSGIEVIKVN
                     ITLRIYSAKWHVYAGLALLNPSAKSQIQQYATSATELFKLMVEGRGEELEDRVWCARK
                     EVFGWRRGEEAGEGDEARAPILLSEDVLDQFSLGKTTSGAQPRESPNSHLSLLAMVDC
                     WAKLGIRPYEHLDVAGTPVFMLWIGVAEYLFRSPALLSAALRAALADRVHRPDDVEFV
                     VAARGWSECVDVGNFDWYRRRFEETSNFFAPRFDEATKLGGKMIKAIQDGMKGR"
     gene            complement(982559..983654)
                     /locus_tag="CNK03340"
                     /db_xref="GeneID:3254677"
     mRNA            complement(join(982559..982709,982775..982864,
                     982927..983081,983281..983317,983369..983477,
                     983539..983654))
                     /locus_tag="CNK03340"
                     /product="hydrogen ion transporter, putative"
                     /transcript_id="XM_567918.2"
                     /db_xref="GeneID:3254677"
     CDS             complement(join(982692..982709,982775..982864,
                     982927..983081,983281..983317,983369..983477,
                     983539..983633))
                     /locus_tag="CNK03340"
                     /codon_start=1
                     /product="hydrogen ion transporter, putative"
                     /protein_id="XP_567918.2"
                     /db_xref="GeneID:3254677"
                     /translation="MSTVAELCPVYAPFFGAMGCTSAIVFTCIGAAYGTAKSGVGISA
                     MAVLRPDLMMKCAIPVVMAGIIGIYGLVVSVLISGNLASPMPLYTGFIQLGAGLSVGL
                     AGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILNTNSAVD
                     YTCSIAA"
     gene            985164..986964
                     /locus_tag="CNK03350"
                     /db_xref="GeneID:3254645"
     mRNA            join(985164..985609,985674..986302,986363..986380,
                     986438..986546,986631..986964)
                     /locus_tag="CNK03350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658118.1"
                     /db_xref="GeneID:3254645"
     CDS             join(985270..985609,985674..986302,986363..986380,
                     986438..986546,986631..986716)
                     /locus_tag="CNK03350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513800.1"
                     /db_xref="GeneID:3254645"
                     /translation="MLPRTVLFRLNHIPRPFCHRPNILAPTIRPFSTSLPLFSSSSSS
                     NSNSNSNSNSNSDSQPGRKVDDSEGKRERPKATHPTKHKPRAVSSGRPVAEHTKEDEK
                     KRSGLPEQPDETVLSSMQAPQLFTLGERTVVITGGGRGLGLTVAQALLESGSHVVCLD
                     LLPEPSEPQWGNAAKYAKQQGLRLDYVDLDVTDQDEVKRVFKQVFESAPPHAPVRGLF
                     TSAGIQVMMPATCYDTAKFRKVIDVDLTGTFLCAQAFAHEWFERHPNIDGAAGVKGAS
                     IAMTGSMSGHIANLGIECAAYNASKAGVIQLAKNLALEWSRRGIRVNTLSPGYIRTAL
                     TAAQLDEKPELRDIWLKGSLLGRLSTPDEFRGPVVFLLSDASSFMTGADLLIDGGHCA
                     T"
     gene            complement(987074..992383)
                     /locus_tag="CNK03360"
                     /db_xref="GeneID:3254653"
     mRNA            complement(join(987074..987274,987366..988824,
                     988873..989042,989114..989640,989754..989821,
                     989947..990048,990174..990544,990625..990679,
                     990763..990891,990955..991061,991139..991492,
                     991557..991727,991792..991908,991970..992112,
                     992162..992383))
                     /locus_tag="CNK03360"
                     /product="inositol-polyphosphate 5-phosphatase, putative"
                     /transcript_id="XM_024658119.1"
                     /db_xref="GeneID:3254653"
     CDS             complement(join(987177..987274,987366..988824,
                     988873..989042,989114..989640,989754..989821,
                     989947..990048,990174..990544,990625..990679,
                     990763..990891,990955..991061,991139..991492,
                     991557..991727,991792..991908,991970..992112,
                     992162..992352))
                     /locus_tag="CNK03360"
                     /codon_start=1
                     /product="inositol-polyphosphate 5-phosphatase, putative"
                     /protein_id="XP_024513801.1"
                     /db_xref="GeneID:3254653"
                     /translation="MSILQRRIPSLGADLQLTTWQRLFRHTHTVVAAHPCRVRAHYNP
                     FLHASAVLVVNKEQQTEAAAVFIITAPEDGKQPDILYIIPIIPSFKHNLEQTPPSPST
                     SFFHQSAKPHITLFLSCEDTTVELRIAANQSAKIQKFVAELRKYSDLANNTLYPSSLT
                     HAWIGLYPVNPPADEDADAPAVDSGKVIVVDHGEKTENTPTVTPAASNATLPPTTSLS
                     EIPSPTTPTSTSKSPLDKPEVNTTTIKQAEDLQPNPYLPTFSRTSFLRSRLFSSLPNW
                     SSSVPIKIRTVSYNVNDKVPPKGTLELKGLVGGDDEERSDLIVVGLQEADLRSQALLI
                     SQGNSRADSWETALFAGLGDKAGEYEKLVMTQYVGVVMIILVRKSLRPHISRVESSER
                     GIGLLGFGGNKAGIAVRLKVHDTTLCFVNCHMAAFTSALDRRRQDYQILRLGLNFPRP
                     LSSASLTSAPLSSSSTISISVPPTSSASSVSSGTLTSGAGTGAGTGTTGAAESGVTGQ
                     SKEEAKLEEQAETINPVFEEFWPEVKDKLLTLEDCHLLFWMGDLNFRVDLPDGEVRKL
                     VENKDWAGMLVRDQLKNDIKEGKSFVGFEEAEITFPPTFKYVHGSSTLDTKRSPAYTD
                     RILYSFPSPTSTSSTPLSPCVPLSVKKGEYTSHEELKWSDHRPVSCVFEVGVRKVDAE
                     KRREESRRAQKELDRLEEVWRPSLEIKVLPESRDAKTDEEGNAKNEKEEVRQEDEGGI
                     HFGQVRCREKKERMVKLRNGGKVPASWSFRKAGTGRDICKPFLWPFPSSGRVEPGEEM
                     VLTIVLDVNEEWAAKLSLGEEDGNDVLVLQVEGGKDTFITVQSIFLPSIISLPLTFLS
                     ALPSPIRDLSLSERKSLFRSLLETAEKQTATNDKGAAAVGSTPFKPVKEIWTLLEYLM
                     ANPPSLSTWCRPSLYTSSFSSSAHSAGIQTIMEHLNTLPSTIPLPPDVPHLIPPTLIY
                     LLSSIPGGLLPESVQAQIERNGVEDRDAAFGVLEGVKMVSTNTLIGLVSVVRLCLGQV
                     MGAQQESAKIEEEEESKEHVERERKVDESKPDSSVAEGSVDSASNLATPSTPESNTQA
                     NRKSIDRSSLLSNANSSGNDHVKLEYAQESKDDTGNPEPEGGALFELGDDEDEDDEGE
                     VKGDAENEEVEVEGGGVPEMEEESKDLSDEIKKDKAEKNEKDLKAKDEPTLSPAASVP
                     ITEPKADPKPSLQPAAELTPSKAKPKMKRAKSLAEESLGEESPIVDDVNGDPDGDGIE
                     KRSGNVEIGDVPEDQVKKLDAEALETPKAQGRLLAGTASAAAGAGAATKEEEVSTIDK
                     LVDVLCPAVFGRVQVSAVGRERRKKFIKLLLEG"
     gene            992571..994035
                     /locus_tag="CNK03370"
                     /db_xref="GeneID:3254639"
     mRNA            join(992571..992883,992953..993286,993363..994035)
                     /locus_tag="CNK03370"
                     /product="expressed protein"
                     /transcript_id="XM_567921.1"
                     /db_xref="GeneID:3254639"
     CDS             join(992590..992883,992953..993286,993363..994009)
                     /locus_tag="CNK03370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_567921.1"
                     /db_xref="GeneID:3254639"
                     /translation="MSGPVTRIPRGFQHLVSTKPNKFAGKTPSRFPHPTTKFVQPYDR
                     IRKWNIRPGDRVRLVAGKPKEKYRNEETAEEGYKVYTVKQIDLARNWVFLEGIHNLKS
                     QIIQDRPYNWDQLSETQKKSYEDQKNFIPILRPVHYSNVQLCLEDKDGPDSIYASRLK
                     TSSTHFNPKTQRIDWRRYATKLSGPVSAENEKAVRINWPKPEKEFVFPGPDSMLDTPN
                     AVTLQPTLNLSPLPPLTSTPLVDIFPQHINSPPPASQGLADEYLRPHSERNTEEIIAA
                     DTLMPLYLSEELAPRWAKSKMWKAYKARREAAELEKRMIGKQAVEEWETQGRDRGLKA
                     VIDLEAVGLEGVFLRGRTRAEVRQAAEGEYEAANAEVQAEVAQHVKEGRLYDPELGLW
                     YNGRKAENKERKRERKERKERKVLERMERLAI"
     gene            complement(994075..998593)
                     /locus_tag="CNK03380"
                     /pseudo
                     /db_xref="GeneID:3254573"
     gene            998729..1000187
                     /locus_tag="CNK03385"
                     /old_locus_tag="CNK03390"
                     /db_xref="GeneID:36393114"
     mRNA            join(998729..999197,999306..999905,999971..1000187)
                     /locus_tag="CNK03385"
                     /old_locus_tag="CNK03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658819.1"
                     /db_xref="GeneID:36393114"
     CDS             join(998790..999197,999306..999905,999971..1000000)
                     /locus_tag="CNK03385"
                     /old_locus_tag="CNK03390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514652.1"
                     /db_xref="GeneID:36393114"
                     /translation="MPGSKRRALKKLLSPNHSPFTPDSPSADTTPSSALSPQPQLPPA
                     IDDGAAAQAAAAGISPQELQDNAVLEDMHEREKEIGHASSPAGLRGVISPSPSSVSAQ
                     GQETKSGGMYANANGGGGGGKKKKSSRQRFEERQARKQEALLESAPPADPEWTAQLEK
                     ERQEEIKVISDACIALNCELFEIAPDGHCMYAAIGDQLGLLGIVPVEEATDPRAIRRM
                     AADYMLSHPDDFMPFLPSIAGEDTPDATSDGMITHSGFAQYCKAVAETGEWGGEPEIQ
                     ALSRAYGVPIHVIQRGPPTVVSHGGKDDSFGGGLTAEESGRQGKRVVRISYHKRMYGL
                     GEHYNSLRPVV"
     gene            complement(1000174..1001804)
                     /locus_tag="CNK03400"
                     /db_xref="GeneID:3254550"
     mRNA            complement(join(1000174..1001358,1001417..1001804))
                     /locus_tag="CNK03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_567923.1"
                     /db_xref="GeneID:3254550"
     CDS             complement(join(1000383..1001358,1001417..1001769))
                     /locus_tag="CNK03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567923.1"
                     /db_xref="GeneID:3254550"
                     /translation="MVFQSPMQSPEMSSQARQQAPSPPAPTNHLHLHLHPAPRTSSHS
                     SNSDQSPINKPEQAHVWVVEEETEQEEGQGLVKRGEEVPPAVDTVWCDSSAEIVLVSS
                     DNVAFHVPAYHILSQSIALRDAIQIDSTFSSSRSLSSSSPITIHFSDEECETSDAIRL
                     FLFLISPHPLPPASPSQSPSFPQLHSHLHSSSPPSTLDDYILSHPTTITLHLLSTILF
                     LQKYDCPLALSLLSAHLRHHALTKAHISREICALDLFLIGAKTGIEGLCVDAVKGYKP
                     RVGSGDEAEVEEDERAYSLGLGLGLRYGTNGESGNEGADHRGRQCSTDSTPFSPYQQP
                     LPPSGRSSSPSGSSSPPPPMHDGRYSWGLYTGLNPSHFPILAWEGCPPLFCWALSKAV
                     GAVKPGDGLGSRSRSGVEEEGAGKGSGRKGLWEKRGEVLEGILEEVRFLR"
     STS             1001559..1002519
                     /standard_name="EcoV3"
                     /db_xref="UniSTS:470706"
     gene            1002264..1004245
                     /locus_tag="CNK03410"
                     /db_xref="GeneID:3254608"
     mRNA            join(1002264..1002683,1002753..1002802,1002867..1003303,
                     1003355..1003378,1003453..1003803,1003931..1004245)
                     /locus_tag="CNK03410"
                     /product="protein N-terminal asparagine amidohydrolase,
                     putative"
                     /transcript_id="XM_024658120.1"
                     /db_xref="GeneID:3254608"
     CDS             join(1002576..1002683,1002753..1002802,1002867..1003303,
                     1003355..1003378,1003453..1003803,1003931..1004046)
                     /locus_tag="CNK03410"
                     /codon_start=1
                     /product="protein N-terminal asparagine amidohydrolase,
                     putative"
                     /protein_id="XP_024513802.1"
                     /db_xref="GeneID:3254608"
                     /translation="MSTSQTPTLPPSRPSSPAPLYRRTPLKVGCVQYDVKLGRVKENA
                     AKVEELTKWMKPGHVDLLVLPEMCLSGYVFNSPISILPYLEAPRIGPTSLLARALATR
                     LGCHVIAGYPEEIPSSGSPSSSPTEIADAAPKELEGEAEGVGYNSAVIVSPTGEVVGN
                     YRKTFRFETDKNWAREGDGFQYFDLSEPLGRVALGICMDLNPKDFIAPWDAFELANFC
                     RDNAVDMLVIPMNWLSPPAEPPTTTSASGEEPSHPVEPPEDPEAPSESNLNYWAARLV
                     PLHDPTPRYSTAPSTSTSTPIPGSGSGKDGEGKEVVFVACNRIGEEEGSKFIGTSCVM
                     TVSNTPSRIELVECCNISEERVMIAVV"
     gene            complement(1004365..1005923)
                     /locus_tag="CNK03420"
                     /db_xref="GeneID:3254609"
     mRNA            complement(join(1004365..1004768,1004830..1005011,
                     1005369..1005715,1005776..1005923))
                     /locus_tag="CNK03420"
                     /product="adenylate kinase, putative"
                     /transcript_id="XM_567926.2"
                     /db_xref="GeneID:3254609"
     CDS             complement(join(1004536..1004768,1004830..1005011,
                     1005369..1005715,1005776..1005823))
                     /locus_tag="CNK03420"
                     /codon_start=1
                     /product="adenylate kinase, putative"
                     /protein_id="XP_567926.1"
                     /db_xref="GeneID:3254609"
                     /translation="MSGNSEVEYLKSLVSQLQDKIHHLEKSTSTSVSNTISSVTSALS
                     PSSSIKPPRMVLIGPPGAGKGTQAPNISSKYCICHLATGDMLREQVARQTELGKAAKQ
                     IMDQGGLVSDEIMVGMIKQELEKNAECKNGFILDGFPRTVPQASKLDAMLAERKQAID
                     HAIELKIPDVLLISRITGRLVHPASGRSYHKEFNPPKKPMTDDITGEPLIQRSDDNVG
                     TLRKRLDTYHAQTGPVVDYYKGTGVWTPVDAAQSPKLVWASISSILESKKN"
     gene            1006260..1007717
                     /locus_tag="CNK03430"
                     /db_xref="GeneID:3254557"
     mRNA            join(1006260..1006488,1006550..1006657,1006718..1006928,
                     1006986..1007033,1007120..1007294,1007358..1007717)
                     /locus_tag="CNK03430"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_567927.1"
                     /db_xref="GeneID:3254557"
     CDS             join(1006377..1006488,1006550..1006657,1006718..1006928,
                     1006986..1007033,1007120..1007294,1007358..1007633)
                     /locus_tag="CNK03430"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_567927.1"
                     /db_xref="GeneID:3254557"
                     /translation="MLGYFAALALALPALAQSASNGSASAVDIEGLQANFQQAELTPQ
                     LLETFEPEALLSVTFGSTAISTGDTLDQDAVSSSPTLAVSPASNATLESGQLYTVVMV
                     DADIVGTDESTTEQTRHWLVNSASLSTDSAPYAVNWTGSTSITDYAGPGPASGSGSHR
                     YVIIVYAQPDTFSPPANLSQAGTPLSTMSLSSYVSESGLGNLITANYFQVENGEATVT
                     VSSTSAVDSSTLAGYLSTTAASSASSAASGTASGAASNSAATSATDSSATSASSAPAS
                     SDSSSRALRSEMGFGMVVGVVGVVGAVLGAGMV"
     gene            1007906..1010761
                     /locus_tag="CNK03440"
                     /db_xref="GeneID:3254558"
     mRNA            join(1007906..1008365,1008455..1008618,1008683..1008713,
                     1008778..1010761)
                     /locus_tag="CNK03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_567928.2"
                     /db_xref="GeneID:3254558"
     CDS             join(1008617..1008618,1008683..1008713,1008778..1010655)
                     /locus_tag="CNK03440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567928.1"
                     /db_xref="GeneID:3254558"
                     /translation="MPLPVERSQGSVSALVARFQTAANREKEASEREKDKDKGRVSLG
                     EGRRVSDALAAQEGVSNADSSSQPTASANTKTVPIESSGEKDTTKGNAPETQSHSLPH
                     VSSIATSQNRNDTARVSPSAPSTTPAKSTSVSSTKSSIGRTSSIKAHTPTPAQAQNRS
                     KANKPRTVSTQHNAKQVTVSPSPSTGTSPRSTAANDNTCTTTPLKPQLTGTPSKPTAS
                     SLAKTRSPPSSRPPNSTSMRSPPPIDDPTATGTERRSSSSSGRRDSVKSPLSSSGSLM
                     GRSSLGRAASARLSQTKSPEVTPLGEDGVGSPKAQPQEKNKDGTSANGSIRRASGSRL
                     MQGTAASRARAAANANAHSSSISSNSHVPISSTSSPASTNVVRPRASISTPVSNSKKP
                     TSSGNDKNNGKRLTPKSNSKDAPTRRPNVSSVAKEGEENPAMKPVGRNPVGRLGLAAA
                     REKKGENEDEIQAPHPPPIGKLGLPAAREKTGTAEGKQRRSNIVKPSEQQTHHVEAEL
                     EHEQEAESEAVVGEEEKQKNDEIMSEPAAEAEEELEEKDGQVDVGLGAGAGPSSFSTI
                     GMRPEGVQTRPDEVEDGEETKCAGEPTEPLELAAEEDNSRQTKGINEANEANEANETN
                     DRDDSEGEKERE"
     STS             1010104..1010408
                     /locus_tag="CNK03440"
                     /standard_name="Hae1"
                     /db_xref="UniSTS:470704"
     STS             1010381..1011163
                     /standard_name="Eco3"
                     /db_xref="UniSTS:470705"
     gene            complement(1010897..1013234)
                     /locus_tag="CNK03450"
                     /db_xref="GeneID:3254507"
     mRNA            complement(join(1010897..1011090,1011175..1011376,
                     1011441..1011496,1011551..1011781,1011833..1011905,
                     1011961..1012210,1012270..1012362,1012413..1012512,
                     1012578..1012847,1012912..1013234))
                     /locus_tag="CNK03450"
                     /product="tartrate transporter, putative"
                     /transcript_id="XM_567727.2"
                     /db_xref="GeneID:3254507"
     CDS             complement(join(1011031..1011090,1011175..1011376,
                     1011441..1011496,1011551..1011781,1011833..1011905,
                     1011961..1012210,1012270..1012362,1012413..1012512,
                     1012578..1012847,1012912..1013088))
                     /locus_tag="CNK03450"
                     /codon_start=1
                     /product="tartrate transporter, putative"
                     /protein_id="XP_567727.1"
                     /db_xref="GeneID:3254507"
                     /translation="MIASPSPIDDQSIMSEVKSEEHFQLDEIDYSPEDEARAVRKVDF
                     LVLPAIVFCFLMLQFDRTNLGNAQTDTTFLPAVGITTSNINIGQTLFTLGFVIFELPS
                     NMLAKILGPHRWVPCIIFIWGLITLCQAFLTSKGGFYATRFLLACGEAGFIPGMAWYI
                     TRFYQNGELSLRLAIFWAANSFAGMVSGPLALGILQGLNEKHGWHGWQYLFAIEGAMT
                     MGVAIFALLYLPASPLDGGRSLLIPVLNSRDAQILAARILADDPKKAFGRGSKITLVD
                     IKDTFVDWRLWGHCAAAFLSSIILTPINTYGPKVIQSLGYSGFTANGMAAPASAIGLV
                     YSVSLAWSSDRFRERGIHIFTAMALSCAGCLWLALAPDSAGKRVLYGGYLLTAGTMGC
                     GQAINASWVSSKFDERRRPVALATYVAFIQMAGFAGSNVFKTKDAPRYKDGLIVCGVC
                     SVVGGVIMLVWKLLYIWDDRRAKEGRRSESSPELEVHHFSDERSIEGKVKAEK"
     gene            1013537..1015310
                     /locus_tag="CNK03460"
                     /db_xref="GeneID:3254491"
     mRNA            join(1013537..1013651,1013742..1013861,1013917..1014057,
                     1014115..1014203,1014259..1014355,1014433..1014590,
                     1014656..1014809,1014872..1015310)
                     /locus_tag="CNK03460"
                     /product="PQQ enzyme repeat, putative"
                     /transcript_id="XM_567728.1"
                     /db_xref="GeneID:3254491"
     CDS             join(1013757..1013861,1013917..1014057,1014115..1014203,
                     1014259..1014355,1014433..1014590,1014656..1014809,
                     1014872..1015228)
                     /locus_tag="CNK03460"
                     /codon_start=1
                     /product="PQQ enzyme repeat, putative"
                     /protein_id="XP_567728.1"
                     /db_xref="GeneID:3254491"
                     /translation="MDQNITRRRGVGTRGVDEQTALNGYTVIAPLTSKNVFLIDNSGE
                     VVHKWDLPYRVGRYARILPNGNLLVGMKDPEAPAPFPFFLKYGGGIYMELDPEGNVVN
                     ELRDPLGHHDCFYEGDGHFFYAGLEALSPEQQAALPGGVPGTEAPDGKTYADTIREVK
                     DGKLVWEWKVSEHLDPKIFPLQHYYPREHWPLINAIYPLKDGNILASLRSVSAVIIIE
                     KATGKIIWHLDSTVVAQQHCANELPNGNILIFDNGAFRHRESFQWSRAIEVDRATKEI
                     VWQWHAPTKETFYTPFMGSAQRLPNGNTLVCESAFGRVMEINTENKVCWEYVCPYFAV
                     YPEKNAAGFYPSESNALFRAYKYAPEEIPWLK"
     gene            1015812..1017763
                     /locus_tag="CNK03470"
                     /db_xref="GeneID:3254486"
     mRNA            join(1015812..1015888,1015944..1017763)
                     /locus_tag="CNK03470"
                     /product="conserved expressed protein"
                     /transcript_id="XM_567729.2"
                     /db_xref="GeneID:3254486"
     CDS             1015993..1017723
                     /locus_tag="CNK03470"
                     /codon_start=1
                     /product="conserved expressed protein"
                     /protein_id="XP_567729.1"
                     /db_xref="GeneID:3254486"
                     /translation="MSPTKTPNGDMNLAAPDVDSYPYNLGSYSCKVNTNSKDCQTWFD
                     RGLIWSYGFHHEEAERCFRYAVHCDPHCAMAHWGIAYAGGPNYNKAWERFDEADLKRA
                     LHECHLATSKARELATAPLEVALVGALCARFPSEREGDYQHWNRSYSEHMDQVYEKHG
                     DHLDVVALYADSLMALAPWQLWDLHTGAPREDSQTLRIESILEKAFQRPESLSHPGIL
                     HFYIHLMELSSKPELAIPAADRLRNLCPDVGHLNHMPGHIDLLIGDYRRAIASNIEAI
                     RGDELYMKHGSTTDFYTFYRLHDYTFPIYAGMFNGQFRIAMDTVERMEKSLTEDLLRI
                     PSPPMIDWMEGFKSYRVHVLVRFGKWHDILQLPFPNDRQFYCVTTTILHYARALSYSV
                     LDRVEDALKERELFRESRRKIYPSRFEFPNSWQDILNVAETMLTGELEYRRANYTLAF
                     EQLRKSIKYYDNLIYAEPWGWMQPPRHAYAALQLEQGNVEEAAKTYAEDLGYVDSLPR
                     AVRHPNNVWALHGYHECLVKLGRHGEAKILEPQLILALAVADISIESSCFCRRMQPAA
                     NQSMCCKSIG"
     STS             1018683..1019208
                     /standard_name="Taq2"
                     /db_xref="UniSTS:470707"
     gene            complement(<1018826..1019636)
                     /locus_tag="CNK03480"
                     /db_xref="GeneID:3254481"
     mRNA            complement(join(<1018826..1019305,1019385..1019636))
                     /locus_tag="CNK03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_567753.1"
                     /db_xref="GeneID:3254481"
     CDS             complement(join(1018826..1019305,1019385..1019426))
                     /locus_tag="CNK03480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_567753.1"
                     /db_xref="GeneID:3254481"
                     /translation="MMLHRVDCITTNKHHLATSLSSLEDQSISAAFDRSTLRVVSLHD
                     RTPRGQVITRYVSSAIHNFSSSTGATALTPWFSKFRMGVVARDGTCLVTDVMHSYCTS
                     CHIVPLSRPDVSATGTSWRHPPQFPSIAICRHCLFLVRYINLSSVSIKILRYTKLQPD
                     CWFGMTFIMHTIA"
CONTIG      join(AE017351.1:1..1019846)
//
DBGET integrated database retrieval system