GenomeNet

Database: RefSeq
Entry: NC_006693
LinkDB: NC_006693
Original site: NC_006693 
LOCUS       NC_006693            1194300 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 8
            sequence.
ACCESSION   NC_006693
VERSION     NC_006693.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1194300)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1194300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1194300)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1194300)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017348.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1194300
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="8"
                     /note="MAT-alpha"
     gene            complement(<77..2412)
                     /locus_tag="CNH03875"
                     /db_xref="GeneID:36393025"
     mRNA            complement(join(<77..490,538..841,894..1026,1075..2021,
                     2075..2412))
                     /locus_tag="CNH03875"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658664.1"
                     /db_xref="GeneID:36393025"
     CDS             complement(join(77..490,538..841,894..1026,1075..2021,
                     2075..2295))
                     /locus_tag="CNH03875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514582.1"
                     /db_xref="GeneID:36393025"
                     /translation="MASAPIASASEQPLTSTNPQLGPEPYFTYPTPTPDQLEEELPPY
                     FENENVSLGLVLDRFARKGNHDLRVLLGEVLPQLSIRERPKPIIEYAKTTRQALLKYL
                     AVLRWKTSVDIASTSTGSSVANTAGPASFPTPHSNNDPNDNSPDAFAGKGKSKTQADE
                     SVIKGKVTDAKRIAHFMEHQNQQHEVAIEHVKHVTKVVEGLRERNPDLLTALSLLATG
                     TYNRLPASLVDPYLPKPVLTNSAILKVLRRLNRQIRYRLRCLDYLPPELIVEDIKDGR
                     MYARGDGWRAELTVVGFEDTSRWWLTGVEWGWKAKEKGVDDPGGRVTKKFTGEERQGI
                     LDIANGEVLPPRELPENEMEVDTVITEDPQVKKSEVVEVVKKTVDAPLVRVYNLLQHL
                     SLSYRLEVLFTQAIALSQGKWRGQLIPEMDREDKTLRLKYWLRERPMQVQRQDSTSIK
                     RPQAPATLPASRQTMVGGIIHITLAEKTTPRSELDNLLSDIACGGLVPSERVLRLELN
                     VKWVVDEAGVGGGLKSGDVMDNSMLHLDPDALSVEDLLHVCTRTHASHLTRSHGTSLL
                     TSPRFLNASSVQPSLQESTDPSARPLTLRVPLPSRYAVSHLLIGVSSFSGLLEVEDEG
                     AKGNDARAERAAMSMKSVNEGKTKLVDDITRLTTAVSSVNKWFINVKY"
     gene            2802..5415
                     /locus_tag="CNH03870"
                     /db_xref="GeneID:3259319"
     mRNA            join(2802..2935,2984..3518,3572..4178,4227..4418,
                     4471..4619,4679..5415)
                     /locus_tag="CNH03870"
                     /product="xylulokinase, putative"
                     /transcript_id="XM_024657754.1"
                     /db_xref="GeneID:3259319"
     CDS             join(3243..3518,3572..4178,4227..4418,4471..4619,
                     4679..5335)
                     /locus_tag="CNH03870"
                     /codon_start=1
                     /product="xylulokinase, putative"
                     /protein_id="XP_024513416.1"
                     /db_xref="GeneID:3259319"
                     /translation="MTSPLFLGLDASTQSLKASLLSVNLDVVAECAIHFDSDLPQFGT
                     KGGVHFGSDGQVHSPVMMLVGAMDLLFDKIKIAGWKVDDIRGVAAAGQQHASVYWSKT
                     SPKILASLNSSLPLSSQLVEAFSRPIIPNWQDSSTTAECQALDAAVGGPAALAQLTGS
                     RAYERFTGAQIMRFKRVDPVAYDQTDRIGLVSNSVTTLLCLDGEVKGIDESDACGMNL
                     WTMNRKQRGWNQELLKAIAGDDGAAELSRKLGTVETDGGRVVGRIGKWFVDRYGFSSE
                     CCVFPGTGDNPATFLSLTLRESEGLVSLGTSDVVLISTSAYHPDPDYHAFFHPAQIAP
                     PSEQDDQNRQGAEPLRYFNMIVYKNGSLTRQHVRDLYFDGSWDKFNAAIEELRPKSVI
                     DLPSRTAFWWLLPDIVPHGAHGIYKYITEPTAGTLFEVPAAKKVDQFPDIRQEALALL
                     ESQLFNYRSRASVILDDSSTPYDPSSPNVDAFLPRLTKVYATGGASANRTILSLMADV
                     LSTKVCKNVEYLDGKWKDADWNACSVGVAYKARWGWERVIAADGDERKWVGFDTVIRE
                     CREARKKIRGDEGRGLELEEEGIRIVASPGPGSRAYERRIEWWRELERKALAEQRAEK
                     TA"
     gene            complement(5971..8335)
                     /locus_tag="CNH03860"
                     /db_xref="GeneID:3259356"
     mRNA            complement(join(5971..6973,7029..7886,7931..8335))
                     /locus_tag="CNH03860"
                     /product="expressed protein"
                     /transcript_id="XM_024657753.1"
                     /db_xref="GeneID:3259356"
     CDS             complement(join(6069..6973,7029..7886,7931..8240))
                     /locus_tag="CNH03860"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513415.1"
                     /db_xref="GeneID:3259356"
                     /translation="MPTRLSQRSALAPTRILEPKRHSSDQSFGGIKLQIRQRVPQLSI
                     SKDKFRNESLRTKTLDQQEKEDGEFYYQQEDAGMPSEAYVCEKNIAKKPSRPFVSKGS
                     HQLKVIASLPSISTSPSAFSFPEQPLRESISKSIDLWFDDFKTDSFISTSTIDNPPPT
                     PPPKITIESDEQPTPKATQVAFNIATAVREAPSINSFTANGSFLGLPEEADMLYRSNI
                     VWGDLDHSEDQQTSHKKLAAAQHLSPASAGSQKHIKAADLRFEDAESEASRARNEGSC
                     DLNDNTEKSEPLDKPLPHLPDDSGPSEYSMTTYSQSSAIISKTAESPEVLHSLNSQPL
                     PQWKSSTPRRLRHHTVSTKSYEHCDEPEQGEEEQGAAVRNQTRHSSSGWEPPRQDAQV
                     KPESTRARHGKAGSVSSTATAKTIGQSHYPAGSTLTRNHIRAVAPQETSRLVIDHSIA
                     PAKPIMDTVTNRINSAKGSKSTRGSFELNDHAVVRASTAENQTIHSLVEDDDVEIIGD
                     FTFASSRRPSVSSSVKTMGTVSFASATAARAPRISLRSPHDRNTSSQDSPAQHPVRAR
                     SQSEDPVPRCIFGISAIFSQSKPGPNRKGHRSILDPFSSFDPHVPIVPCKTVPNDNWI
                     LITNTAEDDILRPGWKDVEMRWVEGESFGGWMMRRIRGECWNTVVAREKRADEQLRMM
                     ELRDGKGG"
     gene            complement(10492..11349)
                     /locus_tag="CNH03850"
                     /db_xref="GeneID:3259170"
     mRNA            complement(join(10492..10623,10675..10759,10812..10858,
                     10914..10960,11011..11088,11150..11237,11286..11349))
                     /locus_tag="CNH03850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572580.2"
                     /db_xref="GeneID:3259170"
     CDS             complement(join(10552..10623,10675..10759,10812..10858,
                     10914..10960,11011..11088,11150..11237,11286..11288))
                     /locus_tag="CNH03850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572580.1"
                     /db_xref="GeneID:3259170"
                     /translation="MSRTVDIPQDVLDALKQFRFKNSKGTTAISVKIIKNSLTMAVDE
                     EFEGQSIEEIAEELPENAPRYVLLSHELKHKDGRISYPLLLINWAPTTSPIELMTLHA
                     SSLSYFQQVSETAKVLEARDGAEGLTTEAVDEKLLSH"
     gene            11490..13101
                     /locus_tag="CNH03840"
                     /db_xref="GeneID:3259092"
     mRNA            join(11490..11792,11872..12032,12084..12181,12232..12326,
                     12381..12570,12623..13101)
                     /locus_tag="CNH03840"
                     /product="1-acylglycerol-3-phosphate O-acyltransferase,
                     putative"
                     /transcript_id="XM_572543.1"
                     /db_xref="GeneID:3259092"
     CDS             join(11604..11792,11872..12032,12084..12181,12232..12326,
                     12381..12570,12623..12999)
                     /locus_tag="CNH03840"
                     /codon_start=1
                     /product="1-acylglycerol-3-phosphate O-acyltransferase,
                     putative"
                     /protein_id="XP_572543.1"
                     /db_xref="GeneID:3259092"
                     /translation="MGISWLLKPVALVSTVALSTLGVLSRRYQRARFYFNLTIYVSTL
                     GLMSVWGVVVSILATAAGQRLNINYYVARSLYGLSGPLLGIKFEVEGEEHLEGLMTAR
                     DGQHQGAVLLSNHQSFLDILYIGRIFPKQAAIMAKKELKWTPLLGQFMSLSGAVFVNR
                     KNRHDAVKALAIAGEDMKKKGVSLWIFPEGTRSSSPEPTLLPFKKGAFHLAVQAQIPI
                     VPIVCENYHRLFDGRTRFESGVLKIRVLPPIPTTGLTVDDVTSLAESTRESMLHALRE
                     ISEPGPSSSTPIPTSAEVPLAPPISRNTTQPPAGDSIQLDISESGALRQRGVHSSGVS
                     SEWSEGKFEAQSEETTEDEMDEDVVLLKKPKENVA"
     gene            13287..16763
                     /locus_tag="CNH03830"
                     /db_xref="GeneID:3259143"
     mRNA            join(13287..13443,13499..13635,13710..13814,13868..14113,
                     14162..14561,14629..15008,15058..15249,15302..15478,
                     15533..15711,15767..16763)
                     /locus_tag="CNH03830"
                     /product="clathrin binding protein, putative"
                     /transcript_id="XM_572541.2"
                     /db_xref="GeneID:3259143"
     CDS             join(13419..13443,13499..13635,13710..13814,13868..14113,
                     14162..14561,14629..15008,15058..15249,15302..15478,
                     15533..15711,15767..16193)
                     /locus_tag="CNH03830"
                     /codon_start=1
                     /product="clathrin binding protein, putative"
                     /protein_id="XP_572541.1"
                     /db_xref="GeneID:3259143"
                     /translation="MAMAPPRKGENWELRQQLNSEYRDKRADAIKRVIANHTIGKDCS
                     GLFPDVVKNMQTDDLEQKKLVYLYLMNYAKTQPELVILAVNTFVKDTADPNPLVRALA
                     IRTMSILRAEKILDYLASPLSRCLKDENPYVRKTAALCVAKVFDLKPELAIEYGFIET
                     LRDLIGDGNPMVVANAVAALGDIHEASLNLPSSQPGSPNDDESPSSVRPNQSLFIIDP
                     ATLTKLLVALNECSEWGRIAILTTLARYRTNDEKESEHICERVMPQFQHVNAAVVLGA
                     VKVIMIHMKNVTKEDLLKSLTRKMAPPLVTLISSPPEVQWVALRNINLLLQKRPDILA
                     SEMRVFFCKYNDPSYVKVEKLEIMVRLANEKNVDTLLGELKEYASEVDVDFVRKAVRA
                     VGQVAIKIDEAAGRCVEVLMELIETRVSYVVQEAVIVVKDIFRKYPHSYEGIIPALCA
                     NLEELDEXEAKASLIWLIGEYAEKIENADELLGAFLETFSEESYPVQLQTLTAIVKLF
                     LKKPDESQAIVQKVLQAATKDCDSPDVRDRAYIYWRLLSSDPAAAKSVVLSVRPPISL
                     PQTTVAPAILEELIGEISTLASVYHKPAATFIGKGRLGADEMHKKSLDAEDDVSREKA
                     LQAVVAGNQAENLLDFDDEPTPTNGESSIPAPGAGLGISSQAIASAAKSTNPLDELMD
                     LFSTASMTTPVVQPGQPAAQAQTSAQSSGGLGGLNGLAGLSSPPQSVSPQPGAPQSQK
                     QQQQAAAQDDLLGLF"
     gene            17286..19100
                     /locus_tag="CNH03820"
                     /db_xref="GeneID:3259015"
     mRNA            join(17286..17641,17713..17750,17803..17846,17912..17923,
                     17977..18040,18093..18117,18175..18288,18353..18383,
                     18442..18473,18527..18646,18721..19100)
                     /locus_tag="CNH03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657752.1"
                     /db_xref="GeneID:3259015"
     CDS             join(17389..17641,17713..17750,17803..17846,17912..17923,
                     17977..18040,18093..18117,18175..18288,18353..18383,
                     18442..18473,18527..18646,18721..19004)
                     /locus_tag="CNH03820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513435.1"
                     /db_xref="GeneID:3259015"
                     /translation="MRNKEILTSNSLVVTYVDNATAFKDGLAFWTSDGIPGIQVDHWS
                     DTAVGANRNSVRITTKSLFEGGLFIIDLALMPWGCGVWPAFWTLGYEGTWPETGEIDI
                     IEGIQSNTNNQMTIHTMPGCSINYSTSNLYSGTLTNQDCDSSTGGSGCSIISASNSSY
                     GMPFNSAGGGVFAMKWDTDGIRMWNWNRAQIPSDITAETPDPDAWDLPTAIWDASICD
                     LESFFKAQVLVLNINLCGDWINSVWDQYPYCPGTCPEYVSNPLNLNNTVMLINYIKVY
                     QQSDAEVTTQQAETNSNLTGAGGPVGVINGATIRRPWWRTAREKMLGMVSVVPVGLLF
                     AGWI"
     gene            19466..20861
                     /locus_tag="CNH03810"
                     /db_xref="GeneID:3259144"
     mRNA            join(19466..19644,19699..19739,19808..20287,20341..20571,
                     20623..20861)
                     /locus_tag="CNH03810"
                     /product="FMN adenylyltransferase, putative"
                     /transcript_id="XM_024657751.1"
                     /db_xref="GeneID:3259144"
     CDS             join(19526..19644,19699..19739,19808..20287,20341..20571,
                     20623..20660)
                     /locus_tag="CNH03810"
                     /codon_start=1
                     /product="FMN adenylyltransferase, putative"
                     /protein_id="XP_024513432.1"
                     /db_xref="GeneID:3259144"
                     /translation="MANISQSLHALLERAQKQDSLGKLIIEALVLIESVIDILGEETV
                     AISFNGGKDCTVLLHLYAAVLYARHTPSLPPHLFPKPSPKITIPPLPSRTPQEPLSPQ
                     PVLPPSLPACTPPSITPPASNPSPPFSHPRSTHHHPPTDLPYPPIRSIYITAPNPFAE
                     LDEFVLSSTKLYGLDLYRFGGGMKAALEEWLGCGGGRGVKGVLVGTRQGDPNDAVDII
                     APTDPSWPQFIRVHPILHWTYSDVWDFLLELQVPYCILYDQGYTSLGSTTNTLPNPLL
                     KSESVEGGWEPAHRLKDASQERAGRH"
     gene            complement(20857..>24566)
                     /locus_tag="CNH03800"
                     /db_xref="GeneID:3259345"
     mRNA            complement(join(20857..22293,22342..22437,22493..22563,
                     22616..23490,23536..23689,23739..23824,23887..23928,
                     23989..24010,24069..24210,24388..>24566))
                     /locus_tag="CNH03800"
                     /product="telomere maintenance protein, putative"
                     /transcript_id="XM_572540.1"
                     /db_xref="GeneID:3259345"
     mRNA            complement(join(20857..22293,22342..22437,22493..22563,
                     22616..23490,23536..23689,23739..23824,23887..24010,
                     24069..24210,24388..>24566))
                     /locus_tag="CNH03800"
                     /product="telomere maintenance protein, putative"
                     /transcript_id="XM_572539.1"
                     /db_xref="GeneID:3259345"
     CDS             complement(join(21165..22293,22342..22437,22493..22563,
                     22616..23490,23536..23689,23739..23824,23887..23928,
                     23989..24010,24069..24210,24388..24566))
                     /locus_tag="CNH03800"
                     /codon_start=1
                     /product="telomere maintenance protein, putative"
                     /protein_id="XP_572540.1"
                     /db_xref="GeneID:3259345"
                     /translation="MTCLQYMGVVFERHWRDPIISVTQSHGCESSYRPTVSYSILPSN
                     RCTPSPPLSTPQSSQPSQNIHSASAASSHMSSLFEAAAAFEEAAAHGANPVILERSGK
                     GHSPVVTMTDMSANAPPPPPSDFNSDINRSVTPLMTNLLPSAVGSDGRVNLFVGNLPY
                     RVRWQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLMGSREDAARAIDRYNGYTWQT
                     RTLEVRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFPGPSHTPFSIPGHITPQSGQG
                     WLPGQIPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSSTPIPGAQSPPSVFGAQPLPLS
                     VQNTGLNAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRRDSLTPFGASLTTFDSAAAPL
                     SSTSPNMAVSRPTSSSGSVKPPSPGGSRAPPPGTLGPLPPSLFAGIKPAPAVDAIAPT
                     IAGDVPAQSPNGGAGRLAAAPIPQLEGLANQGMGLGPPSTLHDRVIFVSNLPLSMQWQ
                     DLKDMLRPAGTIIRADVATDAHGKPRGFGTALFATEADATRAVLLFNDREIGGFRIRA
                     HLERDIHPEVSQRSARNSVSGEATSLGIQDHLTGVPEGVKDMLQSNGITPIDTSVPST
                     KPSSTSPIAKLPWSLNTSLQTHTAPGHGQPPHGEPSPTSHTPVFRHPHHPGPISMPPF
                     HMEHGNPISPLHTRGLPPMTPSMPGFVFNYPETPPLHGHASHFMSPAAGPFSPGIPVT
                     SPGAFQYNPFLNPAPGAPVNRFPSTPGNHPQAGSAALGTPTTQAFPNGPIGYGQYAGP
                     PGGALQGKSENSPQARQGQDYFANAIPPQHATSTAGNRTLGVGALGGKDKLRSSPLSG
                     GDGQNDSDEETRAPSAVGDELAKMAEELTVDDENEDGEPGRQSSSGLSLSGLGSSAAV
                     SPRGGRASMDDGKLGRH"
     CDS             complement(join(21165..22293,22342..22437,22493..22563,
                     22616..23490,23536..23689,23739..23824,23887..24010,
                     24069..24210,24388..24566))
                     /locus_tag="CNH03800"
                     /codon_start=1
                     /product="telomere maintenance protein, putative"
                     /protein_id="XP_572539.1"
                     /db_xref="GeneID:3259345"
                     /translation="MTCLQYMGVVFERHWRDPIISVTQSHGCESSYRPTVSYSILPSN
                     RCTPSPPLSTPQSSQPSQNIHSASAASSHMSSLFEAAAAFEEAAAHGANPVILERSGK
                     GHSPVVTMTDMSGASSRAPTSAEIDAVIAAAIANAPPPPPSDFNSDINRSVTPLMTNL
                     LPSAVGSDGRVNLFVGNLPYRVRWQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLM
                     GSREDAARAIDRYNGYTWQTRTLEVRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFP
                     GPSHTPFSIPGHITPQSGQGWLPGQIPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSST
                     PIPGAQSPPSVFGAQPLPLSVQNTGLNAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRR
                     DSLTPFGASLTTFDSAAAPLSSTSPNMAVSRPTSSSGSVKPPSPGGSRAPPPGTLGPL
                     PPSLFAGIKPAPAVDAIAPTIAGDVPAQSPNGGAGRLAAAPIPQLEGLANQGMGLGPP
                     STLHDRVIFVSNLPLSMQWQDLKDMLRPAGTIIRADVATDAHGKPRGFGTALFATEAD
                     ATRAVLLFNDREIGGFRIRAHLERDIHPEVSQRSARNSVSGEATSLGIQDHLTGVPEG
                     VKDMLQSNGITPIDTSVPSTKPSSTSPIAKLPWSLNTSLQTHTAPGHGQPPHGEPSPT
                     SHTPVFRHPHHPGPISMPPFHMEHGNPISPLHTRGLPPMTPSMPGFVFNYPETPPLHG
                     HASHFMSPAAGPFSPGIPVTSPGAFQYNPFLNPAPGAPVNRFPSTPGNHPQAGSAALG
                     TPTTQAFPNGPIGYGQYAGPPGGALQGKSENSPQARQGQDYFANAIPPQHATSTAGNR
                     TLGVGALGGKDKLRSSPLSGGDGQNDSDEETRAPSAVGDELAKMAEELTVDDENEDGE
                     PGRQSSSGLSLSGLGSSAAVSPRGGRASMDDGKLGRH"
     gene            complement(26252..27645)
                     /locus_tag="CNH03790"
                     /db_xref="GeneID:3259231"
     mRNA            complement(join(26252..26607,26664..27123,27543..27645))
                     /locus_tag="CNH03790"
                     /product="expressed protein"
                     /transcript_id="XM_024657750.1"
                     /db_xref="GeneID:3259231"
     CDS             complement(join(26477..26607,26664..27123,27543..27557))
                     /locus_tag="CNH03790"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513431.1"
                     /db_xref="GeneID:3259231"
                     /translation="MTRTERNQYPAAVLKDRHSRTGLDKTQWNHKNGDGAHNWGSTAR
                     KGDDEASGRLDGEAEAEAALDELPSSDVFDLDEEINDPVGAMPVTDSGNDFKPMDLGK
                     RGSIQGQSNIATSPTDSMSSLDSGDRPGMGRRMSAVSDEEREKMRLYREGVLHKKQGV
                     DLAHIAXSSHGIAXSPPTNSYLGPXSPSNXRYGFNFVSVQL"
     gene            complement(27880..29725)
                     /locus_tag="CNH03780"
                     /db_xref="GeneID:3259084"
     mRNA            complement(join(27880..28002,28053..28143,28196..28306,
                     28365..28644,28704..28858,28916..29001,29131..29259,
                     29318..29393,29468..29511,29628..29725))
                     /locus_tag="CNH03780"
                     /product="chaperone regulator, putative"
                     /transcript_id="XM_572538.2"
                     /db_xref="GeneID:3259084"
     CDS             complement(join(27950..28002,28053..28143,28196..28306,
                     28365..28644,28704..28858,28916..29001,29131..29259,
                     29318..29393,29468..29511,29628..29712))
                     /locus_tag="CNH03780"
                     /codon_start=1
                     /product="chaperone regulator, putative"
                     /protein_id="XP_572538.1"
                     /db_xref="GeneID:3259084"
                     /translation="MLPTTLFFLLTLALLGGCLAESLYNVLGVRKDASDADIKKAYRK
                     LSKKYHPDINPDEAAHEKFIQVSKAYEVLSNSETRTIYDRHGEQGLKQHEAQKSGGSQ
                     DPFARFFGGGAAQEQKGPGLITNVEVSLADLYTGRTLEFQIPRRVICPHCHGSGAESE
                     KDIHSCNKCGGQGVVVQRHQVFPGMFTNVQMTCPHCNGKGKQITRSCHVCHSEKTVQT
                     QHTLALHIPAGAPEGFEEVFHGEADEQIDMEAGDVVVRVRSKLNEGEGAWRRKENGIL
                     GRVTLSVAEALLGFERRLTHLDGRTITLSRTGTTQPGEVEVIEGEGMPSYMDIPPGDM
                     FIEYSVVFPTAVSSETRQKLSDILKYAPPVHHDEL"
     gene            29948..32622
                     /locus_tag="CNH03770"
                     /db_xref="GeneID:3259046"
     mRNA            join(29948..30200,30255..30665,30738..30951,31009..32622)
                     /locus_tag="CNH03770"
                     /product="expressed protein"
                     /transcript_id="XM_024657749.1"
                     /db_xref="GeneID:3259046"
     CDS             join(29997..30200,30255..30665,30738..30951,31009..32495)
                     /locus_tag="CNH03770"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513414.1"
                     /db_xref="GeneID:3259046"
                     /translation="MADKEELQERTKVARQEYREYLPLAQQLQGDLRDDAEQLRVQEG
                     WDEDTWNGVEEWVDDVGSIWRALRRNRYDQNKTHSFLLSVLSTRLSLSLHGPIPSILP
                     YSDSPLFHILPLPSHTDKLNRPIVVLTAREIVRDEQGMLDDVKEWIWWALEMCRRTSK
                     DWWSKGMWDGSGVDGYGRGKGKARGEGGEGIVLLVDAAGAGYRNLEVDLLPTLLSVGH
                     NSFPGLLEAVYVINVGWTGRSMWAVVKHLLPKSALERVAFLDTKESLAEVFELDKIPQ
                     AYGGDSPYTFSPSNNPIYAYYSRHSSHSFIASISRSTSCTSIADVYYTARNTPFPSRR
                     TSPLISRQNSASSGMMKAMFRAGYGNDLRMTKSRDERSRKVEGDDDGDEEDEMTRVIS
                     ASDVAAVGPMTGLITQSLTEPEDPQPILSRASSTLTSRSKPPTRAPSSAAVSRIKSLS
                     DFHLYLSPSRLARIDLLSDSSDSEDEPPPPPSIPSLPRRKVLRPALLEKSLAGTPDER
                     EKRTNRPALRLMGLPGHLADDDPVRSYSGRLQMHHAKWLEGWKGTPEELGLEDNHKLG
                     GVKHEEEENAPIPRTISVSPPIDRPPSPSGTLEPSPSPSPIHSPAMTPQPHDIQPYST
                     SNPFFGYPVVQFGSSIRPRYPRNRKRDLVKTLLFLFMLKLQSWRDSVERALGLNRLRI
                     PSLSQPYCSSSLYTPGPNRRNPAEGLVRSAATPGTYSKQVAKYRRWDKDWWWMIIGML
                     LLRGTWGRIVLAPLEALGLGLSEWKAIWGAV"
     gene            33763..35429
                     /locus_tag="CNH03760"
                     /db_xref="GeneID:3259191"
     mRNA            join(33763..33947,34006..34070,34123..34562,34611..34798,
                     34848..35429)
                     /locus_tag="CNH03760"
                     /product="UDP-galactose transporter, putative"
                     /transcript_id="XM_572536.2"
                     /db_xref="GeneID:3259191"
     CDS             join(33934..33947,34006..34070,34123..34562,34611..34798,
                     34848..35379)
                     /locus_tag="CNH03760"
                     /codon_start=1
                     /product="UDP-galactose transporter, putative"
                     /protein_id="XP_572536.1"
                     /db_xref="GeneID:3259191"
                     /translation="MGVLRLAVCISGVYAAFLLWAIAQERLSKPFPSVHPHPHQQPHS
                     PSDPPPGDKFPSPLFLNFAQALASSLSALCYLSFKAWRDGWKGRGLGQLLGLKEVFGK
                     SQTALNGDAKANKKESELNEKTKEVVEKAPKPPKKSLLALLVQVSVFQTIASPIGFLA
                     LRHISYPTMVLGKSCKLIPVLLLNVLLYRRKFSPHKYIVVALVTVGISMFMLFAETSK
                     KKKGGSDSMWGLVLLLVNLLIDGLTNSTQDQIFSSYPSYTGQQMMFTMALTTQIILLP
                     LLVLPLPTNPISLLAHLPPPFGSSVPTSTLSFSPPAALESISFLLSHPSALAPLFAYA
                     LLGGLGQLFIFETIQHFGSLTLVMVTVTRKLFTMLLSVVVFEHRLTKGQWLGVGVVFA
                     GIGVEAGMKRKDVMKKAKKD"
     gene            35859..38633
                     /locus_tag="CNH03750"
                     /db_xref="GeneID:3258992"
     mRNA            join(35859..36013,36074..36328,36385..37625,37679..38200,
                     38248..38409,38467..38633)
                     /locus_tag="CNH03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657748.1"
                     /db_xref="GeneID:3258992"
     CDS             join(35918..36013,36074..36328,36385..37625,37679..38200,
                     38248..38409,38467..38623)
                     /locus_tag="CNH03750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513413.1"
                     /db_xref="GeneID:3258992"
                     /translation="MSVPTQRFSDIRRSRPSYSCQVCRDRRVRCDQARPKCGNCVRNQ
                     AQCVYQSNLSQKRKDPITDDSANKMPRRNKSSGSERSPSPLETGKLKPGYLVLNSGGR
                     SRYTESTFWACVDAEGLELDRILRNLPLFPRTGGPDDLVTPPAFSSSPGAATSVPNPS
                     TGTSPDRISWGPVRLAKLLQPLPPKLVCDRLFRAFMDCIHPLIPLMHIPSFESAYDEF
                     WSWRLTRPAQNISLSILHRNPSFLPLLISVLSAGSITIHEPWSDRVGQKLRGLMPEAL
                     RVIGFPYYPSVYSLMAYILANSTLIREEDAFSSCSFVAVALRVAQSMGFHRDGTEFEL
                     DPISTEERRRVWWHLMHLDTMTSIAQGLPGIMSSSRCTTQVISEMKDELIGKIKSTDS
                     LDRELWVEPKYVLAAGRYEASTQLRTILERLQEAPNITLSDIAPLEMQIEDLRRRQSR
                     RLESVNLHAHSASLQEILDQLSVRVGGDDFTDHRPPPPTTASKAIQQWNQALLHLTTV
                     KAYCILYQPFMSDKVIWANLRSRALPHFQYFLALFLEMTTNPSYRPFHWLYPGSYQPL
                     QPCAVLLSDLSAHPHSSDKMLSMQLIDRVFSLLGPAGRLVSPGSYQSLPSLTGAKQVW
                     TVLEKLRAKVWHDLGYDHTLFWAEDEKGDDGLAHRGSMDFWLTGNLAGHSADRSDTAT
                     SSYPPPMPQNGEAIADSTTHPTSYAESGATSTSSIPLPVAALNEQDWQNDMDALSWIP
                     WGTSNDPPFQSIQNSLTTSNYMPESTDSGEAEIAPGQMIVPPGNETDLFGLYPPTESQ
                     LSSTRYQGQNFF"
     gene            complement(38844..44135)
                     /locus_tag="CNH03740"
                     /db_xref="GeneID:3259009"
     mRNA            complement(join(38844..39022,39076..39495,39545..39629,
                     39691..39978,40029..40152,40202..40209,40259..40351,
                     40409..40773,40823..41793,41851..42309,42372..42429,
                     42482..43554,43625..44135))
                     /locus_tag="CNH03740"
                     /product="catalase, putative"
                     /transcript_id="XM_024657747.1"
                     /db_xref="GeneID:3259009"
     CDS             complement(join(38946..39022,39076..39495,39545..39629,
                     39691..39978,40029..40152,40202..40209,40259..40351,
                     40409..40773,40823..40859))
                     /locus_tag="CNH03740"
                     /codon_start=1
                     /product="catalase, putative"
                     /protein_id="XP_024513412.1"
                     /db_xref="GeneID:3259009"
                     /translation="MTEKTPTYTLSEGCPIADATTAQRLGSCPVKGLMLMQDTQLIET
                     LAHFSRERIPERTVHASAVGAWGEFEVTHDNSDITSAAFLNGIGKKSKVLMRISTVGP
                     EAGTAETVRDVRGWSMKIFTEEGNQDFVFNSIPVFFIRDPIKFPSVNRSHKRHPAKHT
                     ADSSMFWDFHNNNPEGTHAIMMYFSNRGLPYSLRQINSYSGHTYKLTKSDGSFVYVKL
                     HFKSNQGVKGMTQAEGVRTAGEAPDFHTTDMWDAIERGDYPTWTLYAQVMKPEEAENY
                     RWNIFDMTKVWPHKDFPLRPLGKLTLNRNPENYFSDIEQAAFSPSTMVPGVAPSGDPM
                     LQARMFAYPDAARYRLGVNYQQLPCNRPVSEVYAPYQRDGAMRYMTNYGGDPNYVRSS
                     LKEVNFKGQLGAKGHSTGGNEKHNEWVGRVAAYTSEVTDEDYVQARMFWEVLGKAGDQ
                     EDLITNVSCHLSKAIPSVQKGAVEIFAKVNVDLAKSIEDRLAELNKGK"
     gene            42149..44173
                     /locus_tag="CNH03730"
                     /db_xref="GeneID:3259296"
     mRNA            join(42149..42329,42381..43446,43509..44173)
                     /locus_tag="CNH03730"
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /transcript_id="XM_572533.1"
                     /db_xref="GeneID:3259296"
     CDS             join(42184..42329,42381..43446,43509..44063)
                     /locus_tag="CNH03730"
                     /codon_start=1
                     /product="glucose-methanol-choline (GMC) oxidoreductase,
                     putative"
                     /protein_id="XP_572533.1"
                     /db_xref="GeneID:3259296"
                     /translation="MVHAATHPKDAPKNFDFIVLGGGAGGCTVAGRLAENPNVSVLLV
                     EAGVNNPSEITDITTPAKAMGLRNSQYDWKYKTTMIDRPDYTRIEKPNTRGKVLGGST
                     ALNYYTWVRGSAATFNDWEEFGGSTWNWENTKEYFNKSTTYHDDLGLFPDDIKSIGNK
                     GGPVDISHSDLVPELKPWRDALERAWVSKGHELTVDVYNGVQKGLFKCVNSIYKGVRS
                     TAAAFLEGKPNITLASSTISKKIIFEGKTAVGVTVIGPDDREYDFYANREVIVAQGVY
                     ESAKILMLSGIGIKSDLEALSIQCVVDSKHVGQNLQDHPILSHVFKIKDGFGLDNHLL
                     RAGAEHDGAISSYRKNHNGPLSSGLLELVAFPRIDNRLENHKQYRDYKAQNGGKDPFG
                     PDGQPHFEIDFVPMFADAFQWHFPTPPTGDYMTVIVDLMRPISQNGVVKLTSTDPFEQ
                     PYINLNFFSHDLDLIALREGVRFVDDILINGEGMKDIVEGDYPWPMPRNSDEGMIRQI
                     LERSQTGFHPCGTARISKDIDHGVVSPELSVHGVKNLRVADASVFPLIPDCRIQNVVY
                     MVGEKAADFIKAAHPDLYKEAK"
     gene            complement(46387..48348)
                     /locus_tag="CNH03710"
                     /db_xref="GeneID:3259222"
     mRNA            complement(join(46387..46816,46871..47150,47203..47249,
                     47302..48171,48231..48348))
                     /locus_tag="CNH03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657746.1"
                     /db_xref="GeneID:3259222"
     CDS             complement(join(46705..46816,46871..47150,47203..47249,
                     47302..47792))
                     /locus_tag="CNH03710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513430.1"
                     /db_xref="GeneID:3259222"
                     /translation="MGLFRSSDGMRFNPLWHSFSLLLTLISFILLMVVVFYNAPIDHA
                     HSTLEGKVGLRMWFLTVNETSSSFPTWTIGTKRYYDAGEGEVPGRGIGLAAPARNKER
                     AADTGSGGDGGLHAYGFGIWGWCEWTNSRWTGDAVCTRKTGYKLPDDSDSSWDSIYEL
                     ELPYAVTHVLSGAAIPILITPFVVLSYFIILCLAILFPGPYPPWPVPSKYPAEVKHYR
                     TRCAWLLRDWRFNLYYFLAMLVLGLSMIVTVLVGRGKVNTEGGGLKARPGTGFGVFFA
                     AWACWICSQMLCMWKTGIIMRREGKERTKYSKG"
     gene            48671..51401
                     /locus_tag="CNH03700"
                     /db_xref="GeneID:3259079"
     mRNA            join(48671..48807,48870..48962,49014..49144,49194..49221,
                     49287..49404,49455..49709,49773..49840,49893..50024,
                     50076..50129,50178..50295,50348..50414,50463..50826,
                     50880..50987,51049..51163,51228..51401)
                     /locus_tag="CNH03700"
                     /product="glutamate decarboxylase, putative"
                     /transcript_id="XM_572532.1"
                     /db_xref="GeneID:3259079"
     CDS             join(48880..48962,49014..49144,49194..49221,49287..49404,
                     49455..49709,49773..49840,49893..50024,50076..50129,
                     50178..50295,50348..50414,50463..50826,50880..50987,
                     51049..51163,51228..51260)
                     /locus_tag="CNH03700"
                     /codon_start=1
                     /product="glutamate decarboxylase, putative"
                     /protein_id="XP_572532.1"
                     /db_xref="GeneID:3259079"
                     /translation="MALSQHVDADKLIEECKDHPIKRHLSHKAALYDIPYTSRYEVED
                     EVPRYRLPSKGVNGRATYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLVQENINKN
                     LVDQDEYPAAQQIHERCISMLSHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQE
                     KMKAAGKDIHNPGPNIVMGAEAQVALEKFARYFEVEARLVPIKPESSYVMDPKDVLKY
                     VDENTIGVFVILGSTYTGAFESVKDVAQELDKYEAETGISVPIHVDAASGGFVAPFAY
                     PHYQWDFQIPRVHSINASGHKYGMSTVGVGWIIWRSMEYLPKELIFELHYLGATDYSF
                     NLNFSRPAHPILAQMFTFLNLGFEGYKRIMDKNLTVARLISRALEHSGYFICLSKIHH
                     PKALTESSSSAEQSNILPAVADAANTVLHGKKTTVDDAEYYCEGLPVVSFMFTDEIKK
                     KYPGVKQAWIQMQLRSIGWIVPNYPLAPDCEKTEILRVVVRESLSGDLARKLIHDILQ
                     VTEDLLNDAGPSYSMSTATRRHENLDHGKLDNIDAVHIKQHTSTYSKPC"
     gene            51643..54335
                     /locus_tag="CNH03690"
                     /db_xref="GeneID:3259203"
     mRNA            join(51643..52338,52408..52479,52533..53465,53518..53580,
                     53630..53664,53715..53786,53842..54335)
                     /locus_tag="CNH03690"
                     /product="expressed protein"
                     /transcript_id="XM_572531.1"
                     /db_xref="GeneID:3259203"
     CDS             join(51982..52338,52408..52479,52533..53465,53518..53580,
                     53630..53664,53715..53786,53842..54244)
                     /locus_tag="CNH03690"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572531.1"
                     /db_xref="GeneID:3259203"
                     /translation="MQPKRTAETRNSTTKRARTVQSGKDETADPPVAVAEDIRSIDSR
                     LKGRAKGRKGKNKAEGTSDSPPPGPKKRVRKPFAAKEATWRDIPDWGDRTDVPLFRLP
                     AEVLDLCFGTKLNLGLQLRDYVALAGVSRYFRFHFTDDVFREIYLKSHPNYMKLRPCA
                     RRSPIKHSQLIFTRAVKDWRQDPPLKRFDHLEIHMRSIPPREEWTQKDYEFVIRADKI
                     IAQARQIWADARAERANIKKEKMKKRRVLRKVIVDGISRTVLATVPGLKHGETQGPKN
                     ELGVPIMTDENGKEIGLGASHAEEGNDGHDDDDDEESDDELNFYSTLQEWEWEESVHN
                     KDGELWQKIYKLEDKMRLLRRTYDNYDKGEDFSDLSSEDEADEGKEGDRSTRKKGKKK
                     QTKKFVRDPNWVLPPEEKPKRPHATLVEYDPLTGERLPHDAYPSPWRARAVEAANKKF
                     INRADAIRVFKVGEAELLCLKHYLVPNPLNPKTPSSIYSLAAIQALALRSHGGPIGHH
                     YHVESANERALKSLATRQANAAKRKADPTYVEKEPKSRQYPQTTVDPDDIGAKYGVDK
                     DCGIWHYQGTFIDFVADWREHRAAKAARKAQRVANGEGSETSDEDGSSQDELLPVPNV
                     PWNDVNEYMYSFTDEEDDLW"
     gene            54549..57324
                     /locus_tag="CNH03680"
                     /db_xref="GeneID:3259242"
     mRNA            join(54549..54992,55052..55363,55410..56932,56986..57324)
                     /locus_tag="CNH03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_572530.1"
                     /db_xref="GeneID:3259242"
     CDS             join(54621..54992,55052..55363,55410..56932,56986..57103)
                     /locus_tag="CNH03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572530.1"
                     /db_xref="GeneID:3259242"
                     /translation="MQASTPSPTTIQTPTLSFPDTPQMDETPKTAVLRTPRATFDGGE
                     VRIEGSVSGSERGSIDMGTANGERKDKGKERAVESAEDKDEEETGFDMEQLTRLQSRV
                     NELEANGKTGDEWVQRDELLGMVKTLLPLTLNHLPFLQERLAAQKSTIATMQQQAKIS
                     EQLMATERERHAVERDSWHKEMRAVMVSKEEEKVSNKRKVLDLDVGYHKELEAANKRL
                     EMDNRLMAPRLVDTQRQIDRLVNELRLLRPHVILNTSALTSKPTELTPATSAPPVFLP
                     QYMPQLENSKGIHRSSRATMGDARTEHLLLAAKAIRSMRKTNDRLGRLTMGELKKAGV
                     VGPEGGMGYKEGYGEQPMSDVEEDASEEEPLIDQRASGSVTKGKSKSQATPLLSRTKR
                     STKKNVQNASISTIPQTPSKSRTTGQSSLPQTTPGGSNFNDLLRAAEMATRPNSPVHG
                     EPILSTLSATRSTTRPRPDSSDIERGSPKRRRGDVWXGGGSHKAHQHSASAGSASALD
                     LLAQASQLDVASSTAPSSVVQSSPAVPLTSSTPQFGGLLEKDSSPRSHGSSLGAPIDL
                     TPRNRTMANVRLKAHPASDDFVVDPSLQTPTHRIRGSSTTSESLTPARGYASSQIYPT
                     PGGELDERLPPAGASSSAINPTSTPGVISEGGGGPGAGNGNFASPSGKVVPGLGKYWH
                     YTSEMPIKRVRSPYLKWTVEEDELLARAVAIHGEKWDLVSKGVPTRSYHQVRQRWLRK
                     TGAFDKKNQAAKAEREAKTESANEAKSSSTEREV"
     gene            complement(57005..59845)
                     /locus_tag="CNH03670"
                     /db_xref="GeneID:3259133"
     mRNA            complement(join(57005..57637,57701..57772,57830..57840,
                     57909..57989,58052..59140,59211..59282,59351..59652,
                     59711..59845))
                     /locus_tag="CNH03670"
                     /product="expressed protein"
                     /transcript_id="XM_572529.2"
                     /db_xref="GeneID:3259133"
     CDS             complement(join(57607..57637,57701..57772,57830..57840,
                     57909..57989,58052..59140,59211..59282,59351..59652,
                     59711..59738))
                     /locus_tag="CNH03670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572529.1"
                     /db_xref="GeneID:3259133"
                     /translation="MTSTFRQPSLFDHFHRIPNPYAQKGLEYVTPGKELRKLKRKEQK
                     ERRIEQRRAHLKKRSQLLAERATIVAKRPVWHDIPDWGDRTDCPLFKLPPEILDLCFG
                     TELDNDLSLREYIALAAVSRYFRQQFTSEVFLAIFLHVTGDCRESLDKHAEHIFSTHV
                     EDWREEKPLPKISESIYIASMPHDQWTRAEYEYHTALQKFYRSRYMVMYLRGEIHRCP
                     SGGTNKWIGNVSYTHSNTMGDKSIYYSSTVPGLKDGETYDPKDPTCLHADVLDKSIYP
                     CCSDWSMDTEIDEDEPELNKWKTIVENYHVTYESDFWNRKAEEILRRRRRKRYRRKQS
                     SRPGEPAKRVDTKLDLSSSDDSGYDTDDLQKLVNDDELGNETEDGLDGYDGDNEDTAE
                     GKNDEINSEVPENQEKLELMMLRTLAIKARDSREAYEKRKEGEETKDEPESDDGWVVP
                     LPGDPEREALALKFLEYVLEPEPHDHWPSHVRRTIARNINSHAVAEDDAIEVYGVTKE
                     ELYGLKHYHGALWEKTDLVLYPRMAVEALTLRSHGGPLGHYRFIIDRHARKLR"
     gene            60244..62780
                     /locus_tag="CNH03660"
                     /db_xref="GeneID:3259116"
     mRNA            join(60244..60461,60508..60703,60768..61261,61313..61829,
                     61884..61954,62007..62082,62144..62780)
                     /locus_tag="CNH03660"
                     /product="alpha-amylase AmyA, putative"
                     /transcript_id="XM_572528.2"
                     /db_xref="GeneID:3259116"
     CDS             join(60367..60461,60508..60703,60768..61261,61313..61829,
                     61884..61954,62007..62082,62144..62515)
                     /locus_tag="CNH03660"
                     /codon_start=1
                     /product="alpha-amylase AmyA, putative"
                     /protein_id="XP_572528.1"
                     /db_xref="GeneID:3259116"
                     /translation="MPVLSKLISLLPLLAIAQGATSDEWRSRSIYQLITDRFAPPSDD
                     TTCPLGATNYCGGTWQTIISKLDYIQNMGFDAIWISPTALNIEGNTKYGEAYHGYWTA
                     DPTKLNPHFGQASDLKALSVAVHDRGMYLMVDIAINALAATSYSLDASALASDADGTL
                     LFKDPSDFHTRCDISWGNHTSEQVCWLVTGDDNGDVALLDLKTESDSVASVLKDWVGG
                     YVTEYGIDGFRIDASKHMSKEFQHDFCEAAGTFCMGEVAGDNTEYAGEYQSAGGIDSV
                     CGFGLMYGFVNVFTGGDKMSTLEYYINLAASSYPDPTVIGTFLDNQDLPRFNSLTSDA
                     SLVYNAIVGMFMYGGMPIVYYGLEQDISDGPTDPQNREALWNYNNYATDGVTFGRITN
                     LNNIRNRLGGVGELYNAVATVLAIQDQDIALQREEALIVLTNRGQSGTGTWAIKNTQF
                     GGSVSVIDLLSCSTSTTDSDGSLTVTWTSGQPFVFVASDVADKAGLCGSLSNSTNATT
                     VSSSSSASTSIDTATSSASISGNLAVITDGSSSPSFSATSSALSSSISWYTPTSAASS
                     VSSSELVVVVAAVSTASTAVTSSGSICRRSKKRAMSKRQL"
     gene            complement(62776..63663)
                     /locus_tag="CNH03650"
                     /db_xref="GeneID:3259125"
     mRNA            complement(join(62776..63021,63076..63131,63265..63326,
                     63411..63663))
                     /locus_tag="CNH03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657745.1"
                     /db_xref="GeneID:3259125"
     CDS             complement(join(62939..63021,63076..63131,63265..63326,
                     63411..63455))
                     /locus_tag="CNH03650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513411.1"
                     /db_xref="GeneID:3259125"
                     /translation="MPGNDSIYYRGTNSQGNRYDSRVDTATGQTGYHYSNTNGSYYYN
                     NTNGSTYYNSGDGYAKYTSPSGQSSNYYGNNAGGDKK"
     gene            complement(64073..65561)
                     /locus_tag="CNH03640"
                     /db_xref="GeneID:3259145"
     mRNA            complement(join(64073..64354,64439..64499,64572..64758,
                     64810..64855,64936..65089,65157..65561))
                     /locus_tag="CNH03640"
                     /product="membrane protein, putative"
                     /transcript_id="XM_572526.1"
                     /db_xref="GeneID:3259145"
     CDS             complement(join(64250..64354,64439..64499,64572..64758,
                     64810..64855,64936..65089,65157..65455))
                     /locus_tag="CNH03640"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_572526.1"
                     /db_xref="GeneID:3259145"
                     /translation="MNEEVFTAVPDADIGLSSQQQNLLPGLAYLTKFGSPVHPTFSHE
                     SQLSATKVGIQDGMHQGGDDISRSITPGGNPIDTSQPGFPVFHRKFGTPAPVGLIPFV
                     GGAFLLNLYTVQARGVTKPNMILGIALGFGGLGQIIAGILEWACGNTFGAVTFSSYGA
                     FWLSLSTLYIPQFGVAAAYAENPAMLENALGLYLCVWGIVTVLFLIASHRSSVVLICI
                     FGALSLNFFILSAGYLSESPKCIKTGGAIGIITAIFGAYTSLAELVTADTGFFRVPIG
                     NLTPKDH"
     gene            66964..68084
                     /locus_tag="CNH03630"
                     /db_xref="GeneID:3259151"
     mRNA            join(66964..67026,67085..67106,67250..67290,67540..67620,
                     67907..68084)
                     /locus_tag="CNH03630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572525.2"
                     /db_xref="GeneID:3259151"
     CDS             join(67021..67026,67085..67106,67250..67290,67540..67620,
                     67907..68044)
                     /locus_tag="CNH03630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572525.2"
                     /db_xref="GeneID:3259151"
                     /translation="MASGFGYSGGRTRCFPFWQEFSKCYANAEKPSDCVAPKDDYMEC
                     LHNTKEIARAKQVKSHFVQKELQESHDSRKAAEKAATGVIVSLGLVEEEGK"
     gene            complement(68164..69408)
                     /locus_tag="CNH03620"
                     /db_xref="GeneID:3259138"
     mRNA            complement(join(68164..68492,68555..68603,68685..68858,
                     68926..68949,69021..69108,69191..69206,69274..69408))
                     /locus_tag="CNH03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657744.1"
                     /db_xref="GeneID:3259138"
     CDS             complement(join(68231..68492,68555..68603,68685..68858,
                     68926..68949,69021..69108,69191..69206,69274..69332))
                     /locus_tag="CNH03620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513410.1"
                     /db_xref="GeneID:3259138"
                     /translation="MRLNENTVLFGDRVILVPYRAEHVPTYHEWMKSSELLELTASEP
                     LSYEEELDMQRKWHIDEDKLTFILLERPSSLPPTAEQNQKVILPPSCLARCRMVGDVN
                     LFLPEGLEGDGECEIMIASKDDRRKRFAIEALSLFLAYLTTALPFPPTHLIARIGASN
                     LPSIHLFRKLGFGVVKHVQVFDEMELRWGAKDVECLSLEGLDEVTTVDWRETSLQGRI
                     GVYDA"
     gene            69540..70721
                     /locus_tag="CNH03610"
                     /db_xref="GeneID:3259118"
     mRNA            join(69540..69677,69737..69771,69829..70054,70141..70415,
                     70483..70721)
                     /locus_tag="CNH03610"
                     /product="proteasome subunit alpha type 3, putative"
                     /transcript_id="XM_572523.2"
                     /db_xref="GeneID:3259118"
     CDS             join(69609..69677,69737..69771,69829..70054,70141..70415,
                     70483..70648)
                     /locus_tag="CNH03610"
                     /codon_start=1
                     /product="proteasome subunit alpha type 3, putative"
                     /protein_id="XP_572523.1"
                     /db_xref="GeneID:3259118"
                     /translation="MTSIGTGYDLSVSTYSPDGRLFQVEYANKAVEAAGVAIGLRCKD
                     GVLLGVERILHSKLLVKGANRRIASLDEHIGMAGAGLLADGKHLASRGRDEASNFRDT
                     YNTPVTVQILSDRLSAYLQAYTSYGSVRPFGLSALVGGVDKTGPKLFCVEPSGVYYGY
                     RACAVGKGKALAKTELEKVVNKEVETGEAITVREGVMELARIIYLVHDENKDKDFELE
                     MTWICEESGNKHALVPEDLLAEAEAKAKAALEEGMEED"
     gene            complement(70964..73936)
                     /locus_tag="CNH03600"
                     /db_xref="GeneID:3259130"
     mRNA            complement(join(70964..71623,71686..72105,72170..72604,
                     72666..72846,72906..73518,73583..73936))
                     /locus_tag="CNH03600"
                     /product="pseudouridine synthase, putative"
                     /transcript_id="XM_024657743.1"
                     /db_xref="GeneID:3259130"
     CDS             complement(join(70998..71623,71686..72105,72170..72604,
                     72666..72846,72906..73518,73583..73911))
                     /locus_tag="CNH03600"
                     /codon_start=1
                     /product="pseudouridine synthase, putative"
                     /protein_id="XP_024513409.1"
                     /db_xref="GeneID:3259130"
                     /translation="MSAQENTQKRPAEDTEKQDVEAKRFKAEEIAPSNTPSLTDHLNA
                     PHRTIPNPVSKMGLVPAIPDLPPSLKMVTGIEADMVARRGFVGEEECGIRGFVGKGKG
                     VRGVIKQRFTDFLVNEIGLDGKVLHLKDITKPQEPGSNEKDKEAATVTEEEIANGQTK
                     STTEVASQSEEPEVAVDLPENLRFAAHPQWSTSTTLKLRPHFSDETIISLHQLVEQGK
                     DAPPKGDSGWGGRKKDTESASEENAEREEEKKEEGEEAAFNDSASKGRGQGRDRGRGR
                     GKERGRGRGGRGGRGGGRNADSGSWWLTYEDEREVLSQPVISKEERAAAHKILREVFP
                     GMFESSTREVKGEEGQRLVIKWSSGAGQSSFHGKGARRAPDAPRLPAYIHFTLHKSNR
                     ETMDALSHLQRLLNVQAKDLTVCGTKDKRAVTVQRVCLKRSGRNLQTVWRALNGVKQG
                     WRTEQQAVEERGDRGVRVGDFEYSDKYLELGMLKGNRFLITLRNVEAESVEEIDRTME
                     SVRDLGFINFYGMQRFGTSSMPTHVTGLFILRSNWSAALDSLLFLREGEHPDCVAARL
                     AWLEDGDYVKALEKMPRRAVAERSIWEFWKRGGRMEDKVGALGVIPRNLRTMYVHAYQ
                     SYVWNLIVSERIKMSATEPLVGDLVIEKSDDDEPVDPENVPAHRKDRHGRTKSWKTSS
                     SPTVRRLTAEDITNKTHTIFDVVMPLPGFDVDYPGGEVGELYDSILKADGLDKDRMRR
                     EQREYSLPGSYRLILLRPLSLTWTHLQYTDPDLPLVQSDEDEILSLNPPAANDPEGKF
                     RAVKVDMQLGASTYATMVLREITREETSSWFQRGRTMKGEDQEFKGIKKDDEGQGGEE
                     GEGGEMELMNE"
     gene            74080..75440
                     /locus_tag="CNH03590"
                     /db_xref="GeneID:3259313"
     mRNA            join(74080..74230,74282..74370,74437..74580,74649..74967,
                     75022..75090,75166..75440)
                     /locus_tag="CNH03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_572582.2"
                     /db_xref="GeneID:3259313"
     CDS             join(74125..74230,74282..74370,74437..74580,74649..74967,
                     75022..75090,75166..75326)
                     /locus_tag="CNH03590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572582.1"
                     /db_xref="GeneID:3259313"
                     /translation="MLKRNTPAWAVPKSPSVKHELKDEPGEEPDTKRIKTGNVKPILT
                     ATHGMFKENRTAAYALLNQLKKSMTIGWEDAFFWIQDTSPGSDPTEALEIFKALERVE
                     FNKINRVFTYIPELTLTTTNEIRNHIRIHSTPTSGIPIKTLREAMPNGIEPLKDLEAR
                     GDILIMRGLTGAWKDIPLPRLGRKNVNGQELMEGGSGRWKTVFWDHLREAGRAGKRVD
                     DEFIYSWADVPIAETDDVAKLLADQELSASSAIPAAPKATANAASKKKKKRTRALKIT
                     NTHMKEQGIDFSKDYVKPA"
     gene            complement(75442..77983)
                     /locus_tag="CNH03580"
                     /db_xref="GeneID:3259269"
     mRNA            complement(join(75442..76564,76637..77116,77196..77388,
                     77488..77666,77776..77983))
                     /locus_tag="CNH03580"
                     /product="expressed protein"
                     /transcript_id="XM_024657742.1"
                     /db_xref="GeneID:3259269"
     CDS             complement(join(75569..76564,76637..77116,77196..77388,
                     77488..77666,77776..77916))
                     /locus_tag="CNH03580"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513429.1"
                     /db_xref="GeneID:3259269"
                     /translation="MSETPPVPLPEGKRTSSPPHNAPTTKRAKRGPQGGGMGGHVTES
                     DLVKIVHETVRILCGMPAPNYQGNLAPDKWPTPDPVNAKDGRMKDEQGKDVWRPDWGK
                     LGALSTMNFVVHATIACRNHPMYHESITDSILTDRVKKYIQSIHKGRKKTPKRKEAKN
                     DRRAIRERQRRLQDFIVKNFDDTPLGHCRERSLLREAFKPNGILATLRIVHHSQVLQH
                     GLRTVSHSKASVRVKRRDVVNGGGGNGVVDETGMSVREGVGDVDEDQYDGEDAEAEDE
                     ESQGANTLASAMEQAMGECGQIPPFDEFQIYTDAWWGEAATPFYVSLDVWWWSELMRW
                     AVWTAYECYRLSPISSERPPPAHLPIEKIDLSSSFRFTNSPPRTRSGPGWPSIWACPG
                     MIDYPTVQSINPNSIPPPTSLPPNPLPSPSDLLLPPLKDLLRKPQHSKLYTSVTKHLE
                     HPRLLSDDQLAELWVLRQNMRTRREYEFALGSLTGDGKRRSIVGEGGLLRGLGLGPGL
                     GSPGDGERAEGVIGIESVEGNVDGEVRDGEEGNAINPEHAPPQSLSNSLLPTRSTQPR
                     DVPLARQAQGPQAVIHSVNPTTAEQPEQPKQLESELGPEPELGPEQTQLIGLEALGEV
                     VGNAIHAAALAELKKKGNSDDEVDEEIEMLEGYEDISF"
     gene            complement(78284..79275)
                     /locus_tag="CNH03570"
                     /db_xref="GeneID:3259032"
     mRNA            complement(join(78284..78572,78675..78815,78916..79143,
                     79199..79275))
                     /locus_tag="CNH03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_572521.2"
                     /db_xref="GeneID:3259032"
     CDS             complement(join(78407..78572,78675..78815,78916..79143,
                     79199..79227))
                     /locus_tag="CNH03570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572521.2"
                     /db_xref="GeneID:3259032"
                     /translation="MKAYIYDDKPGDQRLPHDTGIDIPEPTLAKLGVVYQRIPIDSEG
                     AWESKIDEFAKERGYKNRDRITVTREGLGEAYEEKIKSFFDEHLHEDEEIRYILAGSG
                     YFDIRGAEGVHEEQWIRIALEAGDLIVLPAGIYHRFTVDSANTITAMRLFQDEPKWTP
                     YSRKADGTDKLGSRDKYLETVRVGVTA"
     gene            79446..83074
                     /locus_tag="CNH03560"
                     /db_xref="GeneID:3259188"
     mRNA            join(79446..79620,79678..80037,80087..80130,80182..80345,
                     80397..80547,80607..81606,81752..82064,82134..82506,
                     82619..83074)
                     /locus_tag="CNH03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657741.1"
                     /db_xref="GeneID:3259188"
     CDS             join(79937..80037,80087..80130,80182..80345,80397..80547,
                     80607..81606,81752..82064,82134..82506,82619..82656)
                     /locus_tag="CNH03560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513408.1"
                     /db_xref="GeneID:3259188"
                     /translation="MPSPKQAEKLANPAVAYTLLEKLGAGNFGTVWKASHNDTKQIVA
                     IKMIDLESSDDDISEIQAEIAHLSSCWSDHVTKYYGSFVRGARLWIVMEYLAGGSCLD
                     LLKPGVFTEAQIAIVCRELLLGLEYLHMEGKIHRDIKAANVLLSASGDVKLADFGVAA
                     QLSSHKSQRHTFVGTPFWMAPEVIRQAGYDSRADIWSLGITAIEMAKGDPPLSEYHPM
                     RVLFLIPKARAPTLDPEEGWSEEFQDFIEKCLQKDPRDRATAKQLLQHRFIRSAKKTT
                     DLIPLITRYQSYKSSHPSSKPNTTPSKTLNRLAAGLGGLTIDGNGYGQGTMGSEWNFD
                     ETIRSTTRGVPINLNLEDMDEGFDEDEGEDDWDAKMAEMERWDGTVKENGGDLLVAGA
                     LTGSEMSSPMIERQPNRRNSTPPPGASASNTDTREEGERKGVDEPKTPPSSTSPSPSQ
                     RSLQSSTGSVSSGKSTWKQRNDKVRGTVVKEGDVGDGFSTVKPMKKIDAVASQRLSTS
                     YIGAGSVRRANVSGPTRNSGSTTESPTKFRPSAPLVSENIPRQTPQNQTQTQGKGASA
                     EPDPRSLAGQALAEQVILPILSSTSSNPKHDLPAPTLESLSLLSKGFSDLSASSPELT
                     YRLVMDILGGIRGNGVVMELVGRMTMGKEVGLDVGDGPGVGAGVELDGVDGVSGMRDG
                     QCVGREEIEEGEAKVKGDLVKERSAIADLLYLRWLDGMRMKWPKA"
     gene            complement(82840..85721)
                     /locus_tag="CNH03550"
                     /db_xref="GeneID:3259137"
     mRNA            complement(join(82840..83475,83609..84265,84325..84702,
                     84759..85117,85171..85721))
                     /locus_tag="CNH03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657740.1"
                     /db_xref="GeneID:3259137"
     CDS             complement(join(83359..83475,83609..84265,84325..84702,
                     84759..85117,85171..85711))
                     /locus_tag="CNH03550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513407.1"
                     /db_xref="GeneID:3259137"
                     /translation="MQHRTPLTPIPQNRSPPSATSSNAPSTPTPKRPSSAKRPPKLAP
                     IFLAKRARPERERQENTAWGVSAKKRVHLAGPSSIPPLAAGSRSAPIASDGEDASQSS
                     DDQSDSEDDRRLYTQRKSQSIHDYFLPSTSRYGRVKDERQDKENTRVIEPITKEECVW
                     KRKRRRLGVKGQGSSLANQRLIPPPQAYLSTLLHSLLPYHPLRPPASILLPSIHPPTG
                     RPRDFAPPLAVSFNHIAKQYTSSDARSQGLRRLIGIAGEEGGVRILDVDEGLGMHREE
                     KGWWWRAHGNAIFDLKWSPDDTKVLTASGDQTSRLHALTTPVPTLLATLRGHTSSVKT
                     VTFLDPSRSANNPSQSSVIASGGRDGNILIYDVRTKGRDPELGEYDAGPARREGSRER
                     YRDGIPGFAPQTSGEVLDPVIVIKGAHGDGKRSGRTATRSVTSLLALSSIPGTLASGG
                     SFDGIIKLWDLRFPAPTNRSSNPRPTCTPSGSLPDATLSGESPAKRARSINAMVESPV
                     NGDVYALCGDSKVHVLRPSAALIQHHPTHSSGAFNAFTEEETYAEAVQPATYSDPSML
                     ISNFYIRLSLSPDGRYLAAGSCKGGLMTWDTQERGQDMNRRRDASTTVAKKLGMGFEV
                     GMSEIGGKDREVCAVEWGKDILAATSDGSLTRIWRSEPEIAKQIAENPGAYANEWAGA
                     I"
     gene            complement(85839..89072)
                     /locus_tag="CNH03545"
                     /db_xref="GeneID:36393024"
     mRNA            complement(join(85839..86239,86302..88036,88096..88642,
                     88711..89072))
                     /locus_tag="CNH03545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658665.1"
                     /db_xref="GeneID:36393024"
     CDS             complement(join(85888..86239,86302..88036,88096..88642,
                     88711..88989))
                     /locus_tag="CNH03545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514583.1"
                     /db_xref="GeneID:36393024"
                     /translation="MFPVPSHLHRSGGEHISSEAEAEVSVQGNQPSVEAQCEQAQSKV
                     LDLLEPLLRPPLDSSDKRNNERKRKVSRWNVDEIKKVKENLENAIEENKTKTHEILMN
                     NLPSISSHIQISSNLCSDFAELKIKLKALESQVDVSDPATSFMPPLLSLLNKHFNSIS
                     ARDTSQGHIAALKALKAKVEKVKKLEEVVWAGQGVEDWVVDSAPLAKKETGAEANEIA
                     VDGLEATAICKALEEKESVLRTLLRDQLVDGFKRAVVVQKDGMKLDVRQEIRLSSPNA
                     SRPDYLQTTTASPYPLSSLYKALSSLSLLPNLLQALQTQLLTTIILPVVSSQRRISIS
                     SSSGIFSLKSDQVSGDMEDQEVLTGLKQVLDFTSRTLYPEEANTPEREPFIREITVKT
                     LESLLDHLIIPSIPSSPSSIPGWLNLIVSSVAIEDTVLPVSSANDQLHHSRPLKTFWE
                     KQAGKEYANKRRYDTADLVRVLVLNEWGRWEGTEKKREREVSVVVEVEVSSDDEDQPV
                     KEQSKEQGEAGEAQGDGWGFGETSENQIEQAGVKQVNREDAEEAEDGWGFDEESIPPA
                     SSADQAPQEEDEADGWDLDVAASTSSSLPESSPSLPQLDPSVELEARTEHAPEPQPQP
                     VSQHEPQHEPQRESEPQPEPKPVSAPAPTSAPTKPLREAKRLGKKVAKKSKTEEYDPW
                     DQPFDNENSLSASTSTFTSASTSSLSNPTRALSAETPSNNDIPPIKKPPKEAKKLGKK
                     VGKKTNKEAERDFWDTDIPVEDLGGGESSVHHTAGVLGDKVEGGGGGNGDGRSRDDDP
                     TSTSPQMTAPPQKRRTELREEKRVIEEKYFVSTACEKLLDIGRGLLKEVEELQSSSFA
                     SPSFTFDSTSPIIIQSLTDIFSLYRALLPIRYAQQLQDIPGITMQAYDDGNYLASQLG
                     SFALPASSTLSLDDEIARLRALSERIYEDFLKNQREGIDEELDSLKGVEGTADYSI"
     gene            89211..92847
                     /locus_tag="CNH03540"
                     /db_xref="GeneID:3259124"
     mRNA            join(89211..89343,89431..90015,90083..90990,91153..91949,
                     92035..92367,92434..92847)
                     /locus_tag="CNH03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657739.1"
                     /db_xref="GeneID:3259124"
     CDS             join(91287..91949,92035..92205)
                     /locus_tag="CNH03540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513406.1"
                     /db_xref="GeneID:3259124"
                     /translation="MLEILERFSTNTTSITTNSRAPETRHLAKEPDSFSGNPTELENF
                     LTSCVLYMDCYPGTFNSDKAKINFIISHCRHKVMKSLRPLMNRAQQPELLQNYEEFLK
                     YLRRHWGDPDEKWNAKREIRNRQERRYLSGYKDPGGLTNITLRFFKPNLPAHVQPMDA
                     GIISAFKSRYRAKVIPFALANYEDGVPPHLCYKVDIKSAMEMADDSWNEITGETVENC
                     WKKVLHVLNLGPASLRKNSQYGAPTTAQRSKATASSIATIMYASSIVNGIAKITPRDF
                     H"
     gene            complement(93182..93289)
                     /locus_tag="CNH03530"
                     /db_xref="GeneID:3259006"
     tRNA            complement(93182..93289)
                     /locus_tag="CNH03530"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:3259006"
     gene            93410..96168
                     /locus_tag="CNH03520"
                     /db_xref="GeneID:3259195"
     mRNA            join(93410..93941,93994..94111,94169..94243,94297..94408,
                     94457..94625,94676..94768,94818..94926,94996..95071,
                     95125..95208,95262..95351,95405..95553,95622..96168)
                     /locus_tag="CNH03520"
                     /product="histone deacetylase 1 (hd1), putative"
                     /transcript_id="XM_572517.2"
                     /db_xref="GeneID:3259195"
     CDS             join(93597..93941,93994..94111,94169..94243,94297..94408,
                     94457..94625,94676..94768,94818..94926,94996..95071,
                     95125..95208,95262..95351,95405..95553,95622..96067)
                     /locus_tag="CNH03520"
                     /codon_start=1
                     /product="histone deacetylase 1 (hd1), putative"
                     /protein_id="XP_572517.1"
                     /db_xref="GeneID:3259195"
                     /translation="MLSAQPPIDPSPPPSSSSSRRVAYYYDQDVGNYNYYLGHPMKPH
                     RIRMAHNLIVNYGMCDEEGQEHGPAEVWGEGKRAVNDEIAQNWGGGEMGDAEVKWEKA
                     ALRGSRSKTMQVFKPRRATKEEMTRFHTDEYIDLLEAVTPETADALTGGGTRCLIGED
                     CPAFDGLFEFCTISAGGSLGAAERLNAGAADIVINWAGGLHHAKKTEASGFCYVNDIV
                     LGILELLRIHPRVLYIDVDVHHGDGVEEAFYVTDRVMTCSFHRFGEFFPGTGDVRDVG
                     MKKGKGYAVNVPLRDGITDDSFQSIFKPVIDRIMSHFRPSAVVLQMGADSISGDKLGG
                     FNLTLEGHAECARFIKSFNVPVMMVGGGGYTVKNVARAWTKETAIMCGVDLAEDLPYN
                     QFLEYYGPRYKLEVLPTNAVDHNPPEYLERIKNQVFENLRSLPFAPSAQMRSVPSKTI
                     GQVLGITDGGDEEPEDEIDQRIKKLLKRRRANVLDVDASSSSESETDTPAFSRPGRAR
                     RQGGNFSGRGRSSRLAQLQRNRERREAAQEASNEVEDDPCGVLGKKKRSFFKVVPKLN
                     GVGVEPIDATGFGIGVVTNGLNGVGGLKDRLGIPVVEQWKGDGIVSRGGTPASIA"
     gene            97332..99805
                     /locus_tag="CNH03510"
                     /db_xref="GeneID:3259131"
     mRNA            join(97332..97427,97502..97592,97709..97817,98232..98379,
                     98447..99805)
                     /locus_tag="CNH03510"
                     /product="v-SNARE, putative"
                     /transcript_id="XM_572516.2"
                     /db_xref="GeneID:3259131"
     CDS             join(97426..97427,97502..97592,97709..97817,98232..98379,
                     98447..98459)
                     /locus_tag="CNH03510"
                     /codon_start=1
                     /product="v-SNARE, putative"
                     /protein_id="XP_572516.1"
                     /db_xref="GeneID:3259131"
                     /translation="MSSEPYDPYIPSGSQPPAGPSSSGNNAQSTKIQAIQSQIDETID
                     TMHDNITKVAERGERLDALQDKTDTLAVSAQGFRRGASRVRKQMWLKDMKMRIIIAVG
                     VCVLIVIIVVPIVKAVQK"
     gene            complement(99658..100798)
                     /locus_tag="CNH03500"
                     /db_xref="GeneID:3259258"
     mRNA            complement(join(99658..100113,100174..100236,
                     100293..100361,100428..100609,100712..100798))
                     /locus_tag="CNH03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657738.1"
                     /db_xref="GeneID:3259258"
     CDS             complement(join(99846..100113,100174..100236,
                     100293..100361,100428..100480))
                     /locus_tag="CNH03500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513405.1"
                     /db_xref="GeneID:3259258"
                     /translation="MKFFVAAVALVPAVMVNAYTTCMLTCMSEQQPTYCPSASSYNET
                     SCLCSDDFITYVKNCLYQSDCSTDVPVWYDLSEDACNTTSSSSSAAAASTASSQSSSS
                     DAAASTSSASTAETSSASSGAASVFGNAAAFGSVAIGVSAVIGGALLL"
     gene            101925..103746
                     /locus_tag="CNH03490"
                     /db_xref="GeneID:3259121"
     mRNA            join(101925..102124,102161..102401,102460..102550,
                     102605..102754,102806..102871,102933..103013,
                     103064..103149,103218..103385,103438..103746)
                     /locus_tag="CNH03490"
                     /product="expressed protein"
                     /transcript_id="XM_024657737.1"
                     /db_xref="GeneID:3259121"
     CDS             join(102285..102401,102460..102550,102605..102754,
                     102806..102871,102933..103013,103064..103149,
                     103218..103385,103438..103479)
                     /locus_tag="CNH03490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513404.1"
                     /db_xref="GeneID:3259121"
                     /translation="MLSLTHILPLALAAASGASASPTTIQKRDISYPGVLGFLEPTPR
                     GWDYSTMGTSPCGGFTTVNQTYYGLSTGMEFQVSNDVSNVVISYSTSSDMSNAVTLAT
                     IESATAGTMCLDGENLFEDEGFNFGDDITLQVFYHDEVTEQDGYQCADISFTSDHVMS
                     VTCSNTSTIITKNGGSSTSSDSTTTVTVTAKSGKVTPLQAGWIGACVTIAVFGFALLA
                     LWYFGAIFFSRNALRRSEIQLGSHRMAEHSLDDISLHRRTTVDHKTPL"
     gene            complement(103670..107083)
                     /locus_tag="CNH03480"
                     /db_xref="GeneID:3259086"
     mRNA            complement(join(103670..104788,104841..105050,
                     105104..105251,105313..105827,105876..107083))
                     /locus_tag="CNH03480"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_572576.2"
                     /db_xref="GeneID:3259086"
     CDS             complement(join(103826..104788,104841..105050,
                     105104..105251,105313..105827,105876..106826))
                     /locus_tag="CNH03480"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_572576.1"
                     /db_xref="GeneID:3259086"
                     /translation="MPVRPSRSNSDSSIPYVTNSSLASSYRPTSIRERETSPINTFNQ
                     LSLERSLTPPKAPRLAPQVTHDPKYTRHKRTQVLRNTSGTPSAASTDDEDDQDERGRG
                     GIDEEVKSWLELRDGQGWKRIGKYKSVNKRGEIKNDLTNQLPPEILIQIFRYLPGNKD
                     LLSVLLVSRFWCLCAFSLLWYKPTLPTITQLASIVRVIHSPTRSLPYANAIRRLPLIQ
                     LGPTLTDELFTSLLVCSRLERLNISGADKLTSGALRNVIACMPNLVSLDLTGVINTDD
                     AVLVIVGETCQKLQAINLSECRLVGDEGVLALAKESRALRRIKFEKCHRITQKSLIPL
                     IRACPLVLEYDFQDVISLSSSVLHTVFLHASHLREIRVNGCVSLNENCIPNLLDLSEM
                     QDDGVAKVSEDVGIKIEPAEGVTMWRPVTTTFEYLRVVDMTGCTDLGDKAVDNLITNA
                     PKLRQLTLNKCPALTDKSLESIGKLGKHLHNLHLGHVSLITDDGVINLARSCTRLRYL
                     DLACCTLLTDACVAEIGENMPKLKRFGLVKVTNITDEAIYSLVRKHTSLERVHLSYCD
                     QLSVKAIAYLLNKLAHIKHLSLTGVSSFKVPELQEFCRPPPDFFNDHQRAAFCVFSGS
                     RVVDLRDYLNNHYLPSMEVDTSEDSGHDGAASSTSSLTIPRAAPTPDHSSISNSVAQH
                     SNLVYRQSLSNLNDVWEDAPSPISPTPMSRPQPPHILTASIQYQSVQPGEGAPFPIAS
                     TSTSPPTFTSSSSARLTPNPTSAAPSYFNISSSPSLHNRFAYGGTTLPTHLDYLVPPS
                     QESSRSSSMSSNGDRFPFIPHQVLSERSRGPDAPSRRDRPSGPRVPSDSYNVSPSYAN
                     EFASYWSREGRLPPASDAEVGMARTHIAEEPMTQVPNLSHRPGANGSSSSSAGAQREG
                     GRGSRWLQRFGNGR"
     gene            107759..108818
                     /locus_tag="CNH03475"
                     /db_xref="GeneID:36393023"
     mRNA            join(107759..108201,108256..108454,108530..108818)
                     /locus_tag="CNH03475"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658666.1"
                     /db_xref="GeneID:36393023"
     CDS             join(108341..108454,108530..108751)
                     /locus_tag="CNH03475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514584.1"
                     /db_xref="GeneID:36393023"
                     /translation="MFHMDIQSQPEYFCKGCGHVYEDSPDHPAHGEKCTKCDKVLFDR
                     VNWIKPGERPIVRNTYTFCNFRSSYCTEVGSYWQDEEEGLEDLCRIMIDNSEVPENTA
                     RLSHNCRNK"
     gene            complement(108993..113104)
                     /locus_tag="CNH03470"
                     /db_xref="GeneID:3259051"
     mRNA            complement(join(108993..109190,109272..109475,
                     109528..109585,109643..109785,109862..110068,
                     110125..110314,110366..110454,110515..111190,
                     111243..111343,111392..111499,111553..111835,
                     111885..112723,112768..113104))
                     /locus_tag="CNH03470"
                     /product="protein transporter, putative"
                     /transcript_id="XM_572575.2"
                     /db_xref="GeneID:3259051"
     CDS             complement(join(109051..109190,109272..109475,
                     109528..109585,109643..109785,109862..110068,
                     110125..110314,110366..110454,110515..111190,
                     111243..111343,111392..111499,111553..111835,
                     111885..112723,112768..113047))
                     /locus_tag="CNH03470"
                     /codon_start=1
                     /product="protein transporter, putative"
                     /protein_id="XP_572575.1"
                     /db_xref="GeneID:3259051"
                     /translation="MSTYSHTPNYPLRTLSQRSNSAAMPQLEPEETSSSSRTKLTSWG
                     RSKKKRVSDATEEEALLEENSSYAFEQELGTEIRHGGKSKGRTIPLQPASPKSPYPAN
                     VVRNQKYSILSFLPLVFYEQFKFFFNFYFLVVALSQFIPALKIGYIVTYVAPLAFVLA
                     VTMGKEAFDDYSRYLRDREANSTRYLVLVPQPPSPNPSSDGEQTPSLPRPQTRSTPAS
                     SIKVGDMVLLEKNQRVPADMVLLTTSEEEGTCFIRTDQLDGETDWKLKVAVGETQKMG
                     EAFVGSAEGSLYADPPIKDIHTFYGVFTLRSTSPGEQTETSTPLSVENVLWANTVLAA
                     GSAVGLVVYTGKETRAVLNTSEAGTKMGTLEKEVNKMAKILCTVTFALSVILVALNGF
                     RGQWYIYVFRFLILFSSIIPISLRVNLDMGKTVYAHQIQTDKEIPETIVRTSTLPEEL
                     GRVEYLLSDKTGTLTRNEMELKKLHMGTLVFGWDSMDEVSHLLSQALDETSGPHGRQG
                     SLPGGNQRGRRDMTGRVRDTVMALATCHNVTPVVNDDGTTTYQASSPDEVAIVQWTES
                     VGLTLTSRDRTSMVVRSSAGRSLTFDILSIFPFTSESKRMGIIIRDRETGGITFVQKG
                     ADVVMSKIVQKNDWLEEETGNMAREGLRTLVLARKKLSEEAYAAFDKAYRAAQLLPSE
                     SRASSITSVISQHLETELELLALTGVEDKLQEDVKSTLELLRNAGLKIWMLTGDKIET
                     ATNIAVSSKLVARGQYIHQAAKLTTADQVRDMLDFLHTKLDCALVIDGESLQLSLDRF
                     RSEFIILATQLPIVVACRCSPTQKADVAKLIREYTKKTVCCIGDGGNDVSMIQAADVG
                     VGIVGKEGKQASLAADFSINQFSYLTKLLLWHGRNSYKRSAKLSQFVIHRGLIIAVIQ
                     AVFSSIFFFAPIALYQGWLQVGYATLYTMAPVFSLVLDKDVNEDLALLYPELYKELTK
                     GRSLSYKTFFTWLTISVYQGGIIMLLSLLLFESEFLHIVAISFTALVINELIMVALEV
                     TTWHSYMVLSELGTALVYFGSMAVLPEYFDLAFVLSSTFVYKVTVIVAVSSFPLYVIK
                     AAHQRLNPAAYKKVAGI"
     gene            113248..114834
                     /locus_tag="CNH03460"
                     /db_xref="GeneID:3259078"
     mRNA            join(113248..113530,113578..113618,113671..113749,
                     113811..113956,114008..114606,114666..114834)
                     /locus_tag="CNH03460"
                     /product="coenzyme A transporter, putative"
                     /transcript_id="XM_572513.2"
                     /db_xref="GeneID:3259078"
     CDS             join(113302..113530,113578..113618,113671..113749,
                     113811..113956,114008..114606,114666..114717)
                     /locus_tag="CNH03460"
                     /codon_start=1
                     /product="coenzyme A transporter, putative"
                     /protein_id="XP_572513.1"
                     /db_xref="GeneID:3259078"
                     /translation="MYNRDQPGSSSSTTSPNGKQRASIMTEQGSLPGLLVNTPLEESV
                     WPPARESDRWTASDFWRKSRERAKTDRNSWDYVLSSGIAGGIAGCVAKTSIAPLDRVK
                     ILFQTSNAEFTKYAGTPMGLLHAISVIYKSSGVRGLFQGHSVTLLRIFPYAGIKYMMY
                     DWLERLLIKHPDQRSPQRFFLAGSASGVCSVLCTYPLELIRVRLAYQTKTSERTSLLQ
                     VIKTIYHEAEIPVNKKQSQSVSPFIRNLPLYPFYRGFSMTIFGMIPYAGVSFLTYGTL
                     KRYAADYIPYFGNHATARDLACGAVAGAVSQTSSYPFEVVRRRMQVGGTLGNGGIGWR
                     EAVKRVYESKGWRGFFIGLSIGYIKVIPMTSISFATWQLMKRLMEIS"
     gene            complement(116146..118163)
                     /locus_tag="CNH03450"
                     /db_xref="GeneID:3259344"
     mRNA            complement(join(116146..117630,117685..117795,
                     117856..117979,118038..118163))
                     /locus_tag="CNH03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_572512.2"
                     /db_xref="GeneID:3259344"
     CDS             complement(join(116317..117630,117685..117795,
                     117856..117979,118038..118120))
                     /locus_tag="CNH03450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572512.1"
                     /db_xref="GeneID:3259344"
                     /translation="MENSWAALAALGILIQLSVQQKVLRTVWLLLNVNDTFRALRLVR
                     ANGRRIGVNTRRKSMRGALVCWIIYLIGTTLSPLSSTLLGWIPLYSPIKSILGCCFLI
                     MRLSCSVAIFKSLVPLVKPYETPIDITVHLFESLFILVFHFGVQIPIIHAAAWIKSVG
                     EVNFKLPIEILQRWRRQLLSSFTTVSLPKAIRRLSNSKDTPSQIVTLPTPPRSAPSSP
                     TATQTSPAHPSTRSRQPRQPKRKPLQPIVISPTPSPPPPPAPAPVLVFAPSTPVRRMA
                     MGEPAVVKKNGFLDVEREVEVRRSPRKNKGKRKDNATEAQREPEKDMEVEDDSQRVKS
                     KKRVREEEQQLQPRLTKSIAISHTMNRPGMNKRSVKRAEIQPSKSGIKKSVSGLKRGA
                     TMSNVSDLHAGKGMEDVEITVREPKHPRLPPSRSVVSLSERNVPFETSLPKFIDKALP
                     LQQPTSVPIAATRTREPQTLTFSTSTRRMQESAPNGVAEPEKPLISAAGRARAAKAKA
                     KALTREEEDRKGAGEKRKAAGGGQREGAGKKARVM"
     gene            118346..119814
                     /locus_tag="CNH03440"
                     /db_xref="GeneID:3259346"
     mRNA            join(118346..118440,118507..118601,118658..118833,
                     119033..119814)
                     /locus_tag="CNH03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_572511.2"
                     /db_xref="GeneID:3259346"
     CDS             join(118412..118440,118507..118601,118658..118833,
                     119033..119716)
                     /locus_tag="CNH03440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572511.2"
                     /db_xref="GeneID:3259346"
                     /translation="MAVDYDQFKGKPFQVISKLGVRYTGIFDHISQEDQTICLAQVYN
                     HGTEDRPTARKLPGSTKSLGWVRFRTESIESLSLVENYNHPGAEPEPQEDPILASVSQ
                     APPPNAVAAGPSSPSPQTTSQPYQRHDLPAKPSQSAISAATAMSRVERSLSELSVDDR
                     PRRPSRQAQARPPAVPDAEFDFQKANEKFEKEKEAFKSAADGQGADVAVLDEPVNQPH
                     PSAVVQSPSEGEPKTAVYNKSSFFDSLSHSSSKISRNEERHRNLDTFGEAGGNGMGGR
                     GGYGGRGRGRGGYTAGGGHYNGNGYGGGRGRGGYRRGGYQNQSQPGESVNL"
     gene            complement(119815..120637)
                     /locus_tag="CNH03435"
                     /db_xref="GeneID:36393022"
     mRNA            complement(join(119815..120199,120304..120406,
                     120482..120637))
                     /locus_tag="CNH03435"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658667.1"
                     /db_xref="GeneID:36393022"
     CDS             complement(join(119820..120199,120304..120406,
                     120482..120541))
                     /locus_tag="CNH03435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514585.1"
                     /db_xref="GeneID:36393022"
                     /translation="MLRPHSPSEYPSLLLYILDETHITVTLTTALAILYTRNAHIVWL
                     AIGALGSSLTAKALKKLIRGPRPPPPPDSSASPVRPKKTYGMPSTHSTALTFYAAYIL
                     PSLSSLPLPYLLGLGVVGYWAAGLWSRKELGYHTWEQIGAGALTGGILTWIWRGIWNN
                     WDVEGTLQPLIDHVWKTIVG"
     gene            120760..121507
                     /locus_tag="CNH03433"
                     /db_xref="GeneID:36393021"
     mRNA            join(120760..120912,121046..121154,121251..121507)
                     /locus_tag="CNH03433"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658668.1"
                     /db_xref="GeneID:36393021"
     CDS             join(120848..120912,121046..121154,121251..121394)
                     /locus_tag="CNH03433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514586.1"
                     /db_xref="GeneID:36393021"
                     /translation="MPQPACQLAKEELLACLLRTDCVLKSGKTPQECLQKPQELPLQC
                     QHLITRFADCKKGMLDMRRRFRGNHLSEEAKERARGTGTVDIRPADDIAPDRPDDQSN
                     RQY"
     gene            complement(121544..123477)
                     /locus_tag="CNH03430"
                     /db_xref="GeneID:3259157"
     mRNA            complement(join(121544..121763,121857..122024,
                     122118..122202,122320..122412,122479..122580,
                     122642..122760,122835..122943,123028..123040,
                     123100..123214,123297..123356,123408..123477))
                     /locus_tag="CNH03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657736.1"
                     /db_xref="GeneID:3259157"
     CDS             complement(join(121696..121763,121857..122024,
                     122118..122202,122320..122412,122479..122580,
                     122642..122760,122835..122943,123028..123040,
                     123100..123214,123297..123339))
                     /locus_tag="CNH03430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513403.1"
                     /db_xref="GeneID:3259157"
                     /translation="MRFRTGISNVGLLHKIIRSLAALARSCVIKLSEEQVYFIVPGSE
                     SATGVQVWSQVKVSTLFEDYRIESNSNNEIWVEVNLDSLVKVLRSADNSVGGINENMR
                     NSAALSQAEVTLKLNKKQNQPIWAFDIKGYTASRKSMIITHEINVKILSSRRQEDLKE
                     PLCPRPDIHVVLPNLQELRNIVSRLAPVADDVDVSANHEGTMELAVRSSKVNLTTTWK
                     DLPIPVTNLEEEGEEAEQPPPPGQMMTTTVTIKALLKFLTSYVISGEAIMCICEGYCV
                     IAYVYIGPIDNAEGVLTFYVPGKATDDN"
     gene            complement(123647..127182)
                     /locus_tag="CNH03420"
                     /db_xref="GeneID:3259206"
     mRNA            complement(join(123647..125490,125585..126029,
                     126115..126256,126397..127182))
                     /locus_tag="CNH03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657735.1"
                     /db_xref="GeneID:3259206"
     CDS             complement(join(124309..125490,125585..126029,
                     126115..126167))
                     /locus_tag="CNH03420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513428.1"
                     /db_xref="GeneID:3259206"
                     /translation="MSSSEEPLTKGKERENPRPFNVTNLSGPARLPTTGSTDPSHVAY
                     SHRNLRDALTGGPADPSMITDLSSDVNKYHSILNSDAVKRTSLPVSGAQRHHFFILPG
                     ITDEGQFAYGTLLALREMSKYKQSSLDSWKESEWCKPPEVETWWDEEVKKGTEWYKEY
                     CKVTGFDPTDPSNKQRALSEWSSTISSRLRQKLKSEHRFQQSCNFPTLSVITEKDIDV
                     ALKFGSYSEAENDRRIDINPQAMMHDWSILRLERENNPNVWRSPLPPIGSHARVLVHS
                     NYSYSGLPEVVTKLALPSTSEDLCKTSPEIYAMFDPENRDDEQSLQGVIDRATAAFSE
                     FDRDIGRSKQIKDGICGGTWQNWEQYTLDPQKKAQCLSAYTSAYLQNEFNQRTRDTNL
                     GGSSQQPYLTPQVLPVHGYDDYIWNTSLETGTFDPSFSGNSGIIADLVAEDVLLRART
                     IINGVTSQATPEGAPPPYEYSEISPVRCEAGSSNLAASTQIPERGKSTKNDMLPSQSE
                     ETVSLPFRPNDNDHTTTTSLSNEPVGRRQRWSSIMARKLLCGSSQNGDISD"
     gene            127888..128818
                     /locus_tag="CNH03415"
                     /db_xref="GeneID:36393020"
     mRNA            join(127888..128323,128382..128818)
                     /locus_tag="CNH03415"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658669.1"
                     /db_xref="GeneID:36393020"
     CDS             join(128210..128323,128382..128471)
                     /locus_tag="CNH03415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514587.1"
                     /db_xref="GeneID:36393020"
                     /translation="MYNFSETPSTEYYCSHCGFVYEASPRHPAEGEKCYKCKGVLYSK
                     GDDIKPEERQVIMFGGIYRGKGI"
     gene            complement(128839..130881)
                     /locus_tag="CNH03410"
                     /db_xref="GeneID:3259186"
     mRNA            complement(join(128839..129536,129593..129946,
                     130003..130089,130146..130881))
                     /locus_tag="CNH03410"
                     /product="transcription cofactor, putative"
                     /transcript_id="XM_572509.2"
                     /db_xref="GeneID:3259186"
     CDS             complement(join(128997..129536,129593..129946,
                     130003..130089,130146..130406))
                     /locus_tag="CNH03410"
                     /codon_start=1
                     /product="transcription cofactor, putative"
                     /protein_id="XP_572509.1"
                     /db_xref="GeneID:3259186"
                     /translation="MSSLALPTIQPSQSHTPSPSAPAPSAPQPATSQRTRKRSTPPLE
                     EDSDEEEEEDKRRGTGPSKKKASGVWGWEDMGDYKYMVEIRQMMFVFGEVQTPLPETV
                     KLVEDIVRGQIIEIVTRARLLTHLRSSRFLSAEDLIFLIRDDRGKVNRLRTYLSWKDV
                     RKRAKEEAERAGEDIDLDVDEDKAMKGRKQMVKLPWELLTPFTSFLRSMPGKEEEDDE
                     DDDELQAHEDSMQRLREADEITKKMTKNEYAQYSECRQASFTYRRARRFREFINFSAY
                     LDVRPNDDIVDILGFLAFEMVRSLCVTALDLRERLEKTKTTGGGEVGSTIGSAGTSAQ
                     KQDGNKRSSAEPGAISQNKTPSSSNPPSLFAPPPSARQPLQPCHVLEAFAQIQRAQAA
                     NRVGGMGNFRGGVGKKRMALV"
     gene            complement(133048..137320)
                     /locus_tag="CNH03400"
                     /db_xref="GeneID:3259140"
     mRNA            complement(join(133048..134377,134432..135377,
                     135436..135664,135715..135835,135882..136149,
                     136200..136349,136398..136662,136711..136820,
                     136871..137320))
                     /locus_tag="CNH03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657734.1"
                     /db_xref="GeneID:3259140"
     CDS             complement(join(133180..134377,134432..135377,
                     135436..135664,135715..135835,135882..136149,
                     136200..136349,136398..136662,136711..136820,
                     136871..137123))
                     /locus_tag="CNH03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513427.1"
                     /db_xref="GeneID:3259140"
                     /translation="MSFPPSVNHLVLPRTKRRNYNTHNNQTEYSEDNQFQDDVEEERD
                     QVDDAVGVGGPTVEFGRQGGVSLQRKRGSWGWMWSVEDRQDLKWRTGKEAIHFFPATR
                     TPEIESDPEISLREVINSSVQYAEDLCLPYERDGLRDVITDILMEEHAAGPSGTSKQP
                     AGPLRKLEEDAFDETQIYQGSIVAVIQNSRGKSARTFVAFPTGEVGHHLNIAPFLATS
                     TTRVDKRSRFRFTPTVKPIDRFPTSILQICSSPMISPFRIDHDATALLVRTRTTTHLL
                     NLHPSLTPFSPYITSTRIAELSFSDTEDRRHVDVVLDPATWSRALVVDEGGGIWMWWE
                     DKEIRGGRLEKVMNLRKIRDKITDDKDQFFRISFGTQPGTALVLSSREATLIDIDNHD
                     HPATSLITLSGFNRRFTFLEKTALERDSRYTTICTTHEVFWLDETGKGVPALGFRHEY
                     GVTDIEAIIFPGQGKDQMTTLLYSPSHPFITALATPKSDPVRFLTPPYALGLPLHRDM
                     TLKELSYLSLNSNRHPPSLIALDQEGGLWCIPLISSRNTRFGAIDSAEGREGQKQKQE
                     IIPISAQWDDEVSSLAAKREDREELGVGDGWLEKAQVAYKEIDLRWVWLAINEQDIKI
                     FSPEPSVASLSDTEGEGEEEASGELMTRNDWVTDDERESGEQDLDKEGGRENVGNEEE
                     GAADSSLEEPGHEGRYREGRGAIESDEATANAANIAAEEVEKDDDDGDESDWEDEEGE
                     GEEDLKRMQCQGEKTESWFRPEEFAQYLRELEAPMDGLVTGSELALDMCFPSASSLDE
                     EQVRRWDDVEEDAPLQTLTIHPYAIRSTLEGMDELVLSKFVPIIHTLHSGFPSFTESR
                     PLLPLPYQRPFQLYRFFLDSFPPSSLRDNLSAAQLALNLYLSTLIFSPSDYLPLAPAA
                     HDRLIDAAAEEEQQGDEVELFVQATSQLSLNDPAPPLIEFNVVKPTLAPVRPLYKSLN
                     AVESGSEWEDVVEGDEKGKEEKRMERLQTHIARTLIDDWKLGQDLTYWTWTPMGLEDT
                     QWDPERATDPTRGDAPQPMDGVSSMQKESDRRIRPLPGSRSHPSLSLSQPRSRVQPAS
                     PPRTSRSHPFSHLIPPSLSTSHSMPSIPSLVQGPRSSPPPTMSQMGIVTSSQPEGENQ
                     NQEMGWASTQVERGKFGGKLEKKKKNKKRLGGF"
     gene            138639..141371
                     /locus_tag="CNH03390"
                     /db_xref="GeneID:3259318"
     mRNA            join(138639..139004,139073..139156,139209..139311,
                     139378..139954,140019..140565,140642..140750,
                     140817..140957,141048..141371)
                     /locus_tag="CNH03390"
                     /product="alpha,alpha-trehalose-phosphate synthase
                     (UDP-forming), putative"
                     /transcript_id="XM_572507.2"
                     /db_xref="GeneID:3259318"
     CDS             join(138762..139004,139073..139156,139209..139311,
                     139378..139954,140019..140565,140642..140750,
                     140817..140957,141048..141247)
                     /locus_tag="CNH03390"
                     /codon_start=1
                     /product="alpha,alpha-trehalose-phosphate synthase
                     (UDP-forming), putative"
                     /protein_id="XP_572507.1"
                     /db_xref="GeneID:3259318"
                     /translation="MTTMSSDVPNSPTSTSFTGTFSPAATAANTAANARTRDAPSPTT
                     SSSGPKLETNKDQRLIVVSNRLPVTISKDDNGEYHFKMSSGGLVSALSGCKKTMSFTW
                     IGWPGKDIPMQDRETVNRRLLEEYNCYPVYLSDELADSHYNGFSNSILWPLFHYHPGE
                     MNFDSAHWLAYREANMRFADVVSSLVQAGDMVWVQDYHLMLLPMLLRSMITGESAQGE
                     MVRQELGRVKEGVDDTVVKEVLKMGPGVAQAEDEGVEMLDDVEEEGGEMDVKTSPKRP
                     HYGRGMSTFQKQELVAKEKGKEGIRIGFFLHTPFPSSEIYRILPVRREILLGVLQCDL
                     IGFHTYDYARHFLSSCTRILGLETQPNGIEFDGRYCQVGTYPIGIDPNQFIEGLQKES
                     IVKRLRSLEARFDGVKVIIGVDRLDYIKGIPQKLQALETFLTQHPEWIGKVVLVQLAI
                     PSRQDVEEYQDLRACVNELVGRINGRFGTVESVPIHYMHKSVPFEELTAMYALADACL
                     VTSTRDGMNLVAYEYISSQAERHGSMILSEFAGAAQSFNGSLLINPWDVQSTADAINQ
                     ALTLSPQQRKTNWQKLFNYVSKYTAEAWGVSFVNELNRLSGQRPAGPTGLAGRRKSGS
                     LSRTSSKASMQRRKSSQSGIATGLGAAAGAAVNWAQAQVGTQT"
     gene            141783..145371
                     /locus_tag="CNH03380"
                     /db_xref="GeneID:3259237"
     mRNA            join(141783..141944,141995..142251,142325..142703,
                     142765..142931,142995..145371)
                     /locus_tag="CNH03380"
                     /product="glycogenin glucosyltransferase, putative"
                     /transcript_id="XM_572506.1"
                     /db_xref="GeneID:3259237"
     CDS             join(142002..142251,142325..142703,142765..142931,
                     142995..144991)
                     /locus_tag="CNH03380"
                     /codon_start=1
                     /product="glycogenin glucosyltransferase, putative"
                     /protein_id="XP_572506.1"
                     /db_xref="GeneID:3259237"
                     /translation="MSLPNAFVTLLTTSSYLPGALVLLHALQDLHPAPRDFQIVALVT
                     PETVDAATIGELRRAGYDLVIGVEPIGSGKAGQVGLELMGRPDLNFALTKLHLFRLAP
                     FFSTLIYLDADILPLRPISHLFTSTAPHVFSACPDTGWPDCFNSGFMVIRPRESDWDG
                     LKGMLKDGEGEDGLYREAGNGSFDGADQGLLNEWFSEEGGGGDWNRLSFTYNVTPSAA
                     YTWAPAYKRFGHKISNVHFIGPNKPWTSLPGRPAGVSNVKGKENSYDYLSLIDRWFAV
                     YDKHVRPASALDPDISRRFAVPQTIAAWDSHANRARAAATVLSEDKLELSELKAATER
                     GVNAFKPGQYTSLPLEGRVDLIMPKPKPVPRAAISQLAAASTVAPSVSPSALTPPPAD
                     AVPAPAPAPVLTQTEQQTAQPFVWDAQRSSPPASAPPEMSVPHTYYRNAWEAPLSQQS
                     SYYAHPESHQPQAEHKEPEYPTLPKEVTGDSWYARFATSTPDKRAVSAVFPWEEKTGS
                     HGYGHGSRPKPERVFPKGEEPLPPLVQQLIHPLQPPSISIQYATPTDSYQSQHPSHAT
                     GMGMAGQAQAPKSPSPPPRHVSMVEAMASYKNVWDDIPQIGKYVDIMSGKTGGRSVRG
                     LSTRGHGHGQGHIQGHSQGQKQSQAQSHERNVSLQSLQSVPGTPRTQYSTFGKSPRLT
                     NARDLERRGSLEQPEDSADGDDENSTSASEEEGGKGGEGKSSKPYKGNRKYRDRWAQT
                     DRVKTVDETVQTQTHAGEEMAGGGLKMWGLPHASAHGRKSSKEIPFPSGSGNGRAGGG
                     GQREAQTQHQSTYYEYQQQHPHSQQPRQGSTASPSQKPELNARLPDYSFDFKGATSHA
                     QGIAQAQAQAQSQAQGQGANSNLNAQHRHKPSGSFSTIYGGRGRVWDPNTDVEVRRRD
                     SQEVLARFMQGNLGRG"
     gene            complement(145810..148887)
                     /locus_tag="CNH03370"
                     /db_xref="GeneID:3259050"
     mRNA            complement(join(145810..146360,146429..146654,
                     146722..147971,148048..148887))
                     /locus_tag="CNH03370"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_024657733.1"
                     /db_xref="GeneID:3259050"
     CDS             complement(join(145821..146360,146429..146654,
                     146722..147971,148048..148851))
                     /locus_tag="CNH03370"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_024513402.1"
                     /db_xref="GeneID:3259050"
                     /translation="MAPSHSHPAHYRRPPSPLPDLGAPLFSLAPSASASASSRTARPH
                     GDTDSVQDVAEMSLESLTLSPPTTATTITTTVAPPTPTTPTSSSTAAATHPVATGGTA
                     AEYPETAAAGIATGAVFTGIGINPPTPAPSPGPHIRGFDDSDTHIREHLEQLLYHGDT
                     TTDPHGQNLDHVQVQAKPHAKPQAQGKTLPHEPYPSPSPAPTPTPTPQTVLSQYTSLP
                     PLLRSKFLNLLIPHLALHEALSLSRKIEPLLRRDFLRELPWEVALHVLSFVDDPQTLA
                     RAAQVSRYWNTLLQDETTWRDLLARHHHRHRYASGGGIGISGRDPPQHARATSREGME
                     GMTGKEEEEKGWDVGSGLGPPADPNAATSTNTNTNTNTSSRRGGSTSSSQAGTSKQRS
                     KTRDNALGTGSGTKQACCIKRVTPFGLEKRVLNLSSGLTGLPPPISPFSPSPSPFPSP
                     SPSSQHSYKTRVKLAYLTETNWLTAGVLLAKHLSADDSVVTTLSFDETWIVVGMANSK
                     IHVFSAFNGGWKRSLEGRAAHTQGVWAMVLVSPPPRTATATQTATANQMQMQEQDMKR
                     MRGTRGMGWYGAQASASTSTSTSPNGWFGINPPSSYPHPQTQTQTQTQSETQENETPY
                     QHGRENQSRGQDQGGNENEDEDENEGSNLCGSVRGWQGLKTSLVVSGGCDKQVKVWDV
                     ETGQCIHSLPGHTSTIRCIKVLPHRPIAVSGSRDYTLRVWDIQRGRCLHTLRGHTKSV
                     RCVEIWGNMAVSGSYDNTAKLWNLDTGECLQTFTGHYSQIYSIAFNGSLVITGSLDST
                     VRVWSPTTGECLALLQGHTALVGQLQLSGSKLVTGGSDGRVIIFDLSSMSCIHRLCAH
                     DNSVTCLQFDKRFIVSGGNDGRVKLWDVKTGGFVRELTKPCDAVWRTSFRGERIVVLC
                     QREGRTCLEVVSFRPGEGERRGKGI"
     gene            complement(149007..150307)
                     /locus_tag="CNH03365"
                     /db_xref="GeneID:36393019"
     mRNA            complement(join(149007..149879,149943..150307))
                     /locus_tag="CNH03365"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658670.1"
                     /db_xref="GeneID:36393019"
     CDS             complement(join(149180..149879,149943..150295))
                     /locus_tag="CNH03365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514588.1"
                     /db_xref="GeneID:36393019"
                     /translation="MPYSLRPRPAPLAELPLDSFLPERPSASPTPTGSTGPQRHQSAS
                     SPVASSSKHPSPMHPHRRGIEPGDGMKSPVKKRTRTVTPRVKQVLDRDDLGVGKSPAR
                     RLFATSVAQSSSHPSLGGISGAILTPPLNDTRATQNQTPIQNQYLLEDGNGNGEDMNI
                     HDPGFVVRRDPEGSVVGRPRTRSRSRSASPFPSSTLSELDIDNQENIPPPLLPSTSAC
                     SISIPDTPHSQSGGSTSTSSRVDSYLCTFPSTVSPSSHHHWSPYSRSSHGHTPGSRKR
                     EQSKLVNELLLLRGEDVPSKTQIKTRARTESESGHRHRKMEEVIIQDELTPGRRTTRG
                     MARRGKDLLAKEVDGV"
     gene            150486..152911
                     /locus_tag="CNH03360"
                     /db_xref="GeneID:3259147"
     mRNA            join(150486..150850,150910..151612,151666..152021,
                     152092..152911)
                     /locus_tag="CNH03360"
                     /product="metallochaperone, putative"
                     /transcript_id="XM_572504.2"
                     /db_xref="GeneID:3259147"
     CDS             join(150508..150850,150910..151612,151666..152021,
                     152092..152621)
                     /locus_tag="CNH03360"
                     /codon_start=1
                     /product="metallochaperone, putative"
                     /protein_id="XP_572504.1"
                     /db_xref="GeneID:3259147"
                     /translation="MPHPDLSIPLLPDADDLPLPHPHYTWPEAGPSSPRAAGFLGNVD
                     AEYAYTHRRRPPGETTGDARGRIRERQGNGQAGEDERDGDGDTGTDPSKAGLFGAKAI
                     AAMTGAMATSLLMTPFDVLKTRLQTVPPHLHPSSVAAALPPSASTVSPGSASAAAAAA
                     ADCCQTTYSGAGTSIKPEHPLVCTHSSSVSIPSTKTGMDISSIRPSPSPSPSPPLASS
                     SSLSSGASTSTSASVNALRPPSGCLNPSKWAGIWGEPIPSGVPGGAGGVLVLREGPGV
                     ALGSLHLGGAGGAGGSSSIGVKSLLSSMKSSTGAVSAGIGSTATGAGGFWKEMATVRA
                     ESGIRGLWKGVGTAITMGIPSSAIYMLGYEYLSTIISPYFLDSSKPVYTTPASTSSIP
                     EPESFGEVDTVVFESLSTLSSASATSTAATTATTRTLTASLTPAPLIAGSLARTLSAT
                     VISPIEMFRTRLQALPIPGRPSPTYTSVTKDMYRLVQSRGPIILYRGLGPTLWRDVPF
                     SGIYWASFELLKTSLTSPDSPLPFSPLSTTLDLGPIPISFFSGFVSGTFAALLTQPFD
                     VLKTRRQVFNPTPGCVTDRQGGMIRVAGTVSLVRHVVKTEGWRALYAGTSARCGKVAP
                     ACGLMIACYEGVGRLLGGE"
     gene            complement(153083..154190)
                     /locus_tag="CNH03350"
                     /db_xref="GeneID:3258984"
     mRNA            complement(join(153083..153586,153678..154190))
                     /locus_tag="CNH03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_572503.2"
                     /db_xref="GeneID:3258984"
     CDS             complement(join(153125..153586,153678..154085))
                     /locus_tag="CNH03350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572503.1"
                     /db_xref="GeneID:3258984"
                     /translation="MSQQDPEAQPLTAEDFEFEQSSSFQDTSRPVPSRSPYHLPASEQ
                     LQGVANRIIFSRYYILFYGAMMGLSLATLVLSLVATRTFYHFVNNCENRMAANLVVAV
                     DKGECPSIAWHIIEFVLNALMVLEVTTRWIANGRKYPMTPLNIIDLTLVCFCVLTLLL
                     VFFNPCGSGTRNEELLDTILIVARNTVQFLRLGSILRRSGHSWLNPPKPIDLSQARDA
                     SRALDFDLDDEEDTERRFYGGGRGRSLLSGGGRRGYEPVSGEEEWMEGTGVRDNAGRE
                     QLSEQDQELWDRL"
     gene            155881..155952
                     /locus_tag="CNH03340"
                     /db_xref="GeneID:3259042"
     tRNA            155881..155952
                     /locus_tag="CNH03340"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:3259042"
     gene            complement(156061..160958)
                     /locus_tag="CNH03330"
                     /db_xref="GeneID:3258988"
     mRNA            complement(join(156061..158091,158160..159172,
                     159253..160958))
                     /locus_tag="CNH03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657732.1"
                     /db_xref="GeneID:3258988"
     CDS             complement(join(156228..158091,158160..159172,
                     159253..160320))
                     /locus_tag="CNH03330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513426.1"
                     /db_xref="GeneID:3258988"
                     /translation="MPYSFDATTAGRPNLAKRNTAPSPVTLLQLPSLEALPTPHKDRA
                     RRAASQSHLPSLEDSSIKPQSIFQKLRSKRPQSSLTAMPPLLKSRRPSSPKEQTSFFH
                     FDLTAMVTAFELRPKATRTNTSRSTKNESMPSSLLPGESFTPFSTPSNTYSMPSLAAL
                     PSIQHVMDAYDITHSKNSMYQEKQQERVSKEQKKKKRETIKLPMMKPPPKLSNYCSKR
                     EELEILDGDDWEYDFLRDISTSLTQPPTPTVPTHSHNHRQRNYSIPVALDYTIRIPAS
                     QRDPRSPNIRSHNSGSFEQDIGSFGTDRSHDIWLQNQVDTLEEVERGAVRELEQMSGR
                     LMTDGWGYGNGSASCRASGRANRASQPELPVTHSPLPPEPLTAPILVTETPTPQPQKH
                     VSEHDQTDKFRQRERSHIQGSNIISVPRARPVSEQRPPTKELLSTSPNVYSPVGRVGS
                     SNSLGGGGHGGSASAKVEREDKRCGSFTMYANTNIPLPPAPPPPTGVPLPAPPIGGVC
                     VSQQVPLYLAGADEKVEWSSGASAGAGVVGVKNQFKVSENDRPVEVTYEVLTNTRATL
                     GLAAAAVIAPPPIPPRSAERGYSGRKEIKRTTSNSYPVTHHAAHAIATAEPLHQQTTS
                     SSIHDSQHDKLASVDGQGETKEQKGKLQTDGTAVNGLSLGMLKPKRASTGGKKRGDRD
                     ILLPKRQDSGSSAQSQPIQKRPLPPIPIQPSSPGTSLISKHRRRPSTAPVPAPVYFSS
                     PRSTDSHSHSNSNSNPITPEKPRRLLPRDEPRLSLSPSSSTHTRDESFSHDRDRDRER
                     KKVRQDLFAMGFLALDEMYLRQSLALAQQPPTPPMPSKIAFGAMGAAKGMVKGLKARV
                     SNAPSMVSHSGFVTTPPTHKVNGQKRESSAPQRKEGGAREEGDSLDFSVNDNEGWSRP
                     TSAEAVYIMPPAERSKIGSHEVDKKRSRHQSRGAEKAKQQKGEGIEDEFQGEFGSGSS
                     VPGSEERSGEEGETSIGMISLWGHGKEGRKEEWHTVKEYDSTKHLSLKLAQGRQAAQT
                     MLFSLPTGTATHTKARPPPIDVSSATIDGWKIKEIEKRGHRPSLLPPPRPRRMTASGQ
                     GRGGSTESSKGRPVSPLDGVVDKRNTFFNLSRPSKPVIPDAAYSPLIQTPAQAVAQNY
                     FPFIPANIIHTSAHDIPRRPSDHASEHHQHLPQRQGQAHPFLPYSTPTTPKSKPRPHT
                     SNSAHHSFTSLSLTLSSISAASDSTADKEKEEKERQRKLLMSAWLASKPVRRSKQEQA
                     GETAPAALGGGGTAGEVRKEGRPGTISAGMGMKRDEDAGSAYRRASLDNRRF"
     gene            complement(<161416..162532)
                     /locus_tag="CNH03320"
                     /db_xref="GeneID:3259068"
     mRNA            complement(join(<161416..161635,161696..162287,
                     162343..162532))
                     /locus_tag="CNH03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657731.1"
                     /db_xref="GeneID:3259068"
     CDS             complement(join(161416..161635,161696..162287,
                     162343..162487))
                     /locus_tag="CNH03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513401.1"
                     /db_xref="GeneID:3259068"
                     /translation="MPFGEITLNDGHRIPAIAFGTWKIPKEVTPFQVGQAIDVGFDHI
                     DTAQVYHNEEEVGQAIKESGLSRNQLWVTTKWSGIDGKGARQSIGESLEKLGLEYLDL
                     YLIHSPQVTKGDIKGAWKELETLQKEGKTKSIGVSKQVYYQTIFFASLSDVWDSFNKE
                     QLQELLAHATVKPVVNQILLHPYVITRTAPLLEYLEEQNIVAEGYSTLIPLTSRPGGP
                     VDKPVNQIAERLNVKPEQVLLAWSRAKRAIPVTTSSRKARLEGYLDVGDITLTEDDVK
                     AIDKAGAKGELWFDCKARFEKVLIGAVFLIALIWLFKTYCRH"
     gene            162835..165793
                     /locus_tag="CNH03310"
                     /db_xref="GeneID:3259058"
     mRNA            join(162835..163054,163104..163200,163257..163374,
                     163439..163600,163659..164066,164132..164282,
                     164333..164706,164776..165062,165126..165139,
                     165208..165267,165359..165600,165663..165793)
                     /locus_tag="CNH03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657730.1"
                     /db_xref="GeneID:3259058"
     CDS             join(162941..163054,163104..163200,163257..163374,
                     163439..163600,163659..164066,164132..164282,
                     164333..164706,164776..165062,165126..165139,
                     165208..165267,165359..165600,165663..165678)
                     /locus_tag="CNH03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513400.1"
                     /db_xref="GeneID:3259058"
                     /translation="MESVVDVVTTVFQAILAVNVVFTVGYAYNGKRASTLSKTLSALS
                     NNLLLPLLILTTFAASPSLTWKRLLQLWPLAIISLTTHAASLVASILSCRYFGAPGWA
                     VESLTYNNVTSYPFLVVYALYRVSAVGGLNHLHWRIKDTTAEAFERATIYILTNFLIT
                     EFFRKFLNPFIVQSGLMDKEQEDADENVEDGFYAETVEATVDEDATERTSLLSRAQQP
                     DSTKLAIIRTAHSPILLSAILGLTIGLVKPLQRFITGVGVEGSSGGWLWLAAGSALNA
                     MGGSFPLFAILATGAAMRAGEQPPSPEYKTPPTLGTVLLFGFWRYICIPAITLPIVKS
                     FHKIPSTKVFLQDPVFSFVLVLTVITPPLLPSHLSPFRSSVLFSTFYSSLITAVPLAL
                     AIGLFGRGISYDLDFDLVSALKSAAGGGLAGAAAMVIQVLTLMPMRTIMNYQYRYGGG
                     LKSAAVTLYEDGGYRRYYAGLAAALFQGPLSRFGDTAANAGILALLSSLPWPVLVKTV
                     AASVASACFRMTLTPIDTIKTTQQTQGGGAGLRLIKERVRQQGVASLWYGALATAAAT
                     FVGHYPWFGTYNYLQATLPLPHTIIQKLFRQAFIGFAASLVSDTSSNSLRVVKTYRQV
                     HEGDVGYLTAAKRIVEAEGWRGLFGRGLGTRLITNGLQGLLFSVLWKLFADLIAGK"
     gene            complement(165801..169781)
                     /locus_tag="CNH03300"
                     /db_xref="GeneID:3259080"
     mRNA            complement(join(165801..166024,166128..166198,
                     166286..166387,166482..166683,166766..167258,
                     167327..167465,167556..167632,167686..167745,
                     167806..167891,167962..168099,168166..168349,
                     168411..168513,168571..168745,168861..169001,
                     169057..169781))
                     /locus_tag="CNH03300"
                     /product="microtubule binding protein, putative"
                     /transcript_id="XM_572500.1"
                     /db_xref="GeneID:3259080"
     CDS             complement(join(165932..166024,166128..166198,
                     166286..166387,166482..166683,166766..167258,
                     167327..167465,167556..167632,167686..167745,
                     167806..167891,167962..168099,168166..168349,
                     168411..168513,168571..168745,168861..169001,
                     169057..169077))
                     /locus_tag="CNH03300"
                     /codon_start=1
                     /product="microtubule binding protein, putative"
                     /protein_id="XP_572500.1"
                     /db_xref="GeneID:3259080"
                     /translation="MSRFVRPSKYRHVYGSKSKVNYENVKISGSAWDTDLVAAGGKYL
                     SVNWQASGGGAFAILPLFSPTSPPQPAGFPTKLPDIVPLARGHTAPVLDTAWNPFDDN
                     IVASAGEDGKIFIWKVEDSAFEGWGEDHWEPEDFNPALKLSAAGRKVGQVIFHPTSSN
                     LLTAASGDHLVRLWDISSGADEPKLVLKGHGDSIQSIAWNSIGTTLATTCRDKKLRLF
                     DPRAGSDAVRITDGHAGVKGSRIVWLGDRDRIATTGFSRMSDRQVSLWDTSSLKNLDT
                     QSIDSSAGVLMPFYAEGNDVLFLAGKGDGNIRYYEFEGDQLYFLNEYKTSDPQRGMTL
                     LPRRALDTQEHEIARAYKLSGGCVEPLSFIVPRKSESFQSDIFPPANSAEPAQTAADW
                     FTGKDVRPNVVDLETGGVSASKEAVPTPTSSAPAPAPAHVSAPSSTPSPTPAPAKEEP
                     KPATVHTPSPPATSTPIPAPAAADVPIAVKKEIDTVPEITAKGLEIEQPEEPSEDEQE
                     DKGPVEKVQDSLKSLTVGKEEPKTENNSVVAPSNTLLVKKLSPFATLPTRGSSLSAGY
                     DLYSAEETVVPARGKALIDSGLSIAVPEGTYGRVAPRSGLASKHSIDTGAGVIDADYR
                     GPVKVLLFNYSDADFTIQKGDRIAQLILEKIVMAPISEVEDLDTTARGSGGFGSTGGF
                     GKAVKDVAGSLI"
     gene            170428..173315
                     /locus_tag="CNH03290"
                     /db_xref="GeneID:3259123"
     mRNA            join(170428..170960,171023..171110,171171..171208,
                     171270..171433,171511..171670,171749..171891,
                     171974..172126,172216..172333,172420..172450,
                     172513..172597,172659..173315)
                     /locus_tag="CNH03290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657729.1"
                     /db_xref="GeneID:3259123"
     CDS             join(170898..170960,171023..171110,171171..171208,
                     171270..171433,171511..171670,171749..171891,
                     171974..172126,172216..172333,172420..172450,
                     172513..172597,172659..173154)
                     /locus_tag="CNH03290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513399.1"
                     /db_xref="GeneID:3259123"
                     /translation="MGEKLRVAIVGGGAGGLSALWVLNNFSQNEVHIYEKEDWWGGHA
                     HTVEFQQPGKEKCEIDTAFIAINSKNYPNFYRFVLDHSVELIKTTMSFSLSRDRGAFE
                     WASNDLWSLFCQGSNFFKPRVYRMMWDIFRFHIFAKDLLSEEGESEQLSIGEYLDREG
                     YSQSFKEDYLLPLTAGIWSIPPEKVALDFPAMALVRFFHNHQMLQLWGKPSWLTVKGG
                     SSKYVEKIIKQIPKEKLHLGEGVQAVVPQADGSFIVREVSGKEEMYDKVILATHTDQA
                     VSLLGENISPEEKAVLGGCEWSANEAVVHYDEELMPIRKKAWTAWNYLTSTKPISPSH
                     ESKTSASAVNTISITFDLNVLQSLPVSKHGHIFVTLNPPTPPSPSKTLSRWIYHHPTL
                     NPALLRAQQQLPSIQGVRGLYFVGAWTGYGFHEDGWRAGMEVAYRPEFGVPLHKRPWE
                     VRRVSGKDVKKEMGEWALRPVIGTVDWGVKGLVTWASWTLGLYMSAIHVVAGRVIKEK
                     KKVA"
     gene            complement(173491..175907)
                     /locus_tag="CNH03280"
                     /db_xref="GeneID:3259312"
     mRNA            complement(join(173491..173681,173761..173898,
                     173965..174705,174799..174911,174980..175153,
                     175224..175339,175432..175601,175686..175907))
                     /locus_tag="CNH03280"
                     /product="isocitrate lyase, putative"
                     /transcript_id="XM_572498.2"
                     /db_xref="GeneID:3259312"
     CDS             complement(join(173544..173681,173761..173898,
                     173965..174705,174799..174911,174980..175153,
                     175224..175339,175432..175601,175686..175745))
                     /locus_tag="CNH03280"
                     /codon_start=1
                     /product="isocitrate lyase, putative"
                     /protein_id="XP_572498.1"
                     /db_xref="GeneID:3259312"
                     /translation="MSSEKAEFDAEVKAFEAFAKSPRFARTTRPYTAADVVSKRGTLP
                     ISYPSDVQAKKLWKILESKARGEGGGCTATYGALDPVQLTQMAKYLETVYVSGWQCSS
                     TASSSLEPGPDLADYPSNTVPNKVAQLFTAQLYHDRKQRYTRSAALANGQDPGERIDY
                     LRPIVADADTGHGGLTAVMRLTKMMVESGAAGIHIEDQAPGTKKCGHMAGKVLVPISE
                     HINRLVAMRLQCDIMGTTNLVVCRTDSEAATLLSTNIDPRDHSFILGSTNPSLPPLND
                     LMIAAEMEGKYGQELQKIEDAWTKQAGLKLWPDVLADALSKHGVSSKKITEFREQSIG
                     TSHASTLQLAQSFGLPPSATPYWSWDTPRSREGYYRYQGGTQCAINRAIAFAPYADLL
                     WMETKSPIYAQAKEFAEGVHKVHPGQWLAYNLSPSFNWEKAGLGKKEMKEYVWELGKL
                     GFVFQFITLAGLHSNAYINDLFANAFSKEGMKAYVELIQSREREIGCDVLTHQKWSGA
                     DYADAMLMTVTGGVSSTAAMGKGVTENQFVDDKTKDALHKL"
     gene            176107..179324
                     /locus_tag="CNH03275"
                     /pseudo
                     /db_xref="GeneID:36393018"
     gene            complement(179674..182256)
                     /locus_tag="CNH03270"
                     /db_xref="GeneID:3259038"
     mRNA            complement(join(179674..180264,180417..180527,
                     180696..180851,180944..182256))
                     /locus_tag="CNH03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657728.1"
                     /db_xref="GeneID:3259038"
     CDS             complement(join(179842..180264,180417..180527,
                     180696..180851,180944..182233))
                     /locus_tag="CNH03270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513398.1"
                     /db_xref="GeneID:3259038"
                     /translation="MSKPKPGLGKGIGKGIARTLSVAHSTPDYALVPTWDPPEIVLAH
                     PARLRHPPASTRLPIFRLSAIPRPYLSQPYSCPYPYSYSYSTLSTSPPPPAQPMPLSP
                     DRVLYSYPSLPPSTSIDVLLSALEINSHTSYTSLFNSSSIALDSSPSSSSPSSSSSAR
                     PNILPVPYSPAGPRDPPSPRSTQQSLKSRSLNSLSSSLDSSSSAPPPPGHSSGGGGGG
                     GVTFGAVIPPLATSDGGGLPSSSFIFHLGASGLAKDRPRTSSSSSSPARPSIPPRPRS
                     FPLLSIPSPPSSALRSISIGEDSYFTRPDGLCIADGVGAWARSGRGKADAGRWSALMT
                     HFCEEEVGNWWSGKDIYLRNPRGKGKGKGKERDKSSSVQSKESSGRGNDKSNVKGKGK
                     SSAMEEEVTEGEKERRPLDPVEIMQRGYEKCLSCAISEGINGSSTCLLALLHNSTLHV
                     ANLGDCCLLLIRGGKVVFRTEEMQHAFNFPLQVGTHSRDEPMKDAMRFDVPVKKGDIV
                     VVGSDGLMDNMFDEDILEVLSQLSPSPSPSPSPPPPQPVSSSPQSPSPTHTHTHTDTH
                     TLTLNPQKASEALCTRARQISETTTTTTPFMCAAIEEGIDFVGGKKDDISVLVGVVGV
                     RSLKEVSVKDGLEGVEEQGQAQGKEGGKERLMLYH"
     gene            complement(182369..185506)
                     /locus_tag="CNH03260"
                     /db_xref="GeneID:3259134"
     mRNA            complement(join(182369..182601,182672..182744,
                     182812..182946,183057..183456,183543..183691,
                     183769..184086,184160..184439,184523..184671,
                     184778..184857,184948..185091,185352..185506))
                     /locus_tag="CNH03260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572496.2"
                     /db_xref="GeneID:3259134"
     CDS             complement(join(182474..182601,182672..182744,
                     182812..182946,183057..183456,183543..183691,
                     183769..184086,184160..184439,184523..184671,
                     184778..184857,184948..185091,185352..185433))
                     /locus_tag="CNH03260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572496.2"
                     /db_xref="GeneID:3259134"
                     /translation="MDIDKMFKLPALPSGGNKRKMGDLPNPETLKKYKPSEPQAASEM
                     MPPPPPGGLNGKGKGRAVTVEDDDVEAEYSRDVGEDVYDGEDDEEGRFFGGGLNREQE
                     QILDIFDAAGEGEQGPALDLPALRRQIGKFQRIVLKNAEQRGKYSDDPSKFIDSESDL
                     DTSLKAFLPLTQNPPLFYPELVKSGIIPIFANLLSHENTDIAMDVVEVIQELTDEDVG
                     GEVDDLDHEEETGSETRMAMGQLIDELLNNSLLDLLVSNLSRLDESEDTDSQGVFHIL
                     GVFENLLSFMPPLADQIVEETALLQWLLQRIKKKEYDSNKQYASEIIAILLQDSRANV
                     LKLGQLDGMDVMLQVLSQYLKTDPGDSEEVEFMENVFDSVCSSLAQPEMKKAFFDAEG
                     VELMVLMMKEKRLAKTRAIKVLDYALQTESGSPACERFVQALGLKTFFSAFMSSASSK
                     AGGKKSKSKLGAAAATSAIEDEEHMLGILASLFTNLASDSPERIRVIAKFVEGGYEKV
                     ERLLEVREAAEGRLGSVIKEIEYEREVMQANEEEITDVEETEWYLRKMDAGLASLQNA
                     DYVLAWVCMEDDGAMTHARLLLSRKNMNFKTIAAVLTEFKNNVGDNDEPNEEDGQREA
                     DDAVNTQKMILEHLIAFLEGL"
     gene            complement(185626..190456)
                     /locus_tag="CNH03255"
                     /db_xref="GeneID:36393017"
     mRNA            complement(join(185626..185890,185987..187393,
                     187476..188721,188779..189536,189629..190456))
                     /locus_tag="CNH03255"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658671.1"
                     /db_xref="GeneID:36393017"
     CDS             complement(join(185736..185890,185987..187393,
                     187476..188721,188779..189536,189629..190352))
                     /locus_tag="CNH03255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514589.1"
                     /db_xref="GeneID:36393017"
                     /translation="MPPPENPPIDPFPPLRPTFSPVESRSASYAAVVRRNTNTNANTN
                     INTNTDPSALTNTDTNTTGASSVERDTEERYSGESLSGRERVHPWRENIHPWRDRIME
                     SSGNGNQRDMDGGMGNASGRVDGNTSINANISATSSSSAHSDALADTNSQTNNPSAPF
                     TLREMLRNVQASSPAPATSSPAWASAPGSSQAPASRSTSRIGINGLPHVRHYDFNHPI
                     RDGNGRNVGMIMRENDDRPSVSGLLSRMIDSSDSTSVSATAQNQSPNQNQNRSQTGAQ
                     TQSHDQSAYPPLPFNRPSAARRGPPIITDGSNRYALGSTPMAQGQEQQRNHFGPIYPL
                     PLRNTNNTNINRDGNSGGNMTAAGEGDDNDVIVSFLPSPPRLFDSDGDSLHSLTDDED
                     DSNRVYEDGGDGRELWDEVEWMREVLDGDHASGSGAGVGAGGAGARNERSFPLRRPGL
                     GSAQADGPTGQGADLQRGGFNRRRDYLDFLDHMVNLPNNSSIPSALHTHSHSHVQDLI
                     NDNLNTDPNRNTTTNTNVGSIAEGQAHGVSRPLEYALNISRSSSRAESRAAGLSPTNL
                     GPIQAGVEPPVLVSSTSASSSRLSRGRRARSAGPDLDVDGRREGAEGGLSEDSPARKR
                     SRTSASSSPSASSSLNGNTGSALSSSSSGASSSAQAQSRPRTGPARHFRPPYLSYSSL
                     PIDTLLPLDLGFPQPPSSAHLTLSSHIHRPSPTLSPASLAANTETETGTESKAGSGRR
                     VARESENIPPRPNIAPSDPRYPIIRPRITFSHPRPTRTDSDATSLMTTLPVPRGVGIF
                     YWEAEVLAKGEEGFISVGWIAGLPTPVIIPEQKDSTNANVNASGSGSGSGSRTLNANT
                     IPNTGGAGGHAGVPMRNMRRLVGWSKGSWGWHGDDGRLFAGQGMGERFSETWGEGDIV
                     GLGLDQTTSTLFFTKNGKLVGSKTFPSLPSCCPPPPPSFSPSPFASHRHPVITKSTDT
                     LLYPAVGLRSQGESVAVNLCGPFKYDIEAHVREVKERMSKEVGRVEVKRVSSVVDLVD
                     DQDIAGTNAEQAEGFEEKCEGGKESEMKESIDTSRIGTPIHRISSATTPTSTTAPGPT
                     SSNSQKLPPSAPLDPLRQTTTAFVLDYLNHHGHTKAEGTMRRAIGERNWIGASTSSSS
                     SSSSVSNTHISNLITSDNIPMAKPNPTLQDFPTISSALLYLSNLIRKPFEERVPWPLW
                     RELALLDEDSAQSREDMKGKGKRKGKGKERARGNDIRNVKYEADKTDGMEREELELEG
                     SLLVYDFLHAAMFSAADHDSIEVDGEEGEREEQGADADARTIAIGRKIQKRLQRPSTS
                     LPTSTSPAVLKPQLQADDWVIYAKEAFGAIVNPQGYSTSERWAHWRERLATRLEVFLR
                     QRRGLPQISRLETAIIQTNAVIHALAQKRPNSGAAFVDVKEALGLNEAKGK"
     STS             187293..188098
                     /standard_name="D1S3694"
                     /db_xref="UniSTS:474272"
     gene            complement(192112..194460)
                     /locus_tag="CNH03250"
                     /db_xref="GeneID:3259257"
     mRNA            complement(join(192112..192649,192743..192992,
                     193087..193926,194031..194153,194245..194460))
                     /locus_tag="CNH03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_572495.2"
                     /db_xref="GeneID:3259257"
     CDS             complement(join(192538..192649,192743..192992,
                     193087..193926,194031..194153,194245..194299))
                     /locus_tag="CNH03250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572495.1"
                     /db_xref="GeneID:3259257"
                     /translation="MFIYNVHTPSKTFALIHKEDEPHQKLFDRIYTKAGLKEEDKSKT
                     GLVYEYKGSRWSLDDDEDLHILLSRYPPSSTPSVTLHLTHPSGGDASGHSYIQSQSQT
                     RGKALGKAPSQARATKSTGMNGTNQTLSQNESNDGDVLPPAYATSPTAKTTAATSTTP
                     AAAATTPKAKTKAKSKSQAEKARAKSVLDSNTRANAQNLSAGTGSDTGFVRHGLEDET
                     LSEGTAFLAPAPKKKLEGEYHLASPVPPYTSDLPANPADRDGASSASAPGQSYPASAY
                     VAGGAADRPKSRARSVYSTVSRKSKYGDPDAEPLGDVKRREWHEFHGNNGVRTVIGKV
                     GDVPNVRMLLKSGHRQIYLSRQFAIKHGFLPKKFGAANGGFAYAGILPLPGPITLTIG
                     SRTSAHKAYVTEENKFDVILGRAWIEKMGVKIDPLDQTILTYMDTGEPIACDVVVLKD
                     EKGDIITIT"
     gene            194701..196130
                     /locus_tag="CNH03240"
                     /db_xref="GeneID:3259199"
     mRNA            join(194701..194897,194965..195513,195607..195674,
                     195766..195838,195929..196130)
                     /locus_tag="CNH03240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572494.1"
                     /db_xref="GeneID:3259199"
     CDS             join(194703..194897,194965..195513,195607..195674,
                     195766..195838,195929..195997)
                     /locus_tag="CNH03240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572494.1"
                     /db_xref="GeneID:3259199"
                     /translation="MPFLRPALRARPLAALPRAAPPAALHTARPRLHPAGSKPPAPGG
                     GERAPLSPEDDPKQGGKGFLGALFYGSKEAKAEGLIDPDPSKQAHSTIIGRGKYVHEK
                     ITHAVVPAHRAQYLASAEKYFTSMVQRNGELGGVKLMGSWESIVGDVGSFTHLLEYEG
                     YKGFDATRRAIAADKEMSSLQSDMLPHLISRQSQLLSEFSFWPSSPPHDSGYPDGGIF
                     EMRSYLLQPGKLLEWEYAWRKGLEARKRFVQPVGAFFSQAGQLHEVHHIWQYPDMETR
                     KRTRDQAWSVGSWADTVRDTVKLAYGMKSTIMVPCSWSPIR"
     gene            complement(196141..199565)
                     /locus_tag="CNH03230"
                     /db_xref="GeneID:3259339"
     mRNA            complement(join(196141..196978,197076..197846,
                     197904..198278,198319..198459,198505..199466,
                     199534..199565))
                     /locus_tag="CNH03230"
                     /product="arsenite-resistant protein ASR2, putative"
                     /transcript_id="XM_572492.2"
                     /db_xref="GeneID:3259339"
     CDS             complement(join(196328..196978,197076..197846,
                     197904..198278,198319..198459,198505..199461))
                     /locus_tag="CNH03230"
                     /codon_start=1
                     /product="arsenite-resistant protein ASR2, putative"
                     /protein_id="XP_572492.1"
                     /db_xref="GeneID:3259339"
                     /translation="MSEPAEQTSPKPGFTRGGFAPIPHRHSDIAPLPSTTSPTLAMAL
                     SPSRVEWERGRGKERELPRRELDPEPEDRERRREWDEYPPRRESRGHWEDDFDRPKRR
                     RSPSPLGPSHRPRLNSPSPPPPRFNIPDPASIETLLPFRTFAEWFRTSHPQTARVDEE
                     ETRKHKEMIESGQATEQEAKEKVGMAKRYERYRKEFTSRQLYALFLTHRDSAWFKEKY
                     LHFPEYVALRRRLNRQGRIPQVAQYISELRSGAHDHVSYDQIEDVPGVKLDEDEPEGL
                     NRALGDKGEWGEDGAVRVEIAPRTKQVFVKTVPPNCSRKALEDLFSRVPGFQWLAISD
                     PSQKRSFHRVAWAQYAEDTDVSKVIEQLDSTKIEGFTFHLTINTTPTIGRVRIAPLSV
                     SNLDRLLLDGTRAKSLALKLEEELLGDDEESVVEGEGEKTKPEGDVKVEDEAAEEKPK
                     VAKSLGLSEKGSDVVEEIIMKMVEERGLTGEDLDEEQKVQKAKITLDQWIAYLRHGLS
                     TCYYCIAPCAFMEELQRKCIAHVRAHPSSSTAEHEHEHEHEREHDTEEHARAEVEDVV
                     KSEVVDGADGGTELKAEVEVEKEEEEKEAEGEEVGKEVNDDDREMREDGQDQSKTLPA
                     AHPSNAAANDRSDRERERKSRKNTFPQKTAEEKWIESHDLRIAPLLIPSAALNLPEEE
                     GGLRLGDYGGRDPEEELKKLCAPLIKQEEQSKYRCKECNKLFRAPEFVIKHITTKHTD
                     VTQGRIDDVLYLNNFVLDPQHIQPSVSTLAAIDDKLPASSSNPLNPSHPSSLPLNPFD
                     PSVAGAAFNHAQMNGMPMSMGMGMNPGGGHGTPSGQGHGQFNLMQQQMMMMLQMQQAM
                     MMGQMGMGIGTGMGGGTGGGVNASPMAAGSGAGVGAGGVGGGGGAMSTPSRGGGQLAG
                     RMGGYAPSPANLAPLPPPPPGGEDPRARRGRVSYQDLDEPGAGGGGGLPY"
     gene            complement(200117..202288)
                     /locus_tag="CNH03220"
                     /db_xref="GeneID:3259043"
     mRNA            complement(join(200117..200972,201033..201068,
                     201126..201161,201238..201339,201422..201428,
                     201482..201529,201609..201729,201861..202288))
                     /locus_tag="CNH03220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572491.2"
                     /db_xref="GeneID:3259043"
     CDS             complement(join(200389..200972,201033..201068,
                     201126..201161,201238..201339,201422..201428,
                     201482..201529,201609..201729,201861..202138))
                     /locus_tag="CNH03220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572491.1"
                     /db_xref="GeneID:3259043"
                     /translation="MSSLHHLVPLLFLIAPALSQYTATYSPYSLPETTEQGQYGTNAC
                     GTSSSQDSKCQNVYVNGVDDFCLWGPPETTSNEGDGTSKIGNVEQIVVSYCLKDGYGT
                     RLIPPGSITGAHFVKVLSEKVSYVQVTGVGDLTKLLIPAGDDGGELDPHSWTGLGNPQ
                     GGLVFTNAFTGSYEQTHEWTSFMSADEFCIRACRDGDNAAAYCQHIYDVLSCSFTIPG
                     DMSPGFDSCLGEPTEEAPGVYSGSTFRQGDPTTPAPHPAGATSECQVYSSVGGGNANI
                     GQGAVVSAATTTRSSSSAEETNSPSSISAIDSTTSYTSYTSPSNTTVFASATSTLSNL
                     STVATTTTIITSASSSSVPSFSSTSSSSSNAATTTALNNAQSNGYPKAIEGMGIASVC
                     IAGMFAFSFFI"
     gene            203633..209557
                     /locus_tag="CNH03200"
                     /db_xref="GeneID:3259270"
     mRNA            join(203633..203868,204048..204103,204192..204263,
                     204395..205908,205968..206134,206186..206325,
                     206385..206489,206542..206617,206681..206761,
                     206813..206908,206971..207213,207271..207481,
                     207534..207605,207658..207762,207823..207918,
                     207973..208179,208229..208319,208371..208387,
                     208451..208543,208595..208675,208720..209025,
                     209085..209557)
                     /locus_tag="CNH03200"
                     /product="expressed protein"
                     /transcript_id="XM_024657727.1"
                     /db_xref="GeneID:3259270"
     CDS             join(204439..205908,205968..206134,206186..206325,
                     206385..206489,206542..206617,206681..206761,
                     206813..206908,206971..207213,207271..207481,
                     207534..207605,207658..207762,207823..207918,
                     207973..208179,208229..208319,208371..208387,
                     208451..208543,208595..208675,208720..209025,
                     209085..209369)
                     /locus_tag="CNH03200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513397.1"
                     /db_xref="GeneID:3259270"
                     /translation="MDPDLEDIGFSFAKPDCAPKNSFESIRSMKPFLPSNSNAASNNY
                     TRLPGRNTGSDSSSSAATIAARPHGMFPSFRFQNAHPLSQSILPENSHSPSSVSTGAV
                     TAASADGVVASKSPSATAPETPNVKGKASTPQLPFGGPGRRLLPTESAPFQTPTSSRT
                     PFASKGFSPAQTNLAPEHQSYSSLSLPFSTPNPAKQGNQIMSGANTHKVTMATENPHR
                     HSRGWAEPPMKDRAKDEELFHREAREEDKEVTMEVEDGQTYEQDNEDGTLEVEKRETY
                     ESTIRQDEMEEDRRNAYNMGRREERTEVATGQQSHPSHENNGQDIKATSRHDLYQDES
                     HEALYPESLPSQIADSGLPSFRRDAHNSSELLGHGPSLPPAQRHCHTKHSSYKTPDRP
                     PPSSTFCSLSNPKPVPRSMSFLEGVSNHDISGCATAMFKPSVPPLTKQQQKKDNDVDQ
                     GRSTLPKTTADLRVELEKGGGSEQMLLMMLQTKNGEIDNLKDEMFRLQELIGAKQSLN
                     DDLAQETKRLEDIYKQSEQIWKTSIGNAKKWRDTIKQKEMSKNQALKELKDGYDEQSH
                     TYSEALASLSKEFIAFREESMTKTKEDLEVHSSTLANIRTALQSVKEDLTANSNAVEE
                     LQNTKSLNAHLEDEMKAKNEELSFARNQASELQDKLKTFEETLAPNLERMMGDMIQVK
                     ASASTNSQALEAALLAQKELYEELSEKEKENVALRQESQEIRFVRDNLDSQLREAANY
                     YHALGCEAKNLKDMVQELERKHKEALQKGVAKTETVEREWKHKLELADTHVSNLEKSL
                     SSIKADAHLFAQRAVQTETDLKADLVARSSEGQARIHSLEKELKVAVTERDKLIRSLD
                     ETRAREQTLKDKITGLTQSTKESQLQLQGAQASLQDARKQGHILEDQVKSLIKQLESR
                     SQKSESAMKFDDHFKRLQIKLEELQSTQGNILELERAKAEVIHKQSRIQDLQKSLNES
                     HSTIEDINNDIRRLRLTIDQITEENGRLKIEIVGRGQSGKELVERWERDELNAEEVVL
                     VQKITQQIRRGEQAICRQELDEKSNAVRKLESRCKKLEAQISALSHGRMTSNLTTPSA
                     LSRITHEAASLLSSPLSNPPTSSTAASHITVHSSSDSPNRPSAKSASSPLAAIAVSHK
                     PSVESAVNLAPTANSNSTAANSKKRRLLDSQDVDDSEESFGHEVMIDEIFANVDEALL
                     NHPSLTQGPAKLQKKTRFAEIIEHSSPSPDSQPEDADDPIDPPTSQPQPNLHQLAPPP
                     PSQVTKTYARNKGAMRARPSLENVTTNSGNASGATGYEKGNRKLRGGRKSY"
     gene            complement(209587..211648)
                     /locus_tag="CNH03190"
                     /db_xref="GeneID:3259254"
     mRNA            complement(join(209587..209794,209865..210154,
                     210228..210286,210347..211009,211098..211423,
                     211508..211648))
                     /locus_tag="CNH03190"
                     /product="ARF GTPase activator, putative"
                     /transcript_id="XM_572488.2"
                     /db_xref="GeneID:3259254"
     CDS             complement(join(209759..209794,209865..210154,
                     210228..210286,210347..211009,211098..211423,
                     211508..211573))
                     /locus_tag="CNH03190"
                     /codon_start=1
                     /product="ARF GTPase activator, putative"
                     /protein_id="XP_572488.2"
                     /db_xref="GeneID:3259254"
                     /translation="MDPTKAQTTATFAHLKAQKANKQCFDCHAKNPTWSSVTFGIYLC
                     LDCSSVHRNLGVHISFVRSTNLDSWSIQQLRTLKVGGNASCAEFFNKNGGGNLLAPQS
                     TDARARYTSRIASLYKEELAKRTQDDAARYPHGIHIDGLELTPLASPAKAAATDDDFF
                     SSWDKPTSKPATPAASAQAATVPSIGLTRAPAPRTVTSSSLRSSTTSAPSSRPASASR
                     LSSSTTTTTGAAPKVSKLGASKLGAKKAAAPIDFEEAQRKALEEEERAKQLSAENKKK
                     EEEAAKAAREREAEEAKKAKAAAAAAASANASVGSSRSGTPANGAAKKSVVNSAPVPG
                     RLGFGQTVGVAAPAQSKTRAAVADDVRTARDKFGNQKGISSDMYFGRGTYDPSAAAEA
                     QTRLRDFQGATAISSNAYFGREEENEEEGGLGGDGGMGGDDAIAGLERGIRDMAERVL
                     ANPEVQQFGDQIRAGALKLSDYLASFEGR"
     gene            complement(212095..214548)
                     /locus_tag="CNH03180"
                     /db_xref="GeneID:3259349"
     mRNA            complement(join(212095..212484,212645..212863,
                     212943..213122,213190..213219,213278..213318,
                     213381..213696,213762..213918,213988..214548))
                     /locus_tag="CNH03180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657726.1"
                     /db_xref="GeneID:3259349"
     CDS             complement(join(212258..212484,212645..212863,
                     212943..213122,213190..213219,213278..213318,
                     213381..213696,213762..213918,213988..214113))
                     /locus_tag="CNH03180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513396.1"
                     /db_xref="GeneID:3259349"
                     /translation="MTAVQAPVSALHDSFNSLTIDSGLPGGPRTVTKRQLTEEEKQAK
                     IYGTSYEPSIEWWTANNKSYIKPADDPLPDGFPEQDNSSSAWDGKILINQPEKWLYRF
                     TADDIALLETAYQHFVSLSLTKNDISRETFPIPTDSTLYKELRKSEYEINNGVGLRVL
                     RGLPVDDWEREKQLIIFAGVSAYVGERRIKQGIQNVVHLRDITTLDVDKRPAITVKGQ
                     TSGNQVFHNDGSVGIVGLITVGVAETGGLSQLSSVANTYNQLARTRRDIIRELAKGDW
                     VTKQFPEGKPLFFAHENRVISSYSRRPFFGFYEADPDVPTLTKEKHLALDAVHFTAEK
                     YSLDLDLQKGDLEYFNNLTVYHARTASTDSDKNARHLIRIWLENKDQPLPAQLRTLYA
                     KINAGQGKTWPLEAWDTNPYLPTESAEEEKKEGEGASYD"
     STS             213321..213993
                     /standard_name="D1S3699"
                     /db_xref="UniSTS:474277"
     gene            216336..217978
                     /locus_tag="CNH03170"
                     /db_xref="GeneID:3259008"
     mRNA            join(216336..216747,216797..216974,217032..217308,
                     217375..217557,217612..217978)
                     /locus_tag="CNH03170"
                     /product="Inositol oxygenase, putative"
                     /transcript_id="XM_572486.2"
                     /db_xref="GeneID:3259008"
     CDS             join(216711..216747,216797..216974,217032..217308,
                     217375..217557,217612..217872)
                     /locus_tag="CNH03170"
                     /codon_start=1
                     /product="Inositol oxygenase, putative"
                     /protein_id="XP_572486.1"
                     /db_xref="GeneID:3259008"
                     /translation="MPVAVQEFVRSDDPAGTKFDTISDAVDDINVAKLKAQHKDNAYE
                     ESKFDSEKEKETFRQFVDSNESSRRFYIEQHTKQTVEFNIEARRKAFEKPRATMGVWE
                     AMELLNTLVDASDPDTSATQIQHLLQTAEAMRKDGKPEWMQVTGLVHDLGKLLYFFGS
                     DGQWDVVGDTFVVGCEIPTEKIVYSDTFGANPDVNHPVYSTKYGMYKPNCGLDNVMIS
                     WGHDEYLYMVCKEQSSLPKAALHMIRYHSFYPWHRERAYTYLENEADKEALKDVLAFN
                     PYDLYSKSDSLPDPVALRPYYEGLIAKFFPEKINW"
     gene            complement(218893..220564)
                     /locus_tag="CNH03160"
                     /db_xref="GeneID:3259321"
     mRNA            complement(join(218893..219109,219162..219685,
                     219732..219835,219874..220246,220301..220564))
                     /locus_tag="CNH03160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572485.2"
                     /db_xref="GeneID:3259321"
     CDS             complement(join(218999..219109,219162..219685,
                     219732..219835,219874..220246,220301..220490))
                     /locus_tag="CNH03160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572485.1"
                     /db_xref="GeneID:3259321"
                     /translation="MRAHLQRLVSRRPTLSRPWTLSRSLTGFPPAVGPSPQAAVRVQS
                     RSRLMDPFSPEELNRFTQICGQVTEQSDYPLSSEIAHNAVVYSGDQLRKFITNGSQSR
                     DDIMAEIHKCLATGPGVLVIRKFVKDTDLIQRTNSVLSKIIEREREGAKGDHFSAAGN
                     NDRIWNSFQKHAIADPRSFVEYYSNVLLDMVSEAWLGPGYQLTAQVNVVRPGGKAQEP
                     HRDYHLGFQSERTASRFPIVSQIASAMLTLQGAVAHTPMPLASGPTQLLPFSQQFDHG
                     YIAYRQPEFVDFFHKHMVQTALDIGDAVFFNPALFHAAGDNKTKDLHRIGNLLQVSAC
                     WSKPMETVDRNAIIRATWSDVKDYIANTQGGIDSPSSQALLKAICDAYSFPTNLDKDP
                     PPADSHCPETQLDRVTRGVAEKWSDDSLNQALDELAAKRAA"
     gene            220732..223827
                     /locus_tag="CNH03150"
                     /db_xref="GeneID:3259115"
     mRNA            join(220732..221039,221099..221263,221325..221410,
                     221472..221716,221773..221787,221842..222128,
                     222176..222319,222373..222492,222543..222635,
                     222690..222718,222769..222980,223049..223827)
                     /locus_tag="CNH03150"
                     /product="L-mandelate dehydrogenase, putative"
                     /transcript_id="XM_572484.2"
                     /db_xref="GeneID:3259115"
     CDS             join(220902..221039,221099..221263,221325..221410,
                     221472..221716,221773..221787,221842..222128,
                     222176..222319,222373..222492,222543..222635,
                     222690..222718,222769..222980,223049..223182)
                     /locus_tag="CNH03150"
                     /codon_start=1
                     /product="L-mandelate dehydrogenase, putative"
                     /protein_id="XP_572484.1"
                     /db_xref="GeneID:3259115"
                     /translation="MQSGLHAFRRTLLRSLRPSHKAYSTHAHAKRSWVLAGTTAVAVS
                     GLTLVFSAGFGNLTLLEDETRNPDQPKRTVLAGGQELISYDEVQKHATRDDCWVIIDG
                     MVYDVTEFLSQHPGGAEVILRNAGKDATRIFKPLHPPDALDILDESQRLGPIDPLSVP
                     ELEEVETEEDKRIKEARKSLPPVDTMLLLQDFEDWGQQVLSGTAWAYYRSAADSENTF
                     HENTDAFRRYWLRPRILRKVAQGDTKTSFLGIDTETPIFISPAAMAKLGHPLGEVNLT
                     RGAGRAGIVQAISANASCGLDEIMEAREEGQKVIYQIYLNKDRKASEVLLQKVEKLKP
                     AAVMFTVDVPWQSKRTMDTRAKNTVNPPIQDTAGSEKKSRAPLGVSEAIGGYQDRDLS
                     WEDIAFIRKYISVPIIVKGVQSVEDIELCVKAGAEGVLISNHGGRSCDYAPAPIDILY
                     ELRCHRPELFNQIDVLIDGGVRTGADVVKALALGAKAVGVGRPFLYANGTHGQEGVER
                     VCEILQEEITNTMRNAGATKVSELVPEMCGLAGPWVGGNRPPYAPKI"
     gene            224007..225722
                     /locus_tag="CNH03140"
                     /db_xref="GeneID:3259148"
     mRNA            join(224007..224120,224177..224494,224557..224809,
                     224872..225045,225096..225486,225553..225722)
                     /locus_tag="CNH03140"
                     /product="expressed protein"
                     /transcript_id="XM_572483.2"
                     /db_xref="GeneID:3259148"
     CDS             join(224301..224494,224557..224809,224872..225045,
                     225096..225486,225553..225677)
                     /locus_tag="CNH03140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572483.1"
                     /db_xref="GeneID:3259148"
                     /translation="MTPVQVTAERLATIPIGNCIQCLGSHPNHTLERKFEALQKGGWK
                     HTEFSFAEYFKWVRQKEPNSVPNVDPETYGDAEAEAGEEEAWEALYRHAPEAKALATK
                     HGVKMWSLQCLGQVDSWPAGSKREIRGREKAVHWLELCSRLGLEFCQIGVNDQYDAVA
                     PFEKTVQDLVWIADQAAARGVKVAYESWNFAPKNNQWEATWAIVQAANHPSLGLCIDT
                     AQCALAPAYGFDPTSGRGFTPVAVQALLERLASVPGDKIFFVEISDVLAPQPALLCGS
                     PFDQWHLDQGPGYRTGFTWCRCARVIPHIGRGTGKLVQGEKGLGAGRTAEIVKAILST
                     GFNGPMFYECFEVAEQEKPDLSIPDELVQASVLSWERMSKAILS"
     gene            226737..228635
                     /locus_tag="CNH03130"
                     /db_xref="GeneID:3258983"
     mRNA            join(226737..227043,227104..227201,227257..227371,
                     227433..227544,227606..228033,228091..228149,
                     228211..228290,228340..228635)
                     /locus_tag="CNH03130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572482.2"
                     /db_xref="GeneID:3258983"
     CDS             join(226957..227043,227104..227201,227257..227371,
                     227433..227544,227606..228033,228091..228149,
                     228211..228290,228340..228461)
                     /locus_tag="CNH03130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572482.1"
                     /db_xref="GeneID:3258983"
                     /translation="MTIEIPSSNRKARIGVMGVGRMGKRHARNIAEFAPRAELVAVSD
                     PYPEALEWAKANLPSTVKTYSSSEELINDPDIEGILIATETAFHAEYAIKVIEAGKHA
                     LIEKPISVDIELTKPVVAAAKKRPDLKVMVAFSRRFDASYQEAAKRIEDGQLGSAYLI
                     KSCTNDLYDPTGYFLNYAKKSGGIFMDCGIHDIDIGRYLLNVGNTDGLKNPAKQVSKV
                     FATGLNTVYPELAEMEDCDNALGIIEFENGSKLNIHLSRTSIHGHDVVCEVFGTKGKF
                     VINAVPNISRVEIRDEHGVRTESHPSYYERFFEAFKTEVQTFSSCILDDTPVPTPPHD
                     ALEAAQIATALTHSFRTGNPVYFDDNGEPILK"
     gene            229742..231779
                     /locus_tag="CNH03120"
                     /db_xref="GeneID:3259056"
     mRNA            join(229742..229819,229872..230275,230334..230431,
                     230493..230607,230661..230772,230832..231259,
                     231326..231384,231444..231523,231577..231779)
                     /locus_tag="CNH03120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572481.2"
                     /db_xref="GeneID:3259056"
     CDS             join(230189..230275,230334..230431,230493..230607,
                     230661..230772,230832..231259,231326..231384,
                     231444..231523,231577..231698)
                     /locus_tag="CNH03120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572481.1"
                     /db_xref="GeneID:3259056"
                     /translation="MAISQGNSNGKLRIGVLGVGRMGRRHASNVAYSAPRAELVAVAD
                     PSQEALAWAKANLPSTVQYYSDSADVIQSPNVDAVLISTETSEHARLALEAAAAGKHV
                     LLEKPISVDVDLSRPVVEAAGKHPELKIMVGFSRRFDASYREAKRRIDEGTVGKPYLI
                     KSCTNDQYDSTGFFIAYSKASGGIFIDCGIHDIDISRWLLDVENPANLKYPKKQVTSV
                     WATGLNAQHPELASYGDCDNAICVVEYENGTKCTFHLSRTAIHGHDCFCEVFGTDSKL
                     IINGNPNMNRVEIRDIHGVRMESTPTYYERFRDAFISEVQTFCDVVLDDKPVPTTPQS
                     ALEAAKIAMALTHSFRAGKPVYFDNEGEAIIN"
     gene            complement(232216..235223)
                     /locus_tag="CNH03110"
                     /db_xref="GeneID:3259351"
     mRNA            complement(join(232216..232340,232393..232503,
                     232560..232599,232642..232730,232789..233200,
                     233253..233429,233479..233628,233681..233690,
                     233749..234734,234810..234955,235044..235223))
                     /locus_tag="CNH03110"
                     /product="expressed protein"
                     /transcript_id="XM_024657725.1"
                     /db_xref="GeneID:3259351"
     CDS             complement(join(232242..232340,232393..232503,
                     232560..232599,232642..232730,232789..233200,
                     233253..233429,233479..233628,233681..233690,
                     233749..234734,234810..234955,235044..235082))
                     /locus_tag="CNH03110"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513395.1"
                     /db_xref="GeneID:3259351"
                     /translation="MPILTCDQCRARKVRCMPPNEAGGPSSDRTRLRQGSKCLNCDRR
                     KEDCTYDYTPKKTGRPRAGTSSRRAPSTSSNVSRSRRSISPSASGLRQNSVQARSFNP
                     RQIPSPRARISPSLASHPDHFRKSPPTASQTAALRVRHSTPNIHHSGPPEDFNFLVDD
                     RSFINPPVVESLYDSFRHLLGTPLPLSFDFTVPSEAEAQSSGQATAQAGSKHPHAFPE
                     TRDVTENDPLKDPDPPISQPPGLPFGSQGLSVSPTSQTVGQSLEGDGVSILGPSPSQV
                     PWSGIGQSPFTNDSHLPNGLQSLDFAGSCSSGIPSVDLQGMLSGDGRTEWLGNSRVIP
                     TIESVASWDEVGFFLSLYLKYQHPLLPLVHRPTFAQDVLHRRDRIDEAFRGLLLSIVA
                     YTICHTNASMLEQRMDRARQETLFRRCQRGSRMIQIRHQMKPSLVILASTILDWITSQ
                     SASAENLPENLISDVRRLVYSLKLNQASPRGMKDLLEVEMCRKLYWVAYDIDKTNAMY
                     LNPVAIQDSDGVPPLPLEVDDDFITRDDMLLVQPGQQHSYMVGFNCVNRLFQILSQCM
                     LRQRLLNSTPSFGFNVWAHGEWVQGAMNELRQILADLPPQLRPEPGSGGDSSTSFNET
                     QAANICITALCVEMALLDLKVRFSPDVDIRQDRQSIAQRVFQQLQSIPIECLARNGES
                     MRGKVAHVVLSLLDASQDTSVTQEDSKMGESLWNWWNMYSRVLCLQVIPDRPASAVPT
                     RPGTPETRRSFL"
     gene            235550..238013
                     /locus_tag="CNH03090"
                     /db_xref="GeneID:3259343"
     mRNA            join(235550..235966,236023..236145,236240..236432,
                     236489..236558,236614..236957,237013..237217,
                     237290..237406,237462..238013)
                     /locus_tag="CNH03090"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_572479.2"
                     /db_xref="GeneID:3259343"
     CDS             join(235656..235966,236023..236145,236240..236432,
                     236489..236558,236614..236957,237013..237217,
                     237290..237406,237462..237838)
                     /locus_tag="CNH03090"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_572479.1"
                     /db_xref="GeneID:3259343"
                     /translation="MVKTHAPDREHIPPLSNFDIDLHPDTVGYVQDSQALADAIGSNG
                     LKDVFASPIVFMAAFSACMGGLLFGFDQGILSIVLTIPQFLKVFPETDISVTSSAGLN
                     KGVMTALLELGAFLGAMQAGFISDKISRKRTIMVGACWFVVGSALQAGSKSFAMLVIG
                     RFIGGIGVGVLSSTAPTYISEIAPPNVRGAFLALEGSSIVIGIVIMFYITYATRHILD
                     SWSFRLPFTVQVVPCIALGIGLWLLPYSPRWLATVGRDQDALDSLVRLRQLPSTDPRL
                     QAEWITIRAEAIQQREVVINAHPHLQGESGFVQDFKLEMHAWIDMFKPNIIARTMIGV
                     MLMVFQQLQGINALIYYSPTLFEQLGLDYEMQLTMSGVINVSQCVATIVAFFLLDRIG
                     RKPPLLIGSVVNAICHFTVAGLIAKYSDNWAAHQSAAWAGVGLLITFMFFFGIGWSPV
                     PWALPAEIHSSSRRAKGVAITTCSNWFFNFIVGLITPPMLQSIRYGTFIFFGAFAVMS
                     GIWAWFLCPETKGLTLEAVDQLFHNHAAQEELRQKHDIISRMIGMELTTTPQPELVDD
                     EKKIYTVQHLESV"
     gene            239034..243607
                     /locus_tag="CNH03080"
                     /db_xref="GeneID:3259317"
     mRNA            join(239034..239542,239593..240710,240762..241289,
                     241355..241693,241742..242299,242355..242575,
                     242643..243141,243201..243607)
                     /locus_tag="CNH03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657724.1"
                     /db_xref="GeneID:3259317"
     CDS             join(239942..240710,240762..241096)
                     /locus_tag="CNH03080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513394.1"
                     /db_xref="GeneID:3259317"
                     /translation="MYLDAGYQMFHLLRALAVCGTRFARVWTLSDHPEGRTFAVETSR
                     PLGNSGPMVAADFFSQVNLDLFPHNLIIPSPSMDSFAVDYRKCELLERTLSRVCDSIL
                     SHTIESALQPRYEGTFDHGTEADPSAFTTQLLRDVEEFACQARPTLKKRRTGKEEVAQ
                     GRTFQRRDRFGDGSNQGRDGDNGKGPRSGGGKQARRGGSGQNSQTKGRVQGGSGQSGP
                     NEDQVGTKDNGGWEDGVGENERSLDPLLKVVEKEDQKQYFAKWQSQLPSSPSSYYPLP
                     SDDDLNKDKEAIFIDYTNTIGRFNLYYQVSFITRAVEMLKMEIIPISTARMDNLYSGR
                     ITSQHVLADPGWDAAISEPFSSRALQTLHCIPA"
     gene            complement(241841..243391)
                     /locus_tag="CNH03070"
                     /db_xref="GeneID:36393016"
     mRNA            complement(join(241841..242691,242756..243391))
                     /locus_tag="CNH03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657723.1"
                     /db_xref="GeneID:36393016"
     CDS             complement(join(242494..242691,242756..242926))
                     /locus_tag="CNH03070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513393.1"
                     /db_xref="GeneID:36393016"
                     /translation="MLGQCDSRLANCSSVSKIKTPSFSSGLGVGQESSQLPQVPISFI
                     LSDLLSLDSWSGMRHANEKSNSLTTFSHLAEQRWQQDAMHRLQKRALRNRLTFIIASS
                     HMPFYSVSCHPLCLYCAVLL"
     gene            244152..246813
                     /locus_tag="CNH03060"
                     /db_xref="GeneID:3259305"
     mRNA            join(244152..244548,244609..244677,244734..244951,
                     245005..245169,245224..245309,245359..245843,
                     245903..245939,245993..246325,246398..246813)
                     /locus_tag="CNH03060"
                     /product="myo-inositol transporter, putative"
                     /transcript_id="XM_024657722.1"
                     /db_xref="GeneID:3259305"
     CDS             join(244414..244548,244609..244677,244734..244951,
                     245005..245169,245224..245309,245359..245843,
                     245903..245939,245993..246325,246398..246642)
                     /locus_tag="CNH03060"
                     /codon_start=1
                     /product="myo-inositol transporter, putative"
                     /protein_id="XP_024513392.1"
                     /db_xref="GeneID:3259305"
                     /translation="MSATHIEDRDNSFLENKAIDHTEEVENVKGSQEPSNLSGFGGHL
                     IDENLVRVEGEDKVTWYLCFLVAASAIAGFLFGYDTGVVGVALPLVGTDLGGSALNSS
                     QQEIITAGTTIGAIFGSAILGGWGDRLGRKMAILISDVFFTLGAVIIACSYSVPQIIV
                     GRIVLGVGVGGASVIAPLFIAETAPTAVRGRCIGINAFFIPFGQVVADAIGAGVQNLH
                     NGWRLLFALGVVPSVLQLLLFHYLPESPRILILRGDTDGARTVFQHIYPTATPEMIDY
                     KFRVAQEYVTATTALQSDTTFWERVKKVWKTGSYRRSITCVSVIQAACQLSGFNTLLY
                     YAGTLFGLLGLSNPALGGLIPASTNAVFVLIGMSLVDKVGRRGLMLFGVPIMLLGLVW
                     NIVAFYYMCKPTGGFLDTSYSYDTTNVSVVIGGIVLFVLGYGLSYSHIAWYQAEYLAL
                     EVRSMGCGVATTANWIANLVVSVSYLSELETMTPSGTYGFYLGLSVIGFVFVVFCFPE
                     AKELSIDETSILFENDWGVKRSIQMRKERRETQKRFHDAELAEAATAHIEARQQKSTS
                     VSPAELSKFMAGLKGGKRKPSVSV"
     gene            247381..248971
                     /locus_tag="CNH03050"
                     /db_xref="GeneID:3259283"
     mRNA            join(247381..247716,247783..247946,248032..248150,
                     248211..248520,248594..248971)
                     /locus_tag="CNH03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657721.1"
                     /db_xref="GeneID:3259283"
     CDS             join(247942..247946,248032..248150,248211..248416)
                     /locus_tag="CNH03050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513391.1"
                     /db_xref="GeneID:3259283"
                     /translation="METVWTRFQPTAYAVEEVIKSGILGKPKRFFADFSMGWDIGVSA
                     DTSQMVNPALGAGSLLDMSAYPSVWAMLLLHRHPLNPDKDPKAFVTHQTVYPRTGVDI
                     NWRWLVE"
     gene            complement(252199..>254199)
                     /locus_tag="CNH03030"
                     /db_xref="GeneID:3259185"
     mRNA            complement(252199..>254199)
                     /locus_tag="CNH03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_572473.1"
                     /db_xref="GeneID:3259185"
     CDS             complement(252334..254199)
                     /locus_tag="CNH03030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572473.1"
                     /db_xref="GeneID:3259185"
                     /translation="MLRTSRLIPLKKDDGSIRPIAVGELIYRLCAKALIISHFQPDFL
                     LPFQLGVKSIGGVEPIVRLTERVLEGSAGAEFSFLASLDASNAFNRVDRAEMAAAVKT
                     HAPTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDPFGPLFFSITLRPTLHALSQSL
                     GPSTQALAYLDDIYLFSNDSQVLSKTTQFLADKQHIIKLNEKKCKLISFDEIRQEGFK
                     MLGTMVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQHALLLLRFCIQQNLRHLQRSLR
                     SDDLVDLWERLDTMLWEEVKRMRMRQREDTVEEETLGRSLTKLPARLGGLGLLSFKDV
                     APLAYRSAAEASDTLLDNLGLLSSPEEPPTPVPQRTRCAELWESQQEAILRNLGDTER
                     KRLTENASRLGRSWLSVIPYLQPLRLSNVEIASGLHDRTLVGSSIPVCRFCGSDSPLG
                     HDELCRARNPWTQRRHNAINRVIYQHLKQIQGATVEIEPHTLSGQRRNDLRVRGSSAL
                     AFTDYDLKVYSLGDRDARSTVTPCAPNGKLADFCLDRCVNWLDKVGQVVSKNAPKVTG
                     GVFKPIILSTGGLMSRSTADEWKEWREAMPVGGFEKMEKRIGVELVKARARTLVL"
     gene            complement(255675..258686)
                     /locus_tag="CNH03020"
                     /db_xref="GeneID:3258995"
     mRNA            complement(join(255675..258112,258203..258318,
                     258371..258456,258513..258686))
                     /locus_tag="CNH03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657720.1"
                     /db_xref="GeneID:3258995"
     CDS             complement(255937..257517)
                     /locus_tag="CNH03020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513390.1"
                     /db_xref="GeneID:3258995"
                     /translation="MAAAVKTHAPTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDP
                     FGPLFFSITLRPTLNALSQSLGPSTQALAYLDDIYLFSNDSQVLSKTTQFLADKQHII
                     KLNEKKCKLISFDEIRQDGFKMLGTMVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQH
                     ALLLLRFCIQQNLRHLQRSLRSDDLVDLWERLDTMLWEEVKRMRMRQREDTAEEEALG
                     RSLTKLPARLGGLGLLSFKDVAPLAYRSAAEASDTLLDNLGLLSSPEEPPTPVPQRTR
                     CAELWESQQEAILHNLGDTERKRLTENASRLGRSWLSVIPYLQPLRLSNVEIASGLHD
                     RTLVGSSIPVCRFCGSDSPLGHDELCRARNPWTQRRHNAINRVIYQHLKQIQGATVEI
                     EPHTLSGQRRNDLRVRGSSALAFTDYDLKVYSLGDRDARSTATPSTPNSKLAEFCLDR
                     CVNWLDKVGQVVSKNAPKVTGGVFKPIILSTGGLMSRSTADEWKEWREAMPVGGFEKM
                     EKRIGVELVKARARTLVL"
     gene            complement(258698..261095)
                     /locus_tag="CNH03015"
                     /db_xref="GeneID:36393015"
     mRNA            complement(join(258698..259485,259556..259704,
                     259767..260111,260180..260290,260350..260698,
                     260758..261095))
                     /locus_tag="CNH03015"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658672.1"
                     /db_xref="GeneID:36393015"
     CDS             complement(join(259156..259485,259556..259704,
                     259767..260111,260180..260290,260350..260698,
                     260758..261027))
                     /locus_tag="CNH03015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514590.1"
                     /db_xref="GeneID:36393015"
                     /translation="MSSISFNISVVRLQLREACKGREKRDDESQKRKNANNWIVDWKG
                     GDLSDASIENRRNRWIKDKCHGTLQQMDFVAGVLEYMTVLERLKNQSGCTPSSFPFYG
                     PLFSPPSLEELQFRGKSISANPSSFLVEPVLVVHPLFYPEMVLDKCPKAGCQSTVKRK
                     GWKPFRSVYGVDHNIKVVSLQYICAEHGVYSPSADTYWEGCMPWEQGLLPHFLAKTAV
                     TRELYDLIAEVRPKSSVNQLVENIHQLHILYSRRLETRFYAAALRERTRMSFFNQSAT
                     PFPMMLQRAEIKKDDGPPAVRTGVSEDNITELSGNTSTGTSGNDNEIAINPSPSFDTV
                     RACYEDFVARQRKHESSQYIRTLSGLIAAVDATMKVANKASVYSRTNNGKMQVVNPFA
                     GGLLTGVNEDKELVFWEFLPNNSPAEMQGPLLEFAERCHLLGQNFSELGEVVVDRCCD
                     FRRRIHEALPEVSVVQDFYHVKERIMRTLPANSDHRHALSTGLPKRSCLHGQIKKAAQ
                     LNIGQLRSS"
     gene            complement(261727..265032)
                     /locus_tag="CNH03013"
                     /db_xref="GeneID:36393014"
     mRNA            complement(join(261727..262084,262265..262278,
                     262340..262406,262483..263181,263233..263295,
                     263345..263364,263416..263550,263604..263706,
                     263758..264091,264153..264207,264256..264400,
                     264457..264821,264878..265032))
                     /locus_tag="CNH03013"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658674.1"
                     /db_xref="GeneID:36393014"
     CDS             complement(join(261851..262084,262265..262278,
                     262340..262406,262483..263181,263233..263295,
                     263345..263364,263416..263550,263604..263706,
                     263758..264091,264153..264207,264256..264400,
                     264457..264821,264878..265019))
                     /locus_tag="CNH03013"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514591.1"
                     /db_xref="GeneID:36393014"
                     /translation="MLLLYIRIFPNSPSSLIRPFSTSCKKTNMTGIGQPRPSLGPNRS
                     STSTVFQVRSLADTSPSNIKSETRTASFPSETDIDVEAQPSTSLNRWTKRDRSPRSKA
                     TDLPDIGNGIRHRRVTLSNSSSRRNSDQYRLLNTSTAVGTGDEPGVDVKSKRDQKNYG
                     HLKGKTRIRVVDYCSNPDQDCMNQSSDFPGEKLQEWLDSGHGKRQLDENDKPIGVRWI
                     HVDGVNWEVVKTLVLHFGLHPLAVEDSLEAPDSPRSKLDFYKDHLYLQLLIHHSQIFE
                     GDELDMLADDMAEGTYGKGQGGIHLGKERRFSQRVRGVFEGDHKKPRLPEGVQGAFEP
                     SMISPRRTIGIHRTPEKQAHKLTVEELSADYMVPIRRSILSIFMLRDGTLISMDAKPT
                     KEVLSPIYTRLEDEQSLLRRSGDVSMLAQAILDTVVDLAIEVSQRFENEILKLEASVL
                     VDPEMETVRHLHVLSSQLIRLRRALTPLLHLCYVIRDQDIQRSVAASAVGRGYGGEGN
                     GNGNGHGREQDGLGHSSSIASGTGGAMGAGAGYNPFSPHSGSSQHSQAMPLAEIPHFA
                     QPQPQPFMPSHNIAPTAPPTSSISRAASRSDTPVPGVALRAKQSDADAASILSMMNLH
                     QSHRNLAALGAPHLGVDVGAASLGFFSPLTKVYIEDVIDHLEIIVGSLEQFVSTCDHL
                     TDYVFNVLSFQTNASMERLSIVTVVFLPLTFIASYFGMNFTGFDQIEGPVSYFWKVAV
                     PCTVAFFIVFSFGYIKRFGVTTTRRFARWRRARALSVNLRKSAGDRERKGS"
     gene            complement(266481..268360)
                     /locus_tag="CNH03010"
                     /db_xref="GeneID:3259366"
     mRNA            complement(join(266481..266798,266937..267153,
                     267268..267390,267487..267802,267855..267947,
                     268014..268360))
                     /locus_tag="CNH03010"
                     /product="branched-chain-amino-acid transaminase,
                     putative"
                     /transcript_id="XM_572471.1"
                     /db_xref="GeneID:3259366"
     CDS             complement(join(266615..266798,266937..267153,
                     267268..267390,267487..267802,267855..267947,
                     268014..268235))
                     /locus_tag="CNH03010"
                     /codon_start=1
                     /product="branched-chain-amino-acid transaminase,
                     putative"
                     /protein_id="XP_572471.1"
                     /db_xref="GeneID:3259366"
                     /translation="MSQALLASNLELTRLPADFTPAPGKESHGRYMLTVPWSRHTGWG
                     TPKIGPRKDLAFDPLAGVLQYAVTCFEGMKCYKSEQGDLRLFRPEMNFDRLKRSGARL
                     GLPHDWDNIELLSLFSSLLSLETPIVPSTDGSSLYIRPTLLETSQSFGIKEDALADEA
                     LLYVVTSLNLGLGLYGSSEREGKGLKLDACKEFIRAWPGGTGSFKLGANYGTVNISKK
                     KGYAMSLWLHGKEDYISEAGAMNMWIIKQASDGYLEFTTMSLDNGIVLPGVTRQSIIE
                     LVEDHASGKKAFPFAEGDVEMPKKIRIVERDISMGEILEGLKDGSLKGMFGCGTGVVV
                     VSIGGITYRNQDYTIPFNPLVKLLRDTMTGIQRGRIDEGRGWSYKIEGSA"
     gene            268700..273258
                     /locus_tag="CNH03000"
                     /db_xref="GeneID:3259236"
     mRNA            join(268700..268797,268853..269338,269481..270226,
                     270282..271460,271526..271741,271815..273258)
                     /locus_tag="CNH03000"
                     /product="cell wall integrity protein scw1, putative"
                     /transcript_id="XM_024657719.1"
                     /db_xref="GeneID:3259236"
     CDS             join(269606..270226,270282..271460,271526..271741,
                     271815..272666)
                     /locus_tag="CNH03000"
                     /codon_start=1
                     /product="cell wall integrity protein scw1, putative"
                     /protein_id="XP_024513389.1"
                     /db_xref="GeneID:3259236"
                     /translation="MAAPPESLQSLPSPTPSSSSQAHSHFGSLHLQTPQTSSTPSTNS
                     HPSPNPLNERDAQANSASTTTAVQPAAYLPSVSSSPPPNPPPYIPPPQHAMPPDPIHS
                     MPSAAGYGQPAMSWANAPPGPNGWRNGGGVAGGSFAGYRGGIPNGRHLPTNPDYPARF
                     GARPGSAHGESRDRRRERRDRDRDDERELEEEVISTIFVVGFPDDMSEREFQNIFTFA
                     PGFEAATLKFPSGSRREPTAALLAELTQLAAHQNAQGGEYSEYPLGNINLEEAISSLS
                     LTTASTSQSTTPSAPMSLTPSVSSNPMLAPGPNPAIPPSSARRQTIGFARFKTRSDAL
                     TAKDHLQGKKIDPLTGSVLKAEMAKKNLHTKKTTSGEEIMGFLLRSGRLGLVPGAGHT
                     TGPVSVSGTSGGNGAMGSVRDAWESWPNSSSGPGSDKDARLNVDEKATANMSSQLNTS
                     TNLTPSSASAPTSTSAPGVSTSTSPPLRQTDSKALLALAEEADELEGWSVNGALGMGM
                     TMGPPYEGYSSVSAPSQGQAPGQGQGQRRLGSQSGPAGAAYGRHGHGHGPEYGTNATG
                     TTLSGEHMDGAHVGGIGLAGGRIMGANPADQNPPINTLYVGNLPAVSPPTHPPGFLEE
                     SLRALFSRCPGFKRMSYRQKINGPMCFVEFEEVIYASQAIKELYGHNLGGLVKGGIRL
                     SYSKNSLGQRGNNHPSQINTNVFGGIAHNVALAGMSMTSPTTQQHPLPNGAVGYGLPG
                     SLGEGSASLGMGDLRRESGPGTATANGISTGTSLSPTAQPFNISLPPTSPRSRYFASP
                     PLSTSNPHKLSPTESASVSASASASASTSVSAGSSLNSNTTNGLSTTGLPTPGGAGVG
                     VPIPSSSSRSSTSARSTASAFQPFGQPSTSISTSVNTNTSSGFSPVSSPIRTPASFSW
                     LSSSAGTGGGVGYGYEFGGSVPLGSLNGAASAWGQSAERRD"
     gene            complement(275176..277781)
                     /locus_tag="CNH02990"
                     /db_xref="GeneID:3259102"
     mRNA            complement(join(275176..275516,275575..275727,
                     275789..276017,276068..276225,276274..276654,
                     276710..277096,277146..277392,277528..277781))
                     /locus_tag="CNH02990"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_572469.2"
                     /db_xref="GeneID:3259102"
     CDS             complement(join(275344..275516,275575..275727,
                     275789..276017,276068..276225,276274..276654,
                     276710..277096,277146..277392,277528..277704))
                     /locus_tag="CNH02990"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_572469.1"
                     /db_xref="GeneID:3259102"
                     /translation="MMSTVDYKPDSIHVEKTSLPPSSSYHENDTKAADASHIEDMGDK
                     SHHTPAVNIIQNPLRRFAPEKVVEDAKLFANGHNLAEYSDLFGRAALVAREGKHFDTI
                     SVLTPEEKTALEYERDHKWHGPRMLWYSIALCAIGAATQGWDQTGSNGANLSFPEEFG
                     IAGEGRDEWIVGAVNSIIFLTAGCIGAFIVDPLNHYLGRRGEIFLTACCLTATPIASA
                     FTHSWQALFAVRFVMGIGIGAKNATVPIFSAEIAPARVRGALVMFWQLWVVAGIFLGF
                     AANVIVKNTGQIAWRLQLASAFIPAFILMLGIWFTPESPRWLMKHGKYDKAFHSFLRL
                     RAHPIIAARDYYYSHVIYQEELSLAKGSNYFSRLWDCFRVPRIRRANYGASTVMLAQQ
                     MCGINIISFYSSTIFTDVGYTDTQALYASLGYGAVQVVFTIPTLFMIDTVGRRRLCLI
                     TFPLMCIFLLAAGLSLLKDSGSRGSQIGPVVLFVYLFTIAYSLGEGPVAFQYSAEVFP
                     TIQREQGMAWVVFINNFFAGVLSITFPRMRTVMTSTGAFGFYAGLNLIAWGMIFFFVR
                     ETKQLTLEEIDQVFSVPTAQFVSYETRVRVPWFFKRYLFFQKHIPTPPPMIGGADDED
                     DYKNEKGATA"
     gene            280674..283252
                     /locus_tag="CNH02980"
                     /db_xref="GeneID:3259295"
     mRNA            join(280674..280757,280807..280836,281122..281227,
                     281272..281353,281413..281518,281569..281950,
                     282003..282242,282289..282411,282466..282917,
                     282987..283252)
                     /locus_tag="CNH02980"
                     /product="chromatin binding protein, putative"
                     /transcript_id="XM_572468.1"
                     /db_xref="GeneID:3259295"
     CDS             join(280733..280757,280807..280836,281122..281227,
                     281272..281353,281413..281518,281569..281950,
                     282003..282242,282289..282411,282466..282917,
                     282987..283207)
                     /locus_tag="CNH02980"
                     /codon_start=1
                     /product="chromatin binding protein, putative"
                     /protein_id="XP_572468.1"
                     /db_xref="GeneID:3259295"
                     /translation="MSTVTFENIFHGDSADLGKLRFNPVGFGWKAYQSEDNNPTTYNG
                     SDIRHATWFRVARHFQLRLGMRNSEKPRISFDGFKRDDLDKIKRTLQEYFNITLETRD
                     TSLKGWNWGEAQVKGSDLVFQVQGKTAFDVPLSQVANSNIAGKYEVALEFNPPSNYKF
                     DPKDLNKRPPDEMVEMRFYIPGKSMKKAGSDAGSGGEETELDEEGNEVSAADAFHSLI
                     KEKADIGAVVGDSIVVFEDCLILTPRGRFSIEVYADSIRLVGKSTDHRVPFTSIHRIF
                     LLPKLDDLHVQLVLGLDPPIRQGATRYPFLVAQWPKDEVVNAELNLTDEELAQYPDLE
                     KTYEATTFQVVSRVLKALTGKKVTPPGSLRNAQGLNGIRANVKAVQGELYFLEKGLIF
                     ISKQPILIDFSKTDSISFSRVGGGVASARTFDMRVVSKTGGADHVFSAINKQEVGPIS
                     SFLQSKNIRLKNEMEEAIVDIDEPFSDDDEEMESPSEDERPSKAKNDKSKTKPVKKAA
                     DDDEDESDDEDFEDESSDGGSPSESDSDDDSGMASDASDPMMEELRKKTQAKRTKAKE
                     TSGSGSEDEKPKKKKAKKDDDE"
     gene            complement(284215..286230)
                     /locus_tag="CNH02970"
                     /db_xref="GeneID:3259083"
     mRNA            complement(join(284215..284729,284860..285172,
                     285264..286230))
                     /locus_tag="CNH02970"
                     /product="expressed protein"
                     /transcript_id="XM_572467.1"
                     /db_xref="GeneID:3259083"
     CDS             complement(join(284366..284729,284860..285172,
                     285264..286059))
                     /locus_tag="CNH02970"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572467.1"
                     /db_xref="GeneID:3259083"
                     /translation="MSSPIHQYLFSPPPSPPSRGPRSKLDPNHGLTSVKSLLLPSEFI
                     PQYSVDGHHRSPPPLKARSSRSPQQERFTLITSVYPSSGHGRHGNGYYAARDLESIPE
                     SSTISILSPSCQGLDQEQLQLAPPINLVSPSTSHFRSFQSAFTVPKPILRLVFLVCII
                     FTTIAILIFVPSARPPSLFLGDIAKRIALVPEAQYVNVNVDVNALEWEGMGEEREYQP
                     PHKKTAWMLKGIRPKKETEVNKEVQAVEKVKEVEKMVQLQAQQHHALPPPKITRPALR
                     PRPIPASHELLALQSYILASQYNVLSESIDPSKPLDANTILGISAAARKFGGEGGLAS
                     MNGKEGKEKAEGEEEWLKDIESEWDDEVVVWFGGNGRKQLPHDVIDIIASSHSTNRHI
                     TYIPLHSRPDREIILSILARLGLPAAADSPIVMIGNEPILGDLETLEEMRLSGELEKK
                     LSKIGWKKVKEERKKKKLKMAVVKKKEKGMIEEMRELAGR"
     gene            complement(286819..288225)
                     /locus_tag="CNH02965"
                     /db_xref="GeneID:36393013"
     mRNA            complement(join(286819..287869,287976..288225))
                     /locus_tag="CNH02965"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658675.1"
                     /db_xref="GeneID:36393013"
     CDS             complement(286980..287801)
                     /locus_tag="CNH02965"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514592.1"
                     /db_xref="GeneID:36393013"
                     /translation="MSLASVYDDTASLWSSSATPSPTQIYVQSRSINDSNSGNFSSMS
                     SQSTTATRKRRKNKKLPLAKIFNSKSLFSNTTSQALFSTAGQSLINERNNLRALEKQR
                     KDLLTSLAGVYGMDYRSIKSSFMSERQATAEANGQGDMRKRWDNKVANRDLIREWADS
                     TEESRNGWGEEVWDGMRIRMKEETEKTSRASLVVRNDVEELESRLKGMRSMMEAGMST
                     GNILGTVTSGNSACRLSTTEGHLEQPTLSPITSTRRFNSNGSVLDGFSSDTLSGL"
     gene            complement(288253..290059)
                     /locus_tag="CNH02960"
                     /db_xref="GeneID:3259308"
     mRNA            complement(join(288253..288576,288654..288719,
                     288784..288840,288904..289159,289231..289426,
                     289478..289689,289749..290059))
                     /locus_tag="CNH02960"
                     /product="L-arabinitol 4-dehydrogenase, putative"
                     /transcript_id="XM_572466.2"
                     /db_xref="GeneID:3259308"
     CDS             complement(join(288427..288576,288654..288719,
                     288784..288840,288904..289159,289231..289426,
                     289478..289689,289749..289990))
                     /locus_tag="CNH02960"
                     /codon_start=1
                     /product="L-arabinitol 4-dehydrogenase, putative"
                     /protein_id="XP_572466.1"
                     /db_xref="GeneID:3259308"
                     /translation="MTIAITSIPASKYRAHYDPTKVLQHPEFQTLAEDAPELSDPDLN
                     IACAYNPSHEIHMIKKPRFEPGPGEVTIHVRATGICGSDVHFWKHGHIGPTMIVTDEC
                     GAGHESAGEIVAIGEGVTQWQVGDRVAIEAGVPCGLASCEPCRTGRYNACPADVFFST
                     PPYHGTLTRYHNHPAAWCHRLADNMSYEEGSLCEPLTVALAGIDRAGVRLGDPIVICG
                     AGPIGLVTLLAAHAAGCTPIVITDLFASRLEFAKKLLPTVKTVLIEKTAKPEEVAKQI
                     KDVAGMQLSIALDCTGVESSIRSAIFSVKFGGKVFVIGVGPSEQSYPFGYCSAREIDL
                     QFQYRYNNQYPKAIRLISGGLVDLKPLVTHRFTLKEAVKAFHVAADPSQGAIKVQIHD
                     "
     gene            290240..292308
                     /locus_tag="CNH02950"
                     /db_xref="GeneID:3259337"
     mRNA            join(290240..290666,290725..290763,290823..291076,
                     291131..291184,291258..291349,291432..291535,
                     291598..292308)
                     /locus_tag="CNH02950"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657718.1"
                     /db_xref="GeneID:3259337"
     CDS             join(290381..290666,290725..290763,290823..291076,
                     291131..291184,291258..291349,291432..291535,
                     291598..291614)
                     /locus_tag="CNH02950"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513388.1"
                     /db_xref="GeneID:3259337"
                     /translation="MPITLDFTGKLVLVTGGGRGIGLAISKALAEAGADVAISYTSKD
                     ATPVAKELSDKYGTKVRAFKCEITKSSEVDALVEEVKKEYGKDVDIGVANAGVSLWKD
                     AHENTDEDFQSIFAVNTFGPYYLSRALVRSWLGLPVPVNSASDPIDVANMKNVDLKKQ
                     ILFVSSISALVAMNPQRQSAYNASKGAVTMLAKSLAGEWSHIGVAINSISPGYVSTDM
                     IANPPDATASTWVKEWEKRTPVGRFATADEIGGFVATLLSDKMGGMGFMAGSDIVVDG
                     GYTIF"
     gene            complement(292485..295266)
                     /locus_tag="CNH02940"
                     /db_xref="GeneID:3259108"
     mRNA            complement(join(292485..292949,293056..294460,
                     294538..295266))
                     /locus_tag="CNH02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_572567.2"
                     /db_xref="GeneID:3259108"
     CDS             complement(join(292618..292949,293056..294460,
                     294538..295173))
                     /locus_tag="CNH02940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572567.1"
                     /db_xref="GeneID:3259108"
                     /translation="MLSSPRHFLNTFHTSSHRSTNASQTSFTSYAASHTTQDTHRANS
                     CSSSNFRSHSYSRSPHAPASTSAADPDFAPSIYHSIHLRHERGEGSTLQGSVTSHTSK
                     GLLFKNPFKKNNDLVSQLERAERVGKDRERQKERVKQREKEKEKEREGEMGESSRRPG
                     LMKQGTAMMKRRFSITRNDVKAVVTPTPKAGGNQMYGGADEDEEVMIIVGNQDEIRDF
                     HLPTQRPVSPIITGDFLKTPSRVRTSLSPSLGESKTSSRPSPSSFSPQLLPEHTPEDP
                     IDLDIFDSFAPFPNYDTNLDADAISAFTADATPKKAVRSTTWQVKARPKSIYVKRLSK
                     RFGKTNNTVASPKLSNGEIHPSLAHPLHAKPLFAESSLQAAPTPAHQASRHIPTKEEL
                     MNRPLPPHTPQGLPSRYRPNGTTIFDIYPDEDLDYHPIPPPGTRQIARIGPNVIPNST
                     THLHPHGAMADANTNTNLNRARNTHVDTRRRTIAPRSSRVFDIPNALYDLWQYGMDEP
                     EIMDLSFDEEELERKRILPMFVHVRSTGKRLVKDTRIQSPGSYTRNQGRKMGKNEVAR
                     SNDRIRNDLTGSPITTGNNTFMVEISPASLDSGSKSSLNSRVSQLSEVSDGSQMSEGM
                     GGSGASGGSRGSRDDSIGLLVHGKVETASKMSLRYATPRAAGRDLKEDMRTDGMASSA
                     SVMTSSVSQASQISGVWDYAALIDDRDHTSPQDEIFTRDQVQTQTQSRTTSAVHTRNE
                     AKAKAQGQRQQGKGEEVHPDGDMAREMAFEDAESVPDMVLDRDSVFEHAL"
     gene            295433..296339
                     /locus_tag="CNH02930"
                     /db_xref="GeneID:3259168"
     mRNA            join(295433..295785,295902..296049,296136..296339)
                     /locus_tag="CNH02930"
                     /product="EF-hand calcium-binding protein,
                     Caltractin-cdc31 subfamily, putative"
                     /transcript_id="XM_572464.2"
                     /db_xref="GeneID:3259168"
     CDS             join(295497..295785,295902..296049,296136..296223)
                     /locus_tag="CNH02930"
                     /codon_start=1
                     /product="EF-hand calcium-binding protein,
                     Caltractin-cdc31 subfamily, putative"
                     /protein_id="XP_572464.1"
                     /db_xref="GeneID:3259168"
                     /translation="MSHYTKPKSRRPATLPLPHSHATTSNSRSLTEDQRGEIKEAFEL
                     FDVDKDGAIDYHELKVAMRALGFDVKKGEVMKLLKEHGGEDGLMDFLAFERIMTEKIL
                     ARNPEHELRRAFELFDDDRTGKISLKNLRRVARELGETLGEEELQAMIDEFDLDQDGE
                     INLEEFLAIMLDGE"
     gene            complement(296953..298097)
                     /locus_tag="CNH02920"
                     /db_xref="GeneID:3259359"
     mRNA            complement(join(296953..297533,297585..297682,
                     297744..297925,298000..298097))
                     /locus_tag="CNH02920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657717.1"
                     /db_xref="GeneID:3259359"
     CDS             complement(join(297063..297533,297585..297682,
                     297744..297816))
                     /locus_tag="CNH02920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513387.1"
                     /db_xref="GeneID:3259359"
                     /translation="MGFGPIHCGSFLLLSAAVLLLVATISAPVIDHISFLDITTGSSK
                     ATFGVFGYCSNIIGSDTCSQRQIGYDIADVTGNLTDYTYVNNSLENVTKAFILHPIAC
                     GIAFLSFLIALCSDRLGFLFAAFIALLAFIVSLVAMIIDFVVFGLVKHEINKNTSADA
                     DFAAAIWLVLAATIILFFSTFVVCFSCCTNRRRVRDREYQAGPMSEKRWWHRA"
     gene            complement(298748..301050)
                     /locus_tag="CNH02910"
                     /db_xref="GeneID:3258989"
     mRNA            complement(join(298748..299049,299121..299562,
                     299638..299751,299816..300166,300219..300290,
                     300349..300412,300470..300555,300610..301050))
                     /locus_tag="CNH02910"
                     /product="malate synthase, putative"
                     /transcript_id="XM_572462.2"
                     /db_xref="GeneID:3258989"
     CDS             complement(join(298825..299049,299121..299562,
                     299638..299751,299816..300166,300219..300290,
                     300349..300412,300470..300555,300610..300872))
                     /locus_tag="CNH02910"
                     /codon_start=1
                     /product="malate synthase, putative"
                     /protein_id="XP_572462.1"
                     /db_xref="GeneID:3258989"
                     /translation="MSLPQGIYLTAPIPKGGEHILSTEALEFLALLHRTFNKRRLELL
                     KNREKVQAELDQGKPLSFLPETREIRENLAWNCAPPGPGLEDRRVEITGPTDRKMVIN
                     ALNSGAKTFMADFEDSNSPTWSNMVLGQVNLYDAIRRQIDFEINGKAYKLSEKPAVLL
                     VRPRGWHLPEPRLIIDGTPMSGSLFDFGLYFFHNARELISRGSGPYFYLPKMEHHLEA
                     RLWNDAFCLATSHLGVQQGVIRATVLIETLPAAFQMEEILYELKEHSAGLNCGRWDYI
                     FSFIKKQRAHKNCVFPDRSDVTMTVPFMDAYVRLLIQTCHKRKVAAMGGMSAQIPIKN
                     DPAANERAMSKVRADKLREVTAGHDGTWVAHPALISIALEIFNQHMPGPNQYHIRRED
                     VTVTDKQIADPSVPGKITEQGLRDNVSAALSYCAAWISGNGCVPINHLMEDAATAEIA
                     RVQLWQWCKYGSKTDSGKDINPSYVQTILSEEASKVSKLPGIDPSHVKIASEYMAQQV
                     KAQWPSDFLTSDLLGYLEGVGTKGGAKASL"
     gene            301568..303607
                     /locus_tag="CNH02900"
                     /db_xref="GeneID:3259218"
     mRNA            join(301568..302023,302084..302231,302314..302349,
                     302415..303131,303208..303607)
                     /locus_tag="CNH02900"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_572461.2"
                     /db_xref="GeneID:3259218"
     CDS             join(301694..302023,302084..302231,302314..302349,
                     302415..303131,303208..303473)
                     /locus_tag="CNH02900"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_572461.1"
                     /db_xref="GeneID:3259218"
                     /translation="MGVLSKFKDQFTQSSPSYDFPPPPPSIPLGPNAVFRYRKQRGVN
                     LGSWFSLEQWICPHVFKGAKPPGQSDYDVASGKDAKRILEEHWDTWITEDDMKWIASR
                     GFNSVRLPIAYYHLCGPLPEVLKGTDFESFRHVFEGAWGRIERAVEMAGAYGLGVLID
                     LHGAAGAQNPDAHAGLSRGKVSFWDTHANQASTSLALRFLASKFASVPHIVGLELLNE
                     PQNNRKLQSWYSKTIDEVRKVAPPDFPIYCSDAWDTDHYAGWVGSRGDFVVLDHHLYR
                     CFTDEDKCQTGTDHANNLRSGFRGRFAQQCEAAKGSLVVGEWSASLDPRSFPQGMPDG
                     EKDAQRRAFVHAQLEIFESHAAGYWFWTYKKGEGWDAGWSATNASQAEILPGWVGSRQ
                     FKGTPPSHIKDQELQNGHKSHADYWAANGGSPNPDMYAPGFSQGWDDALIFLSTQGSP
                     SEMGFVHQWAIRRQAEFESQGHKLGRAAWEWEHGFKQGVEACARCCLA"
     gene            304739..309592
                     /locus_tag="CNH02890"
                     /db_xref="GeneID:3259330"
     mRNA            join(304739..304938,305024..305111,305190..305331,
                     305389..305558,305621..305813,305862..305970,
                     306020..306344,306394..307005,307057..307389,
                     307450..307541,307607..307789,307843..307952,
                     308007..308169,308226..308486,308541..308858,
                     308915..309044,309137..309592)
                     /locus_tag="CNH02890"
                     /product="ubiquitin carboxyl-terminal hydrolase 5,
                     putative"
                     /transcript_id="XM_572460.2"
                     /db_xref="GeneID:3259330"
     CDS             join(304936..304938,305024..305111,305190..305331,
                     305389..305558,305621..305813,305862..305970,
                     306020..306344,306394..307005,307057..307389,
                     307450..307541,307607..307789,307843..307952,
                     308007..308169,308226..308486,308541..308858,
                     308915..309044,309137..309246)
                     /locus_tag="CNH02890"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 5,
                     putative"
                     /protein_id="XP_572460.1"
                     /db_xref="GeneID:3259330"
                     /translation="MQQPANDVQDIILDESPAPMEVDDIPNVHDYEAYAAKCMPDLGL
                     EIEDFQYQTWRIEHWSQQPKRIVGPEFSCGGHKWRILLFPQGNANGQPNDMVSVYLDY
                     ANPKTAPEGWHACAQFCLAISNPWDPTIQTSSHAHHRFVAEECDWGFTRFVDLRKLYT
                     ADPANGKNRPTIENDEVEITAFVRVLKDPTGVLWHNFVNYDSKKETGHVGLKNQGATC
                     YMNSLLQSLFCTNYFRKAVYQIPTEDDIPSESLALALQRVFYHLQTSNQPVGTTELTK
                     SFGWKSLDSFMQHDVQEFSRILQDKLEIKMKGTPAEGAIPKLFKGQMKNYIKCIDVDF
                     ESSVIEDFYDIQLTIKGLKDLRASFKEYVSVETLDGENKYQAEGHGLQAARKGVIFKS
                     FPPVLHLQLRRFEYDVEKDALVKINDRHEFPFEIDLGEFLDESADRAQSHVYKLHGVL
                     VHSGDLHGGHYFALIKPEKDGRWYKFDDDRVTPVTDKEVLEDNYGGDMLNGLVPPHQR
                     TQARTLKKFTNAYMLVYIRETELDTVLAPFTESDTPPHLKARLDHEREQLEAKKREKD
                     EQHLYLTAKVITDEIFSQHQGFDLASFEDKNIPATDLPTFRVLKNESYPTFKSRIASH
                     FKIPERDFRLWVLVNRQNKTTRPDVPIHENDNTQTMENIRNSMAARASDLKLYLDYNP
                     DHARFNELHAEGKEPPIMIFLKWFDCSRQTLLGQGKVFVDKYQKVSDLLGIIQERMGW
                     PSSTPIKLYEEIKAGMIEGMKLKQSFIQNEIQDGDIICYQVELPEKEIADLEAQSLYS
                     SVPQFYDFLQNRILVHFKPRYEDRAASVPEFDLMLSKKMTYDVMAHRVGEFLKHDPLK
                     LRFTSAHNQNGAPKAIVKRSLNQSVADITQTSYYNQHAHICIYYELLDISIIELETKK
                     SLKVVWTGRHNKEEATHSFLLPKTCTFNDVADNMLKLVKLEPNGSGKIRIFDVSPSGR
                     SPREHTGSEMIGNLPESAELYAEEIPVEELQAGEGTKIVNVFHYSRDPSRTHGVPCKF
                     VLHEGEPFSETKARLQERIGVPEKEFAKYKFSLVTSTVFKQPSIVEENDIIYDHKWAP
                     DDALGLDHIDRRPNKANVEKGIVMR"
     gene            309706..311180
                     /locus_tag="CNH02880"
                     /db_xref="GeneID:3259045"
     mRNA            join(309706..310125,310226..310489,310555..310655,
                     310713..311180)
                     /locus_tag="CNH02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657716.1"
                     /db_xref="GeneID:3259045"
     CDS             join(309830..310125,310226..310489,310555..310655,
                     310713..311035)
                     /locus_tag="CNH02880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513386.1"
                     /db_xref="GeneID:3259045"
                     /translation="MPLPYNRPWLMEFADQQWFPPYLRIPVYEMLTYIWTHRIPLLQS
                     KAPYERAAQVLETIIENANSESGRPGSSPGNDDVRVVDFGSGAGGPLGKIERWINRRR
                     NDSSKPPIPFYLTDLYPMPQPTLSNSSPSSSSLVYIPESVDALRAPTSVTSRRHLRTF
                     FLSFHHFNEEQAREVIVDAMRSAEGICIFELQECNFGSAMMILLLAPLTWIFIPFQRP
                     NLRTLIFTYLIPLIPFILVLDGLISVYRTRSPSHILHLANLANLSLALEGEDKVLGDM
                     DWKWEHGAERHTWPFGQLVWVVGRRDWSENNGNVTETETEEDSHSEAEHGT"
     gene            complement(311328..313100)
                     /locus_tag="CNH02870"
                     /db_xref="GeneID:3259095"
     mRNA            complement(join(311328..311412,311470..311673,
                     311734..311805,311865..312398,312476..312616,
                     312679..312739,312793..312808,312864..313100))
                     /locus_tag="CNH02870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572458.2"
                     /db_xref="GeneID:3259095"
     CDS             complement(join(311410..311412,311470..311673,
                     311734..311805,311865..312398,312476..312616,
                     312679..312739,312793..312808,312864..313041))
                     /locus_tag="CNH02870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572458.1"
                     /db_xref="GeneID:3259095"
                     /translation="MILLLFCLYPLLVLSVSAHQSRSYNPLSTSQLKRLIQLDPPQFS
                     SVTDGHLGKLLIPRPSGSENNTLVQNYISSVFSKLGWHEEKTPFTSATPIGDIDFTNL
                     VYTFDPDAPRKLVLAAHFDSKWYPDYPANQFIGATDSAAPCAILLSIAEFLTPFLNSR
                     QSRISSGQPFLRDGFDEEEEAETTIQIIFFDGEEAFHDWTDMDSIYGARYLAEEWSET
                     YLPPAHPLTRRRMHPHPTMLDTIDHLVLFDLLGNKHSSIRSFFRETDWLFDRMANGDE
                     RLREEGLVEVEKGEDGWFRTERGRKGMVGDDHVPFLNRGVSVLHVISVPFPSVWHTIA
                     DDTAALSLPAIRRWNRILRVFVCEYLSLFPEDMDMSLDRSIDMDMGSAANEATASTIS
                     TPKARSQDEL"
     gene            313255..314354
                     /locus_tag="CNH02860"
                     /db_xref="GeneID:3259333"
     mRNA            join(313255..313647,313702..313784,313837..313875,
                     313934..314354)
                     /locus_tag="CNH02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_572457.2"
                     /db_xref="GeneID:3259333"
     CDS             join(313440..313647,313702..313784,313837..313875,
                     313934..313972)
                     /locus_tag="CNH02860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572457.1"
                     /db_xref="GeneID:3259333"
                     /translation="MSLIRTALRLSRPSISSTRFLHSSRRVFASEIPPNPFEDPIFKA
                     FADRVKQHQGAVDAMKGLMNVMQQKGFDKNKKPTMMQMIEMASDKDLKAAASVLMSEL
                     QKAGVDQTEAMEIFKKASSR"
     gene            complement(314292..318749)
                     /locus_tag="CNH02850"
                     /db_xref="GeneID:3259149"
     mRNA            complement(join(314292..315808,315889..316618,
                     316676..316888,316969..318749))
                     /locus_tag="CNH02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657715.1"
                     /db_xref="GeneID:3259149"
     CDS             complement(join(314497..315808,315889..316618,
                     316676..316888,316969..318655))
                     /locus_tag="CNH02850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513385.1"
                     /db_xref="GeneID:3259149"
                     /translation="MTDAPPSRSRHPLPRPLVLAALSALLPLAHATPVPPLRHRARLR
                     LRASLHVEPLSHLFSSLGESFARRNNVSGPVLGIASYSTSAQSYTLPADYVILTPYFN
                     GGFIVLAYIIAFIGSLCTLELLIRRTTNSGWRNQALLAAAGFCFGAVSTFAMHFVFNN
                     ALGLKHPLHPEYPVSYLSYNAGFTILSLVVSCLAMTIAFFIMGTKLGDWKCGSRAKRR
                     HKKIKDRGSKSQRERDEYREWKSSHKKGIQAGSKGHRSLLTRAGSHSTWSALDPETET
                     SERSLRAKLFGTRRKSGWKDDTRLDGPENLDKDLQEMEFRLGKAAVEEELERKAREAL
                     DGRMGRRASLPIAQSLNDFSSPPAEFHPDRVRSSLPESASVFTPNFSFPAQSPSLFPR
                     TNTTDISQSTASNPESYSNENPHPFSARHEWRRASLPTNILFTQPPKRPSYSGPSGSG
                     LSRIQSLPEGDIDPPPSPTTILRSNASQNSDTSDEAKVSLSPEAQLHGLQQEKSASSE
                     DVREGKRDRWAKVNEKKNLWGKLGAFLGFDIVTAAEVIKVFVTGITAGFGVVGMHYIG
                     QASIIGIPYVAYKPAYVVGSVIIACGAVVIALYIMFIMLRPKLKHTWWSKILVALILA
                     VAVCAMHFCGTLGTIYGWPAARSTTKHSKLSGTNAAITGIVSALAFAACIACTVFFLL
                     HSLHLRREQARRRRVVVASVMFDEKDRILVHSTDGMLPMCDIANLTGGVHGNSSGRGS
                     FIQSLSSESTVLGMDLSTGHEAFVSALKLSWMWRNPIMSQQNSVHLLDSKSQSQPHSH
                     AAHAQADSMFAPTLLDIRRGSMVTNHTSTTLTGSRSMPLSISKFLEKFSTSSGHLAMR
                     LTGQMNGITRLGVLYDQILTTGWVKLQNSSDTVSKGQLIFLVRRINSAAEQFDLVSRH
                     YMFADPSAVASALQRTLSVPFDHIMPLLDDIRLFCDSTLHCTLHPGKLYAGVAVVQAT
                     PFDGLRILLEKDKRGQLPMREMCTFGTSPAESGALYGTVEEIGEAVSMLQGFNMLSII
                     SRNISPSTETDTLLSGRVSALLSALELAIVPMLDEMLTAEDMEHILPRLTLHPLLIPL
                     TPGGRPQSLSAKRSPYTPPYLIVFYANYDVAVNTFTDKWLPFSLFRAQSACVMSQKVQ
                     VGTRMERIWGENEPDGSATPNAARRPSKVQFEFPTNGAQLASGSTFDTSIFNGYSFPA
                     SDDNQTSVPHYSSSSSSSSAHINPLANVTRKSSLVRGRFSSSGDELPDLNADSGIASA
                     HGVNGTTGLGIGQAGVGVGKDVLIKPVWPGVGTWDQDWLLHLLRASLRAET"
     gene            complement(318835..321379)
                     /locus_tag="CNH02840"
                     /db_xref="GeneID:3259227"
     mRNA            complement(join(318835..319089,319148..319366,
                     319466..319636,319702..319848,319956..320045,
                     320102..320203,320259..320426,320502..320551,
                     320606..320727,320801..321379))
                     /locus_tag="CNH02840"
                     /product="expressed protein"
                     /transcript_id="XM_572455.2"
                     /db_xref="GeneID:3259227"
     CDS             complement(join(318901..319089,319148..319366,
                     319466..319636,319702..319848,319956..320045,
                     320102..320203,320259..320426,320502..320551,
                     320606..320727,320801..321258))
                     /locus_tag="CNH02840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572455.1"
                     /db_xref="GeneID:3259227"
                     /translation="MSFHPQNEPASPVSEQTRHTDANPVPESLSPSSTLTLSSAATPA
                     PVPVSAAAATPFSHAHPAFPALPQLGKLPTTPQEIHQILSLPANQFTAKALPLLAKVA
                     DGKPFEGASLKAWERRNAGEQLLALYEAGDEVYETADERVKEIGGGLIYVLSARITLG
                     QGNAVVWSDKMLNFAIRLCELADPAQLRICHQRVAAFAWGLLRLSQQLSKVKLVIPAI
                     TSLIQKLNYHQTFSPIFGALLEACLVTRQFDHPSLGLVLDIIFLDVKTTAPTYLDILT
                     YYHHAGAVTMAVGDFCKAKEYYLTAVTVPTTTASAIQLACAKRALLCELIVTGKKIVW
                     PKYTPTPVTRIIEKYATSYNELAKEFEAHNWANVRRAHTVAEFEKDCNSGLIEQVVNS
                     IHRHMILRLRKTYMRLTVDSLARRLRVGDDMPKAERVVAILDDMIKSGEVSAILTPSA
                     TQPQSHSQAIIEFITATESFTSPAALGRLERASAVAALLQEHLAEGSRRLGASKEYLV
                     KQAQYLESNSKKNKGDEFDQLMEAEETMEPGAGSGKMMGSSGGGGSKSGSLRGVASNM
                     ADIGF"
     gene            321514..323658
                     /locus_tag="CNH02830"
                     /db_xref="GeneID:3259127"
     mRNA            join(321514..321770,321848..321875,321939..322025,
                     322126..322187,322255..322451,322522..322587,
                     322658..322762,322842..322981,323045..323158,
                     323233..323347,323431..323658)
                     /locus_tag="CNH02830"
                     /product="2-nitropropane dioxygenase, putative"
                     /transcript_id="XM_572454.1"
                     /db_xref="GeneID:3259127"
     CDS             join(321572..321770,321848..321875,321939..322025,
                     322126..322187,322255..322451,322522..322587,
                     322658..322762,322842..322981,323045..323158,
                     323233..323347,323431..323547)
                     /locus_tag="CNH02830"
                     /codon_start=1
                     /product="2-nitropropane dioxygenase, putative"
                     /protein_id="XP_572454.1"
                     /db_xref="GeneID:3259127"
                     /translation="MPIITVRYFGLNHPSLACRPPLSQHTYIYPASNARITSAFLHNL
                     VSNTLTSTQIIMSVISTPITKLFGIKHPILLAGMNVAAGPELAAAVSNAGGLGVIGGL
                     GYTPKHLRGVIKDLKASLKSPDLPFGVDLLIPSLGPSARKTNYDYTKGQLNDLIDVII
                     EEKAKLFVCAVGVPPKEAVEKLHAAGIYVMNMVGHPKHVTKALAQGVDIICAQGGEGG
                     GHTGRTTFSILIPACVDICKGKKSPLTGQPVHVIAAGGIYDGRGLAASLMYGAQAVWV
                     GTRFVASTEAAAPKKHKELILSADHGDADTTLIYTGRPLRVRQTDYVKSWTNRQDEIL
                     QLTKQGKIPHDLELQKHPEKSLESRPWLMGDVSALIHDVKPAKEIIDEMVSTAKQCLE
                     HGYTSVSGGRGPSKAKL"
     STS             323803..323954
                     /standard_name="Indel2"
                     /db_xref="UniSTS:470896"
     gene            324134..325344
                     /locus_tag="CNH02825"
                     /db_xref="GeneID:36393012"
     mRNA            join(324134..324284,324350..324668,324738..324773,
                     324885..324994,325045..325344)
                     /locus_tag="CNH02825"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658676.1"
                     /db_xref="GeneID:36393012"
     CDS             join(324210..324284,324350..324668,324738..324773,
                     324885..324994,325045..325122)
                     /locus_tag="CNH02825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514593.1"
                     /db_xref="GeneID:36393012"
                     /translation="MPPKKGSSTTTKSSGKTKKAAGLSQPTLGFQSQRKHSGTISKSK
                     PSLQRQTSTISEINVEPEGRSDSDIELLAGSDMKDKTTRMGGNKSTESSALPEQRTED
                     EEPKQLKVKSKEWAQVLKAAKEAMGNLEPIHAHADTHNDIHHILRVFDMTAKYGPCVG
                     ISRLDRWKRAQKLGLEPPDEIRTILTTQQGREDPSYRENVLNAWL"
     gene            325526..329645
                     /locus_tag="CNH02820"
                     /db_xref="GeneID:3258994"
     mRNA            join(325526..326526,326577..327409,327450..327492,
                     327540..327709,327760..327987,328039..328194,
                     328251..328275,328336..328539,328588..329290,
                     329359..329645)
                     /locus_tag="CNH02820"
                     /product="nucleus protein, putative"
                     /transcript_id="XM_024657714.1"
                     /db_xref="GeneID:3258994"
     CDS             join(325599..326526,326577..327409,327450..327492,
                     327540..327709,327760..327987,328039..328194,
                     328251..328275,328336..328539,328588..329290,
                     329359..329437)
                     /locus_tag="CNH02820"
                     /codon_start=1
                     /product="nucleus protein, putative"
                     /protein_id="XP_024513384.1"
                     /db_xref="GeneID:3258994"
                     /translation="MDPSLLHSSEEVKSTTNTSPGGSNDPSPNTTGQSHTTDSTSPST
                     VPQSQPTSQISNQPPQSSSQFQNQPGQDTSSLDDNESAKRPRLRLAHACDRCRRRKIR
                     CDTQHPCTPCQQSNNVCTFETPSRRTVKSKGNSERVSSTGGIKRPHSPGRVFASLATG
                     KGESQSNLEARLAALESMLRDVPPNVHNAFLSTLDARLGSGTGVGLKEGGGGGEGVGV
                     AVEALAGTSLGNLNLPGNLGYNMGGSGLNAQRRLGQNAFSPDWAANGGLSGWLNDAVL
                     GKKKEEAGMDELAKRLGGMSFFYEDEIGQAKWQGATSGFPLLHLLAAHNAPKEEDEAD
                     SADGDVSGEMIASPATDSIPSTSPNTSTILPRRISSSSTPAGRASSVHAKARSSSIGL
                     GAIGRRASSADRRKKERFFPDRTPRPHQTLNPEASWKVITGVIPPDLMDTLVRCYLST
                     SHLLWPFLHVPSFLTDYANPAQWGEPGFTCFIVAVCTLSSRHVDDPRVRANPADPSTA
                     GKQYFELFKRLRDLPSADRPTLYSIQAAFLAAIYAFGLGNLSKAFSLQAESITLCLDG
                     GLHRSVDGYDHFDAIEKETRKRTFWSIYAWDKQSAALFGRPPIIHLRDCDVTEPLIVD
                     DEDLNPGGIKDESINSKSRMCAFVATIRLHVILEGVIDSATQPSAFPTSPFLARAAAT
                     IARRTAQSETLRDEEELLEEWKRILPKYWCYDTETANSRDPIRITQAERLHCLEHLVK
                     MIIYRHRFSGFVAMPASTAEERARHLDLCRKAMQCALTIIADHVHISQRGMMTYYGVH
                     VIHQLAQAGRTLVAVILNCRNADFRPIIAPSVEGLRSCVGLLRRFSGRYLCGLRSADI
                     IDEFCRVCNIPVDSPRVPNSAGRPSPAWLRPVRKRVATPPPIADSPGSSGMMNFDPNT
                     LTANSGVHASGVNDNMSISAGGLGDIGGSASDLDALFNTAAYFNVPGGEVSAGMAGTS
                     TGSAPNVGNQNANIGPSNSFLPTLGGLGEASAPYDRFETLSPNVELGNGSTIFSNYQD
                     SHAGFSLSGDTDHPMGSGPGTSVGAGAGHISFDYGLNGHGFGGESLAMKGMDNVSDGL
                     KQGTGGSNLSAATILSLMEEGSFDYGSIFTDQAP"
     gene            330899..331847
                     /locus_tag="CNH02815"
                     /db_xref="GeneID:36393011"
     mRNA            join(330899..331353,331417..331525,331588..331847)
                     /locus_tag="CNH02815"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658677.1"
                     /db_xref="GeneID:36393011"
     CDS             join(331194..331353,331417..331525,331588..331657)
                     /locus_tag="CNH02815"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514594.1"
                     /db_xref="GeneID:36393011"
                     /translation="MTALSSSLHRDNQQSLPRRASSKSDRRLASGAPNVSTSSSTASQ
                     STLGDYNLEGEELPYSETLEKKKRKYSEKLYQWTQEMWNNTKQDMDRRSSVSSSEDSA
                     DIYKAHNESK"
     gene            complement(331993..334686)
                     /locus_tag="CNH02810"
                     /db_xref="GeneID:3259271"
     mRNA            complement(join(331993..332693,332746..332780,
                     332829..332985,333045..333448,333504..333552,
                     333617..333706,333759..333891,333939..334149,
                     334213..334355,334416..334686))
                     /locus_tag="CNH02810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572566.1"
                     /db_xref="GeneID:3259271"
     CDS             complement(join(332118..332693,332746..332780,
                     332829..332985,333045..333448,333504..333552,
                     333617..333706,333759..333891,333939..334149,
                     334213..334355,334416..334534))
                     /locus_tag="CNH02810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572566.1"
                     /db_xref="GeneID:3259271"
                     /translation="MNRNCSSSTPTSSHSPQQSEHKRRWWDDLTFTKCKKMFLRHLHF
                     VGPGLVSSVAYIDPGNWATDLEAGADYGYKLLFVVLLASLAAVVLQLLSVRLGTTTGL
                     SLPAQTRLLFLRLKSRYPRYRIPLTIALWTLYALAEIAIIATDLAELLGSAIALHLLF
                     PKLPLFAGVLITAVDVLVVLVFFRSSSGRQGMMFFEIIIVSLVLAVFISFMILLKLTS
                     PVWRDVFLGLVPSETLVKPGALYLGVGIIGATVMPHALFLGSFLSGVDRLNMIPQPPS
                     MRKPRNVTMPSFNPFRRTRSIRSDSEQGEGVSTGISPVLLQAPRPSSGSEAAVLENDG
                     AKDEVHLQDSVVELTKEEKLFAIEQKEYERNVRMFDRIKWVDVHLFHSTIDTAISLLS
                     FALTINASILTLAGAVYYYNESPPSEGADLFGAFDLIKSYISHAAAIVFALALLCAGQ
                     SASITATLAGQVVSEGFINWKTSPFLRRLITRLLGVIPSAVVASAVGTKGLNTMLVAS
                     QVLLSIVLPTVVFPLVYLCSKHEIMTVQGPEVESIEMERIANSGASVSDPFALAATTP
                     SLSPTTLGDDLAALGIESTTVRVEPDQSVDRPSRRSKSYVSPKWVTVLGYVLFVVIVL
                     ANVYVIVELCLGNG"
     gene            complement(334983..339966)
                     /locus_tag="CNH02800"
                     /db_xref="GeneID:3259353"
     mRNA            complement(join(334983..335134,335188..335717,
                     335789..335988,336044..336152,336220..336337,
                     336395..336556,336635..337653,337709..337866,
                     337916..338040,338094..338855,338908..339026,
                     339073..339966))
                     /locus_tag="CNH02800"
                     /product="protein tyrosine/threonine phosphatase,
                     putative"
                     /transcript_id="XM_024657713.1"
                     /db_xref="GeneID:3259353"
     CDS             complement(join(335685..335717,335789..335988,
                     336044..336152,336220..336337,336395..336556,
                     336635..337653,337709..337866,337916..338040,
                     338094..338855,338908..339026,339073..339612))
                     /locus_tag="CNH02800"
                     /codon_start=1
                     /product="protein tyrosine/threonine phosphatase,
                     putative"
                     /protein_id="XP_024513383.1"
                     /db_xref="GeneID:3259353"
                     /translation="MSSAILPYPSQPSYPLSRPSTPRPTTTLSAPPTPITPTHLLPVA
                     MERARSTEGVVNGVEQALNQARGIKDNKEPKPGRLKFEWEHIERPKTPESDHGIDDDE
                     EQKMDVDEEQPIQPPYLGLGEPVSTYDEERAQRENAMRQMDIHHEEPPPPIIWGMPKW
                     GREAERQEVAKGVRLLGMEELPQLVKTHSLIDTPSSVMFPWLHGISDDGHKGQEMAQF
                     FGYSPPFGPPPYRGLCLLFCPPHPLDKHHLRPPPQRNDTDLTTVPTSAPYKVPDRKDS
                     ESESTSSESYNSSGATELTSPSLGNSLPSPSLSSFKPLPETDTQSMDSSKDDSNGAEV
                     AMHPCYSKRLSPTTVAKGLDEDNHPLPCSSILNAAAEPETQKPSLSSSVSSSSSDVDE
                     AVGQNQNPSCILFNALHVHDIFDLSKIGDDTEKRASFRAAKLPDQINLRNLNIQQIKY
                     ATVSDIVLYSKTGLTQGLLHIAEQIAQAQEDLYNQRLQEIYHVNHTGGDGEGSSEPIR
                     YGVWVVLESFNEIEKHYPELVNIDSKGRDKHPHLQTDLFEREAKESREMTKASEVVEG
                     FWVGNDCDVPGATLEGAGSFIRFDLCLKASECSEMPSTSALSSAYRKLLDIDRRRREA
                     GEESQSTSAFNWTASPATHALRNLLSPSSSSVTTEVPSKRTASPTPSDRQLRAKPSLT
                     TDHEYVALDCAGSSRTITGHTRNMVTMTDRVIELVYFLRKLVEGRDNGRKRKILVHCQ
                     DGYTESSIIVLAYIMSSLSISLPEAFLHLQVNANRSFFLYPADKPLLRKVDARLAADR
                     KAKAIKLLSATSAGSASSHTDSDGKQSNPSPRWRPWGMNFGAKREQAPNRTSAIGGKE
                     RSKSTADVAREMLAEHENGGSAAAQEARLWFDDKRFDGFPSRILPFLYLGNLEHAGNA
                     AMLHSLGITHVVSVGESLMNMDNSVIAYYGHKSENTLAAAVRAGKLSVLDLTDVRDDG
                     NDPLRPVIARACEWIEEARARGGKILVHCRVGVSRSASIVIAYMMQYEHMRLMDAYMV
                     CRARRLNVLIQPNLRFFHELFGWEVELAKREAEAAKARREEAEKQGVRDPEALKLIEG
                     EARKIIYSWPSFCRDLYCLNRRFLCN"
     gene            341720..343375
                     /locus_tag="CNH02790"
                     /db_xref="GeneID:3259106"
     mRNA            join(341720..341814,342000..342053,342115..342276,
                     342362..342452,342528..342734,342799..342877,
                     342951..343052,343106..343375)
                     /locus_tag="CNH02790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657712.1"
                     /db_xref="GeneID:3259106"
     CDS             join(342050..342053,342115..342276,342362..342452,
                     342528..342734,342799..342877,342951..343052,
                     343106..343189)
                     /locus_tag="CNH02790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513382.1"
                     /db_xref="GeneID:3259106"
                     /translation="MSCCSQIPPVQAEYTPKGSYTTFNDLKTYAVGPEDVKVAVLVVY
                     DVFAFSPQILQGADIIASQGYRVVMPDFLVGNYATPEMFKPGNEEMKAEYFSKFPGAC
                     GSQSEPVAKAINGLKAAGHNKVAVIGYCWGYKTAVLSEAGLAEADAFISVHPTFPAAE
                     DADKINVPLAMLSSSGENISIINAIQKGVESKNPGKNFFKHYPEQVHGFAAARADLSG
                     GAATEAYAEAYQLIIKFLRDQVSA"
     gene            complement(343350..344601)
                     /locus_tag="CNH02780"
                     /db_xref="GeneID:3259063"
     mRNA            complement(join(343350..343565,343626..343782,
                     343840..343923,343993..344080,344348..344601))
                     /locus_tag="CNH02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657711.1"
                     /db_xref="GeneID:3259063"
     CDS             complement(join(343689..343782,343840..343923,
                     343993..344080,344348..344474))
                     /locus_tag="CNH02780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513424.1"
                     /db_xref="GeneID:3259063"
                     /translation="MSNSTSSTPTKNTATPSPTITPLHDPSHQAKVIPAKPLGVSNPN
                     IVPGMTTNGAAAGLGQKALLAKKFAKANKPTISPTDQLQSPCTAKLSNAKQRHFAKGK
                     PASLSQSFVAIRESSGAAPSPVNRKTDF"
     gene            complement(344957..347746)
                     /locus_tag="CNH02770"
                     /db_xref="GeneID:3259276"
     mRNA            complement(join(344957..347177,347260..347638,
                     347694..347746))
                     /locus_tag="CNH02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_572450.1"
                     /db_xref="GeneID:3259276"
     CDS             complement(join(345577..347177,347260..347638,
                     347694..347717))
                     /locus_tag="CNH02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572450.1"
                     /db_xref="GeneID:3259276"
                     /translation="MHEPPHGTASRQAALHKALSTAYLNHQIAELENRVNAAHIKSPA
                     PQAKAKAKGGDSARSPDASARQLQPQPQPPQQPPGDPNDDLGRPDDVEIDVDDEAEDW
                     RVVVVDISALMWAKNAVKRLVAKGWEVIIPAEAISTLDLLKKGSNATAVAARQAARYI
                     EHALRFHDVLSSDPSLAIQSGTNYKRGSGMRLQRAKETASVNSIVDELAIPPMDGEED
                     LPKWVEAVFSCVAYFKKIMDAEEKEWDAEDNGYERERGPILYVGNPPVFVELEQGRAE
                     PTPSARDGDAKDGLDYMARAEGHVILQEAARFDLTLQVLRDDDVEVEASGLGGKKQRE
                     RRRGRKRGGDGGKRRDREAAKKEPEPEREVKILLRRPSPTREASPDSYPSHLPSPTSP
                     IIPGPEIKSRDHPRAPPLLVRPPPLPSGRPPPPVPPPQSKGLHHHHRPPPPPPLAPES
                     GVDMGLRMGMHTRPHPNPEMRPSLPLHPSMAHHLENGIPRDGGGGGHHHYPHPHLGHH
                     RPPPPPALFDELSDGSRGAHGHGRRGGHGGHGGHGGHGFGRGRGGHHGHGGGGGGGGG
                     GGGGGGGGGGKGHGRRLKNRDNEFVLLQRPHSFVRPPPPGRPGQSQTPGSELFPSINT
                     APAGAAGANAGAGASSGNGKGNGKSSMPRIDDDPPVVLLQRPK"
     gene            347876..348607
                     /locus_tag="CNH02760"
                     /db_xref="GeneID:3259077"
     mRNA            join(347876..347981,348029..348607)
                     /locus_tag="CNH02760"
                     /product="50s ribosomal protein l19, putative"
                     /transcript_id="XM_572449.2"
                     /db_xref="GeneID:3259077"
     CDS             join(347912..347981,348029..348546)
                     /locus_tag="CNH02760"
                     /codon_start=1
                     /product="50s ribosomal protein l19, putative"
                     /protein_id="XP_572449.1"
                     /db_xref="GeneID:3259077"
                     /translation="MPSPLRPLARALRHFSSAPARASSYPFNPSAIARPSTTPLPPPP
                     ALLHPKNGWSLITHLNNAAAQSPWAHLFARRSKDRLPAGSVLTVITYSDPARKSISPF
                     SGVLMGTKRRGVDTCFRLRNIVNKAGVEMTFKLNSPMIKEIKVVKRAEKAKGQLKDLK
                     RAKVNYLRERPAVMAAIARALKTAKQNEAAAGESS"
     gene            complement(348583..351911)
                     /locus_tag="CNH02750"
                     /db_xref="GeneID:3259342"
     mRNA            complement(join(348583..348981,349048..349185,
                     349244..349529,349592..349821,349896..350624,
                     350685..350881,350946..351423,351498..351911))
                     /locus_tag="CNH02750"
                     /product="protein phosphatase PP2A0 B subunit gamma
                     isoform, putative"
                     /transcript_id="XM_572448.2"
                     /db_xref="GeneID:3259342"
     CDS             complement(join(348946..348981,349048..349185,
                     349244..349529,349592..349821,349896..350624,
                     350685..350881,350946..351423,351498..351521))
                     /locus_tag="CNH02750"
                     /codon_start=1
                     /product="protein phosphatase PP2A0 B subunit gamma
                     isoform, putative"
                     /protein_id="XP_572448.1"
                     /db_xref="GeneID:3259342"
                     /translation="MKGLKKAMNLSRTKSSEKSKSPNPPAHKQSTASSGPSSPSVNSP
                     SRQASDAPGLQGGAPITPRRSPINDKTSPAPPLVVISGAPQPPPINTEMPSDPIPHSP
                     HGRYGSPERTLGADGQPTPPKVGPMNRLRGPKDTIPAVGKTPRKQRSSRFYVTEKVEI
                     EKLPNFADVRPEQRNELFVQKLQQCRVVFDFNDASSDLEGKQIKSQTLHEMLEYITSQ
                     RGVITESIYPEVVSMFATNLFRSIPPQVNPTGDAFDPEEDEPVLELAWPHLQIVYEFF
                     LRFVESPDFNTNIGKRYIDQSFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLNLRAF
                     IRRSISHVFFQFVYETERHNGIAELLEILGSIINGFALPLKEEHKTFLTRALIPLHKA
                     KSLALYHPQLAYCVVQFLEKDPALTEEVVLGLLRYWPKVNSPKEVMFLNEVEEILDVI
                     EHNEFIKIMQPLFVQLARCINSAHFQVAERALYYWNNEYIVNLMGEHISIILPIVFPA
                     LYQNSKTHWNRTIHGMVYNALKLFMEINQEVFEECQNNYRAQRKAESDRAIERYDEWL
                     QLREQAIQNWESAHPSSPLPERLQEPPPPRPEPYEDEPMMDVSVDMTANGFDPSESFT
                     LDRSIAEETVPVADPGVDRAPPLSPTSPTQLLGQQGQAPSSPTPSGGGTAPHLRRKSV
                     LPIDAGVMRDLQNHRSLENDANP"
     gene            352112..353070
                     /locus_tag="CNH02740"
                     /db_xref="GeneID:3259028"
     mRNA            join(352112..352157,352250..352375,352506..353070)
                     /locus_tag="CNH02740"
                     /product="ubiquinol-cytochrome c reductase complex 7.3 kda
                     protein, putative"
                     /transcript_id="XM_572447.2"
                     /db_xref="GeneID:3259028"
     CDS             join(352140..352157,352250..352375,352506..352562)
                     /locus_tag="CNH02740"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase complex 7.3 kda
                     protein, putative"
                     /protein_id="XP_572447.1"
                     /db_xref="GeneID:3259028"
                     /translation="MPGFQDVIYNTFFRRNSVFVATTFIAAFSFSMGFDLATTAFWDS
                     HNRGKQWKDIRHKYIEAAGDDE"
     gene            353090..354310
                     /locus_tag="CNH02735"
                     /db_xref="GeneID:36393010"
     mRNA            join(353090..353387,353459..353573,353640..353836,
                     353889..354310)
                     /locus_tag="CNH02735"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658678.1"
                     /db_xref="GeneID:36393010"
     CDS             join(353173..353387,353459..353573,353640..353836,
                     353889..354165)
                     /locus_tag="CNH02735"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514595.1"
                     /db_xref="GeneID:36393010"
                     /translation="MKDKPCTLTLEDGTRYDLTQLASAKADYVTNVGDITYVFNVCRR
                     VVSEVYRIEEPENVGAFMRDGYADFSLGEVNTTLTLSPMTDDPMIIMTDGSICPGNPG
                     QTASTAIRFVCSQSDFNADKPIFITSLPPQDPCQFYFEWNTHLACRPGRKSPTRPTFP
                     KGELDTHHYYFAFAVFLVIVLLTWFGGLTLYNRLYLKRRGLSQFPLPTFDYQSISIPS
                     RNSNEQPGPNWDPSRRRSNRSGGYGHVRAEGHDGEERFAARYSLEEERD"
     gene            354587..356586
                     /locus_tag="CNH02730"
                     /db_xref="GeneID:3259190"
     mRNA            join(354587..354785,354865..354941,355020..355087,
                     355143..355263,355322..355454,355509..355921,
                     355989..356158,356226..356586)
                     /locus_tag="CNH02730"
                     /product="NADH-ubiquinone oxidoreductase, putative"
                     /transcript_id="XM_572446.1"
                     /db_xref="GeneID:3259190"
     CDS             join(354652..354785,354865..354941,355020..355087,
                     355143..355263,355322..355454,355509..355921,
                     355989..356158,356226..356468)
                     /locus_tag="CNH02730"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase, putative"
                     /protein_id="XP_572446.1"
                     /db_xref="GeneID:3259190"
                     /translation="MLRNLRPLLRTVPAPSRSVIRPLSTTSKAFATAQSSPVRAHSVE
                     ELHALTAEEILKEGGVRKEAEMRHFTVNFGPQHPAAHGVLRLILELNGEEILRADPHI
                     GLLHRGTEKLIEYKNYTQALPYFDRLDYVSMMTNELSYSIAVERLLNIEVPERAKWIR
                     TLFGEITRVLNHLMAVLTHAMDVGALTPFLWGFEEREKLMEFYERVSGARMHAAYVRP
                     GGVAFDLPHGLLDDIFKWATQFSSRVDEVEEVVTGNRIWKQRTIGIGPVTAQQALDYS
                     FSGVMLRGSGIPWDIRKVAPYDAYDKVEFDVPVGKNGDCYDRYLCRVQEFRESLRIIG
                     QCLNKIPDGAYKVDDHKIVPPPRASMKESMESLIHHFKIFSEGYSVPPGETYAAIEAP
                     KGEMGVYLVSDGTNRPYKCKIRAPGFAHLAGADFMMRHHFLPDAVAIIGTMDLVFGEV
                     DR"
     gene            357300..359018
                     /locus_tag="CNH02720"
                     /db_xref="GeneID:3258996"
     mRNA            join(357300..357454,357521..357619,357676..357767,
                     357824..358080,358142..358430,358483..359018)
                     /locus_tag="CNH02720"
                     /product="expressed protein"
                     /transcript_id="XM_572445.2"
                     /db_xref="GeneID:3258996"
     CDS             join(357365..357454,357521..357619,357676..357767,
                     357824..358080,358142..358430,358483..358924)
                     /locus_tag="CNH02720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572445.1"
                     /db_xref="GeneID:3258996"
                     /translation="MSTSRPRIDSLRSSSTIDHSVWGARAPSPSFSTTTTGSKVNLPE
                     NHALITRKDLRQSITCFEELMAAAKAYRNALLAMSSATAAFATAMEACSRVKGCRSSN
                     SALAGAGGLQYLISNHEQLLADTVYRQFEIPLLDALDNYKMITADRLAAYDKALHEQS
                     QKIRKTEAENLKIGRRRKRDLQQFRQALGELQKQVDELDSIKAGYHEEVLEGEEEVWE
                     TVLGRVTFVIRSQLDFYEKIAGKASDPILEPMVMSIPDPFDAYGPPKEEGQIFSVLAP
                     LSLLDSSAPQSPTPNLPRVLSPPPMSATTSGRPSSPSDVDGTPTRLSPAPREPGPNSE
                     SVFGQHDTWLEDASGSSGTSGVSDMGNGTARSRRELSIIDEGDITVNGKDNDQGESNG
                     DGDGGGGAGVKAVKNSLGGKINGLPTKNNE"
     gene            complement(359085..362189)
                     /locus_tag="CNH02710"
                     /db_xref="GeneID:3259267"
     mRNA            complement(join(359085..359281,359367..359671,
                     359761..359902,360041..360295,360377..360673,
                     360747..361177,361243..361580,361640..361731,
                     361786..361831,361892..362189))
                     /locus_tag="CNH02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_572444.1"
                     /db_xref="GeneID:3259267"
     CDS             complement(join(359129..359281,359367..359671,
                     359761..359902,360041..360295,360377..360673,
                     360747..361177,361243..361580,361640..361731,
                     361786..361831,361892..362154))
                     /locus_tag="CNH02710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572444.1"
                     /db_xref="GeneID:3259267"
                     /translation="MIPRRHHFKPAPQPTVQVLQPPDEDAPSLTITMLGAGQEVGRSC
                     CVIEHRGKKIVCDAGLHPAQPGIGALPFIDELDWSTVDAMLITHFHVDHAAALPYIME
                     KTNFKDGNGKVYMTHATKAIYGLTMMDTVRLNDQNPDTSGRLYDEADVQSSWQSTIAV
                     DYHQDIVIAGGLRFTPYHAGHVLGASMFLIEIAGLKILYTGDYSREEDRHLVMAEIPP
                     VKPDVMICESTFGVHTLPDRKEKEEQFTTLVANIVRRGGRCLMPIPSFGNGQELALLL
                     DEYWNDHPELQNIPVYFASSLFQRGMRVYKTYVHTMNANIRSRFARRDNPFDFRFVKW
                     LKDPQKLRENKGPCVIMSSPQFMSFGLSRDLLEEWAPDSKNGVIVTGYSIEGTMARTL
                     LSEPDHIESLKGGNVPRRLTVKEISFGAHVDYAQNSKFIQEIGAQHVVLVHGEASQMG
                     RLRAALRDTYAAKGQEINIHTPKNCEPLTLTFRQERMVKAIGSLAATRPEHGTSVKGL
                     LVSKDFSYTLLSPADLHDFTGLSTSTIIQKQGVAISVDWAVVRWYLEGMYGEVEEGVE
                     EEGKAAFIIMNGVQVVQISPTAVELRWKSSSSNDMIADSALALLLGIDGSPATAKLTA
                     SPNKHACNHSNSHSHTDLYPHTYPGDKSAKDVASNPEFERLRMFLEAHFGHVEGPNLR
                     PPLPPGADGDGNDDKDKDGDDWLTMDVKLDNQTARIDLISMRVESESAELQKRVETVL
                     EMALTTVKSLSQTFLGGGLDVDMVKVEPNESDS"
     gene            362341..365577
                     /locus_tag="CNH02700"
                     /db_xref="GeneID:3258982"
     mRNA            join(362341..362446,362513..362603,362659..362746,
                     362798..362978,363083..363227,363331..363389,
                     363451..363543,363604..363692,363761..364556,
                     364615..365577)
                     /locus_tag="CNH02700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572443.2"
                     /db_xref="GeneID:3258982"
     CDS             join(362350..362446,362513..362603,362659..362746,
                     362798..362978,363083..363227,363331..363389,
                     363451..363543,363604..363692,363761..364556,
                     364615..365366)
                     /locus_tag="CNH02700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572443.1"
                     /db_xref="GeneID:3258982"
                     /translation="MSTTIQQGDTDTGAGNHLPAWLLAMSGIFTAVATAISMMSIVLQ
                     LKNYRKPTLQRAVVRIMVMVPLYAISSLIALFSLEAAFFIDAIRDLYEAFVIYTFLQL
                     LITYLGGERSLLIILHGRPPIPHPFPVNIFLQPMDVSDPWVLLNLKRGVLQYVQVKPL
                     LVLATVALKATGTYQEGRFAADSGYTYVSIAYNTSICLSLYCLAMFWVAVNKDLKPFR
                     PVPKFLCVKGILFFSFWQSIGISLLVAMGAIRKVGPYTDPEHMSLALVDSLICFEMPI
                     FAIAHQYAFQASDYIDHNLVYAARLPFIYAFRDAFGFKDVWQDTIDTFKGRGVSYQAY
                     EPAEGGLHYGVGRQKRIRAGLRYAKGGKMKYWMPKPGDEARMKGQSGLITSMKRRVDE
                     RLAEREGYAPLLPQQAARVVHLDPGRYTTYTGGERMFDSDSSDDSDAPSLTFHSADEM
                     EDAMYDRARRIGYAGFPNVDVSKEEARRKRREEEEGILKGRWTRSGLRVRDGTGLGGG
                     EGQGEGRMRAGSAAKGKSNGKNKDKGKGKGQSRKVYGTWADHPPSVQRFNSSSSSTRN
                     GNGNGHPADFDEADDEGVVRQEEEGRAIKKKRQRQSPPVWVTRTGATTGVGSSSSPFS
                     IGDDDDDDDEDGEGVKNRETQGDRSMSFNHPDNSSHNSDSDSEHSVKPSTTKKLPADA
                     VDLVKEDYEAVEAARERERRRGEPQTNAPAHVYRKTIIDEIPETDTNAGAMKRRRGIG
                     GRIEEIQEVYAHDPHVMTKDEIQTGVKEVVDHVETSLTVEPPKHAMSLDLEDNPWS"
     gene            complement(365478..368097)
                     /locus_tag="CNH02690"
                     /db_xref="GeneID:3259047"
     mRNA            complement(join(365478..366037,366113..366522,
                     366592..367049,367104..367655,367711..367926,
                     367988..368097))
                     /locus_tag="CNH02690"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_024657710.1"
                     /db_xref="GeneID:3259047"
     CDS             complement(join(365573..366037,366113..366522,
                     366592..367049,367104..367655,367711..367926,
                     367988..368064))
                     /locus_tag="CNH02690"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_024513381.1"
                     /db_xref="GeneID:3259047"
                     /translation="MDAPVPAAPAFGGSWAKLNPPLSPWILDVINSMGFKNMTPVQAG
                     TIPRAVKNQDCVVEAVTGSGKTLAFTIPVLERLSRREEPYKKGEIAAIVVAPTRELAT
                     QIHAVFHHFLSSLIPPESEEETGDVEAHAPPFASSSRSPSPQTPDKPLFPLPMLVTSG
                     TPTPYETFQSTHPSILIGTPGRLAAFLLNPRGLAIVRVSELDVLVLDEADRLLSSPDH
                     RRDVERIMRHLPKQRRTHLFSATMTDAVEEMIGLGLRNPVRIVVNLKDKRKDGEEPKE
                     RRTPMALQNTYLVCRHAEKTLQLIRLLLCESTKHERSKFIVYFSTCAAVDYFYRILSR
                     LPSLSKFHLTSFHGELPPKIRETALSTFTSHPSSHLSPAVLLCTDVAARGVDFLDIDV
                     VIQYDAPTDPKTFSHRAGRTARAGRRGKAVVLLGKGREEDYVDFLNIRKIPLTKQPYI
                     NAYLEEVDTPQALDPEATTLLHSIRQIILTDRELSDKAAKSFVSAFRAYSKHEASFIF
                     RTLDFDFNSQAISFGLLRLPAMPEIKDWKKKKEAERQRLEKIKSEGGEVEEKEIIEWE
                     DAGVNWDTFAYASRQREAARLATLAQRADNQSSNDAARAEARAKRKIKAEMREAWSEQ
                     KERKVRKEERKEKKDAKKKYEWELEQANGEGDRQSDLANIAKAQAERKKRREREEESW
                     DEEIGKEYKSLKREIKEEKSVKESSKGGAGGGGIGGGMFDDLE"
     gene            368278..370299
                     /locus_tag="CNH02680"
                     /db_xref="GeneID:3259327"
     mRNA            join(368278..368542,368600..368984,369057..369186,
                     369283..370299)
                     /locus_tag="CNH02680"
                     /product="h-sco1, putative"
                     /transcript_id="XM_572441.2"
                     /db_xref="GeneID:3259327"
     CDS             join(368342..368542,368600..368984,369057..369186,
                     369283..369427)
                     /locus_tag="CNH02680"
                     /codon_start=1
                     /product="h-sco1, putative"
                     /protein_id="XP_572441.1"
                     /db_xref="GeneID:3259327"
                     /translation="MNTLRATLSRPSTSFRTAVLPRFSALPPAPRLAAQAVFARRFAS
                     ETPPSQSGLDQQQQKARDQSTVGPFTWKAASLFLLTGVGLYMYFESEKAKVQDRRRQE
                     NASKSVGRPSIGGPFTLTTHKGETFTEQDLRGKWSLIYFGFTHCPDICPEELDKMGEA
                     VEMVDKATGKADVTPIFITVDPARDTLPQVNKYIQEFHPRMIGLLGDYEAVKKTCKMY
                     RVYFSTPPNATAADDYLVDHSIFFYLMDPLGQFVDAFGKATSAEQVAEKVLDSMRKWE
                     AAGGNAAAGL"
     gene            complement(369506..371384)
                     /locus_tag="CNH02670"
                     /db_xref="GeneID:3259300"
     mRNA            complement(join(369506..370380,370436..370646,
                     370709..370923,370977..371384))
                     /locus_tag="CNH02670"
                     /product="expressed protein"
                     /transcript_id="XM_024657709.1"
                     /db_xref="GeneID:3259300"
     CDS             complement(join(369571..370380,370436..370646,
                     370709..370923,370977..371303))
                     /locus_tag="CNH02670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513380.1"
                     /db_xref="GeneID:3259300"
                     /translation="MSTSKSPSLDLCLATLHELLHPAPILSLLLSALNLSAHFQLFAR
                     QLSSDAGLIAAFHEKHYHIVHESSIDEEEEISKGYLLDSSEGEKVKHIRYRKEEIFDA
                     SIRLRKHHIATSLAMVKRNPRQVKVLIDLYFPDIDPEDHSYRKNEHLFLSCMKRSQAR
                     KMVEERKTVIKWYKDAIEVFDAHEPPLPYRTFFYGETSSFAHGKVLSQALLEECQEVV
                     QEARDFEALLAGDGSWQGEKWASSKRKGRDVRRYTMTATVTDSKSTNRSPPAVKPPRQ
                     PRISLPANLDVNLNSPPSTDNDKRTISPPSDSESVRARTLPRLSFSSSSIRKTSSAQL
                     RDGHQADAERTPSRAPVHTNAQKAVSLIGKTGATSPPPSRTTYPEKSSESSRRQPCHP
                     EVTDKRVTLPASAPLSPSSPRTKAKEPVKLNKETESEWAAKERRVEEARLRRSLGGAK
                     LGDGNGEGMGIDVTPAIPTQKPATPASPQAKTTLAKKKRPRQSFPLSGPEFSRGTGSG
                     TGSANKRPKVIE"
     gene            complement(371391..373198)
                     /locus_tag="CNH02660"
                     /db_xref="GeneID:3259368"
     mRNA            complement(join(371391..372319,372374..372691,
                     372765..373198))
                     /locus_tag="CNH02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657708.1"
                     /db_xref="GeneID:3259368"
     CDS             complement(join(371813..372319,372374..372691,
                     372765..373127))
                     /locus_tag="CNH02660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513379.1"
                     /db_xref="GeneID:3259368"
                     /translation="MPRPGQQAARRKRARVSTTPAPSTNQEEPGSPNPRARCLPVADL
                     PADFDGVPEDGAQYLAMVMRNNEELPWSTRMEGWTPAVENETEVRPDSGQPAGTRHMA
                     LPQGSWEVLFPLHFQNYRKNLAESWPPSPPLPYPQEYPPLPEANRRSEWYMFINGYSM
                     EQYSKPLQRGTKGKERAFELTEEEAMNEGASDNQNAQGANGESSAELKGKRGKHREPL
                     VSVVQGLNSNEAVRILSHFAHWLTESITQLPPPFPTSPELLPTQPDGPMNPPSPASSS
                     TARPPNPFPPHYAQWILALLMIVDSHLSGGQISTLRDLARAAMRVAGWRWIRGVVARD
                     VSEGWKLGGQGWRLVTASTENEGDEEENVDEMLARCWVVVHAVVAGWAQRDLLDDLEN
                     LFK"
     STS             373120..373306
                     /standard_name="Indel1"
                     /db_xref="UniSTS:470897"
     gene            373317..374905
                     /locus_tag="CNH02650"
                     /db_xref="GeneID:3259105"
     mRNA            join(373317..373465,373518..373595,373654..374429,
                     374482..374640,374700..374905)
                     /locus_tag="CNH02650"
                     /product="chorismate synthase, putative"
                     /transcript_id="XM_572438.1"
                     /db_xref="GeneID:3259105"
     CDS             join(373376..373465,373518..373595,373654..374429,
                     374482..374640,374700..374862)
                     /locus_tag="CNH02650"
                     /codon_start=1
                     /product="chorismate synthase, putative"
                     /protein_id="XP_572438.1"
                     /db_xref="GeneID:3259105"
                     /translation="MSSFGTLYRVHTYGESHCKSVGCIVDGVPPGLQLTEADIQTQLS
                     RRRPGQSDITTARSEFDTVHVQSGTEHGVTLGTPIGLLVHNKDQRPHDYAETDLYPRP
                     SHADYTYLAKYGVKASSGGGRASARETIGRVAAGAIAEKYLKEAFGVEIVAFVASVGK
                     TALPFADEEDEVLGKAYMDLVQTVTREEVDKEITRCPHKETSKKMEETIRAAKAKDDS
                     LGGSITCVIRRCPLGLGEPCFDKLEAVLAHAMLSIPSTKSFEIGSGLRGSTFPGSLHN
                     DPFVEGVDEKTGGRRLRTVTNWSGGVQGGISNGEDIYFRIGFKPPATIAQEQSTARYD
                     GSEGVLAAKGRHDPCVVPRAVPIVETMAALVIMDMVLQQNARLTAASLLPDLTHLPPT
                     MVLPGKSTVQKIREGQSVGEVQSQKVGEE"
     gene            375211..380031
                     /locus_tag="CNH02640"
                     /db_xref="GeneID:3259085"
     mRNA            join(375211..375768,375836..375977,376046..376787,
                     376845..376996,377048..377147,377203..377464,
                     377521..378082,378150..378212,378270..378452,
                     378523..378695,378749..378822,378896..380031)
                     /locus_tag="CNH02640"
                     /product="specific transcriptional repressor, putative"
                     /transcript_id="XM_024657707.1"
                     /db_xref="GeneID:3259085"
     CDS             join(375380..375768,375836..375977,376046..376787,
                     376845..376996,377048..377147,377203..377464,
                     377521..378082,378150..378212,378270..378452,
                     378523..378695,378749..378822,378896..379866)
                     /locus_tag="CNH02640"
                     /codon_start=1
                     /product="specific transcriptional repressor, putative"
                     /protein_id="XP_024513425.1"
                     /db_xref="GeneID:3259085"
                     /translation="MSTSETQIPALPSSGGRPSHPSSSSSAASISNTSIPSVVEQQNG
                     IPIPPTNIPEEAVSGTVTASTSDTPQASRNSQVPTEENTKSIDLQEPTVPEKNASVEE
                     PSGVESSEVGGEDQEIKEGPKFIQPDHFSPLTNNPNGSRPARGIPNIGDGWLSPEDDP
                     HALRGIPVFKPSMEEFLDFEGYARKTTAWGQYSGIVKVIPPAEWIESVPPITKSSLAS
                     VRVTDPIQQNLIGSSGLFRIANVVRNKRRPLTVEEWFKKCKDKKFSGPGPKDVGSTTN
                     RDSKEAEERRQRVRDDMRKEKEKRREKRLAAEANRARKATGIEDIKEEEEVNGQAPSV
                     LDRKDEASTEFVNNPQECQPASLEPDSRTKGIMVEKSINSWYESFDPKEDWLPENTRR
                     EDYSLEACVALERRFWKNMGLGEPSWYGADMEGSLFMDEKTPWNVAHLPNLLNRWDLR
                     HLPGVNAPYLYFGMWGASFAWHVEDMDLFSINYIHFGAPKFWYAIPQQQAERFERILQ
                     GYFPEDARNCDQFLRHKSFAVSPYRLASDGMRVNMLVHNQGEFVITYPRGYHAGFNMG
                     FNCAESVNFALDSWVELGRRAKACNCVNHSVRIDVDEMLAKDAVRFQGEEELLSAIAE
                     ERNKKRQHRRPSAGDNHTPRKRAKPDSQTPSGGLVSSHTPIVIEATDQSKPVKVPGKR
                     TPKAVIDISSNQQRAKANSIKDPNSFPCLFCPGFARDDLLPVFDPSDSVKARWKPRHG
                     EVMAHHSCALAIPGVGIEDREVPGGLGTFVVGVENVESARWKLKCLLCKDKKLQKTGA
                     KIQCTKGKCPRAFHVSCARESDVANLKIWEVETPMLPREGEPPLPEGAEVPTMIDIKV
                     ELLCPQHNPEVKEKLEQRKAETFRDKVMSIPSGSKIKIKVRTGASLEYTLVEARETTQ
                     QVYVHDAQGVGGIFPWSSIDLRPAQGPLLENEYARTHLFANNRRHDQTNGAPSQDDPS
                     EAQRHLTSQEFKQPAQSAHSRPLRMDEILNPSPKKSKKLNPGAGLPQRESMPEPASYN
                     SYPPHGSVHRSANHLHFHPASHPESHPQHPRSQFPTPIPPLQVSHRMSYDLGLHRQTH
                     QSVPQQVFYPQPPSQEHQPLHSIPHPPISRRPHHPIPPSDTSQRVANHQAPHDSYYPR
                     PASVPMLHRYHHQPLQPSYPSRYQTPPQTHYPSHPYPRHEPHIQPPAPSAHPMNNQAT
                     DASHFHGQMYEPYRRHSAPHPVYPTHFMSSVNSVTAEQTRVWDRKASAPNGAVHPSIP
                     DGYRQGYY"
     gene            380499..383315
                     /locus_tag="CNH02630"
                     /pseudo
                     /db_xref="GeneID:3259316"
     gene            383572..385403
                     /locus_tag="CNH02620"
                     /db_xref="GeneID:3259323"
     mRNA            join(383572..383693,383763..385403)
                     /locus_tag="CNH02620"
                     /product="dihydrofolate synthase, putative"
                     /transcript_id="XM_572569.2"
                     /db_xref="GeneID:3259323"
     CDS             383766..385376
                     /locus_tag="CNH02620"
                     /codon_start=1
                     /product="dihydrofolate synthase, putative"
                     /protein_id="XP_572569.1"
                     /db_xref="GeneID:3259323"
                     /translation="METMPGPSKKMETMSDPSETENPPHIEAADQEIYTSSSSTSAAD
                     SSATGLGEIDLGLLRMQILISAFPPLLVPAIHLAGTNGKGSVSALLESCFLSAGFRVA
                     RYNSPHLLEPRDALRIDGLPPTEGQWEEAVRIVKEIDKERKVGATVFEITTAAAYWLI
                     YNTTTWCKGGVDVMIIECGMGGARDATNVIRADTVLASALTSVGLDHTAFLGETVEEI
                     TKEKASIAVQDAVFVIGPQQYEGVVDMARMTAEERGAKVLEALRTERVSKEIDGQVMS
                     LRPFEAPRPVEVRTWLPSIPTATASSSSRRTRSSDRNRNSNSSSITTQLSLPGNHQLD
                     NLSVALTILHGIRHDTRAKQILPLLEKLTDAAIQQGVASCQWEGRCSWVHYVENDRGK
                     RHNFLVDGAHNSDSAKVLREYIDSLLIKEKTDQKPRFRFIVSLSASPGKSIDSVLSPL
                     LRHGDEIEVVEFTTPVQNMPWIKAVPREEVAQTAGQLLGEEAVSIGGIGEDGVRDALR
                     NAKSSGRLAVVCGSLYLVADAYRLLRGG"
     gene            385537..388528
                     /locus_tag="CNH02610"
                     /db_xref="GeneID:3259034"
     mRNA            join(385537..386024,386091..386252,386305..386384,
                     386459..387163,387238..387321,387410..388528)
                     /locus_tag="CNH02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_572437.2"
                     /db_xref="GeneID:3259034"
     CDS             join(385586..386024,386091..386252,386305..386384,
                     386459..387163,387238..387321,387410..388060)
                     /locus_tag="CNH02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572437.1"
                     /db_xref="GeneID:3259034"
                     /translation="MPQAKSLDALPPELLSRTALHLVAASPRRHPSALLPLFLTCRAV
                     YHAISLPNNPQLYKDLYFATFDYSAVLRRCQWMETHIFKDGYNILNLLSDPRLWALDY
                     TTRWEMSRRMRQIAKLGRVEIPGVCDRRQFMQDMWTVWFLVTENDGRNLPFLLEQCNL
                     RAALATYYRDTLLKESLQPGYPTEDGEKALVAWTCIFAGIDTVGEDTPEEVDEKIFML
                     RPYVFACAKYDVSFAPWHLKKLPVCDPGCSSHGADPTVRYRAMTYKRFGYSWRRCPPQ
                     FVLGAYVLFLRLLERHPNRIGLRSGSSSFSYSPFEVGLPGVFSTNKVPLSIENDKEWQ
                     RNTMCQDSHTNEGLLPLTYRGSIQGFWRGKFLFYDFEFYREILSGNLRGVYTGMFAEQ
                     AVEAELRETLVKVKKEDVGGDGPLLTAGFKDMGSLEEETKFLEQGYGHEIVHEDDEDE
                     EGWTKEILISGRGRTAWGWAQIRGRVRAWDGLVILCLSYSPQREPGTRWLWRGYILTG
                     GYLVGRWRDTFTPETLRGYEGAFGLIRAGDIYYPEHFPKRMDDSAGVNQFDQGVFRQM
                     PITGESLPSAGLGTGSSVPSISGSTLTSECNQNQSQSQSQSHNQSLQDQSQIQRVPAG
                     HSHPHHHPHQPLQPVMRKDLHVVPQEPLQTAPSTLSQSQSQPRSQLQTQPQPQTQTQT
                     ETPSQSRPQTLSPEHDPGTKSGRQ"
     gene            388879..390430
                     /locus_tag="CNH02600"
                     /db_xref="GeneID:3259365"
     mRNA            join(388879..389276,389373..390430)
                     /locus_tag="CNH02600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572436.1"
                     /db_xref="GeneID:3259365"
     CDS             join(389021..389276,389373..390382)
                     /locus_tag="CNH02600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572436.1"
                     /db_xref="GeneID:3259365"
                     /translation="MAAQAASAAQSDDGFLDQLIASMPKSTVPPESGVGPAAPKKEVT
                     VEDFEKLLDSTPLFMRETPKDGDDNPVLEALRSLVFEGEGDEIATNFKNHGNELHAQK
                     SYGEAIKAYSEGIDAHPSSATLLVTLYNNRAACHLILKNYRSALKDTSAVIALYTAGK
                     IPQPDKALVKALFRAAQSLVQLSRWKEGGDVVERGKELAEQVKEDTKVWDTLEKEVVK
                     GKKRDDDRVERIRRDNMTKLALRKAVEDRGLIVVDTPSPPDNPHPLHFDEQSIPTINE
                     EVGWTPPPPHTPIVFPVFLLYPPYGQSDFITHFHEDAAFEDQLSAMFPVSPSAPQIPW
                     AEWDEKHEYYVPNLAVYVETKERRLLKVGKELTLREVLGKARREAKGDVKKDGVVLRD
                     GLLSFVVLVKGAQEKAWIEEFKRQRDEKQ"
     gene            complement(390408..393260)
                     /locus_tag="CNH02590"
                     /db_xref="GeneID:3259325"
     mRNA            complement(join(390408..390709,390782..390854,
                     390917..390942,391056..391181,391289..391298,
                     391385..391498,391607..391669,391734..391768,
                     391835..392534,392610..392985,393055..393077,
                     393143..393260))
                     /locus_tag="CNH02590"
                     /product="cleft lip and palate associated transmembrane
                     protein, putative"
                     /transcript_id="XM_572435.1"
                     /db_xref="GeneID:3259325"
     CDS             complement(join(390556..390709,390782..390854,
                     390917..390942,391056..391181,391289..391298,
                     391385..391498,391607..391669,391734..391768,
                     391835..392534,392610..392985,393055..393077,
                     393143..393242))
                     /locus_tag="CNH02590"
                     /codon_start=1
                     /product="cleft lip and palate associated transmembrane
                     protein, putative"
                     /protein_id="XP_572435.1"
                     /db_xref="GeneID:3259325"
                     /translation="MPPPQQAPQEGEQQQSKITGIVRSVAMFFAVQMALKYGMSYLGI
                     GQQNVPAKQPTAGDTASAPNVPRAQSAAVAPALPAWELGTPLSMVLYTSTSPTGQDID
                     PLHPVVQWDGLTYGNWNDEREADLVLDVPESVLHNGSWWLDIVLVKDGGLPLNKQPGT
                     VYSQRKLLTRYYPKKRIRKEKKLIGGTEEDAEKIEEESTEVLPQQIVSHWSNNLTLSI
                     ISNGGPISLQQLAPPTAPSYTFVDGPTEGTKVYYPPIFANDFWLMKESLSPINESTKT
                     LPLHISYHALSNMKHQIYASMTMSFEQAAAQGGGGVEFDEIKRTLLETNPWLLITTAI
                     VTLLHTVFEFLAFSSDVSHWRKKDRDLVGVSLNTILTNCFVQLVILLYLHDSSEETSF
                     MILFGQGIGLLIEAWKITKVTNVRIRPAPNSFIGYSLQFENKRQLTEDEKKTQEYDAL
                     AFRIVSYFAIPLLGAYTVYSLLYETHRGWYSFIISTLAQAIYMFGFVQLIPQLIINYK
                     LKSVAHMPMKAMMYKTLSTVVDDFFAFCIRMPWLHRLACFRDDVVFLVLLYQRWIYRI
                     DYSRVNEYGQVNEGMVEDVGTADGAKEETKKTK"
     gene            393404..396953
                     /locus_tag="CNH02580"
                     /db_xref="GeneID:3259099"
     mRNA            join(393404..393494,393567..393694,393755..396953)
                     /locus_tag="CNH02580"
                     /product="phosphoethanolamine N-methyltransferase,
                     putative"
                     /transcript_id="XM_024657706.1"
                     /db_xref="GeneID:3259099"
     CDS             393758..396871
                     /locus_tag="CNH02580"
                     /codon_start=1
                     /product="phosphoethanolamine N-methyltransferase,
                     putative"
                     /protein_id="XP_024513378.1"
                     /db_xref="GeneID:3259099"
                     /translation="MSEVSPQSQYGGEPDKPTTKSSSWLRNLSRSNLAALILFYVASL
                     HVIGLYVFTQGFLLSRLAIPHVSPAYNVSNPSPISATHSKAVIIVIDALRTDFISPYH
                     PQPPSPHHHGVLSLPAELTQSRPEHSLIFNSFSDPPTSTMQRIKGITTGSLPTFIDIG
                     SNFASAAIEEDSLVSQLVAANKRVGFMGDDTWMNLFPSSFHPNMSHPYDSFNVEDLHT
                     VDNSVITHLFPYLHPSNQSQWDVLIGHFLGVDHVGHRVGPHRDTMTEKLTQMNEVLEK
                     VVDLIDEETLLVVLGDHGMDDKGNHGGDSEMETSSALWLYSKGPMLTNPAVVQDKDTS
                     AIFKSLPTYIFPKSTMPLRQINQIDIVPTLALLLGVPIPYNNLGSVIPECFTNNLETL
                     EVAQRVTADGIWRYVEAYGDKEVKENLNSAWRHAQSQYQKDNLSASIIAHRAFSLDAL
                     VHLRSLWAQFSMPLIVIGSLILGLCALTLIALYVGVRNNGVNWDVYARLALETATMGS
                     TVLASIAGTVAGVYTARPIVAIKVFIVAAALISEVILILPLFVKSSLSLALPLPTSFS
                     INRHIGPFILIVHALSFASNSFIMWEDRVVLYLISTIPIIYIIRALSAPTADMRLKII
                     FLSLAFTILSRLAGTITICREEQQPYCSVTFFSGVTATAPTWALIAIVPLALQIPRAI
                     GITLSRSKSLAGPAPFILGILWRAVLVANSVYWVLEFFESFDGLNPARIPLVNFLKLW
                     LARCSAGASLGAIPYVWLTSPLCISVERTTDQATGEEEVTVFGFANAFGSTYILYTLA
                     PFALIHLVSQPMAQFTLTAFLIGLLVYLELVDTRRDAIILTTSFASLGNNKNNNNASS
                     PAGLASFDPADTAQTIVRPSFTDVVPIALSGFLTFFATGHQAVISSIQWKSAFVGFST
                     ASYLFSPVLVVLNTWGGFFLSAIAVPLLAIWNIAPRPRESIPTLAHALQVTLAFLVYH
                     TVVAFASAITAAWLRRHLMVWKVFAPRFMMAGVTLLVVDVGLALGLFGVRVTGWKVKK
                     TFGCESI"
     gene            complement(396954..401178)
                     /locus_tag="CNH02570"
                     /db_xref="GeneID:3259059"
     mRNA            complement(join(396954..398320,398377..398522,
                     398578..398649,398706..400564,400639..401178))
                     /locus_tag="CNH02570"
                     /product="ABC transporter, putative"
                     /transcript_id="XM_572433.1"
                     /db_xref="GeneID:3259059"
     CDS             complement(join(397201..398320,398377..398522,
                     398578..398649,398706..400564,400639..401092))
                     /locus_tag="CNH02570"
                     /codon_start=1
                     /product="ABC transporter, putative"
                     /protein_id="XP_572433.1"
                     /db_xref="GeneID:3259059"
                     /translation="MLLPALAIIHYTHPILLSLPLPFLLTPSSPQSRPPPGLVPITVQ
                     RISPRRTFILTLLALLAFTSFLDVIILVANALSARTRYGDDLPLYLTGAQLGGEIAYS
                     LGGLVAWGVALIACSWRNRFSSGLAVFASLGIIGEIVNLIWLVKREVHTGNSEKLFAI
                     LSLIPSSSRLLILPLLFLATLSPRVSYEPASERSGLLDADSATNGRLLEPGTASAYGT
                     FATGTTTPANPPQAEEQTEQQRQEERAKQKKIKLTKALGSRRQPKKVLSWSEGWPKFK
                     KLIPTLWPSTDKKLQVYVIITAILILIQRFLNPLSPITLGWLVQALSSWQHRSDVWKA
                     LGAYLAVRMVNSYDFISIAQQYFWIPVVQYTDREMQMVCFNHLLDLSLSYHTRRNTGE
                     VMRIIDRGSAINELFRTILFSVVPTLSDTVIGFSVFIWLFGPWITFGILAVMIPYCVF
                     SILATRYSQKFRREYVDTDVRQRGIVSDVLTNWESVKYFTSEHREVARFEEAVNEVMK
                     VDYQWRMGLQVIYAVQSLLLVTAFAVGAIFLSVKIMHGQATAATFVVYITYFGQFTQP
                     LNQLSSLYKTISSDIIDAEKLLSLLGETTEIKDDPDAKEMVVTDGVIEFDNVTFSYDG
                     TKDAIKNVSFKLEKGQSLALVGQTGSGKSTILRLLYRFYDITSGHIYIDGQDISKVTQ
                     ESLRKAIGIVPQDSVLWNDTIGANIAYGKPDASDEEIIEAAKAGRIHDKVMTFEDQYD
                     TIVGERGVRLSGGEKQRVSLARMFLKSPLILVLDEATSALDTETEREIQKSLSKLAEG
                     RTSLSIAHRLSTIINSDKIMVMKEGQILEIGGYKELIDKNGAFARMWKRQIYTEAELL
                     EGDAIDKFASALPTADDFKAFRKEEYGEEKPQNGGGDNSEQTVAATSNSNGELKDQDD
                     QQEGTKSTGEPVDKRGYKVDSPTPADQPGAQSFAEIVKSEPHEGKDMPSTYAEAAAEP
                     SQPEETNDKDRQPVSSEVGESVTESVPSIPEPSAPSIGDHNAPATPKTVPFPSVYDSR
                     RASYPAAQGTPVHRLSTFSTLSASPSVSSISRASPSSVKSDAVSGDSSKQDTPGASTN
                     KEDKRRKRLSSIKGFVRRISDQGGLTRSPSGLKSPKPERGKGLNIDEGLVPDNGAAGD
                     EVIDERTALLQGQDPVRAAETLPAPAGGQASEQVGLAEQALAPPTSLPASIKSHGGGN
                     SRKEKKKKKNRR"
     gene            complement(401330..403292)
                     /locus_tag="CNH02560"
                     /db_xref="GeneID:3259003"
     mRNA            complement(join(401330..401644,401701..401777,
                     401830..402035,402087..402404,402461..402815,
                     402878..402891,402945..403292))
                     /locus_tag="CNH02560"
                     /product="syntaxin, putative"
                     /transcript_id="XM_572432.1"
                     /db_xref="GeneID:3259003"
     CDS             complement(join(401583..401644,401701..401777,
                     401830..402035,402087..402404,402461..402815,
                     402878..402891,402945..402971))
                     /locus_tag="CNH02560"
                     /codon_start=1
                     /product="syntaxin, putative"
                     /protein_id="XP_572432.1"
                     /db_xref="GeneID:3259003"
                     /translation="MARDRLGNVNRQYGEQPTPGPTYPPPGNGVVAPTRTANPYAQQT
                     SVAAAAPGGYGAQGGYGASAGNPYAQTGQAGSPYATGGQYGQQEQYAMGGANGGAGGD
                     FWTELSNTNSLLGQLQEQIQAVRTAHQTSLTSTDPQAAAYAAQLNDQARVQREECKNE
                     IKTLYKLAKGDRAQRTQAEGVKSRFQGLLQEHQVIEKEFRKKVKDRVERQYKIVNPNA
                     TEEEIKEVTESDNPQVFSQALLNSNRYGAARGAYREVQERHAEIQKIEKTLTELAQMF
                     QEMAMLVEQQDETIVNVETQAHGVDTDIKAGLVQTDKAVESARRARRKKWICFWIVVL
                     IIVILAVILGAYFGTKGK"
     gene            403544..404855
                     /locus_tag="CNH02550"
                     /db_xref="GeneID:3259311"
     mRNA            join(403544..403697,403751..403766,403824..403872,
                     403927..404133,404189..404486,404570..404855)
                     /locus_tag="CNH02550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572431.2"
                     /db_xref="GeneID:3259311"
     CDS             join(403602..403697,403751..403766,403824..403872,
                     403927..404133,404189..404486,404570..404785)
                     /locus_tag="CNH02550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572431.1"
                     /db_xref="GeneID:3259311"
                     /translation="MGGSPQITPLALIKRVWERIAPLQLAERSWDNVGPIIEAPYPNP
                     SHRQVLLTIDLTPSVCAEALKHPSLSLIVSYHPPIFRGLKSLTLSDPLQASLLKLSAK
                     GISVFAPHTSLDATPNGINTWLIKPFIPISISHDPIIPSDPLESFEGAGMGRIAKLSE
                     PLDIRQAIKMVKDHLSLDFVQLAEPQPDVRKPIKSVAVCAGSGGSVFKGVEADLLITG
                     EMSHHEILAYVASGTTVILTNHTNTERPYLSHVLQPWLQEELNKETKDHSNEYGANGG
                     KWEVLVSKADADPLKVV"
     gene            complement(404430..411410)
                     /locus_tag="CNH02540"
                     /db_xref="GeneID:3259013"
     mRNA            complement(join(404430..404829,404893..405186,
                     405264..405390,405445..405569,405650..405733,
                     405793..406201,406254..406381,406426..406645,
                     406700..406858,406924..407036,407089..408112,
                     408161..408566,408621..408801,408855..409358,
                     409420..409632,409686..410046,410100..410380,
                     410431..410640,410695..410844,410903..411036,
                     411095..411410))
                     /locus_tag="CNH02540"
                     /product="cellular morphogenesis-related protein,
                     putative"
                     /transcript_id="XM_024657705.1"
                     /db_xref="GeneID:3259013"
     CDS             complement(join(404956..405186,405264..405390,
                     405445..405569,405650..405733,405793..406201,
                     406254..406381,406426..406645,406700..406858,
                     406924..407036,407089..408112,408161..408566,
                     408621..408801,408855..409358,409420..409632,
                     409686..410046,410100..410380,410431..410640,
                     410695..410844,410903..411036,411095..411299))
                     /locus_tag="CNH02540"
                     /codon_start=1
                     /product="cellular morphogenesis-related protein,
                     putative"
                     /protein_id="XP_024513377.1"
                     /db_xref="GeneID:3259013"
                     /translation="MAHSSPPLNTQPSESRALKRPASQSRLTQLLVPGRSRSDSTTSQ
                     TSVNIEDSGSSGRATPEGRTRAGKAAAASLLANDPKYKRFKQQVDKALQSFENVNEWA
                     DFISFLSRLLKTLQSPSPPYHEIPRKLIVSKRLAQCLNPALPSGVHQRALDVYSYIFS
                     IIGTDGLQRDLAIWSSGLFPFFQYAATSVRPLLINIYDHYYLPLGENLRPATKAFVLA
                     LLPGMEEEAGDFFDKILFLLDRLSGAISPSFFLQNIFLILITSPISRLAALNYLARRM
                     TKPLDHPDAAIETGLLIRGLSAALDDENVLVRRNALDLLLRVLKLESKVLKEAELSDK
                     QLLIDSATSVVLQKELSLSRRVYTWLLGTSESPNDQVDYFKAHGLDLLSSTLLLKMEK
                     SMVEEDGGRDDDPQKPFKIFLSLLDKWEIGGVLSEKVAIPALRIMMDASSSGLTEASN
                     MASALYEAMEPSIIWKELYHSVEERILRGNKGDVALVSWLLDNVPQKDEEIAALHLPL
                     LLDRILELIQCDNIAADQLPEAIRLAVSLVQHIPATVFSKSSSTFHRPPTEEPPLFQG
                     LYEQKQQPRDIEIRLHAHLLPHIVQSAFSISIAALKGSDPTILLHAINIISVLIDYEV
                     PALGEIDGPTWLSALVDSLPRVKAFVVVEALVMVALKASRSDLMKSGISVTSDKTMSA
                     ILDSLFRYLQPSASLYHSRAVELLWDYNQLAEIHTLETVIARRMTKSSSINSALEAFG
                     IFWRLTDDSMLPGEIFHVPVCTVLESLKSTDPDVQRQAETWLRLNLRSYFRVLDPLLS
                     RLLDPSIKYDSSQGTYDGLVDLNLIRHQIESVTALFQFGGQGLCKACQVEELNGSLHS
                     TFISRAEKAFPGVKGYMELICLLLIRFVEAETSPQMGKKASPLILRVQSAALSLLQMI
                     VSRGEVSQPFISSLKTTLANKLLSAVQARRLTLQSKMLHLLHSAINASSSHREPSSRV
                     PSQTHRRGASSVTEKPLSIDVSTSDFEHQLVITVMQGVATPSNIPVLQHWIDFVLMTV
                     PLLVNRPNLLHTLAECFSQETRELVQRIQEGHEKKSLLRDRKDIIIMPDEVLNVTDAE
                     VIMTLNVLERVLTILSNPASGKVDDSVSGQGESGSRILGLVSTVFTVEAPSNELKPES
                     PRYLDDAVHALLVTWSATLPSSEAADERARVEDVSHQTYVNIRGRTRKVLEKVFRANP
                     LAVISSCVHVWSLRSEQVSDEAIFDCVDTLTPSAQRVVELICDMASGKSGKAVSDYKA
                     DPSCLAFLEAYISRLEAPIAVQVWSTLFGFARELVSAATTVFTRSQLFSLLQCLTELS
                     LTISKTTALEDRRLRRDLHDTYARALDLVVNNSLKIAEAGIWDRPDIAKSVDADKEDD
                     VDVEKGLVKIYDYLATAVIPNLRLLLVESDRVNSACSGIIVAIVNPAFRRQRVDAPIL
                     RLILEISRIPSTAKTWRPLVSDFFSDHRLFKSKPSVETDYWKQLILALFTSDKERFPD
                     LLSRITSTSSANINIFTNREQEMAGKCGNLRRLSLILLAAERNHYLGLLPAIQERLVE
                     MLRSGNVSARVHSEVYLCLRVLMCRISPQHLTNFWPVILAELLRIFERTLDEPPEDES
                     EELLLVLAACKFLDLLLVIQSEDFQIHQWMFVTDTTDAAYPPEDYAPDAMMDKLAELL
                     SELGSKGGDTELSLSEPSLVLTSPLNRLPNSLRRPRLSEVTSIVSLQQLQMFFARASM
                     DTFESVYAEAAVDWNGIEEGLLGEIFDA"
     gene            411490..413523
                     /locus_tag="CNH02530"
                     /db_xref="GeneID:3259234"
     mRNA            join(411490..412266,412325..412476,412537..412565,
                     412642..412831,412889..413002,413067..413080,
                     413120..413195,413251..413523)
                     /locus_tag="CNH02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657704.1"
                     /db_xref="GeneID:3259234"
     CDS             join(411505..412266,412325..412476,412537..412565,
                     412642..412831,412889..413002,413067..413080,
                     413120..413195,413251..413479)
                     /locus_tag="CNH02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513376.1"
                     /db_xref="GeneID:3259234"
                     /translation="MSSKADASIKFNADTSNEEELDTETKLVLLASLVHPLTLPPQAL
                     EVLASVDGDVAKAAERLLLPNPETSRKRKAGSSLQGWLGRPSDNKKAVKAKRKQEAES
                     TDRHLTVSAAGGSKISGTSTITIDEDKQRDDTISETAPPKSVTNAFEILGRAPSSPVK
                     QKVGPQPAIHLSSQASIDSHSLPLTLINQFLSPSLASALYLIMMEESNSWGANRFYIA
                     GKAAKSPHTTGFYRKEGGGYGGGKYFYAGMEQGPAKVYPAFLARAAEIVEKAVNENLR
                     KRPRYGLEWGGEWKANVCGANRYDGSRSSVGWHADQLTYLGPYTTIASLSLGTSRAFR
                     LRETPPSDPAFVINDKPPCTYEITLAHNTLCLMNAGCQERYKHTVPPQKAIDLFRPGY
                     DIAENPIPKDAQLAFTSRINITFRFYREDFHPVPNAGPFGPREGTPICRCGVPTVLRA
                     DQKAKARSRLSSTSFKSRPRASSNTNIIEDDMVFFWQCQSATQTGVGKGCGFFRILDM
                     KKEGRGPCIGDRV"
     gene            complement(414227..416491)
                     /locus_tag="CNH02520"
                     /db_xref="GeneID:3259364"
     mRNA            complement(join(414227..414526,414594..414740,
                     414806..414855,414904..414914,414962..415150,
                     415206..415476,415531..415536,415592..415712,
                     415783..415894,415957..416002,416050..416061,
                     416110..416168,416220..416491))
                     /locus_tag="CNH02520"
                     /product="cysteine synthase, putative"
                     /transcript_id="XM_572428.2"
                     /db_xref="GeneID:3259364"
     CDS             complement(join(414418..414526,414594..414740,
                     414806..414855,414904..414914,414962..415150,
                     415206..415476,415531..415536,415592..415712,
                     415783..415894,415957..416002,416050..416061,
                     416110..416168,416220..416463))
                     /locus_tag="CNH02520"
                     /codon_start=1
                     /product="cysteine synthase, putative"
                     /protein_id="XP_572428.1"
                     /db_xref="GeneID:3259364"
                     /translation="MGVSDYFIAFSAKFWERLRFPSKFTRDLVWGIILGITVSLSSTS
                     AALILQEWRRKRAVQRIPPRPIELRSDEIVPGVTGLIGNTPLIRINSLSDALGVEILG
                     KAEFLNPGGSVKDRVALQIIEDAEAQGLLYPNTGSVLFEGTVGSTGISLATVGKAKGY
                     ESCIIMPDDVAIEKVQILEKLGARVERVRPASIVDQKQFVNLARKRALEFGKSELTNI
                     PGHGEEIAVSTAAEPSEINHHHLFPSAFEHKPRGFFADQFENDSNFMAHYKGTGPEIL
                     RQTSGHLDGFVSGAGTGGTIAGTGCFLKKALPDLKIVLSDPEGSGLFNKVRFNVMFDP
                     KESEGKKRRHQVDTVVEGIGINRITYNFSLGLPVIDDAYRVSDEEAVAMSRYLVQHDG
                     LFLGSSSACNLIACIRLAKTMSRGSRIATILCDSGSRHQSKFWSDDYLRANNIAIDPS
                     IVDRLLES"
     gene            416615..417495
                     /locus_tag="CNH02515"
                     /db_xref="GeneID:36393009"
     mRNA            join(416615..416688,416750..417049,417104..417320,
                     417375..417495)
                     /locus_tag="CNH02515"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658679.1"
                     /db_xref="GeneID:36393009"
     CDS             join(416657..416688,416750..417049,417104..417320,
                     417375..417428)
                     /locus_tag="CNH02515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514596.1"
                     /db_xref="GeneID:36393009"
                     /translation="MTIFSLYIFDRHCDCVYYQDWHRTSPVRPPPPASFKPGVHRLPP
                     APQPTDTYRRSIFDEKRSSGQASTVDIKSDGLGSGRALKGLPFDEEAKLVYGVLISLR
                     SMVKRLSGRDDEPFTSYTTPQYKLHLFETPTGYKFVLLSDPTSDSLRFILRQLYMGPF
                     LEYVVRNPLVKLDSREEGIDNDQFRDAVDRHMRALSMFGS"
     gene            complement(417454..421404)
                     /locus_tag="CNH02510"
                     /db_xref="GeneID:3259109"
     mRNA            complement(join(417454..417782,417850..417997,
                     418060..418229,418284..418403,418462..418512,
                     418566..419117,419171..419305,419366..419667,
                     419716..420198,420259..421159,421252..421404))
                     /locus_tag="CNH02510"
                     /product="chromosome organization and biogenesis -related
                     protein, putative"
                     /transcript_id="XM_024657703.1"
                     /db_xref="GeneID:3259109"
     CDS             complement(join(417609..417782,417850..417997,
                     418060..418229,418284..418403,418462..418512,
                     418566..419117,419171..419305,419366..419667,
                     419716..420198,420259..421159,421252..421281))
                     /locus_tag="CNH02510"
                     /codon_start=1
                     /product="chromosome organization and biogenesis -related
                     protein, putative"
                     /protein_id="XP_024513375.1"
                     /db_xref="GeneID:3259109"
                     /translation="MSLHEGNRRRDALEALKHRKSTQSRPPVSRSPSVEYIQDSDVLV
                     PPSSSPAPTPQQSKYFASKLTQKNGALDSMKDTLDKRTNARKDEKYPSLNGSPSDVLR
                     AIHRHSPQPLRRPKPRYVDPDEEESPVKPTPATPSMISSVRQPSLVHAAQSARDDQEE
                     KMIQRLASQFPNVERSTISSLLRKYPGNPDRAINQIHYANQMKAEQESYTSARSTTSK
                     RSSPLPVPVSPAASNSKSKKKNENSTIYANRKRHRRSNDSEEEFSGSESEDDFSDGDD
                     GRKRRKGEDDEPDAEGAALKAFNEDSVETLTGTIACRPEQAAIIIKHRPYEDVDDVRA
                     KLTKARGVSFKLFEQYTEIMEGFVQIDACLNRCEAIASDVAKTLAVWKGASHAQDGSV
                     VGTPRSDGLNDVKVDVAKVSELLKNETDVKKRKILKQYIQTQPSTLSEGTVLKDYQLL
                     GVNWLNLLYSKRIGCILADEMGLGKTIQVIAFIAALKERGIIGPHLIFVPASTLENWT
                     REFRRFAPDIDVQTYYGSQAERAGLRSDLKAQFRRGELEVVLASYTQMTSADDLSFFR
                     KKIDFETCVYDEGHRLKSCTTKAYTDLLSIKPKWRLLLTGTPLQNNLQELLSLLMFIH
                     KDTFTDAEPYLRAIFKSQGSASLLSHTRTTRARTMLTPFVLRRRKAQVLSLPPKIEIV
                     EHCEMTKVQSKLYSETMQKSKKILSELTEEALEEVAGEDGSVATGKKPEADKKSVKGK
                     KASGVTTSGSNILMDLRKAASHPLLFRRLYTDAKIRQIAKACLNTPSYCDCNLDYVIE
                     DLEYMSDYEISNFCTSSVEEELHKYALDPEVFLEGGKVMAMVKHIERCKAEGKRMLLF
                     SQFVMILDILEGALNHLGIRYTRLDGQTKTDERQGLVDEFNDDTDITVFLLSTKAGGV
                     GINLTAASVVVIYDQDFNPHNDRQAADRAYRIGQERKVEVIKLITKNSIDEDMLEIGL
                     TKLQLDDMVGGEEITLDGTDGAGADDKTAKETRKSLLTQLRTKFVESES"
     gene            complement(421817..422845)
                     /locus_tag="CNH02505"
                     /db_xref="GeneID:36393008"
     mRNA            complement(join(421817..421942,422017..422745,
                     422808..422845))
                     /locus_tag="CNH02505"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658680.1"
                     /db_xref="GeneID:36393008"
     CDS             complement(422057..422314)
                     /locus_tag="CNH02505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514597.1"
                     /db_xref="GeneID:36393008"
                     /translation="MAPCVCLTTLLFCSPRRYSLANLSAAPSLSINTTVCLPVGLSSI
                     VPRALPPFPHRDMSVFDVLLPVAAPTYCICLDILCLLRDFL"
     gene            complement(422960..424555)
                     /locus_tag="CNH02500"
                     /db_xref="GeneID:3259096"
     mRNA            complement(join(422960..423591,423650..423724,
                     423786..423882,423939..424082,424140..424166,
                     424246..424555))
                     /locus_tag="CNH02500"
                     /product="expressed protein"
                     /transcript_id="XM_024657702.1"
                     /db_xref="GeneID:3259096"
     CDS             complement(join(423218..423591,423650..423724,
                     423786..423882,423939..424082,424140..424166,
                     424246..424362))
                     /locus_tag="CNH02500"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513374.1"
                     /db_xref="GeneID:3259096"
                     /translation="MPSCRVTNNTAHPLNISLKQVTALHFENGVQPGQTIKFRPGKVW
                     FTFEALVDDGSKKSRYSVLKSAATIAVISVAVGAVAATAGTALLPEAVALETAAAASV
                     AGGAIAKGVTAAKTALIANSGTIARISSVALPKAIEKLSAESGGLTALQREVVSIIAS
                     PTLSSDVRHKSASLLRSLHKSYTGDKAARQEASSANNPDAGQPSATLTPISDDEAEKL
                     ERDVESGEVDDRVENTAVRTGEVLRVHGIYMKQHREFEIRVGEEGKLALYDVDQKKFI
                     M"
     gene            424830..427776
                     /locus_tag="CNH02490"
                     /db_xref="GeneID:3259030"
     mRNA            join(424830..425270,425323..425983,426033..426517,
                     426578..426747,426802..427606,427663..427776)
                     /locus_tag="CNH02490"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_572424.2"
                     /db_xref="GeneID:3259030"
     mRNA            join(424830..425270,425323..425983,426033..426517,
                     426578..426747,426802..427551,427607..427776)
                     /locus_tag="CNH02490"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_572425.2"
                     /db_xref="GeneID:3259030"
     CDS             join(424836..425270,425323..425983,426033..426517,
                     426578..426747,426802..427551,427607..427661)
                     /locus_tag="CNH02490"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_572425.1"
                     /db_xref="GeneID:3259030"
                     /translation="MPLPPKVSPVTGNPVPPHYIHSSTLHFQDVNGRSLVLRGVNLSG
                     SAKHPNNQPSHIREGFWETAEAGKGDFINKPLNLDDGSADLHLARLKAWGYNLLRYVF
                     TWESLEHAGPKEYDYAYMDYIIAVLRKCKEWGFRVFMDPHQDVWSRFTGGSGAPLWTL
                     YACGIDPYHLTPTAAAYLHCEWPSAESPKPQDFPAMIWGTNYTHLANQTIWTFFFAGK
                     TYAPKCIIDGKNIQDFLQDHFIDAVGELAKRIAEEGGDLLDECVIGWDSVNEPGEGLI
                     GYKDLAVIPAEQQLKKGPSPTPIEGMRLGMGEVQDVQVWNFGPMGPYRGSRQTIDPKG
                     VKLWLSEEDDVKRGSGKWGWTRGKEWALGTCIWAHHGVWDIATSTLLRPDYFSTLPTN
                     PSHQVDFVDDFWALHWLAYSSRIRLHHPESIHFIQAPVLRQPPKLPESFLKGRACSSP
                     HFYDGLTLMTKHWNWFNADAIGVIRKKYWSIVQAVRIGEGPIRKMIQGELAVLKQDTV
                     DILGKYPTLIGEIGIPYDMDDKKAYGYVDGGRGEGDYSSQQKAMDCSMNACDGPNCLN
                     YAIWNYVPDNVHEWGDNWNGEDLSLWSLDDKEQESYHDSPRSDTPNFSTNSSSLTNSS
                     ATLTVPMSGAAKLRLSPSVIDAGDFSPALILDGSRAVAAFCRPYPVVTVGIPERIDFD
                     ITSTKFKYAVRVRADDIVNEQVYTEIYLPFVHYAASLDPSRPAGHNPNSGQTALTSTD
                     GDDSNLSSRQTSKVDLIEDERAIKSSDPSSISIRSVPYSSSTQLSLDVAIVASHGRVE
                     IQGQTLRWWYPVPGTGEEVYTIEVQRNGGALRRDLGCVKASQYNGQTLINLSL"
     CDS             join(424836..425270,425323..425983,426033..426517,
                     426578..426747,426802..427606)
                     /locus_tag="CNH02490"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_572424.1"
                     /db_xref="GeneID:3259030"
                     /translation="MPLPPKVSPVTGNPVPPHYIHSSTLHFQDVNGRSLVLRGVNLSG
                     SAKHPNNQPSHIREGFWETAEAGKGDFINKPLNLDDGSADLHLARLKAWGYNLLRYVF
                     TWESLEHAGPKEYDYAYMDYIIAVLRKCKEWGFRVFMDPHQDVWSRFTGGSGAPLWTL
                     YACGIDPYHLTPTAAAYLHCEWPSAESPKPQDFPAMIWGTNYTHLANQTIWTFFFAGK
                     TYAPKCIIDGKNIQDFLQDHFIDAVGELAKRIAEEGGDLLDECVIGWDSVNEPGEGLI
                     GYKDLAVIPAEQQLKKGPSPTPIEGMRLGMGEVQDVQVWNFGPMGPYRGSRQTIDPKG
                     VKLWLSEEDDVKRGSGKWGWTRGKEWALGTCIWAHHGVWDIATSTLLRPDYFSTLPTN
                     PSHQVDFVDDFWALHWLAYSSRIRLHHPESIHFIQAPVLRQPPKLPESFLKGRACSSP
                     HFYDGLTLMTKHWNWFNADAIGVIRKKYWSIVQAVRIGEGPIRKMIQGELAVLKQDTV
                     DILGKYPTLIGEIGIPYDMDDKKAYGYVDGGRGEGDYSSQQKAMDCSMNACDGPNCLN
                     YAIWNYVPDNVHEWGDNWNGEDLSLWSLDDKEQESYHDSPRSDTPNFSTNSSSLTNSS
                     ATLTVPMSGAAKLRLSPSVIDAGDFSPALILDGSRAVAAFCRPYPVVTVGIPERIDFD
                     ITSTKFKYAVRVRADDIVNEQVYTEIYLPFVHYAASLDPSRPAGHNPNSGQTALTSTD
                     GDDSNLSSRQTSKVDLIEDERAIKSSDPSSISIRSVPYSSSTQLSLDVAIVASHGRVE
                     IQGQTLRWWYPVPGTGEEVYTIEVQRNGGALRRDLGYVQQGNFLDVCPECVIA"
     gene            complement(427813..430577)
                     /locus_tag="CNH02480"
                     /db_xref="GeneID:3259297"
     mRNA            complement(join(427813..428026,428100..428172,
                     428245..428297,428359..428430,428502..428734,
                     428811..429379,429437..429579,429634..430319,
                     430367..430423,430482..430577))
                     /locus_tag="CNH02480"
                     /product="mitochondrial DNA repair and recombination
                     protein PIF1 precursor, putative"
                     /transcript_id="XM_572423.2"
                     /db_xref="GeneID:3259297"
     CDS             complement(join(427918..428026,428100..428172,
                     428245..428297,428359..428430,428502..428734,
                     428811..429379,429437..429579,429634..430319,
                     430367..430423,430482..430562))
                     /locus_tag="CNH02480"
                     /codon_start=1
                     /product="mitochondrial DNA repair and recombination
                     protein PIF1 precursor, putative"
                     /protein_id="XP_572423.1"
                     /db_xref="GeneID:3259297"
                     /translation="MPKPGFYAVRFGRRPGVYITWAECQQQVHMFPGAVFKKFGTYDE
                     ASLWASLRPQTPPPPETSETDRKDGLKESDKGKRISDSADPSAQHGPRSSSKASPSHP
                     LHLPYQQDCKRERSEDTDDTESPGRKAKAGKHDRNEDKNGYDGFTAMDDYISVLPPDD
                     EAGQSSSTQVDGNITTAELPAVGGEPELSSQQSEILAKIMNGENFFFTGSAGTGKSVL
                     LRAIIKAFKEKEGEREQREATRSFRSWQGYRGAQKAEKEEVVKWSLAVTASTGMAGVN
                     IGGTTIHSWAGIGLGVDNAEKLANKVRANALSRKRWRTTAALVIDEISMIDAPLLDKL
                     DHIGRIVRNDDRPFGGIQLILTGDFFQLPPVTKGQIPQFAFEAKCWPKLFSHKNIKTL
                     TRVFRQRDDRFINMLEAMRRGTITPDDTVLLQSLNRPIEYPDNIEPVALYPQKRDVEF
                     VNSARLDALPGAVTLYDCHDEPGFTAGGFPISRTEATIKLNKNTIWPQHLSLKEGAQV
                     MLVTNMGDGVLVNGSTGTVVDFLTIPDAIKRGIHLPEAAIKGQTSMDLEFPVVAFAQS
                     KFARKKVPERVIIPSMSVDMLNALGQPEATRYQIPLILAWALTIHKSQGQTLERVKID
                     LAKIFVEGQTYVAISRAVSLDSLEVLNFRPHSVKAHSKVIDWARPYEEEQAAEEEWNN
                     LEDNIGILY"
     gene            430680..433651
                     /locus_tag="CNH02470"
                     /db_xref="GeneID:3259087"
     mRNA            join(430680..431209,431262..431372,431425..431783,
                     431877..432088,432154..432210,432286..432469,
                     432562..432726,432811..433021,433107..433317,
                     433386..433651)
                     /locus_tag="CNH02470"
                     /product="DEAD box family helicase, putative"
                     /transcript_id="XM_024657701.1"
                     /db_xref="GeneID:3259087"
     CDS             join(430701..431209,431262..431372,431425..431783,
                     431877..432088,432154..432210,432286..432469,
                     432562..432726,432811..433021,433107..433317,
                     433386..433502)
                     /locus_tag="CNH02470"
                     /codon_start=1
                     /product="DEAD box family helicase, putative"
                     /protein_id="XP_024513373.1"
                     /db_xref="GeneID:3259087"
                     /translation="MPTSRCAARLFSLTKVLCPHTASLTRPPIHPARPYATILASSQN
                     LHQPPSDHAGPNNTTRNQNITLRSYQEAAISACLDALQSGSRRLGVSSPTGSGKTTIF
                     LSLIPRVPFYASRGNDSHPRDGKGQTLIIVNSVELAEQTQKSAERLLGDEWTIEIEQS
                     KRVASGLADVTIATYQTLNNPDRLSKFDPSKFKLVIVDEAHHSAAPSYLRLLHYFNED
                     VKIPKSPQAPSPHLHGFKVPIIGFSATFSRADQHSLHSAFEEIVFHRDMKDMLSEKHL
                     APAKLTIVKADLELDEVETSSGDFKNAALARKVNTTEINELIVRTYLHRASERRSTLV
                     FCVDLEHVSALTQTFRSAGIDARSVSSKSKPEMRKATIAAFGKGEFPVLINCEVLTEG
                     TDIPQIDCILLARPTQSRNLLVQMVGRGLRLSPESGKTDCHIIDLVDSVANANGLIVT
                     PTLLGLSLDEMDVEDHGRESTEKAKPQDELETVPPIAPDYDITYLDQDDPFHVDVFAQ
                     PVIQKVSKNAWVSCGNGKYALELIGSGTIIATRNDPQLYSISYRPNLPHELTPLGKGR
                     SPYGSVRVVGHAPDLERALQAGDKFAENKLGRGRCLALSRYAPWRQRLASENAVKHLL
                     KRLGEDNDSLLNGQGKERVISLWGKKVSVGSLTAGEVSSWLCAMKNGAKSIRIARDKS
                     EEKARAKAEAKAEKERQQQLRNLPLPPST"
     gene            complement(433353..434431)
                     /locus_tag="CNH02465"
                     /db_xref="GeneID:36393007"
     mRNA            complement(join(433353..433557,433623..433900,
                     433971..434157,434212..434431))
                     /locus_tag="CNH02465"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658681.1"
                     /db_xref="GeneID:36393007"
     CDS             complement(join(433655..433900,433971..434157,
                     434212..434375))
                     /locus_tag="CNH02465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514598.1"
                     /db_xref="GeneID:36393007"
                     /translation="MTMLPTARPRVAHILPYIQHFTASTSTSSTASDPPRRRRSNRND
                     TPATGVDLVAPPDPLSNIRPILYASKPPTRPSANSPYSASEFPSSSGDAKLDNMELEW
                     RLRRERVDLTNHRFWAANNIAFNAQLDHRLSLLPPASDPPSPEDIRRKEDCLTQFYAD
                     WQMANQERQIRWVKEWWREIWEGLRIQARLYVMRALRR"
     gene            434516..436542
                     /locus_tag="CNH02460"
                     /db_xref="GeneID:3259229"
     mRNA            join(434516..434669,434722..434886,434947..435035,
                     435096..435153,435206..436035,436123..436542)
                     /locus_tag="CNH02460"
                     /product="bud site selection-related protein, putative"
                     /transcript_id="XM_572421.2"
                     /db_xref="GeneID:3259229"
     CDS             join(434571..434669,434722..434886,434947..435035,
                     435096..435153,435206..436035,436123..436468)
                     /locus_tag="CNH02460"
                     /codon_start=1
                     /product="bud site selection-related protein, putative"
                     /protein_id="XP_572421.1"
                     /db_xref="GeneID:3259229"
                     /translation="MSALDNSTAPSLQTKKRKRTGKEREERKKAAIQAKQEAEAVEKA
                     NGEVEGGTIVQDSVQETVAPQEAASVEHEAGLSSVDVEKVAKRIPQALKSLHPVFKQA
                     KTFETRRLIKKIKFLRNKDVKDETADLESQLKIIHDIQLQPLAKSHLLVKLRKHPLFK
                     QTPLPSEISSLLSPPSATTASFAGTSATPALINKAENRLCSAKIVAERMKNVVSWTVC
                     EGGAKLVIEKKPATISAGKGGSKKAAESTDEEDDEQEEGEEANVGDISRSMVNGSDSE
                     EDSDDERVLQDRAADAAGWESGSVSGFDSEGGEVDIASESESESDNSDAIAVPSAKRA
                     KTAVPPLPPKSKPLKSEKADKPPKSAKDLTSSIFLPSLSVGFTRGDDDDSDPDLDDDP
                     NGVAGKQPVVRKNRRGQRARQAIWEKKYGKNAKHVVKAHEEEKLQAQKTREKAEAKGR
                     TRDSGWGAKSGKAVGPAVAAGPAQTAAVSHTQKVYSEPKQSQTEQKKSLHPSWEAAKL
                     RKQKMGVVQTEIKAQKIVFD"
     gene            complement(436507..438590)
                     /locus_tag="CNH02450"
                     /db_xref="GeneID:3259033"
     mRNA            complement(join(436507..436964,437017..437117,
                     437171..437850,437904..438268,438330..438437,
                     438495..438590))
                     /locus_tag="CNH02450"
                     /product="1-pyrroline-5-carboxylate dehydrogenase,
                     putative"
                     /transcript_id="XM_572420.2"
                     /db_xref="GeneID:3259033"
     CDS             complement(join(436632..436964,437017..437117,
                     437171..437850,437904..438268,438330..438437,
                     438495..438548))
                     /locus_tag="CNH02450"
                     /codon_start=1
                     /product="1-pyrroline-5-carboxylate dehydrogenase,
                     putative"
                     /protein_id="XP_572420.1"
                     /db_xref="GeneID:3259033"
                     /translation="MTSQLATFKVPVIDNEPMRNYPPNSAERAGLQAAVDKMLAASPV
                     EIPCIINGEEVKTGDIQAQPMPHDHSKNICTYHAATPEVVQKAIDGALATRQTWEEMP
                     WADKAAVFLKTADLISGKYRYELMAATMLGQGKNAWQAEIDAAAELCDFLRFSVKYVE
                     ELYQQQPPRNSTGVWNRVEYRPLEGFILAVTPFNFTAIGGNLVGAPVIVGNVCIWKPS
                     PMATYSNYIVHKIFLEAGLPPSVIQFVPGNPPEVVKQCIDHKEFAGLHFTGSTHIFRK
                     LWKDIAQNLDIYRGYPRIVGETGGKNFHLYHPSADIKSGVVQAIRAAFEYSGQKCSAL
                     SRCYVPASLWKNGFKDTLIAETEKIKTGPCTAWENFAGPVIGKPAFDKISGIIEQAKK
                     EGDEVIAGGSYDDSKGYFIKPTVIVTKDPKSLTMTTEIFGPVLTVYVYEDAEFDNMPA
                     LIDSTTEYALTGSVFAKERSVLASASHKLRNSAGNFYINDKSTGAVVGQQPFGGARAS
                     GTNDKSGSMAIFSRFVSMRSIKENFVAPEDYLYPSNFL"
     gene            complement(438867..442064)
                     /locus_tag="CNH02440"
                     /db_xref="GeneID:3259036"
     mRNA            complement(join(438867..439265,439332..439424,
                     439489..439636,439687..439766,439820..440205,
                     440255..440501,440560..440713,440762..441122,
                     441173..441277,441331..441900,441951..442064))
                     /locus_tag="CNH02440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657700.1"
                     /db_xref="GeneID:3259036"
     CDS             complement(join(439007..439265,439332..439424,
                     439489..439636,439687..439766,439820..440205,
                     440255..440501,440560..440713,440762..441122,
                     441173..441277,441331..441900,441951..441992))
                     /locus_tag="CNH02440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513372.1"
                     /db_xref="GeneID:3259036"
                     /translation="MPFCSYQEGLKVASDLGNKAIQTEASLSSLSPVASPIPTLQKAF
                     PIYISAAEAYGHLLSSKLVPQSDIETVKRKWRLVLERAEKVKSRIEQLGGHVAKAEIG
                     DRGEEIAVLRRASLINGVAVELWRPPGDTFDAGEPYREAVQPELAAAQLDMDPEWRDI
                     QADCWLHQAPNEGDWVMRQGPVSDCSVVAAMGVGIKHAGQFGTAFGWENLYPQDAHGR
                     PRRSKNGKHILKLLLNGAWRSVVLDSLLPFSKRDKTPLFTTCHPAPHILPTSVGSPWA
                     PLALKGYFKVHGGYSLRGSNPSSDIYEFMGWIPERIGLKEGFQREKEWKRMKEAWHKG
                     NVMVSLGTGSKVSEGLVKLHAYGVIRLREEGHERILDIFDPGATSFTMSWDQVCAEFE
                     ALHLNWKPSVMPNTATRHWSWPKPPDLPSDADPGMMNTRYRLHVNASSPSSSLSEVWI
                     LLSQHITSRDRPLDDIALHVFEGLGPNNSRNLGAIYSEGLERTNPYTNSNHLLVRYQL
                     RRPTSDLTLIPSRDRGIDQTGFTLNAFAPASISLSLERISRTLPFTQRISGNLTDRSA
                     GGHPGWPTHMTNPQYKVVVRPGEGKSEISGRIILHGEKDVPWNVKLIWGRGQLVYELS
                     EDLIVADTGSYSYGIAYCDIPELQPDTYTLIVSAFEPGQTGLFSLSLEATAPVSIIPI
                     AAEGAGMYNRVVNGFWTERTAGGRPSGGTYESNPRVEMVLSKPATIQSRLYLPTRSPV
                     PINLTIFKRAQGGALGEQLVTTGPYSDSICGVSTGKMKLDSGVYLLVPSSYEKSKGGW
                     VLKIWSDVALSAEIVG"
     gene            442257..445109
                     /locus_tag="CNH02430"
                     /db_xref="GeneID:3259110"
     mRNA            join(442257..442296,442365..442469,442523..442940,
                     442991..443178,443229..443274,443328..443540,
                     443597..444201,444255..444366,444422..445109)
                     /locus_tag="CNH02430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657699.1"
                     /db_xref="GeneID:3259110"
     mRNA            join(442332..442469,442523..442940,442991..443178,
                     443229..443274,443328..443540,443597..444201,
                     444255..444366,444422..445109)
                     /locus_tag="CNH02430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658682.1"
                     /db_xref="GeneID:3259110"
     CDS             join(442365..442469,442523..442940,442991..443178,
                     443229..443274,443328..443540,443597..444201,
                     444255..444366,444422..445056)
                     /locus_tag="CNH02430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513371.1"
                     /db_xref="GeneID:3259110"
                     /translation="MLLKSAIRCRTPSRLAYGFSVSRHLSNVATAKKLWGDSLVFSEE
                     VEAALHARSPIVALESTIITHGMPHPVNLETAQSVESIIRASSAVPATIAIINGKIHV
                     GLSSRQLEGIADVSTGLGKGSVKVSRRDLAPTLALRRTGGTTVAGTMYIANSVGIHVF
                     VTGGIGGVHRGAENSMDISADLIELGRTPMAVVCAGAKSILDIPRTLEVLETQGVCVA
                     TYGGNSEFPAFYHPSSGCESPWSVPDIKSAANLVYASLNLPTPLSALLAVPIPSEHAD
                     AGLTVQKAVEQAARESVEQGIDKRGKEVTPWLLKRVGELTRGTALGLNIKLYENNARI
                     GSQVAVQVSKLFREQKDASSALYIPVSSSESFPKPELKNESPKLALPNTSTQSSLPSP
                     STLVFGSAAVDLTSTSTHSLAPRTTTPGEVFVSPGGVGRNIAEAAQNLLPPNSVQLVS
                     AYGSVSGSSESDTTEPDAFGKLLLFELAGANMRADGLVGKEGRNTAVCSLTLEKDGDL
                     VAGVADMGIVETLTEEFVARKIDEEKPEMVVFDLNLLEGVVKAILTACQTLNVPTFCD
                     PTSTPKLPRLIPALNILLPSSPSFPRPLTHLTPNLLELDLLHSLLSSSASDDTSSITW
                     EFINSLGLDGDWRAKVERFTNVNGREWINVNGVVQKMVSCLPYVASFWVKAGQRGLLH
                     LRMTSVPPQPSPDTLVHPLAGQHHGKYLAFTHYTPPVIKPEEIISTTGAGDTLAGGLV
                     AGLVGGKGEPEEIWVRRALDRVGRSLRNRRAVG"
     CDS             join(442365..442469,442523..442940,442991..443178,
                     443229..443274,443328..443540,443597..444201,
                     444255..444366,444422..445056)
                     /locus_tag="CNH02430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514599.1"
                     /db_xref="GeneID:3259110"
                     /translation="MLLKSAIRCRTPSRLAYGFSVSRHLSNVATAKKLWGDSLVFSEE
                     VEAALHARSPIVALESTIITHGMPHPVNLETAQSVESIIRASSAVPATIAIINGKIHV
                     GLSSRQLEGIADVSTGLGKGSVKVSRRDLAPTLALRRTGGTTVAGTMYIANSVGIHVF
                     VTGGIGGVHRGAENSMDISADLIELGRTPMAVVCAGAKSILDIPRTLEVLETQGVCVA
                     TYGGNSEFPAFYHPSSGCESPWSVPDIKSAANLVYASLNLPTPLSALLAVPIPSEHAD
                     AGLTVQKAVEQAARESVEQGIDKRGKEVTPWLLKRVGELTRGTALGLNIKLYENNARI
                     GSQVAVQVSKLFREQKDASSALYIPVSSSESFPKPELKNESPKLALPNTSTQSSLPSP
                     STLVFGSAAVDLTSTSTHSLAPRTTTPGEVFVSPGGVGRNIAEAAQNLLPPNSVQLVS
                     AYGSVSGSSESDTTEPDAFGKLLLFELAGANMRADGLVGKEGRNTAVCSLTLEKDGDL
                     VAGVADMGIVETLTEEFVARKIDEEKPEMVVFDLNLLEGVVKAILTACQTLNVPTFCD
                     PTSTPKLPRLIPALNILLPSSPSFPRPLTHLTPNLLELDLLHSLLSSSASDDTSSITW
                     EFINSLGLDGDWRAKVERFTNVNGREWINVNGVVQKMVSCLPYVASFWVKAGQRGLLH
                     LRMTSVPPQPSPDTLVHPLAGQHHGKYLAFTHYTPPVIKPEEIISTTGAGDTLAGGLV
                     AGLVGGKGEPEEIWVRRALDRVGRSLRNRRAVG"
     gene            complement(445059..446527)
                     /locus_tag="CNH02420"
                     /db_xref="GeneID:3259228"
     mRNA            complement(join(445059..445198,445259..445418,
                     445466..445799,445854..446054,446118..446237,
                     446303..446527))
                     /locus_tag="CNH02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_572417.2"
                     /db_xref="GeneID:3259228"
     CDS             complement(join(445166..445198,445259..445418,
                     445466..445799,445854..446054,446118..446237,
                     446303..446468))
                     /locus_tag="CNH02420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572417.1"
                     /db_xref="GeneID:3259228"
                     /translation="MPQPPFELHKYLGKALPHLREQYPPGTGGTGPRAQWDGLLTGVQ
                     VIEDFGDQVANFWKTIPDKPVQPHPSFKYPKIAQVHSKLPNPLKTPRDLQTCLSVLPL
                     AACSAALTALDADPADLKTTGPQALDKAGYESDGGEELEVVNQREMKTKGWKFRFSKS
                     PMGSGEFLLMREDSDDVKLVVRTINSSAFTTADWEEYVVSGPYRYETRSKASWYWSRA
                     WGASKRLGCQYYVLTDWQRWTFGYFNQDRTHGWTSPVLHFNEQNPSIGHSLFFWARSA
                     IGKENGYKPQEKDVSGLPEIFPINPSRRISHSGKSTPRGEIRQPKKANESDIEESDAE
                     GDA"
     gene            447313..449632
                     /locus_tag="CNH02410"
                     /db_xref="GeneID:3259025"
     mRNA            join(447313..447954,448010..448334,448393..448897,
                     448955..449632)
                     /locus_tag="CNH02410"
                     /product="expressed protein"
                     /transcript_id="XM_572416.2"
                     /db_xref="GeneID:3259025"
     CDS             join(447766..447954,448010..448334,448393..448897,
                     448955..449375)
                     /locus_tag="CNH02410"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572416.1"
                     /db_xref="GeneID:3259025"
                     /translation="MSVVPKCDETGCTDNAIKVNSRCRFCKLSFCWSHFENETSHPCL
                     TASHPETNRDGFEFEKEPEVSEILRYLDVHAIKHEVESIFPGHICNYVGKPQIWQELP
                     RLCGNYNYHIVLGFADGQRWAMRIRLKQKKYLPPQALTASLESEIATARALEDAGCAV
                     PRTWERPKDSQLSKSLAYFYQEFVPQGDCTIYTLWTEPFNQQTKIFIRNYAKFMIGLE
                     KVHFNQMGSLTLTEDGDVTVGPFIEKRTTIDNPPYFLGPFRTAKEAYLAIIDVRLQQT
                     LNRSRYKPSRELLHYLVLLEVRSLVSNCAELDKGPWYVRHNEDDTNCIRVTSGGAITG
                     IIDWKWATLTSKGGAFAAPFCFPDDKYSEGLNALGVRELALIEAYRDLGRPELADLVR
                     TGRKYHRLFDVLFRECVTLTTLNALRRAFLGLPDGKQGLPQTLKEWIQVAKQNYSTDE
                     HLETMLARSEEFVKNSNQSAMYSEHWGLK"
     gene            449804..450770
                     /locus_tag="CNH02400"
                     /db_xref="GeneID:3259354"
     mRNA            join(449804..450228,450301..450409,450472..450770)
                     /locus_tag="CNH02400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572415.2"
                     /db_xref="GeneID:3259354"
     CDS             join(449955..450228,450301..450409,450472..450679)
                     /locus_tag="CNH02400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572415.1"
                     /db_xref="GeneID:3259354"
                     /translation="MTTHHPRALPIVLITGTPGTGKTLHSQLLVSELSEADSPIPMKH
                     LNIGDIVKEHGFHEGWDEEWKCWIVDEERLLDWMEEVVNPRDGPAETGFVIDHHDPSL
                     FPERWIDLAVVLTCDNGILHDRLTARNYPANKISENITAEIMMTCLNETRESYAEEIV
                     VQLQSEGKDDGEVEENVRRIAQWAENWRQNQQEEES"
     gene            complement(450753..451612)
                     /locus_tag="CNH02390"
                     /db_xref="GeneID:3259226"
     mRNA            complement(join(450753..450853,450910..450959,
                     451085..451234,451324..451395,451454..451506,
                     451556..451612))
                     /locus_tag="CNH02390"
                     /product="nuclear transport factor 2 (ntf-2), putative"
                     /transcript_id="XM_572414.2"
                     /db_xref="GeneID:3259226"
     CDS             complement(join(450841..450853,450910..450959,
                     451085..451234,451324..451395,451454..451506,
                     451556..451592))
                     /locus_tag="CNH02390"
                     /codon_start=1
                     /product="nuclear transport factor 2 (ntf-2), putative"
                     /protein_id="XP_572414.1"
                     /db_xref="GeneID:3259226"
                     /translation="MSDPTSIAQQFTQFYYQQFDSDRNGLASLYRDTSMMTWESTQVQ
                     GSAAITEKLVSLPFQKVQHKVVTIDAQPSSPQVASLIVLVTGQLLVDDGQNPLQFTQV
                     FHLIPEGGSYFVFNDVFRLNYG"
     gene            451978..453705
                     /locus_tag="CNH02380"
                     /db_xref="GeneID:3259238"
     mRNA            join(451978..452259,452331..452367,452426..452513,
                     452579..453705)
                     /locus_tag="CNH02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_572413.2"
                     /db_xref="GeneID:3259238"
     CDS             join(452115..452259,452331..452367,452426..452513,
                     452579..453559)
                     /locus_tag="CNH02380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572413.1"
                     /db_xref="GeneID:3259238"
                     /translation="MFAAAALASLLSTIAANAVPCVQFDSSWNLYAFGGDQDVKIGDN
                     STWSSPSTTPLSTSGRPPWTGNNTQCILSQTNNAMYVIGGDSDDLSSIYVYDFADDSW
                     STQSTSRTPSDLGNSRSSTVLDHDTNVFFTLTTDSGLYQLDLSSITNSASSDSLRWEA
                     VSDPSFSVDGYTATLAQAANHVFFFGVPGTAAGSANLFVVHYAYFQPEAQAFSGTAFP
                     DTVGQAISIPNVDNNVPYSMVFIPDDFSDTYIVTHWTDLSNYSVTSDAPFGLDLINST
                     QTLPAPTSQDSTAAYAASPYAIVQVDAAGGIYYMSNPVQSDYTVSSSASWEKLGYSLT
                     GLNDSASNNSSSSSTASSTSTATGEAAGSASGSASRTSSTDGASASASSTSSSSSGAE
                     KMTASGDILGISMGALALVASILL"
     gene            453875..457425
                     /locus_tag="CNH02375"
                     /db_xref="GeneID:36393006"
     mRNA            join(453875..454171,454228..454438,454492..454601,
                     454671..454715,454771..454971,455032..455523,
                     455581..455938,455990..456168,456219..456333,
                     456383..456389,456438..456561,456609..456721,
                     456805..456935,457009..457425)
                     /locus_tag="CNH02375"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658683.1"
                     /db_xref="GeneID:36393006"
     CDS             join(454083..454171,454228..454438,454492..454601,
                     454671..454715,454771..454971,455032..455523,
                     455581..455938,455990..456168,456219..456333,
                     456383..456389,456438..456561,456609..456721,
                     456805..456935,457009..457116)
                     /locus_tag="CNH02375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514600.1"
                     /db_xref="GeneID:36393006"
                     /translation="MPFCTHSTLPIAGTIISPANLAHQSSLRPSMDMSDSNNHAPISI
                     DNQTGIDDEDTDRFKIKSSTFCKVMRIVAGLAPPVPKSLVKGKDRAPTRRPPVWAESR
                     QELCEALPYYRSFQSGLYMYKKVAYGYLLEAFPAPRDVWADNGRVIISHGGGQCICAK
                     LPDGTQGPPILQTDQSPLNARIETLLQAAERRTPLVLIAGEGYRQLPWKLDCAYVVLG
                     WYWISYTWVEAEPVGKGVLPPRDRDYFHRYKIRFDWVKNQGEPWWDCESDLSLNLGTS
                     PKNTPTTTVPQTPGCANVHEEGPSGLGAAARLIIPVEPLRHVNSGFILNAPDHLSPNN
                     DIMRRDCSSGFEDKLMYYSAEGCGKWPRGDEEMTSCLPTVTDQDEEPSIHLYDTFVCP
                     NCHQKTPMIYKEGQICVKPSCPAFFLLRTAYGLFPIPPGFSLTLNPSFLLLRPTPKSL
                     ENLPYDLVPPTLDESISEGAECKANLGGRALWKGWVCTDCERANCRYKWEVWECRNCG
                     NLFAPLSRNESMPLSGLSFHFPPFMGDAMTMHTGRIMMLSSMKNIAIAYDLPDAGTVY
                     HVISHDRIVADKLFHDYQIEAARGFCFQRRALKANTVKGALLAQHFAVNSGAPYKYNV
                     DTLSVPFDQSPSCVMAALNLISSGTSDVLKADTEFNEILSVIYREGQKMGWHDDGEPG
                     LGPVVASLCLGSPADISFRPKVVNRANGTSNAEVALSFTLSHGDIMIMQGRDIQKKYH
                     HRAMPYGLRIAATARMISDS"
     gene            457571..461160
                     /locus_tag="CNH02370"
                     /db_xref="GeneID:3259302"
     mRNA            join(457571..457853,457918..458162,458215..458920,
                     458970..459190,459245..460558,460609..461160)
                     /locus_tag="CNH02370"
                     /product="calcium-transporting ATPase, putative"
                     /transcript_id="XM_572412.1"
                     /db_xref="GeneID:3259302"
     CDS             join(457733..457853,457918..458162,458215..458920,
                     458970..459190,459245..460558,460609..461022)
                     /locus_tag="CNH02370"
                     /codon_start=1
                     /product="calcium-transporting ATPase, putative"
                     /protein_id="XP_572412.1"
                     /db_xref="GeneID:3259302"
                     /translation="MLSNAWTFTPQDALGYFGTNPDTGLTEEQVKRNREAYGENSLPE
                     SAPNSLFKLILAQFQDQLVLILLGSAVVSFILAIFEDSAEPGGSWMTAFVEPLVILLI
                     LVANAAVGVIQETNAEKAIDALKEYSPDEALVLRNGRLSRVSASSLVPGDIISVHVGD
                     RIPADCRILSFSSSSFRVDQAMLTGESMSVGKTDAAIKDDSAVKQDMTNMLFSGTIVV
                     NGAAKALVVLTGSRTAIGAIHSSISKGDEEEEKTPLKRKLDDFGDQLAKVISVICILV
                     WLVNIRHFNDPSHHGWLKGAIYYLKIAVALAVAAIPEGLAAVITACLALGTKKMAKRG
                     AIVRNLPSVETLGCTNVICSDKTGTLTTNQMSVSRFVTCDDAGFTEYQVGGTTFAPIG
                     AVTRSDGQPLDKSTLITPIIRKLSEICAICNDAKVAYHPESETYSNVGEPTEAALKVL
                     VEKLGSDNDLFNSGLATLDPLARATAVNDYYDSNVKRLLTFEFSRDRKSMSVLSQSSN
                     GTSLLVKGAPESVLERCSNVLLPNGVKAFTPELRKKLEEKQLEYGHKGLRTLALAYVD
                     ESDGDVSHYKTDRSEDYVKFERDMTFVGLIGMLDPPRPEVRDAIAKCKTAGIRTIVIT
                     GDNKNTAETICREIGVFGHDEDLTGKSYTGRELDALSHEEKIAAVQRASLFSRTEPTH
                     KSQLVDLLQGLGLVVAMTGDGVNDAPALKKADIGIAMGTGTDVAKLAADMVLANDNFA
                     TIEKAVEEGRAIYNNTKQFIRYLISSNIGEVVSIFLTVLLGMPEALIPVQLLWVNLIT
                     DGLPATALGFNPPDHQIMKTPPRSGKEPLVGGWLFFRYMVIGTYVGCATVFGYAWWFM
                     FYTGGPQISFYELTHFHQCSSVFSNLDCSMFTGLPAQRATTVSLSILVVIEMFNACNS
                     LSENESLFVLPLWSNPYLVASIILSMALHFMILYVPFFREMFRITALNKEEWIAVIVI
                     SFPVIVIDEVLKFISMRMVKSEKSGKAQLKEKAE"
     gene            463969..466226
                     /locus_tag="CNH02360"
                     /db_xref="GeneID:3259064"
     mRNA            join(463969..464590,464642..464731,464788..466226)
                     /locus_tag="CNH02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_572411.2"
                     /db_xref="GeneID:3259064"
     CDS             join(464294..464590,464642..464731,464788..465894)
                     /locus_tag="CNH02360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572411.1"
                     /db_xref="GeneID:3259064"
                     /translation="MLSSTPSSSQQESIRTPLAQSASLPPSFAMPGQSERPDSEEVKL
                     RRSPDTTPSSPSVSASVSATASSPQSLPDTRGISMKEDGEEKDVDKLLKKVELEKKMH
                     QLQQRLELASVKASNGWTDLSVKEIETKLPSTPFRSRKAHLSVNTRSPKGNNQVSASP
                     AIPYEPPSPSRPWQLIDVLWQPLPPPSHGMYPTSPTSPMKRARTDDHPEAPRPNGGSH
                     AYPVALSSPGGSRTAGLGHRRASSSLSGQTLDKRMMAAGPSSPLRYGFEHKERKKRSQ
                     SQSTHYRDRVPTEQTTSQDVDAAKALTFMLGGGSEDGGSMSRRSSSSLLPAAETSSLP
                     LPDSFANSAPLSPTMSSRRLSQQTTPRPTVARTPNSHARSNLLRNSGVSNDDKRPEED
                     QDAAELMMFLAHSPSPLKSARKSVPAESADLPDKPSFGAAARVLFAEEDKVKPPLHSI
                     LGSSLPSSSHGKSHSRTSSYSHSNLALAPPITPDSKDADNSRVENEI"
     gene            466799..472753
                     /locus_tag="CNH02350"
                     /db_xref="GeneID:3259294"
     mRNA            join(466799..467128,467236..468149,468202..471065,
                     471124..471192,471249..471446,471506..471568,
                     471634..471693,471756..472016,472068..472328,
                     472405..472753)
                     /locus_tag="CNH02350"
                     /product="protein-histidine kinase, putative"
                     /transcript_id="XM_572410.2"
                     /db_xref="GeneID:3259294"
     CDS             join(467075..467128,467236..468149,468202..471065,
                     471124..471192,471249..471446,471506..471568,
                     471634..471693,471756..472016,472068..472328,
                     472405..472505)
                     /locus_tag="CNH02350"
                     /codon_start=1
                     /product="protein-histidine kinase, putative"
                     /protein_id="XP_572410.1"
                     /db_xref="GeneID:3259294"
                     /translation="MILGTDIDLSSIPTAFLEAYPFPAVVIVIDSSLRPRPPLHSRDT
                     DVTVRQTDGQISPLASPPVQQFASAPVAWGNQRWNELTQGKTIAECVDVISQNKLQTW
                     VEGDIGEKSESFTLDMKLPEGVTLHLAKTILPLSPPSASQSFCILTSQYINKPESFTP
                     SISSSDVLFSPLPRFSQTFSRSSSFSSNPRRSIDVPASLPGHRGSATSTSSNLRSSVD
                     LTSPNSEYSPPSREQSTYFTHRFAVREERPSVRRRRSPPNSFKRSKPPESHAQDCWDL
                     VENFDWSKTALGPREQWMDALDPVLAITFESRTADCAWLGPDLELVYNKAYQELIDHP
                     SAFGKPARQVWATNWDYLEPLVKRCLSGTPVYKDNDPLFWRRYGNGRLLEHYHTWRYV
                     PITGKDGSVLGIFNQSIEVTDSVLLERRMGTTRELLEHMSFIRTTEDFFSSIADVFSQ
                     NPTDIPFALCYRVRQVDTDGTFVHLDVSLQSSVGVPEGHPSAPDQIPISFFNGNPYPS
                     NVERSFSPAFSIVSIHSSSSHRVCHVSEDTTQWPIAKALQRRQCVIIEECSQLIEGYP
                     IRRWDELPFSAIVVPICSEGSPEIPDAVVILGLNVRRCFDHEYDSWIHSIRSQLSSAL
                     VTVKAREAEQKMVEENARMEKAKVAWFRGAAHDLRSPLTLVAGPLADVLDSDLSPNQR
                     TSLTVAQRNLDRLVRLVNALMDFSRVEAGRMEGRFVPTNLSQFITQLAALFKPAVERL
                     GLEYVLDVQPREELVFVDPVLFETVVSNLIGNALKYTETGCITVRVKYTDYAEVSVID
                     TGVGIPKNELALVTEWFHRASTAIHSGTQGTGLGLALAKELLKLHKGELLVESQTANE
                     SGGPHGSIFTARVPLDFKPSPSAHIIPSVESPKTFGKYSQVVANEAMRWVGDSDDFSE
                     ACDMSSGTGGSSASNGSGNTTAFGPKFADAFLFDRNDVVLIVEDNADMREYIRQLFTP
                     YCTVVEACNGEQAYSMATQNPPNLILSDVLMSKLSGTELLQKIRSHPDTRIVPMVLIS
                     AIAGDESRVEALLNGADDYLAKPFKPKELIARVHLHMQVGKKRAKLEALYAQRETELT
                     ALSDYCPIGIFRGDKYGHIVYANAAWRAQSGLLVGDPNDWASYVHPESKAQLLEEWNQ
                     WLRGDLKEFRAAWRWSNGIPVRSILVRLDHVKEGFSGLIGCVVDVSHEERRLIEAEER
                     RKEAEESKHQQELLIDLTSHEIRTPVSAILQCSDLVKENLVALKDQLRGAGPKGFVPT
                     PELLADLEQDVEALESIYQCGLVQERIAGDVLSSTSSSAVRKITIQYDVSFVPPADDS
                     CAVPSSGVPDILPAKENTPLWLFVSVTDSGPGMTEQELSVLFQRFAQGNKMIHTKYGG
                     SGLGLFICRKITELLGGRIEVLSQLGHGSVFRFFIKTRAVAPPSAIAALVESSPLKPI
                     SATSPSSSLAMSRSSSRSTNVTTPIEGSGTEHVLIVEDNLINQTVLKRQLIKAGLSCN
                     VASNGLEALNIIRETHRQHRRGGPNRKRLFDVVLMDLEMPVMDGITAVQEIRGSEAAG
                     TLGRNMVIALTGNARQGQIDHALASGFDDVVIKPYILVDLLKKIKFMKVRRLELETAK
                     AQEE"
     gene            473040..474017
                     /locus_tag="CNH02340"
                     /db_xref="GeneID:36393005"
     mRNA            join(473040..473124,473162..473492,473547..473699,
                     473762..474017)
                     /locus_tag="CNH02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657698.1"
                     /db_xref="GeneID:36393005"
     CDS             join(473075..473124,473162..473492,473547..473699,
                     473762..473947)
                     /locus_tag="CNH02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513370.1"
                     /db_xref="GeneID:36393005"
                     /translation="MASPAPQGDQRDLPPPWIRQFDPSYQTYFYVNPTTNPPTTSWTH
                     PGLAEGQVHPEQAQAIHEAGQTGGDNQGEAAKFLNSGSVADPATGSYNQPGEIQGAGG
                     QTPEAGERGLGSMVSGLMGKTNNNNQYGYNQQQYPQQYPQQQQQQSGGSKFGFGTGMV
                     AGGAALLAGKLISNVVGGRHNSSGGGMFGGGGGYSHNMGPPPFMGGGHHGGHGGHHGG
                     GGMFGGGGGGPGGFGGGPGRW"
     gene            474065..476128
                     /locus_tag="CNH02335"
                     /old_locus_tag="CNH02340"
                     /db_xref="GeneID:3259322"
     mRNA            join(474065..474920,475030..475133,475201..475530,
                     475597..476128)
                     /locus_tag="CNH02335"
                     /old_locus_tag="CNH02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_572409.2"
                     /db_xref="GeneID:3259322"
     CDS             join(474184..474920,475030..475133,475201..475530,
                     475597..476060)
                     /locus_tag="CNH02335"
                     /old_locus_tag="CNH02340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572409.2"
                     /db_xref="GeneID:3259322"
                     /translation="MTESAGHSSPPMSPGTQPAAQPPVTLKLKHSMADRANYSSSEEE
                     EEGEEEQLAEDRLSTSPPPKRKKLSSTPTNSSAASKGKQSIKLTLGPQHAHLQQPSSS
                     SSASAGSAANQGKKSYDWLQPSAAGASHSGPPERERERERSALSPGDLPSALSPGDLP
                     IPSVSVASAASGSSTKSLGMSPAEEAIGGLLDESVDDNTSTNDNGDPSTLKKENQSAP
                     KAKRSHHKKKASDAPPGPGRNWKKGMKKAAPGAPGVKLENEGTPASTPAFSAISRETS
                     PDPLGLPSPRLAPDTQSMTITPAPVPLPSASCPPSPPFIPADPTTLGFPVFSHPIVPP
                     KIHLGTFPKVTSFFAPINGGDSGPFPRKEKVRSWTFQEKGIVGVGGGVMKYKSWARGP
                     TSELERALQEEKDAQTPQRQPKAAKGTNATSTPAPQTGADPTASASASSTPAPPNAAN
                     AADITTVNDDRPNVSRADSFDMSMNASPGPPGDDESENGSEIAGPTSTPPAGGKKKMG
                     SAPAKKKGKTPKSKLAQEIVIREDNEGAPVEQAIAE"
     gene            complement(476182..481695)
                     /locus_tag="CNH02330"
                     /db_xref="GeneID:3259215"
     mRNA            complement(join(476182..476770,476849..479798,
                     479862..480144,480195..481126,481184..481277,
                     481326..481618,481655..481695))
                     /locus_tag="CNH02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657697.1"
                     /db_xref="GeneID:3259215"
     CDS             complement(join(476252..476770,476849..479798,
                     479862..480144,480195..481126,481184..481277,
                     481326..481618,481655..481686))
                     /locus_tag="CNH02330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513369.1"
                     /db_xref="GeneID:3259215"
                     /translation="MTLDSLDDGTKLEAAYTHALHSALAFFKALHSSTPSPAWKPVAL
                     PQPAQKHARHTAGLAKLAAADVAVHRRSAKHGDVYRATVDVDCGSDISVDTFRGCLAT
                     PETRPLWDRMVEEAVTLDLLDAHTRVTKTNYRLGWPSSPRDTVTISKTLVDSHTIIDI
                     STSLPRSRHEPSYLRPSPPYVRAHVSLLAWCIQLPSSSSADNIPDGKARISCFWSWNP
                     KGTWAVGGGVPQHLPSLIVGLVDYIRDKSDRVPVLLGYGPDISIGSVSYDTSRVTLGV
                     HYAIVNNGAENAETESLRRQVEFGLSSTQSWDIQITVKTQSGKDTPSTFWTSFVGQAP
                     TVDPNARAPKRLILRFAHSPLEPGEELVRVNMSIEQTTGSTAGVRINGIPITIERMQP
                     TDETGQGPKRPLLEDTASMTGVSLRTISTTVDKQEERNDEREEVVQKGISSLVKRNYI
                     YFTSLLQEPEPKWKPVLDSRGVAIHQLDSIDKTLVVYRAEAVFVGVGIWDLFAVIATP
                     GARPVWDKTHEEASLVEDVNELTDIWHMQSKAAWPVSARDSVMLRTTYKSPSSVHLFG
                     FSIDDTTLFPCIPPSTDPTVIRTQIDLQGWSIESLSPNTTQVTLLEQSDPRGWSGKGS
                     IPQVMLGTLAGIGEFAIKHGGPPVCTRLGGAKSLASRYDVESETFRFEYQPAKARRSA
                     SSSIATSFPSSPPLLMNLKGGGGGESGSDESSLRSVSTEGSKETVECEIRCDADQWSS
                     SFAIVIDPPQQSISALKRHRLSPNGGGLWLTIEHDPALLKSNGKVVITVRRGAPTSSS
                     KTYVTVNGSKIKVDVEDLPEAKVQLLKKQKRARPTRAPLDQPPGLTVRKKSSMDMTTA
                     SATFSSQISSAVSPGLGSASSTFTKVAMPFSKWYNFATETTRSALVPIPTASPLPQVG
                     LSPVEAAVNALRQLTRMHADRDGESTTPEGWLPVSDRDGLKIEKKVVPHVSETFPVFR
                     AGRIIEGFTAEEVSSAASSLKANERFEKPVVLEEYGHGIKTAHVVAHTTFPFRGRSLL
                     VASIVARMADPPPASPSIHGPQTPLSTIFHARTSNFDASITNLDPSKYNPTSLPPGNI
                     ILEGWIFETIDPYSHEQYAIPSTRCMYIASVDYSCSMPLSVNNMLNSSLPRSLLAIEG
                     LLKNEGPPSRARDPDMAVLAPEEKDRVVGKKIIWGLRTVDEARLGVQEINDDSEYSLT
                     VTIHPSAAATPSFSRSETLSPTLKHNDSRTSVNSRSTVIDLGEEIRKGKKDLVVMEVE
                     VGSRAVTNRCIIELTAVSLPVALHSSLSLGSPAGTLIDSTPAVLEGARDAASIGTLPL
                     TLPSLTTDLPFKPTIISLAPSVLQTASLDPSSPARHLLRVTLPTSGYDTPINDPLTGP
                     GTPLPRPRWLLDLINDGAVVQLKLKTSSETESLQTGAGAGTEGEGKDKNDLERASYIY
                     QGEEIAVQDEKRGKHQGLRDATRQNLPQIVSLPLATGNEIDGGGGMKGVRGLNKPLGV
                     RQEFLKEGVKVASVEEKKEEGGDGAEGGKTVEIQPVLSPVPRPALVEQPRYTYNFWRY
                     SRLPRFSTSTPSTAPGSPVKPQSSPPLASAVATQPDGAPVLQTGSSGNGPLSAVKVAE
                     TAQARELTGILRPVTSLPGLIIACIVCFLVGSFLRSLLSDADYVIYQPSSLSGTLPDI
                     QGAGPWRELRRLAEWKIGWDRDLVIAIARRRG"
     gene            481947..483605
                     /locus_tag="CNH02320"
                     /db_xref="GeneID:3259174"
     mRNA            join(481947..482073,482117..482336,482523..482547,
                     482685..482743,482900..483298,483365..483371,
                     483434..483605)
                     /locus_tag="CNH02320"
                     /product="protein secretion-related protein, putative"
                     /transcript_id="XM_572407.2"
                     /db_xref="GeneID:3259174"
     CDS             join(481954..482073,482117..482336,482523..482547,
                     482685..482743,482900..483298,483365..483371,
                     483434..483467)
                     /locus_tag="CNH02320"
                     /codon_start=1
                     /product="protein secretion-related protein, putative"
                     /protein_id="XP_572407.1"
                     /db_xref="GeneID:3259174"
                     /translation="MARLPPLAVLFAALGALAHGDHSFDLSDQADNALSYAERHMHTE
                     HHIDSFDLESFFKLHDLDMNGYWDELEIQAVYGLHHHSLKDKMRKGAQVDARAQNIVS
                     KVLEALDKNQDDHYDEESEYCTIPRPRLKQTSHIPIQKVHHAEIEDEEDARERRFEGL
                     PPTADLTKDHVAADPLDHHEHAPGQGPLDENENPQSRGDGDGDENDFKPGDEVDPPPV
                     RVPKRVDPGAAPQRIVKAGHLEELGGLKQAALEQPGWVGGARPKSAEERLRAGVPYKY
                     KMRKGFRYDEF"
     gene            complement(483614..485965)
                     /locus_tag="CNH02310"
                     /db_xref="GeneID:3259235"
     mRNA            complement(join(483614..483836,483904..484038,
                     484174..485078,485145..485238,485315..485401,
                     485466..485535,485618..485965))
                     /locus_tag="CNH02310"
                     /product="expressed protein"
                     /transcript_id="XM_572405.2"
                     /db_xref="GeneID:3259235"
     mRNA            complement(join(483614..483836,483904..485078,
                     485145..485238,485315..485401,485466..485535,
                     485618..485965))
                     /locus_tag="CNH02310"
                     /product="expressed protein"
                     /transcript_id="XM_572406.2"
                     /db_xref="GeneID:3259235"
     CDS             complement(join(483777..483836,483904..484038,
                     484174..485078,485145..485238,485315..485401,
                     485466..485535,485618..485778))
                     /locus_tag="CNH02310"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572405.1"
                     /db_xref="GeneID:3259235"
                     /translation="MPRYPLINAIGSIVISAITLTSALYLLVLLHRQGKGKLRVRLLV
                     GMVVSDLLLGVVILPPDAMYLAGRKLVTGSAGCNAQGFILIAILFTQHLWTLAIVIST
                     FLLLRHPLSRVTFLLERYSWVITPVIWGVSILHAGLWYHYIGYTNTGNLCYYGTRSAR
                     VGLDRDICQFIPRAFVFLVTIILYSRLFTFLRRPDTIQLSFHSTPKTSIIDVRSAQPA
                     RLPIAKLSKKLGITLSAACPQSPKKEVNPEAPWEAMEFIQVGNVDLLAPDATVTCVND
                     CAAARPPPASHFRALALESGSSSTNTLSAIAPPCKTEDASGTVQLSYDGSALISSSPK
                     IGSSGVDVGVGVEASQTSMTIASAGCTTGFPALVESEKKVVGVKEEGEEPPEEQRQTL
                     KEFFAEHQMSAAELGAVGKNGGGCQQRSATSYFNRQASLLMLYFPFAYMAVFSVSLVR
                     LVYDMAYSGSSNPVLGIISHWMVLSAGVIDGLVYGIAEFMVKRKVRRKMPEHL"
     CDS             complement(join(483777..483836,483904..485078,
                     485145..485238,485315..485401,485466..485535,
                     485618..485778))
                     /locus_tag="CNH02310"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572406.1"
                     /db_xref="GeneID:3259235"
                     /translation="MPRYPLINAIGSIVISAITLTSALYLLVLLHRQGKGKLRVRLLV
                     GMVVSDLLLGVVILPPDAMYLAGRKLVTGSAGCNAQGFILIAILFTQHLWTLAIVIST
                     FLLLRHPLSRVTFLLERYSWVITPVIWGVSILHAGLWYHYIGYTNTGNLCYYGTRSAR
                     VGLDRDICQFIPRAFVFLVTIILYSRLFTFLRRPDTIQLSFHSTPKTSIIDVRSAQPA
                     RLPIAKLSKKLGITLSAACPQSPKKEVNPEAPWEAMEFIQVGNVDLLAPDATVTCVND
                     CAAARPPPASHFRALALESGSSSTNTLSAIAPPCKTEDASGTVQLSYDGSALISSSPK
                     IGSSGVDVGVGVEASQTSMTIASAGCTTGFPALVESEKKVVGVKEEGEEPPEEQRQTL
                     KEFFAEHQMSAAELGAVGKNGGGCQQRSATSYFNRQASLLMLYFPFAVSFFFGFLDFW
                     IFFFFRVPLRIPGGVTRKVLMEGPDADICGGFPQYMAVFSVSLVRLVYDMAYSGSSNP
                     VLGIISHWMVLSAGVIDGLVYGIAEFMVKRKVRRKMPEHL"
     gene            complement(487674..489002)
                     /locus_tag="CNH02300"
                     /db_xref="GeneID:3259011"
     mRNA            complement(join(487674..487884,487925..487984,
                     488048..488366,488416..488580,488623..488707,
                     488759..488770,488830..489002))
                     /locus_tag="CNH02300"
                     /product="arf-related protein (arp), putative"
                     /transcript_id="XM_024657696.1"
                     /db_xref="GeneID:3259011"
     CDS             complement(join(487869..487884,487925..487984,
                     488048..488366,488416..488580,488623..488707,
                     488759..488770,488830..488910))
                     /locus_tag="CNH02300"
                     /codon_start=1
                     /product="arf-related protein (arp), putative"
                     /protein_id="XP_024513368.1"
                     /db_xref="GeneID:3259011"
                     /translation="MYHLVKGLHDYLTRKDEYSVVIIGLDNAGKTTLLERIKTMYNPT
                     PGMAPDKIGPTIGQNIGKISLPSTTLLFYDLGGQRDIRTIWEKYYDECHAVVFVLDAT
                     DQARLSETWEVFDEVLNSPRLLNLPLLLLANKQDSPSCLSVAEIRESFDAWQRARTNR
                     NQDGNKDDLKEPGKGKAPLKEADEPRETDASRTEGQGWDDGGAKEERMASLDVMGVSA
                     LEGTGVSDAINWLYIRVQNARKIEPRE"
     gene            489112..490361
                     /locus_tag="CNH02290"
                     /db_xref="GeneID:3259292"
     mRNA            join(489112..489221,489276..489315,489373..489402,
                     489455..489473,489528..489760,489813..489991,
                     490046..490109,490164..490361)
                     /locus_tag="CNH02290"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_572402.2"
                     /db_xref="GeneID:3259292"
     CDS             join(489159..489221,489276..489315,489373..489402,
                     489455..489473,489528..489760,489813..489991,
                     490046..490109,490164..490270)
                     /locus_tag="CNH02290"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_572402.1"
                     /db_xref="GeneID:3259292"
                     /translation="MAKTYTPEEAEALVHSHDPEHPANLICDLCREFYKLGWVTGTGG
                     GISIRKDDVVYLAPSGVQKERIKPEHIFVLPFAQSSVPKPGSKRDFIRIPSKKGLNES
                     QCTPLFWNAFTMREAGACIHTHSQHAVLLTLLLPRDAPSFRISHQEMIKGVRLGGVGK
                     TLKFFETLEVPIIDNTAFEEDLTEGMAAAMARYPDAPAILVRRHGVYVWGNTWEQAKT
                     QAECLDYLFEIACKMIQNKIPLEGDT"
     gene            491584..493561
                     /locus_tag="CNH02280"
                     /db_xref="GeneID:3259176"
     mRNA            join(491584..491649,491711..491756,491808..491895,
                     491941..492197,492245..492594,492649..493264,
                     493320..493561)
                     /locus_tag="CNH02280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657695.1"
                     /db_xref="GeneID:3259176"
     mRNA            join(491685..491756,491808..491895,491941..492197,
                     492245..492594,492649..493264,493320..493561)
                     /locus_tag="CNH02280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572400.1"
                     /db_xref="GeneID:3259176"
     CDS             join(491747..491756,491808..491895,491941..492197,
                     492245..492594,492649..493264,493320..493351)
                     /locus_tag="CNH02280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513367.1"
                     /db_xref="GeneID:3259176"
                     /translation="MSDSGTLSLLAGIVFLVLWTVVWSICLLGWRTARIRYAHPNIPS
                     RLSKLPVSSAPGVTIIRPLCGLDQNLYNTLESVMKLEYPKFEVIFAVQNEKDEALPVV
                     NMVMEKYPEVEAKVIIDSRKVGVNPKVNNLMTPFQEAKYDMLWILDSTCSVLPGTLGR
                     SVEAFFSNTSSTASPYDPESSPLLSISDDVRKPPVAGEVGLVHQVPIAVCYQKTWGSL
                     IEQAYLNTTHAKMYLAINATSIDSCVVGKSCMYSRDNISHLTTPSPSLRSLPDPPSGL
                     AGFGPFLAEDNMIGLSLWHELKLKHSMTSDVVLDFIGSLSVREYVNRRIRWIRVRKKM
                     TLAATLLEPLTESIISGLYGAWAISRLLGGNILPLFLLHMAAWISVDLSTKRALETNI
                     KGIGPPENKVTFLMAWAARECLALPIWILAMTSSEVVWRGQKYKIIDSGEAIRLDDRN
                     "
     CDS             join(491747..491756,491808..491895,491941..492197,
                     492245..492594,492649..493264,493320..493351)
                     /locus_tag="CNH02280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572400.1"
                     /db_xref="GeneID:3259176"
                     /translation="MSDSGTLSLLAGIVFLVLWTVVWSICLLGWRTARIRYAHPNIPS
                     RLSKLPVSSAPGVTIIRPLCGLDQNLYNTLESVMKLEYPKFEVIFAVQNEKDEALPVV
                     NMVMEKYPEVEAKVIIDSRKVGVNPKVNNLMTPFQEAKYDMLWILDSTCSVLPGTLGR
                     SVEAFFSNTSSTASPYDPESSPLLSISDDVRKPPVAGEVGLVHQVPIAVCYQKTWGSL
                     IEQAYLNTTHAKMYLAINATSIDSCVVGKSCMYSRDNISHLTTPSPSLRSLPDPPSGL
                     AGFGPFLAEDNMIGLSLWHELKLKHSMTSDVVLDFIGSLSVREYVNRRIRWIRVRKKM
                     TLAATLLEPLTESIISGLYGAWAISRLLGGNILPLFLLHMAAWISVDLSTKRALETNI
                     KGIGPPENKVTFLMAWAARECLALPIWILAMTSSEVVWRGQKYKIIDSGEAIRLDDRN
                     "
     gene            493698..495070
                     /locus_tag="CNH02275"
                     /db_xref="GeneID:36393004"
     mRNA            join(493698..494087,494143..495070)
                     /locus_tag="CNH02275"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658685.1"
                     /db_xref="GeneID:36393004"
     CDS             join(493808..494087,494143..494891)
                     /locus_tag="CNH02275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514601.1"
                     /db_xref="GeneID:36393004"
                     /translation="MASAHLRPCQQQGPRLAISIPPQLRLTKSQPHLQLNDRSTLSIE
                     NDPMSPSTCSRFVGLGEDEGIWQERCMILVRERYRRHRDIEKLKKRIDGLEYQQQHFI
                     RMCAKDDIPALKELRTELQTILEEIKVGKVESEAVLRQAAKPPTFSPLKDRREDRPVN
                     RLIRPFSTMFPSTKYQADYLADQLIPPRRTRSMNPGFAQWPPPIAEANEKRIDSWRRR
                     TAEPSNVPGLSSSHGDTQTIFPSFHQPERQLEPRRNEAPLGNQEPAATPLHAASPSRP
                     SSNYIALGHSGSQRVVHIEDVNVFDEDDESEDFPIWSLRRKRHEARGSKLLSKISFPW
                     RRSSYFER"
     gene            495501..500736
                     /locus_tag="CNH02270"
                     /db_xref="GeneID:3259196"
     mRNA            join(495501..495740,495918..496398,496440..497355,
                     497406..499787,499846..500443,500498..500736)
                     /locus_tag="CNH02270"
                     /product="chitin synthase 4, putative"
                     /transcript_id="XM_572399.2"
                     /db_xref="GeneID:3259196"
     CDS             join(496041..496398,496440..497355,497406..499787,
                     499846..500443,500498..500515)
                     /locus_tag="CNH02270"
                     /codon_start=1
                     /product="chitin synthase 4, putative"
                     /protein_id="XP_572399.1"
                     /db_xref="GeneID:3259196"
                     /translation="MSRPHLQQNVSFQDTKPPSRRAARDDIPPRPPAKSDPSKASLTT
                     TTTVQSVAGYNNQLDFDDNAYVDAGSSNPQGFSDYNGVRRKKSMVRPERERIDPNHRL
                     WHYREHAAEDQVDIQPSSTGNQPYNQYNSQRPGANLRRGKSLLARETDDVDDSSGLNI
                     FKRGATIRRKASRATPRQAPTGAQSNRVSAGQKEDEECCCLGNFAPGPKDCWMVYCYL
                     LTICIPGFVIAKVFGKKTPDAQRAWREKMGIVSIVAYLMAAVGFITFGFTQTVCGDTQ
                     LRLPGGSANTGSLVINGYDYDFSTWSHPAAGDTFNGSTSPLYMDQYMAGGMDASFLFQ
                     NVNQHCLGVITPANGTGIDHDGEQMGWYFPCNLHDQNGTSAANLTGYTDRTNCHVSSY
                     ARSNFSAVVPTAEIYYTWERVKDESRNLAVYKSAVIDMNLLQWLDDTQVTFPSFFNTI
                     MNRNDTYAGKDITALIERADLSQYARCLTDIIQVGFVDTITIGCIMSDLVLYVSLVFI
                     LGAVFIKFGMAVVFGWFLSWRMGNFKGESYQERMKRAAEIESWTDDIYRPAPGYLRPN
                     ATGTARTGVKKNFLPTTSRFSRAEPMLVSSSRPSTSYGMVGETRRQGSSIYGNKLGPP
                     LHTTPPGSPLLRNSRSSTSLPFRDDSRHSISDRSVNNNMPCPFPLGNVVPQPAPDFEP
                     FGYPLIHSICLVTAYSESIEGLRTTLDSLATTDYPNSHKLILVICDGMVRGSGSKQYT
                     PEIVLGMMKELVTPAEEVEAHSYVAIADGHKRHNMAKVYAGFYAYDSETVEASKQQRV
                     PMVLVSKVGNPLEVNDAKPGNRGKRDSQIVLMSFLQKVMFDERMTTLEYEFFNAVWRC
                     TGIPPDRYETVLCVDADTKVFPDSLTRMNACMVNDHEIMGLCGETKIANKSETWVTMI
                     QVFEYYISHHNTKAFESVFGGVTCLPGCFSMYRIKAPKGDRGFWVPILANPDICEHYS
                     ENVVDTLHKKNLLLLGEDRYLSTLMLKTFPKRKMVFCPQAVCKTIVPDTFRVLLSQRR
                     RWINSTVHNLCELILVRDLCGTFCFSMQFVVFMDLVGTLVLPAAISFTMYIIIISIIP
                     ESVTGTPRPVISLILLAFILGLPGVLIVITSRKVAYVGWMLIYLLSLPVWNLILPAYS
                     YWHMDDFTWGETRKIAGEVKEEAHGGKEGTFDSSHIVMKKWAEFERERRWRTGTASRD
                     SQYFDVVQRANSPRSGIPSNRYSVVSTSETFNSGLGTAESNHLFRQSQSFASMSQVAP
                     SPETNYGNVSQLALPPARGASIGREQSPSSTESGASNNYGGHGSSEDPSGSSHADPYY
                     QPFTNEVYQDEAEQPILPSEYHPTTSPEPVYQTAPARVRQPSQRGVSLVDTGPVRSAQ
                     AAPHDAVRRVSRHQRRSSSKNQLVSPISSGGHTGNLPPGAAPPQY"
     gene            501001..502223
                     /locus_tag="CNH02265"
                     /db_xref="GeneID:36393003"
     mRNA            join(501001..501112,501221..501453,501514..501615,
                     501674..502223)
                     /locus_tag="CNH02265"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658686.1"
                     /db_xref="GeneID:36393003"
     CDS             join(501100..501112,501221..501453,501514..501615,
                     501674..502084)
                     /locus_tag="CNH02265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514602.1"
                     /db_xref="GeneID:36393003"
                     /translation="MSFQGPLHMFHMAHDGSSARPYTLSASVHHSTLAPASVDDTLSK
                     KEDVEGRRISNGTDEEKTDIVIKKKISRADSKKSIESSFTPQAQNSSVSLVTMNGNMN
                     TPMEIENLPSLVQSTDASTESSVVLKTPPKSARASYGLVEHITIAFSAWQSNGCNHRF
                     DNNQTGQFSEPGSQIFGICQQDSHHEETKMLNGLSEETLKIMARAGKRDLGAGVVQET
                     WIEHIMAKTKLGKGVVGITGKPRFFIGDVDGYAV"
     gene            complement(502194..505651)
                     /locus_tag="CNH02260"
                     /db_xref="GeneID:3259306"
     mRNA            complement(join(502194..502350,502441..502905,
                     503059..503250,503318..503467,503539..503582,
                     503631..504192,504239..504623,504680..504822,
                     504883..505023,505076..505651))
                     /locus_tag="CNH02260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657694.1"
                     /db_xref="GeneID:3259306"
     CDS             complement(join(502312..502350,502441..502905,
                     503059..503250,503318..503467,503539..503582,
                     503631..504192,504239..504623,504680..504822,
                     504883..505023,505076..505558))
                     /locus_tag="CNH02260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513423.1"
                     /db_xref="GeneID:3259306"
                     /translation="MYRPRPRSRSPDRTQRAYSPSRPLSPPPTRYDRYPPRRHDDYPP
                     HPAPDSRRYGDYPPEMPDYPKNQSMGYGEPFYRRRHEEPYPGNRYMDEPGYAPPRRER
                     NEREYDDWGSDGRSYEPRGRDWERGYDRGMAIDREEFPSRRDADPAHEQWERGRDPEL
                     ARYDAPYSAGPASDLGNQSNHGRKGKNPSEPSMDVIFLGLDPELTEDDFLGYLRTEHK
                     AAISGVKIVRDKFTGASKCFGFAQFQSLDGASDFINNNYPTVLMPALYAHSDPRKVKI
                     DFSTPQQNPHSGHGSYQSAPMYVRPGHDGMRDIGSPGGGKRVLLLRGLDSMTTPDEVI
                     RRIGQEIARMVGKQGRESEAESSIVRVVLIVDKSARSSWGYGFVELATSELASALLPF
                     LLSPQHQPTGFLIHDVPVATSFSNPSSFVPVSAGPLGGEFIIRPSRFGGFGSETIDKP
                     EGQWCAYWHEKGGAMESVPRGAPAIGEDGNVELTPAHRAFLGSLAGVPQSQATSSQGP
                     QSVQTTGMTSASVEGVMQPIKIGIGKGKKKEEAAIIPITQKRSLLDDGEEDDKVGKDT
                     VLLSRTKGARIVPPTSSSRKIASNINKWNTKQSELAIPDPVSESAPPKGISDANSAIG
                     TRRPVNAESGSNPAQPIVMPAPSPSVLPTATQAEEFDYTDVSTLATTGKVACLLCQRQ
                     FKSEDILRKHIAQSDLHKNNLQDTAICQAGQRRKDAISSSTTTPEPSASIYRDRAAER
                     REAFNQPAVPSRAEREALAASTAAYQGKRKPPPVKSKQPSSPEPSKQTEENNVGNQLL
                     AKMGWKTGEGLGLAGEGRAEPIKVQQFESRAGLGASKGVEAGRWSGPGGWQQRAKDMT
                     KERYNSESGQK"
     gene            505809..507536
                     /locus_tag="CNH02250"
                     /db_xref="GeneID:3259128"
     mRNA            join(505809..505908,505958..505968,506020..506052,
                     506108..506218,506280..507536)
                     /locus_tag="CNH02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657693.1"
                     /db_xref="GeneID:3259128"
     CDS             join(505884..505908,505958..505968,506020..506052,
                     506108..506218,506280..506369)
                     /locus_tag="CNH02250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513366.1"
                     /db_xref="GeneID:3259128"
                     /translation="MAGGHGHFEPVKLDPAIERWSQMRENVYQHFRFTPQKTRQVFTY
                     ALLLPALVAGISWTYNNKFDWAGKQKGSSLLANTPAKPLPKSDEE"
     gene            complement(506366..509369)
                     /locus_tag="CNH02240"
                     /db_xref="GeneID:3259120"
     mRNA            complement(join(506366..506753,506811..506952,
                     507006..507433,507486..507625,507678..507728,
                     507781..507897,507947..508103,508154..508481,
                     508532..509130,509187..509369))
                     /locus_tag="CNH02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657692.1"
                     /db_xref="GeneID:3259120"
     CDS             complement(join(506487..506753,506811..506952,
                     507006..507433,507486..507625,507678..507728,
                     507781..507897,507947..508103,508154..508481,
                     508532..509130,509187..509318))
                     /locus_tag="CNH02240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513365.1"
                     /db_xref="GeneID:3259120"
                     /translation="MKEGNAFNSAEAGPSRPLYNPHRAWSADEVDTAIQTSYGDVEGK
                     NGLAKGSLPTPHSHSTSRVSPSATLLRKPHLAIDLPLHMSASEIFIPPVPSSHEQSSG
                     DKPSTYSSLPPSPTSEFLSTPKRKTLDRDELEEILDQLGNTSTRSDVDYEVDEGDATD
                     VEEWWPARSRRPTIGEEDRPDQGYRSTSGPMSPNSPVSATAAECDSPEGDEGKESSKE
                     ISGIWELLKDEMGAEDWEGWIADGKWERIANFLAVPLAVEKTTLFGALLCLDGFLYNF
                     TVLPIRSSFALARILSNFFRNRPWRPVPIAHLNSILRMLLLVIPTGVLLASTDASKMY
                     HTVRGQDTIKLYVIFNALEIGDRLCCAFGQDVLDTLFARETLSPSVRKRGKGRKRQQA
                     RPVFFFALSLGYVLTHSLIFFYMLVSLNVAINSYDYTLLSLLISNQFVEIKGSVFKKF
                     EKENLFQIMCADIVERFQLSLMLAVIAIRNMIEMSGSEIAFLPKSFMKGKSLVDSILS
                     PVLFVIMSEMVVDWVKHAFISKFNHVRASVYERFTDVLAKDVLLAGSITSSPSRRHRD
                     GKSRNHRILLDQSPLVARRLGFASIPLACLVLRISWQAIGMLTMSHSHAEESEFGNGG
                     EEGLWGTVWWGLKVASWIGVGICSWGCLMFLKIILGLSLLGFSAMRQEGMDEREAEDS
                     VNDYGRSAVGESKEETEYNRQTREYLSKAADDLPDYPSLSSSISQGGVSLPDTKVSHK
                     HSGAQQGNGESDKDLDKGIPKTDGGKKGKKWKLEEVERWTMVKRIW"
     gene            509555..510325
                     /locus_tag="CNH02230"
                     /db_xref="GeneID:3259069"
     mRNA            join(509555..509653,509740..509833,509907..509984,
                     510051..510325)
                     /locus_tag="CNH02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657691.1"
                     /db_xref="GeneID:3259069"
     CDS             join(509626..509653,509740..509833,509907..509984,
                     510051..510147)
                     /locus_tag="CNH02230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513364.1"
                     /db_xref="GeneID:3259069"
                     /translation="MSAPLKQSNAQNTVPPPAPQPSFLQKKGLLGAAGRGGVKPGSIV
                     SPSDVLSPISAKLNSSKQRHFQKGKPVHLASQLSQLASQASPASKENKPKIDDF"
     gene            complement(510326..511450)
                     /locus_tag="CNH02220"
                     /db_xref="GeneID:3259251"
     mRNA            complement(join(510326..510453,510505..510720,
                     510780..511088,511151..511279,511338..511450))
                     /locus_tag="CNH02220"
                     /product="expressed protein"
                     /transcript_id="XM_572395.2"
                     /db_xref="GeneID:3259251"
     CDS             complement(join(510403..510453,510505..510720,
                     510780..511088,511151..511279,511338..511379))
                     /locus_tag="CNH02220"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572395.1"
                     /db_xref="GeneID:3259251"
                     /translation="MPSQKFTEYLLNKYADDFKAATTHPFLEQAGKGAIDPRPLRAWL
                     KQDYLYAYVGYIKFASSVLSHLHIPTPLSAPSPNTSKAISVLTFSLANVKRETDFFVS
                     TAKAHGLDVFSPEANDGAEGGLLGEYNEITRAYVDFLHAVGGVGAVEEGLVLLWAMEI
                     AYLTAWRNAKSLRPETLTSADPSSLSQTQQALLKFVDNWTCDEFVEFVADCAEIVDGA
                     GIEIGSALAERCETVFKRTLWLEQRFWPSV"
     gene            511607..513073
                     /locus_tag="CNH02210"
                     /db_xref="GeneID:3259091"
     mRNA            join(511607..511885,511942..512160,512211..512472,
                     512526..512673,512726..513073)
                     /locus_tag="CNH02210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572564.2"
                     /db_xref="GeneID:3259091"
     CDS             join(511735..511885,511942..512160,512211..512472,
                     512526..512673,512726..512986)
                     /locus_tag="CNH02210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572564.1"
                     /db_xref="GeneID:3259091"
                     /translation="MSPPSSKQPLTPSLQINRKPLPKWEKVLWRSQPYPDNYVPPDFL
                     SELNDILPRPRPPFYALLLACLPISQHISIIAIFLAIFAALLEERVTPEAVGWGCVLG
                     GISGWAIWTWGWGRWGPKEPQDSLIPTPTPLRTLILPPLLLSLLSPVLGTLTSATTSD
                     SIWPLAGGLGFVHLLLVDFRTGEDVRVVRRRERLRKRRGSVGLKEIGEEKSLTSSLSL
                     TSALSASVVLASRLPSTAHVFSLVLLAVLLFAGWPVITKSVRETGRAYSFVLTVSTTT
                     LALSLFPPTPSTFSGIYFGYLPSTPTLVFLLILFLVNFIGPAMLWYAWRWKVRRGGGW
                     DVATVRIRQSRP"
     gene            complement(513032..513682)
                     /locus_tag="CNH02200"
                     /db_xref="GeneID:3259146"
     mRNA            complement(join(513032..513310,513369..513476,
                     513529..513682))
                     /locus_tag="CNH02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_572394.2"
                     /db_xref="GeneID:3259146"
     CDS             complement(join(513172..513310,513369..513476,
                     513529..513551))
                     /locus_tag="CNH02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572394.1"
                     /db_xref="GeneID:3259146"
                     /translation="MVSLVANSSQVSSPATTLPPRPTSSSPDATAKEVNPLNPNNLKP
                     CCACPETKQARDDCFIKSAPGEGETNCRDFIEAHKACMRGYGFKV"
     gene            513848..514926
                     /locus_tag="CNH02190"
                     /db_xref="GeneID:3259303"
     mRNA            join(513848..514155,514227..514249,514342..514391,
                     514448..514516,514588..514926)
                     /locus_tag="CNH02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657690.1"
                     /db_xref="GeneID:3259303"
     CDS             join(514012..514155,514227..514249,514342..514391,
                     514448..514516,514588..514664)
                     /locus_tag="CNH02190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513363.1"
                     /db_xref="GeneID:3259303"
                     /translation="MPIPLLRPLTGAVRQQARRGYTSVLEKPSQKPTQELPLRLQAIR
                     LYKELHRLGRDYPDPEYDFNKRLRRAFEKNAKVTDPEAMKKQLELGEHIKKEVLALIS
                     LKKFRHLRRAYHPNEGPR"
     gene            complement(514906..523515)
                     /locus_tag="CNH02180"
                     /db_xref="GeneID:3259053"
     mRNA            complement(join(514906..515047,515105..515339,
                     515396..515561,515615..515779,515827..520683,
                     520739..521375,521439..521987,522036..522124,
                     522179..523276,523324..523515))
                     /locus_tag="CNH02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657689.1"
                     /db_xref="GeneID:3259053"
     CDS             complement(join(515005..515047,515105..515339,
                     515396..515561,515615..515779,515827..520683,
                     520739..521375,521439..521987,522036..522124,
                     522179..523276,523324..523458))
                     /locus_tag="CNH02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513362.1"
                     /db_xref="GeneID:3259053"
                     /translation="MEEPPQKRFKYTSYTDQIKNIALDTGNKRGLAWETEQYNEDTEQ
                     TNTPLTAQLDRLSLLDLTVPYQDLQRALLPLTNTLPITLHNLPEIQKIFHEFYAKLDD
                     GQEHIHSGLDSTLYLHQALYETCLSEALAYVPETAKDLLRVGALRALDPKLVERTYST
                     LSLILRTMAFSLLKPNEANRSTLKETWITINPFLSPKSNKRYVRRCVADAWVGVIRKA
                     RSEGLARLMELLMEDNVDGMEAVWAHSLKGSSGQLHSRALTIYTILLDNLVKNPSPQQ
                     TITLGQVSTALVHHASASVVQPVIELVINKLESDTITLPSSTAVLNVLSTFLFTRKGK
                     RFPETTLKPLMQKFLSLVPKLATDAAVNEDMDKGEAEIKEQWRKTLVICIVGSLQAGQ
                     LAQWLSPGVTLIDSLWQKLNDRECFSFVNALIALKWTGIEQFILSHVAKASLPSLNSD
                     PLSTLILLNNLAASGYLSGGLSNVQGGRWRQALISAIVGLLKPLTKSNLDLNERRITG
                     QVLKLLPALPSDADKFAPQVVKILESALDRLDSKGLEVIKTEWEEGGAWNDTHLVGSL
                     LRTADQLIASPKADVSKDAKDLLVGKGWLSKILEKWYWNKEVMESVVPHVERWATNLG
                     LSHDVILEQFMPNLISSDSTLRLSSLQILAAVAPGTALAPDSEENTTSLREIYNLCVQ
                     IESSEMTLRNVRERTTNISRLTRSISALPVPLPTLVLKGIVTYLVAQFKVNFRPVYPE
                     TIAALSTLTEKHKEEVWEIVWTELERTNNSKEAVTPDLDAKYPDWAEERGSNEDRVEK
                     DEEEAEFRCPNLEKSKVVFSRVWGQRSQEEKLDQQEISVQVSHDKLDVLNYESQLLAT
                     LAAIPSVAEKHSRLIIPVVFSVARQGTSDQGDEVQSATHLSTKQLQARTANYLELLTK
                     FANPKAAFRSEELHNLYLDILSKGEPRLQGLALKCLMTYKSPKLTPYEEPLENLLVDS
                     KFRDELARLRLGVDSQDYALAARDSEATGTTRVVVIEPTHRDEALPVIIRLLYGVITS
                     RRGRSSNSQGQGARKQAVLSALNGCSESELGVLVDLMLEPFGSTVEDVGKVPGRQQMG
                     FLSLLTDVIRYLGPQLGSHWSRLVSTTISLVANAQERLTASDIVTEDANEGEEGEGIE
                     AEKGMAPLRNIRSIGLKRLVQFLRSPVTFDVNPYLPTIFKSIVSPRLDKLEVENTQAP
                     SGTLDLIATLAGEPDLAKQLTALDDRTLPKTFACMTAVKVKPAVVLRVFDILESLLPE
                     EDDQEITKEVLLPHIRVLIDNIIGLVGSLKSSQNDDITRRLLGILSRLSTIVEDGTQA
                     QQLATLLAPMLRHKQTPEKAKTNILATLQRLYAISPDFADPSSKFFYQSYDLISSLFQ
                     TLFFSTSRRALVSTLETFIAVDKSLEKSIKLVADLNAYSTRRLEEPDFDRRLSAYEEI
                     NDAEIESLPSDIRAWLPILRTALFFLHEPEELSIRTNASAVLQKFITLIGDSSEGPYV
                     EALQNIILPGLKRALKSKQELVRNEALLAIAHGVKTCEGVPELTEMRPLLAHGDDEAS
                     FFTNIAHIQVHRRTRALRRLRDIIAEPTTVIRESSLTSIFLPLLEHVIAGATDVTDHH
                     LINEAIQTVGGLARELRWGKWYGLIGRYMKLGIGSGKTGQQKYYVRSVAAVIDGFHFE
                     LSEGMDVDKGDEERDEEKGDEEEEDEEVEKKEVEGASPEKITAILLNKLLPSLSRFVS
                     GKDETDSAIRVPLALGIVKIAHALPRGSSDIEVLRVITNVAQILRSKDQDTRDITRET
                     ICKIAIYLGPEWLVRIIKELEIALPRGPQKHVLAVTTHAILVQATTQAADRFINLDDA
                     VELAVQVTAEVIWGESGKDVATEGFKTKMREVRGATSRGFDTLQLLSQLVSPSKIGVV
                     LAPLREVMHASQAVKPMQQVDEALRRVSLGLNANSLLRPQELLSLCYSLISGNSSYLK
                     AKRKMVRPTETPDAFKVVMKRDIKKEDDFYPANAHKFVMFGLDLFVTAFRRGKFDFDD
                     VDILARLGPMVNAVGNTLYSPATNVLLLSLKATAAIARCPVPQVEPALHVFINNIFKI
                     IKHAGGTAESEVAQTALKTLAVILRDCKSSEVSENQLRYLIEVISPDLEEPERQSAIF
                     TILRSIITRKFVVPEIYDLMERVSSIMVTSQSTQVQELCRGSVMAFLLDYPQGKGRLK
                     SQMTFFAQNLQYTYEAGRLSVMEVLFAVFEKFSEGLIEEYAGMFFVALVVVRANDDSE
                     KCRVAAGELLKLLWKRLDEADRAKMAEVIRSWVAKRNENETLAGAAMGVLGLLVETGE
                     NGLEEVISVIEPVLSESAAKLQEAEEEDEIVDLDYTLPHQTLSTTAKLVLATPSSSSA
                     LPWSDIVPHLLFPHDYVRYDTAKLVSNLFANGSEASAVCEMLGDELCLDIVRKGCLVL
                     KGNRGDSGEWIVGSGKLADEIVKVLWNISKHWASLRVESADAGEEEAGDDHDVEEPTR
                     NPLTWLMSRMSFLARHLIVNRPAPNSYQAQEPWSAPIMSILRFFAGITESLNKAQAVG
                     FLLHILSPVYRILDEGGDLGQVEEKQVDDLRALATQIRDFVQEKTGTTAFSRKWEKLR
                     QATQAKRLERREGRVKLAVTNPEKYAERKGKKVERAKEGKKRKNIAFAEGRKTAGAKK
                     RRQ"
     gene            523693..525051
                     /locus_tag="CNH02170"
                     /db_xref="GeneID:3259334"
     mRNA            join(523693..523933,523988..525051)
                     /locus_tag="CNH02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_572391.2"
                     /db_xref="GeneID:3259334"
     CDS             join(523723..523933,523988..524628)
                     /locus_tag="CNH02170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572391.2"
                     /db_xref="GeneID:3259334"
                     /translation="MQDKPLSAQRITEERAFIKRYTESLADYTVQYPADFSAPLHERP
                     RKVPAIAIPVADPPSADAMDVDSPSKDTVISLTVKSLKPSLTIPVTAQLTDTVSDLKT
                     IISKSSASAPAPDAQRLLLKGKALTDTKLLKEYALESGATVHLIIKAPSATPSSAPTP
                     SISTSDATIPPPSSVAPHPPALTITTSVDESSEAGTSMPLTLADQVAPPLGPQPEVSS
                     ATFHHTISDPTFWQKIHALCVSEFDNEQEANSAWETFLVSMKGGLSAGEAAKIRDVVG
                     VWGMGGQ"
     gene            complement(524603..525599)
                     /locus_tag="CNH02165"
                     /db_xref="GeneID:36393002"
     mRNA            complement(join(524603..525038,525110..525198,
                     525261..525599))
                     /locus_tag="CNH02165"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658687.1"
                     /db_xref="GeneID:36393002"
     CDS             complement(join(524730..525038,525110..525198,
                     525261..525495))
                     /locus_tag="CNH02165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514603.1"
                     /db_xref="GeneID:36393002"
                     /translation="MGAQSSKSIRKLPKSSLPKATPETRFPPPPHQAPPPPVEEIEDE
                     PSGPIDYGRITEDVKRQEKGQKQGAVEFSGEKDDAIRKDAMDPQFMQNLLKLGPVEIH
                     DAGKFRPAAAQRTLQSRKDEFTSSSQIAPPGHLTFPFLASLLDGLKTLPPGSDPAPLY
                     KQYGVDKEKIEELRKWVNSVSVEEEDIVRVEEGNEIREMKAVWIGGVKKP"
     gene            525706..527182
                     /locus_tag="CNH02160"
                     /db_xref="GeneID:3259035"
     mRNA            join(525706..525933,526013..526117,526179..526245,
                     526327..526433,526490..526550,526607..526643,
                     526699..526741,526790..526858,526917..526972,
                     527023..527182)
                     /locus_tag="CNH02160"
                     /product="expressed protein"
                     /transcript_id="XM_024657688.1"
                     /db_xref="GeneID:3259035"
     CDS             join(525811..525933,526013..526117,526179..526245,
                     526327..526433,526490..526550,526607..526643,
                     526699..526741,526790..526858,526917..526972,
                     527023..527098)
                     /locus_tag="CNH02160"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513361.1"
                     /db_xref="GeneID:3259035"
                     /translation="MATYNPVGPNALSLPIFKKLANRRVVLASASPRRKEIFANAGFF
                     PEIVPSTFAEDLPHSRFEGHLADYPIATGAEKAMEVYERLVKQDAENPPDLVISADTV
                     VVFPPEKDTAEGGPAHGEVSEILEKPINKDEQARSLAHMSGRKCEVITGISIVYPTVE
                     YPGFKVHSISCSTLVKFYDNTPQTIQAYVDSKEGIDRAGGFAIQGLGGILIEGIEGNY
                     DNCVGFPSAPFWRWMSELDADGVFDEAWE"
     gene            complement(527092..528702)
                     /locus_tag="CNH02150"
                     /db_xref="GeneID:3259241"
     mRNA            complement(join(527092..527454,527509..527857,
                     527912..528010,528064..528298,528375..528702))
                     /locus_tag="CNH02150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572389.2"
                     /db_xref="GeneID:3259241"
     CDS             complement(join(527155..527454,527509..527857,
                     527912..528010,528064..528298,528375..528549))
                     /locus_tag="CNH02150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572389.1"
                     /db_xref="GeneID:3259241"
                     /translation="MPARQTIVIVSVVSLLLLYLFVHHTTSSHKPSVPNVPSRGAGEA
                     AYRQRLVAVGDLHGDIDNAKKTLQMARIIDDDSKWVASTDILVQTGDIVDRGAYADDI
                     YRLMQSLRGQAASQGGKVVSILGNHEVMNAIGDWRYVTKGDIARFGGTKSRQHALSAE
                     GWLGQEWLANYSTTALVPISPYPSSPTFSFTHGSLRPSYANLTPYPAAINDLGHSLLT
                     KALTPPMAPPYPPNPYSGLPKGTTHEEADLYAEGGPLWWRGLAEREEAQVCEWAKNLK
                     QKIGARRIIGGHTPNFEKIVARCNASVIIIDTGISSAYGGVLSALEIVYTLTPVDRRG
                     RDHSQDPLLLSTSSESIAGLKGRFVEREEVHAIYEHSRKWLALEEREVVLD"
     gene            528792..529954
                     /locus_tag="CNH02140"
                     /db_xref="GeneID:3259314"
     mRNA            join(528792..529262,529323..529647,529707..529954)
                     /locus_tag="CNH02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657687.1"
                     /db_xref="GeneID:3259314"
     CDS             join(528889..529262,529323..529647,529707..529874)
                     /locus_tag="CNH02140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513360.1"
                     /db_xref="GeneID:3259314"
                     /translation="MSTLATAILSSDESDAEFIPEAPKVKRSRKPRAKRVGSGSATDS
                     SSCSSGSGSEDEDAEGDKRAAKKAKLEEDAKNEAEERRRKAREEFERMKAELSGTPAE
                     SVKETEEMVEIKRPRRFAGETIYETVRLRASDPEAVAYLKSLAAKPDLDEDRPDLAAK
                     QPLSRQETPNPPPASLGLDKSTAAVNADVPASTSVAALSVTARPKGPPRRKRQTLEQM
                     SAALDKGKKMTTLEKSQMDWKSHTSSSASMADELAANRRNGGYLEKKDFLDRVGERRA
                     GAFSEQGSTRRK"
     gene            complement(529924..532916)
                     /locus_tag="CNH02130"
                     /db_xref="GeneID:3259273"
     mRNA            complement(join(529924..532295,532366..532516,
                     532584..532916))
                     /locus_tag="CNH02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657686.1"
                     /db_xref="GeneID:3259273"
     CDS             complement(530139..532289)
                     /locus_tag="CNH02130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513359.1"
                     /db_xref="GeneID:3259273"
                     /translation="MTAPHTPTPIQRYPPSLSQSPSGPSRPPRTYPIPSIDSSVASPP
                     IPSAPLNEYTSLQELLQRAGYKETRVYTPEAEKVRKHIKKTLDDNEEEVSALYGTYGF
                     DRTRGPGIHHAHQNVTEPIMPMKRSASILRSLALQAAARSKAAVKEEAPEHSWWTTWG
                     KTQKISSPEGPTKVGLGLAKNGEGVRKVQSAWDIERGRWRRAETDSLPQEERPPLPQM
                     RQTSTPHEMTAATGYTTTKTTTCPMDRDIFSSPPPPQALSDDAFGYCPLPDDYEAQCD
                     EDEALYDMGVNDYDVYSIGSYSASDSAHSMHSRTPSDDRAEREIRDFENEVDDGLLDE
                     VNDVGKRLLASAVEYDEDLECDSPPMRTWVLPQVDTSRPHEAPKIPLPSPPIEVAPRE
                     EKGDKIPEPAKPLKYGDRATKLRLAHSTPNLKKPDAQNPSLPAGWLGSIRSALLGSTQ
                     SPSPTPATSSWNPSMPIKVTAPTPAQPRLVTAGPVICDSASGDAEDLPPIPPPKAKQS
                     SGPISILRLRPSIAKLRDVVLGQYAEADRDDPLVLSPRMDWKQQGEQFAGWSPIRKKG
                     DGGEGESLYSVRSGGVDFSKSFFYKPGTPPKVKASGSCETPKASNTVSRGLKKQRSIK
                     SLQAALLLPVASSPIPPVPPIPSHLSTPKRIPVLAIQSPQAAQPRELVLDGDEFNPQS
                     APGSGKRGRANTKKGNGVRRRKSKKKGVLKEDSP"
     gene            complement(533128..534821)
                     /locus_tag="CNH02120"
                     /db_xref="GeneID:3259253"
     mRNA            complement(join(533128..533498,533549..533935,
                     533982..534224,534277..534434,534496..534573,
                     534630..534821))
                     /locus_tag="CNH02120"
                     /product="peroxisome assembly protein per8 (peroxin-10),
                     putative"
                     /transcript_id="XM_572386.1"
                     /db_xref="GeneID:3259253"
     CDS             complement(join(533433..533498,533549..533935,
                     533982..534224,534277..534434,534496..534573,
                     534630..534732))
                     /locus_tag="CNH02120"
                     /codon_start=1
                     /product="peroxisome assembly protein per8 (peroxin-10),
                     putative"
                     /protein_id="XP_572386.1"
                     /db_xref="GeneID:3259253"
                     /translation="MDAPVASSSSHHPQAPLPAPYADLSFEPASQAQILRSHQRDTAQ
                     IHRLTELASEITRSLAGTRWLAQKQMIIDLLVKAIYLSLTLGRGSQTLGEEYTDILPY
                     SPGRKPPPSKTRRFFTIMFLLFPTILVSPASTSYIRTGGLSQPSSRWRIAREKLGDFL
                     SSPLGRAIPELHMIAFLFRGRFFELARRLTGMSYISALPPSPPEQRPASYEPLGLLLL
                     IPFIHRLLLPLLNSQAELPESANHETWIADTIHDGKPTERASIVGANTFYDSPNTYLT
                     QEALELPERQCTLCLEPRGTGEGSGGTVAVTECGHVFCWGCLGGLEKLECPLCRQSLR
                     MERLIAAYNL"
     gene            534993..536914
                     /locus_tag="CNH02110"
                     /db_xref="GeneID:3259049"
     mRNA            join(534993..535196,535249..535311,535369..535526,
                     535580..535840,535889..536914)
                     /locus_tag="CNH02110"
                     /product="histone deacetylation-related protein, putative"
                     /transcript_id="XM_572385.2"
                     /db_xref="GeneID:3259049"
     CDS             join(535101..535196,535249..535311,535369..535526,
                     535580..535840,535889..536738)
                     /locus_tag="CNH02110"
                     /codon_start=1
                     /product="histone deacetylation-related protein, putative"
                     /protein_id="XP_572385.1"
                     /db_xref="GeneID:3259049"
                     /translation="MTLTDYPTFSSSPFFYDPRNPVLPEAEQGHIRAHSNPSVAYYHP
                     KNVGNYHYGERHPMRPHRLELTNQLVLSYGLHEKMSYHAPRAATEEELLEFHEADYVD
                     FLKRVTPKNAQALTKDWTKFNVGDDCPIFYDLFSFCKQYAGGSLAAARKLSSGSADIA
                     INWSGGLHHAKKGEASGFCYINDIVLGILELLRYHPRVLYIDIDIHHGDGVQEAFYLS
                     NRVLTVSFHKYAADFFPNTGNLSEIGSDLGKYFCLNVPLQDGIDDESYISLFKAVMEP
                     TITIFKPSAIVLQCGADSLGCDRLGTFNLSIAAHGECVRFIKSFGLPLLALGGGGYRQ
                     SSVSRCWTYETGVLAGVQLSNELPQNNYYEFFAPDYKLHPPLTGKIQNLNTAKSLERI
                     RISIREKLRYLGGAPSVQMQEIPPDLQGLLEEDEKSAAEKMDEKEEERREGKGKEIDW
                     LDREVGGSGDGVGSGRYFGGARRRF"
     gene            complement(536928..539453)
                     /locus_tag="CNH02100"
                     /db_xref="GeneID:3259112"
     mRNA            complement(join(536928..537416,537474..537600,
                     537647..538007,538065..539453))
                     /locus_tag="CNH02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_572384.2"
                     /db_xref="GeneID:3259112"
     CDS             complement(join(537090..537416,537474..537600,
                     537647..538007,538065..539361))
                     /locus_tag="CNH02100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572384.1"
                     /db_xref="GeneID:3259112"
                     /translation="MALSPLPSSTELVFYSQKRRRRRICSTATGCPSTPYATRVASDP
                     YKRVGMRLSSFCCILITLLSHLLLVTAAPPCVRFADYDSINQMFIDGGPGTKVLLCPN
                     RLYRLSGPIIFTAADQEIATYGYPTGSERAVLRVESRNTATAIQGDCRRCARVSIKNL
                     VVDGNRKKLGRMRDFELATGLVVLGGNEGQSIQNSWIKNPRGFTAIHIREGDKLQCTG
                     ARIEKNEIGPVGEEYDRERDGDDPEMSPLGRPLADGISIACRDSFIRDNTFRDNTDAA
                     IVVYCSPGTLIHANHIFAQSLSAMAGILMVDSTPFDGDYTGTVVKSNIIDAVSRTIRV
                     GIGIGATVWSDDTETILTGGSVVGNGLKGRYMGYGIAAAGLKQWTIKDNWDEAKHEGR
                     KSARCFDEPVNPDPIGLLYNQPTMQDCTVQSEFADHDFQYLVCIDGLYDKSNPPKHDL
                     LPPPHDVSPTNAQEEDNTVQQDGGGSEPIKQPREVGDIEAEPPVEKMFSTGSEMMDDV
                     LEHSHQRMHEAIDHLSRRIDILGAASAGKGSGDSKISDVLDPALSSHLEKLQRKIEHL
                     EFSLRSQIETAIQLRSAIQGWDQEMALVTDWEYDILLDVRHKLELSSYPHDQPLDPKL
                     MRGQSYLDNEAVLVDDHSHPSLEGENLRAMSNRARLNANEETETRASVLQIGLIGGSV
                     IALAWVGLRWWRKRKVHGKLL"
     gene            539831..541463
                     /locus_tag="CNH02090"
                     /db_xref="GeneID:3259194"
     mRNA            join(539831..539934,540011..540148,540198..540299,
                     540359..540460,540514..540590,540644..540729,
                     540787..540917,540977..541463)
                     /locus_tag="CNH02090"
                     /product="retinal short-chain dehydrogenase/reductase,
                     putative"
                     /transcript_id="XM_024657685.1"
                     /db_xref="GeneID:3259194"
     CDS             join(539913..539934,540011..540148,540198..540299,
                     540359..540460,540514..540590,540644..540729,
                     540787..540917,540977..541428)
                     /locus_tag="CNH02090"
                     /codon_start=1
                     /product="retinal short-chain dehydrogenase/reductase,
                     putative"
                     /protein_id="XP_024513358.1"
                     /db_xref="GeneID:3259194"
                     /translation="MALTLDIVVCCLRKTIFSPYLAISIPVVLHLHSISSRLVLIVSY
                     FWGVVICFIRLLCYADWRYANQAPWFHAPPKLQWEDQVVLITGGGSGIGALLAQTLAN
                     RNVAVAILTKDLPKQPFSHSHIHVFACDVSDYNAVMGVSARVREAVGDPTIIINNAGI
                     VSGKLLLDLTEEDITSTFGSNTLAHFWVLKAFLPAMLRRGRGHIVTMSSILGIVGAAQ
                     MTDYCASKAAVLSLHQTLRFELDSRYQTPGIRTTLVLPAYTLTSLFNRVKLPTNRLFD
                     FLCPPVQPRAVVEHIISALDDNESRIIRLPFYSNFARLCGDAVGLVPAGVRDFVQWLS
                     GADYAMKGYGPTPDAGERLLAERQSHTPLNRKRTE"
     gene            complement(541429..544921)
                     /locus_tag="CNH02080"
                     /db_xref="GeneID:3259039"
     mRNA            complement(join(541429..542527,542578..542737,
                     542789..544921))
                     /locus_tag="CNH02080"
                     /product="expressed protein"
                     /transcript_id="XM_024657684.1"
                     /db_xref="GeneID:3259039"
     CDS             complement(join(541477..542527,542578..542737,
                     542789..544805))
                     /locus_tag="CNH02080"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513357.1"
                     /db_xref="GeneID:3259039"
                     /translation="MTEEGLLETLPIPFTSASFIQALITLSDSEAISLCFKLLISGKV
                     DDASLAKDVIGQGLEKGLVYFADVLASPEEVTEEELEKVVGAREETLRAYLGLEEMRR
                     RLDTWEIISPKQVAATEAKVEALDALMIDKDERQPLPQDDTELGDPWGEYGDPKEEDS
                     KGSTLLDDPWSQDSSVPASGSTSQAVITPAAPSTTAFESADPLPITMSGFLSQPVLVS
                     ALTLASTSSLQALRLLCQHNHGELYPYRFDLLEAVPGWVSPSDLEAVELLPAVDSDDN
                     ERWIRPVVASSIVTHQAFPQIINDVYLPPSISTIPPTILLQPRQHAVSPSDLTKWYTT
                     HVLSLDEVGILDIQLAWVQHGASLGVPSLDSLGEDLSLLSRLVYDANLTQDQHAKWTL
                     GNWMLAKESDIIAAYLSNSTPESIVDDVRRLVMPYLYVLESRAERAGIASSSLVSDSL
                     NSTILSLPLRLALPLFEASKATLPLSERVIRNDLDVARLALACLYGSQERGGAVWSTM
                     SSIFECLPVWELTGEDAEDEELTSTTLDSISNFLRPTSASTPPPSKSDILLFFHPLPF
                     ASLSRALDILDVQLESGEILARWGVEKRLGELLGMAGDQKAQVELAERLARQSGASVG
                     KSGDDRWRKLWNDMERLSSGEGLLKGALGTLTLQTRGRIYFDGILRSGDFEIAKKMLK
                     MLQGDGAIDDAAVEEVVLKVSKDFYVSADSCNIYTGNMKLAYDSLSVAPSTPATVAER
                     QYIEATSRLSSFSTFTLSPSEIRRNVNPISLLSTVLSDSSSDAYRLPDLMLDLAEKLG
                     CRSETDRGLVWGMVGRAAIAKEDWAMASKAVENMVQMVKKSQSSQTAVKQEQQGNHVT
                     EPGNALRSETWALAHALSSQSEFSDISAKLKFVSSAMELCPASELPSIIETFRQIEKG
                     RIRLDEAARRRRMKGIASPELPSEPSIGVSSVAAVQERVLGSRTAAKAAKLALDIGGR
                     LTAHRQLPSPALLSSATFSSPFAGQELSRPLSRNSAAGSEVGSDGGYKVGGSLSSGSA
                     GARDLFEHLGRDEAERVRKGARRALVRGVGWLLGADESEIAGVEQ"
     gene            546031..551464
                     /locus_tag="CNH02070"
                     /db_xref="GeneID:3259341"
     mRNA            join(546031..546242,546463..547201,547264..547348,
                     547394..549398,549453..549611,549666..550563,
                     550617..550849,550902..551039,551095..551464)
                     /locus_tag="CNH02070"
                     /product="protein kinase SNF, putative"
                     /transcript_id="XM_572381.2"
                     /db_xref="GeneID:3259341"
     CDS             join(546506..547201,547264..547348,547394..549398,
                     549453..549611,549666..550563,550617..550849,
                     550902..551039,551095..551119)
                     /locus_tag="CNH02070"
                     /codon_start=1
                     /product="protein kinase SNF, putative"
                     /protein_id="XP_572381.1"
                     /db_xref="GeneID:3259341"
                     /translation="MHQQRAPAAHHHSYSYAPYPHASVSAENTVPSMAQPQVYYQQPP
                     ADFYPHVPGHNPHTGASHGTQAGPSQSAENNAFAMPDVRQSKSARPRPPPSSVTMPMI
                     PTSLPDPSMHSYAPVQAPVPQQQTRTANRRSHNPAATLNSPSAPRPEELTDEYVLHPS
                     VYAFKQEYPRRAMVGLGPYIVLQTLGEGEFGKVKLGVHADYGVEVAIKLIRRGDLQEE
                     AHASKVEREINVLKTLKHPNIVRMFDVLDTHKYIGIVLEFAGGGELFEYILANEYLKD
                     KEGQRIFAQLISGVDYLHKKGVIHRDLKLENLLLDKNRNLIITDFGFANQFDLSKGDL
                     MSTSCGSPCYAAPELVVLDTPYHGSAVDIWSCGVILYAMLAGYLPYDDDPDNPDAGNV
                     VELYRYIMNTELHYPDHVSPLGKNLLQHMLILHPEHRIKIPVIVKHPWLKSYHDMFNK
                     SVEECEAAFQDAMYRKSRQARKELQERRRVQTQARESLQTKERAHVQRSQSSAPGTII
                     NAAALDQIRRRPHSAMPGSTPLPEIIAKHSESVDDVALTMRSATPPTALSQPTEIRSP
                     TTESPRPRSESMAPRLSFTTSVSTPTAMTVETPSSVPVQSPTDALPPAAMTVMQPSVE
                     AAPPMRDHKNRNTIQVEHAGEGLHDRAKEAFDANHGRADGSMETTSTADTGMVASSLL
                     DVKREESTDIEMESGSSDSEQPKPANDGISQQPGEKSMDIPPIVPITIPLAPPAESGT
                     ATAANDSSQVLEPQEKLSPALVEHGSASIDEMASPSTPRVSTSVEQEPVNITPRAKMR
                     APPVATTPKASLVNERKRHGSMPPPMGPSFVSDSRPESSLTATGLPKLPKKDRYRKGM
                     SLDKFGLAKLLGHASQAHTTVHGEGKMAPPSASSSALALQHQLQQHGGQSQAVSESDS
                     VKKSRRRTLQFGFHSRKDSKASSAAVATPGTPLMDKDTNGENRLSSITGGTASLRDKR
                     RKTVQIGLSTQSEQKDTTVNVPGLSSSGHLVKNPATEPPQGISIGPVVGTDASALSQS
                     SPSAVALEAFAAQQGHYPSYRGSSSRASKVMDWFRRKTFVKETLPEPKSPVIKSDSQS
                     SFVRIGEVASPASKTQESAQASTVSQENTDKAEEKIDSTADQENAAKTTPTKSPVLPQ
                     PIGATATTPSVMITPPRPTAATTPTIGSSTQQSPPTTIRTRSASTFTFDESKIRVHTG
                     LVDQSALSTKPPQDVFVEVIQVLRGMGVEMKRESDFKLRCTRAKKKAAGTSIGLGSVV
                     STGSGMSPFSIMNNASASKTDSRGLPRPTSPSAVANRSSAGIKGLLRRGSSRSSAHPA
                     RLTRTGDEVPNPPSQSTPNLELPESSMASKPEPLYGKELMDAGDEVKFTVELCKMKNL
                     PGLFILKIKRTKGNLWSFKFIYQTVIERTTTLTH"
     gene            complement(553516..555504)
                     /locus_tag="CNH02060"
                     /db_xref="GeneID:3258985"
     mRNA            complement(join(553516..554380,554438..554558,
                     554605..554742,554799..555113,555169..555504))
                     /locus_tag="CNH02060"
                     /product="mitochondrial outer membrane protein, putative"
                     /transcript_id="XM_572380.2"
                     /db_xref="GeneID:3258985"
     CDS             complement(join(553692..554380,554438..554558,
                     554605..554742,554799..555113,555169..555333))
                     /locus_tag="CNH02060"
                     /codon_start=1
                     /product="mitochondrial outer membrane protein, putative"
                     /protein_id="XP_572380.1"
                     /db_xref="GeneID:3258985"
                     /translation="MSETFSPNLTFTEGFVLGQASFLIILLLFIRYVVFSPSEQIDHE
                     GWRKRRAERADLLSNHTPPPLSNLLSKTSYDMSIHPAESSDWVNVLLAQILQGYRNDL
                     LSEGGEEGARQRIEGWLNPKGENLSWLDPIDVTSLSLGTSYPLLSNARIRPADGQGRL
                     RAEIDVDYLDSLSMTLSTAVLVNFPKPRFAVLPVTLGVELVSIGGTMSVQLHEPIEDR
                     QHIHVNLLPDFHLNLKVTSLLGSRAKLQDIPKLEQLIVSRLRNLVQDRFVHPNHISLA
                     LPRILSPSVSSTPILEGLGEGAVDAMKDAVSDGMKRMVEDFMGENPVEGALNGQGEEQ
                     WLDDDFPPTPLVQPPGTFPTLSVSSRQSHRQSLPPSRPQSTTQGQPQLFYRRPLIHPT
                     QSYPHYNTYTLDPQIPHSVSYRHPPRGSHVHNPPETPVPQRPSHGQGRMSTTSSLTPS
                     QSQSQFRFRGQFASGVTPGQVGTSR"
     gene            complement(555626..556584)
                     /locus_tag="CNH02050"
                     /db_xref="GeneID:3259057"
     mRNA            complement(join(555626..555814,555870..556052,
                     556105..556165,556551..556584))
                     /locus_tag="CNH02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657683.1"
                     /db_xref="GeneID:3259057"
     CDS             complement(join(555771..555814,555870..556052,
                     556105..556165,556551..556553))
                     /locus_tag="CNH02050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513356.1"
                     /db_xref="GeneID:3259057"
                     /translation="MPQQVRDIKKFLEIARRKDATLARIKKTAIKPAHTTTASSKSKA
                     AKTPTHVTKFKVRCSKYLYTLVLDDAEKAEKLKQSLPPGLKVEEVGAKPAKK"
     gene            556812..558196
                     /locus_tag="CNH02040"
                     /db_xref="GeneID:3259208"
     mRNA            join(556812..556835,557144..557177,557228..557299,
                     557352..557452,557507..558196)
                     /locus_tag="CNH02040"
                     /product="ribosomal protein L4, putative"
                     /transcript_id="XM_572378.1"
                     /db_xref="GeneID:3259208"
     CDS             join(556833..556835,557144..557177,557228..557299,
                     557352..557452,557507..558097)
                     /locus_tag="CNH02040"
                     /codon_start=1
                     /product="ribosomal protein L4, putative"
                     /protein_id="XP_572378.1"
                     /db_xref="GeneID:3259208"
                     /translation="MAPKGKKPAAAPFGTKKAGKKVQNPLFEKRSKTFGIGGDLPPKR
                     DLTRFVKWPEYVRLQRQKVILNQRLKVPPAIAQFSNTLDKNTATQLFQLLNKYKPEST
                     QEKKARLLAEAEKREKEGDKATTADTKKPIFAKYGLNHVVALVEAKKAQLVVIADDVD
                     PIELVVFLPALCRKMGVPYVIVKGKARLGLVTGKKTAATVAITEVRSEDQQALATLVS
                     AAKANFLEKYEDHRRHWGGGVRGNKSINKLKKRAKALGQDAKKIDLSL"
     gene            558374..559329
                     /locus_tag="CNH02030"
                     /db_xref="GeneID:3259061"
     mRNA            join(558374..558667,558786..558822,558883..558977,
                     559058..559119,559170..559329)
                     /locus_tag="CNH02030"
                     /product="cytochrome b5, putative"
                     /transcript_id="XM_572377.2"
                     /db_xref="GeneID:3259061"
     CDS             join(558455..558667,558786..558822,558883..558977,
                     559058..559119,559170..559239)
                     /locus_tag="CNH02030"
                     /codon_start=1
                     /product="cytochrome b5, putative"
                     /protein_id="XP_572377.1"
                     /db_xref="GeneID:3259061"
                     /translation="MAAPAPPVAADPARTADPSAYSGPDVGAESGSKQEEKLLYTFET
                     LAQHNTREELWMLLHDKVYDVTAFMDEHPGGDEVLLEEAGRDATEAFEDVGHSDEARE
                     MLTKMYLGEFQGEKKGKAKKGSSSTGTSSSSSSGFPTWTIPLALFVAFLAWRLLLA"
     gene            complement(559313..560748)
                     /locus_tag="CNH02020"
                     /db_xref="GeneID:3259139"
     mRNA            complement(join(559313..560427,560483..560618,
                     560671..560748))
                     /locus_tag="CNH02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_572376.2"
                     /db_xref="GeneID:3259139"
     CDS             complement(join(559373..560427,560483..560618,
                     560671..560703))
                     /locus_tag="CNH02020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572376.1"
                     /db_xref="GeneID:3259139"
                     /translation="MSATKDTFDLRAEEDAARRLNVGRVLPSAALSGTNSRAKHTELI
                     GKPFLRQKVEAASKSHGIKFDEEATLYLTGAIESSLRSLVNLTRAAQLHRTSSSHLHA
                     PPMAKSSSTSSDEKDGKPMWSLTLRDDPNAVIEALNRRNRDAEQEFRKMRMDRLARDA
                     ELQKARERQASQSQTVEAAASPFPATAAVSPAESSSSPSTPSKPLFGATKETPKGTPP
                     ASSSSKKKSSTKKPSSRDVSAEVQHKMTNLTAMRSAGMGKKYGWMMGNAPAVSSPLAG
                     KKRKAEGAEGKEKDGEKGKASESPLGQDRPSKKARPIPVPTRRMVAVSSPPPPPPAPS
                     AAANNPNNTTTDKAEPLKVSDDKALTMVDLVFALEHGGLGQAGGLGMGSVSGDILQGI
                     WAKGGPWSESEGKKP"
     gene            560902..565494
                     /locus_tag="CNH02010"
                     /db_xref="GeneID:3259282"
     mRNA            join(560902..560997,561051..561161,561285..561413,
                     561549..561671,561727..561801,561857..561936,
                     561985..562082,562132..562232,562283..562746,
                     562797..563101,563159..563347,563404..563572,
                     563629..563813,563867..563939,563999..564158,
                     564211..564751,564805..565069,565128..565251,
                     565310..565494)
                     /locus_tag="CNH02010"
                     /product="transcription activator snf2l1, putative"
                     /transcript_id="XM_572375.2"
                     /db_xref="GeneID:3259282"
     CDS             join(560995..560997,561051..561161,561285..561413,
                     561549..561671,561727..561801,561857..561936,
                     561985..562082,562132..562232,562283..562746,
                     562797..563101,563159..563347,563404..563572,
                     563629..563813,563867..563939,563999..564158,
                     564211..564751,564805..565069,565128..565251,
                     565310..565405)
                     /locus_tag="CNH02010"
                     /codon_start=1
                     /product="transcription activator snf2l1, putative"
                     /protein_id="XP_572375.1"
                     /db_xref="GeneID:3259282"
                     /translation="MNPLLAASSAANPNNTSVDDDKLSDYVPNSRDLSVSRAPSVIAS
                     EDAGHLDTAPQTPEPEEDEEDEIPEDELNEEELMDGKKITPSAAKRAAQASAKKAQTA
                     ERKAQHAEIGKKRSAIEQARFADSMKRFNYLLGQTELFQHFIDLKRQREPQFAQMLDE
                     QIAKQAGKGKKKAIDNRHRKSEKEEDEELLKDEEEDEPFVFEESPAYVKGGKMRDYQV
                     QGLNWMVSLHHNGINGILADEMGLGKTLQTVAFIGYLKFHLGIPGPHLIIVPKSTLDN
                     WAREVAKWVPGFDVVVLQGTKEERGELISRRILTQDFDVLITSYEMCLREKSTLKRFS
                     WEYIIIDEAHRIKNVDSLLSQIIRTFVSRGRLLITGTPLQNNLQELWALLNFILPDVF
                     SSSEDFDAWFKTKDEADPDAVVKQLHKVLRPFLLRRVKADVEHSLLPKKEINLYVGMT
                     EMQRKWYKSLLEKDIDAVNGMTGKKEGKTRLLNIVMQLRKCCNHPYLFDGAEPGPPFT
                     TDQHLVDNAGKMVILDKLLKSMKAKGSRVLIFSQMSRMLDILEDYCQFRGHQYCRIDG
                     STAHEDRIAAIDEYNAPESEKFVFLLTTRAGGLGINLVTADIVVLFDSDWNPQADLQA
                     MDRAHRIGQTKQVYVFRFITQDAVEERILERATQKLKLDQLVIQEGRAQQTAKVAQNK
                     DDLLDMIQHGAEKIINNKESMLIDDDIDEIIRRGEERTKEINSKYAGLDLDALNNFKS
                     ESLVNTWEGEDYGNRQQKRPLLWIEPSKRERKTNYSVDQYYRDSLKTGGPKADKPKVA
                     RAPKQVVVNDFQFYPPRLAELQNKETDWHRKSINYQVPVREPEEGETQEQVEAEQKEE
                     QERIDNAVPLSEEEVAEKETLVGEGFHDWQRRHFQSFIRALEKYGRDDLEKVVTDVAD
                     RTEDEVREYAAVFFERYKELKDWERIMDRIRAGEEKIKEQQDRIDVLHRKIKATRFPL
                     QELKIVYGQNKGKAYSDEEDRFLLVRMHHHGIDRDDCYELIKRDIGEWPLFRFDWFFK
                     SRTPDELRRRAQTLLLCIMKEDDKVEDEKKPIKGKKRPIDELKSGPGSRDTTPSAAGS
                     KGSKKKKV"
     gene            565711..569232
                     /locus_tag="CNH02000"
                     /old_locus_tag="CNH01990"
                     /db_xref="GeneID:3259287"
     mRNA            join(565711..566149,566210..566642,566690..566751,
                     566800..566895,566948..568033,568083..568259,
                     568315..568529,568587..568700,568753..569232)
                     /locus_tag="CNH02000"
                     /old_locus_tag="CNH01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657682.1"
                     /db_xref="GeneID:3259287"
     CDS             join(565793..566149,566210..566642,566690..566751,
                     566800..566895,566948..568033,568083..568259,
                     568315..568529,568587..568700,568753..569170)
                     /locus_tag="CNH02000"
                     /old_locus_tag="CNH01990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513355.1"
                     /db_xref="GeneID:3259287"
                     /translation="MPSDSTSLSMFSLSQDLVRSLIPSITESSNSRLSDHLSSKVRSQ
                     IKADKYGGTRKEWNEVSQSIMGLAEAGRIRVQEDLAEGLEKNLSNLNRHREQGKNVWE
                     EDVPIKMDNLPQHVQFLLNLAEKPTYQTHAFAYDYIHRSTPIGPTPEQLIYQQIMEED
                     PFDPGEVWDEEVRHGWTDSDTDDMSDLSTQSPSEDELATPSDLAMRMRLEDKEQEERA
                     QREEAEVKERAIEELAKKLKNGYWKGQPEVEIMRKDLHGWKELTTNTNAAAMAKNFFP
                     ASFSNNSKAISASQLQRELIFALSGRPGILFTFDEKADCQIISDHPHVKTFSPGALEG
                     ILMTFRSHASQASKLRLFVQKTLQPRVPADPAKQTQATNKTAQAFAEATREVLELYDT
                     WLSNLEASFTLGSRHGQSSSSVTGVPASTTPLLLIHELEQAHAPILRYLSEFVPYAHS
                     PTLILNLIYSAIVNTRQTGSTPHITSSLFKLFYRSAEPMWHVLGVWLQQGMPVPLSLT
                     DPEQMAFSSLSLDDGERELDRDFFIKRDKDVSWADEDFWECGFVVGDEGWPLWMGDEI
                     GAMVMEAGKAQGLLRSLLGNVNTEIVKEWSFLFDVLMGPMDGFASPFPLGEMDIVEKV
                     IGYLQPLCQLVQFHLRRVLDEECGLMQHLEAIEGTMLLRGFEVIHEWTEGLFKKIVKG
                     EPWSDFQLLTSSIRTVAEVRQAFWMNPNALRIRTTRRQGVYLGPRALGAIRADYLIPF
                     PLSQIFTETSIAIRAEVFSFLLQLLMSRWILAETKRTDKEMMVYSLSTDQRRELRSLW
                     CMRGKLLWFLDMVYTWLTGRVIENQTASFRAKLEELTSLGSMITLELEHTRKLRDYSF
                     LNPASSDLLEAIFGILDMTCTLSDSLTLFKAQSTPDKTPQFVTKRRRRVRRLQRDLSS
                     DEEMGKMIEGPSQTTGEYKKVSSGKANLKEMQRELQFCVGVIKNAVEKLSMERDGELW
                     AELSIALEEWHEV"
     gene            complement(569191..571765)
                     /locus_tag="CNH01980"
                     /db_xref="GeneID:3259184"
     mRNA            complement(join(569191..569513,569569..570191,
                     570240..570364,570413..570513,570566..571037,
                     571396..571765))
                     /locus_tag="CNH01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_572372.2"
                     /db_xref="GeneID:3259184"
     mRNA            complement(join(569191..569513,569569..570191,
                     570240..570364,570413..570513,570566..571241))
                     /locus_tag="CNH01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_572371.2"
                     /db_xref="GeneID:3259184"
     CDS             complement(join(569483..569513,569569..570191,
                     570240..570364,570413..570513,570566..571037,
                     571396..571405))
                     /locus_tag="CNH01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572372.1"
                     /db_xref="GeneID:3259184"
                     /translation="MAETIASSSAPTTSATPTTSPQVSTDVESSAAVTASDTSIVPQS
                     SSVTTTSESTTSTTSTTESSTAPSSAESSTDPITSSTSTSASQQPSVEPSSTSSSQSV
                     EPSSIPISSSSSIEPSTSTEPITSTVTSTSSSSSEDPTSSTSSSSDATSASERHSTSV
                     VVVTVTDSNGSMRVTASSIATGAATDTENSGSGTNIGAIVGGVIGGVAGLAIILALLW
                     FFCIRRRRNNEQAFDEKTFDPSRAARHSVNDPMDLLSPSVPAVGGAAFSGNSTPRVDP
                     FPFQNASSPEDQPYDPISHAPMRMPDARDYMGGAYDPYGGMEGGYGLAAGAGAGIGAG
                     SAADHYNYGESAHSSSDYPSSVSPTQTSAAMAKQREAAAERRTSRTSSGYNVPSGSGN
                     GPQEVIGSPAPSETGGRRESGISEGRTSVYQHTDMKSLPDEEEEQLDEIPPDYQSISR
                     QTQ"
     CDS             complement(join(569483..569513,569569..570191,
                     570240..570364,570413..570513,570566..571086))
                     /locus_tag="CNH01980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572371.1"
                     /db_xref="GeneID:3259184"
                     /translation="MADLSPSSSNSRATTSAIASSSAPTTSATPTTSPQVSTDVESSA
                     AVTASDTSIVPQSSSVTTTSESTTSTTSTTESSTAPSSAESSTDPITSSTSTSASQQP
                     SVEPSSTSSSQSVEPSSIPISSSSSIEPSTSTEPITSTVTSTSSSSSEDPTSSTSSSS
                     DATSASERHSTSVVVVTVTDSNGSMRVTASSIATGAATDTENSGSGTNIGAIVGGVIG
                     GVAGLAIILALLWFFCIRRRRNNEQAFDEKTFDPSRAARHSVNDPMDLLSPSVPAVGG
                     AAFSGNSTPRVDPFPFQNASSPEDQPYDPISHAPMRMPDARDYMGGAYDPYGGMEGGY
                     GLAAGAGAGIGAGSAADHYNYGESAHSSSDYPSSVSPTQTSAAMAKQREAAAERRTSR
                     TSSGYNVPSGSGNGPQEVIGSPAPSETGGRRESGISEGRTSVYQHTDMKSLPDEEEEQ
                     LDEIPPDYQSISRQTQ"
     gene            complement(571939..575824)
                     /locus_tag="CNH01970"
                     /db_xref="GeneID:3259062"
     mRNA            complement(join(571939..572968,573034..573156,
                     573214..573826,573884..573974,574034..574115,
                     574167..575559,575618..575692,575753..575824))
                     /locus_tag="CNH01970"
                     /product="cyclin dependent kinase C, putative"
                     /transcript_id="XM_024657681.1"
                     /db_xref="GeneID:3259062"
     CDS             complement(join(572149..572968,573034..573156,
                     573214..573826,573884..573974,574034..574115,
                     574167..575530))
                     /locus_tag="CNH01970"
                     /codon_start=1
                     /product="cyclin dependent kinase C, putative"
                     /protein_id="XP_024513354.1"
                     /db_xref="GeneID:3259062"
                     /translation="MRFSSRDEEPEDGEVVEDDAVWKNPLATTKYLKGAPSVSSSQKT
                     SSYKKSRPSFIPSLDPADDDGHRPRRPPPPSLSSPPYQQSRHRSSSHNRKTISYEDEE
                     RGSGMQHALPKNPQTRQYPHSTEMREPEQRREDKYAKEPRSPHRREGYYSSRRGDGRD
                     YPPQLDRERYGPARRLESGGDGGYGDRSRDRNMDRGGYRDKDDRRSYGRPSDSSAWGR
                     PPREEYRDRRPEEFARHPTGERYREDSRERFPVDRDTGQRRSCSPVRIRSPERSSDRP
                     LTPVPDNGRTSSPDHGAKNIASSRGHRSSPSHSSNHEDHNGEKGNGPIKLNRNRHRPS
                     LPLKHISTQPPRSPSAPPPPPPPDPSTVPPSPTEPPPPMPGNLSLEQTVPHAPNPRAQ
                     MATRPPSPKREEGEIRQETESVVFKFKLWTAEEELKALGKNFGGSSTLMRYNMGTKLG
                     EGTFGVVTKAVENDTKRAVALKKITQHNFRDGAHITTLREIKILKSLQHPNVVPLLNM
                     VISRHDNHSENTFIKNEVFMVFPYMDHDLCGLLSNNDFKVNHSGAKCIMKQLLDGMAY
                     IHSNNIIHRDIKTANILVDKHGQIMIADFGLARPWTDNKKMPPHLATEYTNMVVTRWY
                     RAPELLLGWCNYGPAVDIWSIGCVLGEMYLRRPILPGGGDREQLSMIFAKCGPLNEET
                     WSGWQDLPGFPEAHGFAWDKTPRDTSILEESKSWHMDRGGADLLVKLLSLDPSKRPTA
                     SEALDHPWFWVSPKPAETINLDFAASHEMSAWHKQPAAAPVQPPPQKAYQTQQAYQSQ
                     QTHHAQQIYQPQQPYVAYQSGYGNQQRGHGGYQQQTANATRHNLAMNPYASSQVGNAQ
                     GYNQQPYMQAQGVSNMPPGADAYGGINPYGAPVAYNTASLPPPNMAYNGQSSFNGGGG
                     LTGGGGQQYSLPHQSYLPPGPPPMMHGNVNRPSRPPPPTSSEGRPLAAAPFPLAGGGG
                     GGGGMKTFAPPPPFSLAGGGGGGRGGMPPTMKRPPSDSRRDFGGDHKRQRTEAPLPYD
                     "
     gene            complement(575869..576783)
                     /locus_tag="CNH01960"
                     /db_xref="GeneID:3259320"
     mRNA            complement(join(575869..576218,576285..576409,
                     576465..576522,576572..576783))
                     /locus_tag="CNH01960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572562.2"
                     /db_xref="GeneID:3259320"
     CDS             complement(join(576114..576218,576285..576409,
                     576465..576522,576572..576733))
                     /locus_tag="CNH01960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572562.2"
                     /db_xref="GeneID:3259320"
                     /translation="MFRTLSLSAFSPRIFTRAMSTAPLPMPQLPRTDEGKRICQIVKV
                     KPERLDEYKKVHAEVWPEVLGALRKAHVVDYSIHYFAPHNLLIAHMRYIGSDFQKDMD
                     GIKENEATRKWWQLTDGMQESFVPGATGSESGPGWWVDAEEVFRLEG"
     gene            577003..578693
                     /locus_tag="CNH01950"
                     /db_xref="GeneID:3259272"
     mRNA            577003..578693
                     /locus_tag="CNH01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_572369.2"
                     /db_xref="GeneID:3259272"
     CDS             577117..578628
                     /locus_tag="CNH01950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572369.1"
                     /db_xref="GeneID:3259272"
                     /translation="MPPLFTSTSLTTFIRQIRGVAKYIQQPATVMSRTAPKRTINTLG
                     RARNAVHHLAHQTFPSLSTPAHQLHQSTTIRAGVRFATSSAGSSSSKTSQRHLGAVGR
                     ALQASKRPQWGRGRSIPSNVGLGSARGFASAPAAGGIPGNIPIVLRAFANLVDDDCSG
                     KKSLPRASRYSPYARKARRTRRKVCKSIDSSFISDLHHYFPRVAASQLDEVKVDLPPL
                     PEQLVTPGKTATLAIPLSPSLEALLHPTSSLTYPETSIGVHILARLTAGLLPIHSAFS
                     LHSSTRVIPLLTKLDGLGVMEFHPGGPNVLAEVVRDPEGRPDILRLIFEQRSSENVKA
                     LLGGSLRENEEGEWWALWDQEDRVMELTQGERRAMMERWDGGEEKNEHDQESLVYPTL
                     DMSLVNSVDPLVTPPPPSEVSSLNSTPSTQSTLSLSSLLSDMDDSLEGWSIPPSEADT
                     DVDSVYSGSEEWGDVSSRIVSIHSEQGEESSDGVVSVWWAGAGEGFGFVAQPW"
     gene            complement(578668..579856)
                     /locus_tag="CNH01940"
                     /db_xref="GeneID:3259044"
     mRNA            complement(join(578668..578828,578887..578975,
                     579034..579309,579362..579425,579476..579560,
                     579625..579692,579760..579856))
                     /locus_tag="CNH01940"
                     /product="expressed protein"
                     /transcript_id="XM_572561.2"
                     /db_xref="GeneID:3259044"
     CDS             complement(join(578729..578828,578887..578975,
                     579034..579309,579362..579425,579476..579560,
                     579625..579692,579760..579788))
                     /locus_tag="CNH01940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572561.1"
                     /db_xref="GeneID:3259044"
                     /translation="MRIPGILPFLPLLPFIYAATISGNIAFNGLLTLDSLPPTSQISL
                     DHGLTKVWVKQDGSFTFHNVPEGTHQLEPLIPGYIFHPLLVTVKPTVSSESDPAKASS
                     EDQMHVQILNPARQPLPISSVSLPYPLVLEPVAKENYFIPKNGMNMLGLLKSPMVLMM
                     LFSGIMMWGMPKLLSNMDDPEFSKEMAETRQKMQGLQNGDWTGALSNMLAGTAEDKSA
                     PVQSGGGSAKAGGKKRRK"
     gene            579941..580954
                     /locus_tag="CNH01930"
                     /db_xref="GeneID:3259361"
     mRNA            join(579941..580107,580172..580231,580294..580439,
                     580499..580954)
                     /locus_tag="CNH01930"
                     /product="nucleoside-triphosphatase, putative"
                     /transcript_id="XM_024657680.1"
                     /db_xref="GeneID:3259361"
     CDS             join(580062..580107,580172..580231,580294..580439,
                     580499..580813)
                     /locus_tag="CNH01930"
                     /codon_start=1
                     /product="nucleoside-triphosphatase, putative"
                     /protein_id="XP_024513353.1"
                     /db_xref="GeneID:3259361"
                     /translation="MSQKQLFAAFDVTRQVFYRSSLSVGIVNLKPLLPGHVLIVPKRV
                     VPRLADLEANEVSDLFLSVQHIGKVLEDVYKARAMTVSLQDGVAAGQSVPHVHIHLIP
                     RHPTDYDGKNDRIYPLLEQSEKQLHGDLKNSDVPVANGRDDDGQTEAQVGKWEVPKDE
                     DRKPRSMEEMEREANWLASFFKSSTNSL"
     gene            complement(580878..581761)
                     /locus_tag="CNH01920"
                     /db_xref="GeneID:3259264"
     mRNA            complement(join(580878..581287,581352..581614,
                     581666..581761))
                     /locus_tag="CNH01920"
                     /product="expressed protein"
                     /transcript_id="XM_024657679.1"
                     /db_xref="GeneID:3259264"
     CDS             complement(join(580967..581287,581352..581549))
                     /locus_tag="CNH01920"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513352.1"
                     /db_xref="GeneID:3259264"
                     /translation="MPGLFSLPPPSVTLALGGLTTSYVFFSSVTDMNWGIVPLLNGRF
                     GAVDIDEKKRIKMWSIYFKRAATGLVGGSVLSALLNFTTAYIHPSPLTRRITFISAVT
                     SLLILPITFASGILPINSRLFEIAKGAETTKDDEVKSLVEAWGKKHLLRMPAYTGAWV
                     LSFFALVYDGRI"
     gene            582129..583521
                     /locus_tag="CNH01910"
                     /db_xref="GeneID:3259219"
     mRNA            join(582129..582250,582317..582336,582434..582504,
                     582572..582644,582713..582780,582840..582898,
                     582958..583178,583232..583278,583328..583521)
                     /locus_tag="CNH01910"
                     /product="kinase regulator, putative"
                     /transcript_id="XM_024657678.1"
                     /db_xref="GeneID:3259219"
     CDS             join(582231..582250,582317..582336,582434..582504,
                     582572..582644,582713..582780,582840..582898,
                     582958..583178,583232..583278,583328..583405)
                     /locus_tag="CNH01910"
                     /codon_start=1
                     /product="kinase regulator, putative"
                     /protein_id="XP_024513351.1"
                     /db_xref="GeneID:3259219"
                     /translation="MSTLFNIKSGQSRTFKPKKVPEGTKQWQLKQYAQQTLGSGNLRT
                     AVKLPEGEDLQEWIAVHVVDFFNHVNMLYGTVSEFCTPTECPVMNAGPKYEYFWEDGT
                     NYKKPTQLSAPAYVEALMSWTQSILDDEKHFPQTIGKRFPPTFMTTAKTILRRLFRVY
                     AHIYHAHFDQICALGIEAHLNTNYRHFLLFVDEFALLSEKDLVPLEDFNKTILNETGK
                     "
     gene            584027..587480
                     /locus_tag="CNH01900"
                     /db_xref="GeneID:3259018"
     mRNA            join(584027..584095,584157..584332,584389..584683,
                     584738..585231,585288..585405,585457..585566,
                     585617..585808,585858..586148,586210..586425,
                     586479..587034,587090..587197,587252..587480)
                     /locus_tag="CNH01900"
                     /product="urease"
                     /transcript_id="XM_572365.2"
                     /db_xref="GeneID:3259018"
     CDS             join(584309..584332,584389..584683,584738..585231,
                     585288..585405,585457..585566,585617..585808,
                     585858..586148,586210..586425,586479..587034,
                     587090..587197,587252..587349)
                     /locus_tag="CNH01900"
                     /codon_start=1
                     /product="urease"
                     /protein_id="XP_572365.1"
                     /db_xref="GeneID:3259018"
                     /translation="MHLLPRETDKLIVTTLGTLAQRRLARGLILNRAETIALISSQLQ
                     EFIRDGRHSVAELMDLGKKMLGRRHVRKGVPESIHTIQVEGTFPDGVFLVTVDDPISS
                     DDGDLNNAFYGSFLPIPSADVFPAAPEPADTLLGALICRKEPIKINASRRRFKLEVKN
                     AGDRPIQVGSHYHFLETNPALIFDRLLSYGYHLDIPAGTAVRFEPGEKKTVTMVEFGG
                     KKIFHGGSGLASGSFDENLRETKVKEMVEKGGFGHKDQEKVEEGPTTEMNREVYASMF
                     GPTTGDKIKLADMDLWIEVEKDYTVYGEECKFGGGKVLRDGGGQASGRHEHEVLDLVI
                     TNALIVDWNGIYKADIGVKNGIIVGIGKAGNPDMMDGVTDGMIVGSSTEVIAGEKLII
                     TAGALDVHVHYICPQLMTEALASGITTVVGGGTGPADGSNATTCTSSSFYMQNMIKAT
                     DTVPLNFGFTGKGNDSGTNALRDVIEAGACGLKVHEDWGATPEVIDRALSIADEYDVQ
                     VNLHSDTLNESGYVESTLAAIKGRTIHSYHTEGAGGGHAPDIIVVCEYENVLPSSTNP
                     TRPYAVNTLDEHLDMLMVCHHLDKSIPEDIAFADSRIRSETVAAEDVLQDTGAISMIS
                     SDCQAMGRIGEVITRTWRTAAKMKQFRGPLEGDEPTRDNNRVKRYVAKYTINPAITHG
                     MSHLIGQVAVGCLADLVFWTAESFGARPEMILKGGVIAWAAMGDANASIPTVQPVIGR
                     PMWGSQPEAAALNSIVWVSQASLDKDLVKRFNIKKRAEAVKNCRAIGKKDMKWNDSMP
                     KMTVDPETYDVHADGVLCDVPPADKLPLTKRYFVY"
     gene            complement(587651..592931)
                     /locus_tag="CNH01890"
                     /db_xref="GeneID:3259245"
     mRNA            complement(join(587651..587967,588034..588130,
                     588194..588278,588332..588556,588615..588686,
                     588742..588917,588972..589089,589142..589264,
                     589316..589349,589430..589503,589561..589568,
                     589641..589651,589701..589751,589805..590006,
                     590063..590282,590339..590669,590723..591708,
                     591763..591840,591896..592021,592077..592183,
                     592244..592307,592372..592931))
                     /locus_tag="CNH01890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657677.1"
                     /db_xref="GeneID:3259245"
     CDS             complement(join(587907..587967,588034..588130,
                     588194..588278,588332..588556,588615..588686,
                     588742..588917,588972..589089,589142..589264,
                     589316..589349,589430..589503,589561..589568,
                     589641..589651,589701..589751,589805..590006,
                     590063..590282,590339..590669,590723..591708,
                     591763..591840,591896..592021,592077..592183,
                     592244..592307,592372..592863))
                     /locus_tag="CNH01890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513350.1"
                     /db_xref="GeneID:3259245"
                     /translation="MSFQETNTPPPPAITISSSNAPHSEQPMPSTPPSPLRSTSSSSG
                     EKRESNDITTPRKRRGSHSHVRINDDPEITISNADGEPSGSGHRKQASFALTADDEAD
                     RHNAEKKETADDDQVNEKTRYEKVKILAELRVKKILGHRWFSWIGPKLTWGKLKPVIR
                     CAISAWLGLVLLMIVPVERSIGNGAFFLLIVSFMLPPSDPVVQTLEKYVNLFFFTSLS
                     WVWVIITVLIAGATRGPPNPDKVAAAEARWAYLKDVDPTKYQQRIIFDGTYLQAKPAV
                     VCCVFLSAGTGALLWWKLRTQPSPATFPLVLSCILIDVSLTVVVFYPYNSYTSGLIFF
                     LPMSVQAGIGTLCSFLIFPESVGHSFQSKFPGILTPLASAMKSIETLFGEAEKHDNGQ
                     EENTDDLLSVRNSDYGPKFYADKLDDWADRSKKIRTQLLQSLAGIPPLRAQQRYLAVD
                     ISYSRLSGEDLRNLFDRLAIVQARSGGMAFFFDVIINNAKHSHLDSSAWSVHHVSQSR
                     SGSRAASIRHEFLDERRGSVDDSLHGDGTVTPPPEVDDHAESPHHDRGLYFGSRKFNF
                     SGILRRNGSPHGFAATQKGSHLSLLDHLRKSQQPVGVYESTRYMDIERNFAVDTEHVL
                     EQLDILARGSVPLIRACEAALSEATDWILNVNRDRSIFTWPNRHRESQKEKRRDEKVI
                     ATTKLEEVTGHLQSALDDFHIARLEIVKPYKHLFDPTHPEEGRRGKMHFRSLFQNFVA
                     QYHVLEFSEALLNLLRLMEELDKSRQKRRLWYPHLTSMIDHFRHSHKDKHLTDGDDGH
                     ENDAAFEQEEEEDFLGEVKKRNPEYKPFDNSFLNLIAKCSKVMDILSSRSFMYALKAA
                     VLGALTTLPNFIASSASFYYLNRGVWCTIMAQLIYSGDTASAWLGRVVASFWGCLVGM
                     VLWYIGSGSGQGNPYGIAAACAVAFPLASFFRIYFPGPVLTAVMAPVTMGLVIGYSYY
                     NGTIGPLTYAQWGWDVAWRRYVCVLIGISAAWAFSYVPPVYSAKRAIRYSYARTIGTA
                     GSILCDVLSHANDHHYHLKENDTIRHNLITWRSKLNKLGARHINATREFSLRGRWPEE
                     RYKALFDTLQDLLSLLSQLNHVLTQLERPWRKALLDRTRLSDPAFLGDVMVVLSMCST
                     ALRAGTPLPQITPSPLVARFGMGKTKGLDLPHDSSDQSGELPTLVTVDVLESDNYMRY
                     ALGITTTFSLISRLDRIVVICKTLLGENYHIAGLHLEQTTRA"
     gene            complement(593036..596760)
                     /locus_tag="CNH01880"
                     /db_xref="GeneID:3259357"
     mRNA            complement(join(593036..593491,593549..593852,
                     593908..594006,594054..594199,594252..594766,
                     594815..595464,595517..595852,595908..596117,
                     596171..596188,596237..596317,596379..596399,
                     596458..596760))
                     /locus_tag="CNH01880"
                     /product="endocytosis-related protein, putative"
                     /transcript_id="XM_024657676.1"
                     /db_xref="GeneID:3259357"
     CDS             complement(join(593310..593491,593549..593852,
                     593908..594006,594054..594199,594252..594766,
                     594815..595464,595517..595852,595908..596117,
                     596171..596188,596237..596317,596379..596399,
                     596458..596574))
                     /locus_tag="CNH01880"
                     /codon_start=1
                     /product="endocytosis-related protein, putative"
                     /protein_id="XP_024513349.1"
                     /db_xref="GeneID:3259357"
                     /translation="MGNDQSRTSSGDGKQVDEKPPDYYELLQVDEEAGYDEIKRSYRK
                     LALINHPDKNPHRIEEATKLFADLQHAYEVLSDPQERAFYDSHRNAPVAATDDDIFEH
                     VRTGDKATNDPKSKLNRRRQGDPGVTIAQLMRFFDPKIASKMDDTSEGFYSIYRTLFA
                     LLASDEALHTTSTTPLSYPSFGNSSTAYAPPPGLTRAQKDSQVWARDFYAVWGEFVTE
                     KKFEWLNKWDAERGDDRMVRRAMEKENKKAREETRKEYNETVRQLVVFIQHRDPRYKA
                     HQTKLAQERAASKSAKTSGASTPAGKPVVDAEAAKRRHEERLRAAAQYEEQDWQKFSS
                     RNSDDEEMEEEEPEEELGDGTGVRLDDGQGGEIFECVACGKTFASEASWINHERSKKH
                     KQAVWRLKKEMRAEAKAMGLTEPQSEEEPGDERAEDADAGEGEIGGETKGVGMTEEEQ
                     LAELQALEAEMVDLALEESEDVDYGNKKSKKKGKKNRRDGVIDEVDTATGLSPSRNES
                     QPDASNTPSAAVSDDGVARESDKTSELSKRDKRRAREARKKIEEEERKAAFKEARKAA
                     KKAGASVETFASPQQSDRKDKVDDDGFVAPKQKGKNSIKSGKGTKGGREQGENDYSDE
                     RVAKVVAGIQEKREKMVEKWGDTWADLVSKLKHLLSGDSHLPLSILCLGLGKPFSDRT
                     AQIQLALALELADALNCTVHDLEMYDPVWDEGDKKVLSSIGVTLLQDNLLGRHTLETG
                     RPYLLYLPHAPKQLYESILSTNYAPSLCGNKPGRILLGNDLAEYLPGFVRPSQKKEPS
                     GEADGDGEFVKPKKKRRGRGEVKPQIKDGVLSRVVPHMSVLPLSDALPETNLPGFARA
                     FLSFTFQWLEENKIEKIDWETKLPEEEWGDDGEIIQ"
     gene            596901..598445
                     /locus_tag="CNH01875"
                     /db_xref="GeneID:36393001"
     mRNA            join(596901..597096,597186..597307,597364..597554,
                     597615..597819,597878..597950,598012..598445)
                     /locus_tag="CNH01875"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658688.1"
                     /db_xref="GeneID:36393001"
     CDS             join(596932..597096,597186..597307,597364..597554,
                     597615..597819,597878..597950,598012..598350)
                     /locus_tag="CNH01875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514604.1"
                     /db_xref="GeneID:36393001"
                     /translation="MDKSHPLLANFDDPPPFPETYPQLRRLDRSVVCQICKEPFTAPV
                     SIGCGHSFCSHCIRSSLDVQKKCPSCNEPASEGSIRRNRALEEIAEAWEQSRPTLIDL
                     SKPLSRKRAAPEVDSRPSSSGIVKRLKDQDGKPSQSPAPAESIESEEEDEIQELTEND
                     EAPCPICMTRMSISSIPMHVERGCPPPPKSIKASAGGGKGNQKADWKKVFSGQTLSGS
                     KGKENGKGKEPEMKKITKPNYSLATPADLRALLSQYSLPTSGDKVALIARVQEWIILY
                     NANLDTSRPSSLSALRAKLTEAEASRKRDKEKGKDELVGQLGSKEGLAKYAQEKKGEF
                     ERLRKEIMERDKRRKAEEKGSGRDSAIEVD"
     gene            complement(598406..599901)
                     /locus_tag="CNH01870"
                     /db_xref="GeneID:3259347"
     mRNA            complement(join(598406..599183,599237..599266,
                     599329..599425,599491..599901))
                     /locus_tag="CNH01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657675.1"
                     /db_xref="GeneID:3259347"
     CDS             complement(join(598453..599183,599237..599266,
                     599329..599425,599491..599721))
                     /locus_tag="CNH01870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513348.1"
                     /db_xref="GeneID:3259347"
                     /translation="MHRDQATKRSEHSQQPHLPFRMPSFTIPLLLLGALPLILLYIPT
                     LTEPYALWDPKVLNSRNASDGRIKAWCNMGWWKNTDIFPEAAEALAGKLLGLAQEGGY
                     QGGGSVLDIGHGAGESLLLHLSQENPPSQLHALTSLSSDTAVAKAVVESAYPDTSTHI
                     KFYTFSAQFRPGKDVGHPLDPMRGFLGEQSSQRFFEEDQSAGGEEWADEPLEDKSQSS
                     SKYDLVYILDSIYHYPPSLPSFLASLRCALHSSSLVVYTDILPPPNLSKINAYLLSRL
                     LSVPMPNLSSRPRNLEEYKAQLGTQGWEDVVVEDWSDGVWDGFSNNLKARGHVWSLVG
                     KGIKAAEENGWKFIGVRARKGGNVHIEA"
     gene            600115..604282
                     /locus_tag="CNH01860"
                     /db_xref="GeneID:3259250"
     mRNA            join(600115..600324,600377..600864,600914..604282)
                     /locus_tag="CNH01860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572361.2"
                     /db_xref="GeneID:3259250"
     CDS             join(600166..600324,600377..600864,600914..604124)
                     /locus_tag="CNH01860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572361.1"
                     /db_xref="GeneID:3259250"
                     /translation="MSHHPPAPSLAALPVDTSKTDPTPAYYKLQFGDDLTGFSYYVRT
                     LTVVIGRNCERPAPVPPPAITNPSVPTNPPLDPNAPSPPSLYTGSILRTPPVANFNSP
                     SVVEEDHEANLEDYGPLVELAEAVAVKEEDVADDISPVLELPDAPPPPPPPKSSANVE
                     HVDVDLGPLKSVSRNHAKIEYRAELGRFCLEILGRNGAWIDDRFYVKGAVVPLAQGSQ
                     VQIATRIFSFVLPPSSLPSPPYNYYGQSALDNVENLPYPYNLPASEVRYQEFFGEAGP
                     GPATAAAMASRQPPAFNAFAAADGYGLGLGVDMESQWGQWESEEESDSDAERDYEHSF
                     ERDSEKDVHEEEQAEDEDWDDAQSEDEDEDEYEEAKPKQATKIKLKKPLIVPGEDESD
                     LSSLESEPERPLKSVKKQAGKKQSQSQSKSVENEKVKALKDAKKPSKKESKSKKKIKE
                     PTPPVEESSAEVKGTPSKSKKKEKEKEKSKVDSGAEQKPDIQAMTNDEKEKTTPQKKD
                     QKKKIKPASESKPPAKPAPGLKLPIPLAQQQQQHQPAAQPQPPSVPTLAAALANTPTP
                     PTIASTPASQPAVRPLQQPVRPAPGQPQQGAVRPPGMPGQTGQPMIRPGQPGVPMGVR
                     PPMSGPGQIPVRPGQPHSHLKQPLPSTPGVRPPLPQTPVPRTTPSSTGTTPQPTQPFF
                     CTELKETSGRPGHIIVNVPIPPSGAGPRPPPGPILGLDGKPFIGPPPLKPTSTFATII
                     HKALSCLPRGRGTLGEVCNWVAGEWEWFRLNVDSGWQNSIRHNLSLNKAFLKVPRIPE
                     DDPESKGSVWIIDPQEGPLFEEKQRRDAMKSASKDKNAESRREKERIRAEERAKKQRE
                     AAIEAARNPHAHPSYVHHPHPTMARAMPPMATARAIARPPANVVHSHPQPSTTQPVPS
                     QPTSANIKGVLQPKAKITVVMQPITPALRAKSVIANTDSNGNPLPFVCDGTTLVLDQS
                     TFGHLTSDILDKLTLLGAAGAVDVLSAWVINKNKMQASKAAQQAKTGVTGTAATSSGA
                     PGAVAAKNGVVNGAARPTNGVQPARPQPQVAPKPNTTPIARPAVPPKPAATPAAPAAP
                     TTTATTTPAQPTPSTAPAVKPASSNPPKSLPGPAPPGTSLTKVIGMIAAVANAKGDVN
                     TVGPNASALLRYIRVVGVEIDLRVAERIWATGVVPPLPVKKVSKPASGAATGSTGTGG
                     AKPAQGAGVKPQGQVQGGAKPVQNASVPASAPNATGVAGLKRKLEDAAPEQGQAQGNS
                     NGTASGTGGDQEAKKPRLEASNV"
     gene            complement(604325..606059)
                     /locus_tag="CNH01850"
                     /db_xref="GeneID:3259156"
     mRNA            complement(join(604325..604520,604575..604736,
                     604793..605113,605169..605370,605423..605608,
                     605657..605725,605798..606059))
                     /locus_tag="CNH01850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572360.2"
                     /db_xref="GeneID:3259156"
     CDS             complement(join(604512..604520,604575..604736,
                     604793..605113,605169..605370,605423..605608,
                     605657..605725,605798..605850))
                     /locus_tag="CNH01850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572360.1"
                     /db_xref="GeneID:3259156"
                     /translation="MSTVPTVTVAGKQVGRMGYGLMQLTWNPQPPPQDVSFAAMKAAA
                     DSGSTVWSSAAFYGNPGNNFANIKLLGAFFDKYPEYKSKVVLVVKGGADYADLHPRGT
                     ELDFLRTELTEMKKILGDKEIDVYSLARLPEGPVEDIFKGLDTLKKEGLFGDVGASEM
                     SAASLEKAHKITPIAINEIEISLFSYDESIRDAIEWHNNNKVPVFAYSPLGRGFITRT
                     YKSPDDIPEGDFKKYLPRFQGQAFYENLKLVDKLDEIAVRKGVKGSQVALAWILSLSD
                     YTIPIPGSSNPKRVVENIQSTNVALTSEEKKEINDFLDAFEVQGTRYPAQAMAHLMK"
     gene            606334..607768
                     /locus_tag="CNH01840"
                     /db_xref="GeneID:3259012"
     mRNA            join(606334..606482,606533..606582,606664..606786,
                     606840..607120,607178..607768)
                     /locus_tag="CNH01840"
                     /product="expressed protein"
                     /transcript_id="XM_572359.2"
                     /db_xref="GeneID:3259012"
     CDS             join(606410..606482,606533..606582,606664..606786,
                     606840..607120,607178..607220)
                     /locus_tag="CNH01840"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572359.1"
                     /db_xref="GeneID:3259012"
                     /translation="MEDIIATIILISAVYFFVKWLVGTKSGNTSDGGIRGVTPSMVET
                     VHSAFPHIPVPNIVYHLSRTRSAQATSEEILERGMLPPPPPTFNIPASLIPTATPQPA
                     LTHSSSNTNTKAANAKTQSLIDRYNLSSRLPSHKGKEKAEGETAQIDNKWEESKEKRE
                     LGLKERKEKMILEARKRMLEKQAKEQATN"
     gene            complement(607255..608878)
                     /locus_tag="CNH01830"
                     /db_xref="GeneID:3259285"
     mRNA            complement(join(607255..607757,607809..607900,
                     607958..608679,608743..608878))
                     /locus_tag="CNH01830"
                     /product="arylformamidase, putative"
                     /transcript_id="XM_572358.2"
                     /db_xref="GeneID:3259285"
     CDS             complement(join(607272..607757,607809..607900,
                     607958..608679,608743..608798))
                     /locus_tag="CNH01830"
                     /codon_start=1
                     /product="arylformamidase, putative"
                     /protein_id="XP_572358.1"
                     /db_xref="GeneID:3259285"
                     /translation="MTSLNFKVAPAVQATEAPPIPKAQAWGCQYVPSPSAPLLDLSQG
                     VPRAAPHPNVLAALSKVASDPQAARYGPILGEPGLRQALAEEIKVQYHVSGQGVTFED
                     VAITTGCNMAFLSLLMTLCPPGKSSVLLPLPAYFNHTMSLSLQDVKPVYVLCEPDNML
                     KASLPSARSYLASLRKGNGDRREPRMIVLVSPSNPTGTVYTNEEIKQWYDLAREYKVA
                     LVLDETYRDFVEGESGQRGLPHRLFEEPDWRSTLVSLGSFSKGYRIPGHRLGSIIASP
                     ELLQHITTICDCMQICPPRPPQIALTPLLPSLRPDLFAASSQLSHRRHLFETTVNAIP
                     GWEVISSGGFFAYVQFPEDYIYASSILGLKRKKLGSEDVARVLALRCGVVTLPGSFFM
                     PPLADDEQWDDILNGETLRQDKWLRFAVANVEDDVILSLGPRLKLMNKIMGVDNEGVA
                     S"
     gene            complement(609021..613541)
                     /locus_tag="CNH01820"
                     /db_xref="GeneID:3259172"
     mRNA            complement(join(609021..609211,609276..609826,
                     609881..609965,610014..610186,610238..610360,
                     610418..610555,610606..610927,610980..611072,
                     611129..611507,611564..612252,612301..612452,
                     612503..612656,612721..612833,612884..612996,
                     613054..613121,613172..613541))
                     /locus_tag="CNH01820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657674.1"
                     /db_xref="GeneID:3259172"
     CDS             complement(join(609371..609826,609881..609965,
                     610014..610186,610238..610360,610418..610555,
                     610606..610927,610980..611072,611129..611507,
                     611564..612252,612301..612452,612503..612656,
                     612721..612833,612884..612996,613054..613121,
                     613172..613458))
                     /locus_tag="CNH01820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513347.1"
                     /db_xref="GeneID:3259172"
                     /translation="MSTKPRRHIPYLPFHKNLIRTLCRPQQDDLLLIAKGLGLRRIVC
                     ALLKTYDRKEDLVLVVGATPADEAGIGDELGIMGVRDPGFRVVGYEMSVKEREEMYRH
                     GGLFSVTSKILVNDLLKGTVPVKLITGLVILHAERISHGSQEEFAVRLFRRENQSGFC
                     KAFSDEPEVFAHGMSPLRDMLINLNMTSVLIWPRFNEVVKVDLSSRRADVVEMYVPMT
                     DLMRHCQDAITECMEAMLVELKRDHSLNLDLEDINVRNAQFKNFDTIVRMKLKPVWHK
                     VGAKTKIHVAALTELRNLHTWLLEYDSATFASYINTLQRQHFQAERLTTGAGRHIHDW
                     FNAKAASQLVEASQARVSRRKMVMDNIPGPEEDADRREVSISRDEGVDSQEGEYGLEE
                     EALREQELAEQQRREIQGIVPDDDEEEIMEIFATQTQTLPQHHRPNDADNDLEQGPMA
                     QDENSDETLRSAEGVPPPVFRPVMLSVKDDLGRSVEKRLKKGYEAVLEEQPKWSVLAK
                     VLKEIEDTIASVQVSHADSPGTNIILVMTSSDRTCLQLRQYLTTMSRTDPPFGPNAGR
                     KMMESLFLSNWQHEKNGEKLGSAGTGMHRSNEDEIRVRGDIESKRVEEQRRAERTRGR
                     GRGVPSYKRRRQRGGAAAPAPRLAEMEKEHKEAMMKAHSAFGGGENDEDTQMQWALGE
                     STRSASFNDLSTPSTSLSSSDPSSALLASTGILDEDDLQPVSGSQTIAEAQYGLLPEN
                     FEEAYGLIAPEGAVIIRPYGGEDDDILLQELRPRFVVMYEPNLAFIRRLEVYRNCNPG
                     LSLRVYQMIYTNSFEEDRFLSTIQREAEAFKKLIDDRQSMVIPIYNNNPRAPMRDTVT
                     RSKTTYSSRNAGGGESAEEARIIVDIREMGALLPSLIDSAGIKVVPSTLTVGDYILSP
                     KMCVERKSLADLEGSFNNGRLHTQCEAMTSHYETCILLIEFDEDKFGMRTKEDARREA
                     AGRANDPDETWRDTFYLQSKLALLALHFPRLRIIWSSSPHESVKILSDLKLNHDEPDE
                     ITATLKGSSEGEQGVRSGVENAAAVEMLRSIPGVSGRNLKFVMSKVESIKHLVSMSRG
                     QLKEILGEEGGEKAWEFLHHDPRYSR"
     gene            613721..614677
                     /locus_tag="CNH01810"
                     /db_xref="GeneID:3259244"
     mRNA            join(613721..614002,614060..614167,614227..614677)
                     /locus_tag="CNH01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_572355.2"
                     /db_xref="GeneID:3259244"
     CDS             join(613859..614002,614060..614167,614227..614520)
                     /locus_tag="CNH01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572355.1"
                     /db_xref="GeneID:3259244"
                     /translation="MFSQVFIRRSLHTTPRLLSTASALEVSLRNALKTAMKSKDRPAA
                     SCLKSVLADVTNAAKSGPNPNEPPTHESVISVLRKGIAQRTQAAESYAPSSPSAHPEN
                     HASLTNEISLLRSFLPAAPSEEVLQSIIKKTIESLPEDVRSSKGAAGKVLQALWEELG
                     ESKAAVDKKAVGKWVQEALKA"
     gene            complement(614212..616930)
                     /locus_tag="CNH01800"
                     /db_xref="GeneID:3259252"
     mRNA            complement(join(614212..615890,615940..616652,
                     616714..616930))
                     /locus_tag="CNH01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657673.1"
                     /db_xref="GeneID:3259252"
     CDS             complement(join(614704..615890,615940..616652,
                     616714..616781))
                     /locus_tag="CNH01800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513346.1"
                     /db_xref="GeneID:3259252"
                     /translation="MPKPHLKALAITDLRPSFLSTISHAINMSFNRSSHHDDLPGQEL
                     ERRPRHTRSGREWRRYSPSWPVDFSSPPPDYRSYSTSPVRTRLYHSRPSPSETTRGPW
                     RPPPPPPVSFPPPHYVDLARPSTKKNKALVKKTVTPKLLVLDLNGALVWRNRSYRAHM
                     SNPRPYLSCFLEYLFLPEPSSDNGNRPGDTQSVRPWEVFVWSSAQPHNVRAMVEACFG
                     SRWIEGIWEQASEEGKKGTEEGEGRLLGVWARDKMGLKGFDYSRKVQTTKDLRKVLSH
                     LIETKKLPDPTTPYSEKTIVLLDDSPLKAVFQPWNQIVIPEFDKALHRSSRLAAGLKS
                     DTHDDSDDGEASTSQTGQGHEMDKILLAVIGILDQLRHVSNVPLWVRAGGLTFDLDET
                     NLHPPTHESLPSHVDYQHWFNDQEVYSKWVAKGEEALKRKGIEVRHGLDIPPSPPSRE
                     TQDGIFHVAPIASLRSPSLDSREEREESRARYSPSRPTSCLSPSSSDDRLDFEVSDGE
                     MECTKSESAFARRKREERAREKAARKVRKGQQQFARYAEHKVDEEAIKGEVHPGDIAD
                     LSINENAAVPSENKIDSKAPNENDIESVAARKEAKQVRRKQTRAERKVKKNEKERELE
                     ELRRERKGEQASGEAPRKRASHLQRRHPLKE"
     gene            617071..620405
                     /locus_tag="CNH01790"
                     /db_xref="GeneID:3259166"
     mRNA            join(617071..617415,617464..618270,618312..619058,
                     619120..619172,619227..620405)
                     /locus_tag="CNH01790"
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /transcript_id="XM_024657672.1"
                     /db_xref="GeneID:3259166"
     CDS             join(617315..617415,617464..618270,618312..619058,
                     619120..619172,619227..620275)
                     /locus_tag="CNH01790"
                     /codon_start=1
                     /product="vesicle-mediated transport-related protein,
                     putative"
                     /protein_id="XP_024513345.1"
                     /db_xref="GeneID:3259166"
                     /translation="MTLPFFLQPLLLVACYYNRVIRSLKSWFHRYNDQLFGPLEQAVA
                     AMVIINLAMKPTAAPLGIFIQPSQVQMLQTPLSNLTDDQDGRRSGGSETASDGTTAID
                     SWSDGFSMLILSLSFFCSKLTSWMNPASIIIIILLTLNLVKGLDDGHLLGELRDLFTM
                     LWDRHRSLGRQERVVETQAHRSTNEEVKTEAPYKKGKDSESETRLSSIDKKTVRQAVK
                     QLAEDSVNCPPDPVQEGRERTKEPIEIDNNGQISSTDKAVDASQKEKPKHFENPSASE
                     QIRVLTESEKTQKSKITNDQVKSQSNKSQDKGKERMAGERTGDVKDETLVKTNTEKKA
                     GSKESLIADPSVASAQSKIQEEDALISGDYRSLKSALKKPTKKPKQTQNIHHNYFMTM
                     RGFRPALVPFPQGLHPKPHYPRNTMWWNNIPDTPEHIMAAPKVPKEPEEEVDVEEPKE
                     KKKVTEEKPIEKKFIEKKNEARKDDGKDMNGKLISESRGSEKTSANRIKAEAESKARK
                     KAEIKASSTGATSASSIATIDKDSGRASVAAKISQGHMSRNHQLDKATYAAQAMLCIL
                     LYQLYPQLSFLLLVFFVWQYIDSHQGSLPTLDDPRATDRSTVASSVAVSKPVSSKTTA
                     PSTTEKAAAETKHKVAEESNIGTSRSSPSQKSPENKDGSEKKLAELENLIKKLKSEND
                     LTPALKDQLKAALKRREGLIASLYDEGAEDNKTTTKGLMHKLEDVESYLKKHHAQNKV
                     TSGSEMKLSKVKAQHEVLKTKVANLQRRNMPVDKVKESGVTTPASKDDDHRNDTRSLP
                     EQREKKLQRDERASIKEHSSKRAKSSEEPNKSANSVTADNSEALSVDCRKMKDKIKAI
                     ESYIMKYRKLATLSDEQKEKVVKAEKQRKEMKEKLESIARKMANVGSSGLSIEEKETI
                     TKDT"
     STS             619618..620475
                     /standard_name="Eco28"
                     /db_xref="UniSTS:470899"
     gene            complement(620376..627719)
                     /locus_tag="CNH01780"
                     /db_xref="GeneID:3259212"
     mRNA            complement(join(620376..620519,620582..620687,
                     620744..621226,621281..621521,621572..621934,
                     621978..622092,622144..622865,622927..623142,
                     623193..624713,624766..626045,626098..626543,
                     626592..627205,627255..627719))
                     /locus_tag="CNH01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657671.1"
                     /db_xref="GeneID:3259212"
     CDS             complement(join(620673..620687,620744..621226,
                     621281..621521,621572..621934,621978..622092,
                     622144..622865,622927..623142,623193..624713,
                     624766..626045,626098..626543,626592..627205,
                     627255..627598))
                     /locus_tag="CNH01780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513344.1"
                     /db_xref="GeneID:3259212"
                     /translation="MSSDNPRPEDVETLLAARRRVQEKPNTDALLPVYLYLLPQSNEA
                     SSGSSPLEDHWYCSRSKSTLHIEAATYLIFLFAFQRQGTSKTWVDKLEVVLESCENCA
                     RSFGVARRRLESRYLSEWPAHVRKNFFAAVDKWQSTFILNHSDKASDRGYGKPSSTEP
                     ALYSLSQPIVQLLLGEPSLLSDPGVNSLYQDAFQSTLPAPTSLTALGMTPIHARLLSS
                     SEPAQNRWSAAQLPALARRPIRFSEWCNLGIGSEIQDLYNDGALDGEKRWQNVAAILN
                     NKVLDQETVEKGLLGGQLETDSRGRKGRGVMSVLSGLLSSDIPYLESVISCLATLLHT
                     SPTRYIWSFDTSPDLPHTLISELRTNPAFNELLETRYPSPLDSEADGHSAHGNGSNKS
                     KGRRKPDTNPLDWLGDYLLSVADTEKGLVTQVGEEKGSGMAFAEALAVTTNMVFQELQ
                     HGRLSNELRATAASAGFEAILRVYQTLIAEDVSVNTAISSTLDLHSSFITTVAFRSKN
                     HPLPAWCEARSSARALLTTIFQADARSTIHSLLTMAAVAHEERKRQQKKRRTKSDVAV
                     GPAKKVDHLPLASVRKDLWSMAYDALSPNDAAGAAILLKSLAPFSHIELLDRQASWYH
                     HGLEEAVKKEDWVAAIRAINTAIKATRESFPRAIESLASQADPSGVRSLWKEQGVAKA
                     ATILLLSPDDEIHTPIISIIQQSFDDVDDRGDCFRALLQHYPDTAVDGLNDFLRTFIE
                     TARITPESCSLAKWLVRCFHDVLEVLCRPSGVLGPLLQSDDFLTSFADGRSMRKRLEE
                     LWHLMTTSLALIFKRTLDWAPHFENEVMVDWMRDALIFGRQMTDHIRAFEAAVLGSSA
                     RGSETMSESSARQSLVGKKMTKQLELVLSDLILWLRLTDIETLFQTHQLIKTILGRIS
                     KSTTDVSKNPTLEKTLLDIDKFCRKGSRSFTSRLSDDLLSELSDLLEPFNLVDDSEVQ
                     FVKEVKPKSSSDVGTSRESTSNISTPSTSKAPVRNAFTEMMKASGGKLASSSKTSTST
                     AKSKLPTPNDVVDVDDFDDDFLSNISASDLDLIEKRAILKESARQAPPKPSIQSRLST
                     SARPHMPSSKLHVDLTYKVPPKPAPSFQSKVMQDIRREHYASIHERKRLEAGQVAPKL
                     PTASALGSGLGAYTGPPKPRVVEPVDSGSSASDSSDDERAAMKGLLSKQKSPAKPVRP
                     VVEKRSIKVLGDPIAEIHRRNEDRRAKAHATKMRLKPDLSPLYRYILSWDPDHQGPSP
                     PYGTKFAAELSDMRVVPTTFDSPRQYERIMLPLFLQELWSQCANDQVQVGPVIPVEVA
                     SRQYEDDLVEIDLMVIGAGDFYCNDSDLVTLRQPSNPKGIFAKIMGFKKHPKGSMIRA
                     RIMSAMDQKELCGKSKWQLRKHVSLSTSIREFAALKGLPWYESSLLSDILAGRSAVMP
                     KLSTQRIEDTMKCLSLNEPQAKAVLGALEVRGFALIQGPPGTGKTKTISGLVGKWMSE
                     RRVPISVDGQPPVKPKLLVCAPSNAAIDEVCKRLILGVPNPDGGQYNPNIVRVGIDAS
                     VNIAVKDVSLDSLVEALISNSSGRNVGGEYGRIQAELDDVKQQIKDKQEAIKLAQDHD
                     EKRKVLEDEYHALITRRTQLGQASSKAKDAARDATRHLDGARRAARDQILKDADIICA
                     TLSGAGHDTLAAHTFETVIIDEAAQAIEMSCLIPLKYGCKRCVMVGDPNQLPPTTFST
                     NAEKLQYNKSLFVRMTKRDASHVQLLSIQYRMHPFISELPSKVFYHGQLKDGPSMAKK
                     TAAIWHQRNIFGPYRFFNVEGTEMKTGTSTKNPAEALAAVELYRRLSADFGTRVNLAM
                     RVGVISMYREQLWELKRKFTEAFGSAILELVEFNTVDGFQGQEKDIIILSCVRSGPNL
                     SHIGFLKDTRRMNVALTRAKSSLFIFGNGPTLERSDERWKIIVQDARDRGFFVNYDST
                     TFNTAFLEPPPSVKKKASATSKSKASPGASKSTTMPDGLLPPKDLAADISTPSKVKRE
                     ASVELAKEKKKKRKMSDGSSRAEESNSNVAVATSKPTSRLSSGSTLPSVKHAEDSPQP
                     SSSKPPLPRIPRPPQSSTASKMTRPPPPPPEDVLFIKKKKKRLNK"
     gene            627779..629179
                     /locus_tag="CNH01775"
                     /db_xref="GeneID:36393000"
     mRNA            join(627779..628469,628536..628645,628704..629179)
                     /locus_tag="CNH01775"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658689.1"
                     /db_xref="GeneID:36393000"
     CDS             join(627890..628469,628536..628645,628704..629099)
                     /locus_tag="CNH01775"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514605.1"
                     /db_xref="GeneID:36393000"
                     /translation="MPSRPNQAISSASRRAKRTIDSASPSTSSASLTPPLSSQSHAAT
                     TTRSGRSVKRPLPDYTDDSDDEEDNGAAEDVDEDELEDEEESIDTDSVPVANPLRIKL
                     TVNNPGIQPKPRQSTSFTKKSATHKKKKAEEPPDMDGDMLDDDDLENEKGVTFGEGED
                     DSATGSKSPTKMTARQRAKGNKDLQEGLLVLEEAPSSRALVLTEQEKLERKEEASRRR
                     RRQVEQKLQDEQDETINRLLRAQTSRSRSKLDNPMDLDGDSPAVASPSRRVQPAPEGM
                     IRWSSKITKEGDVVMRVAAPKEKESWLDLVGTKLDEVDGKRRSLNSGKGMCDVPGCGE
                     KRKYRSVKDFERGGCCIEHLKAVEASL"
     gene            complement(629567..630467)
                     /locus_tag="CNH01770"
                     /db_xref="GeneID:3259324"
     mRNA            complement(join(629567..629723,629777..629865,
                     629926..630076,630262..630467))
                     /locus_tag="CNH01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_572351.2"
                     /db_xref="GeneID:3259324"
     CDS             complement(join(629661..629723,629777..629865,
                     629926..630076,630262..630357))
                     /locus_tag="CNH01770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572351.1"
                     /db_xref="GeneID:3259324"
                     /translation="MTFKRRGGGRNKKGRGHVKFVRCSNCSRCVPKDKAIKRFTVKNM
                     VEAAAVRDLSEASVYAEYALPKLYIRLAYCVSCAIHAKIVRVRSAKPGAINSRKNRNP
                     PPRAIFKDGKRVNPAVAAAMAAKTAQAEKV"
     gene            631553..633756
                     /locus_tag="CNH01760"
                     /db_xref="GeneID:3259277"
     mRNA            join(631553..632798,632846..633756)
                     /locus_tag="CNH01760"
                     /product="glycogen storage control protein, putative"
                     /transcript_id="XM_024657670.1"
                     /db_xref="GeneID:3259277"
     CDS             join(631877..632798,632846..633597)
                     /locus_tag="CNH01760"
                     /codon_start=1
                     /product="glycogen storage control protein, putative"
                     /protein_id="XP_024513343.1"
                     /db_xref="GeneID:3259277"
                     /translation="MYHSMPDSHDLPAQSIASSSRQPSSILNRADQHASEAGPSRSAS
                     TDKGYHADVVNRPKGDHLGVPPSSAYARGPTSPTSELSPLSCSGMTPHLDICKYPTQQ
                     LLRLLAGLLQHIAGSNDQLRAELEAEEDDEMDEQHVDDNTANVDRRSRPHSRASGRSY
                     VPSGTSSTAELFSEPASSTLTSPALTSRSSSAASSPTSYPLSQFPLFTASKSSLSHPS
                     ALLAFHARHIPSISIEAYLLRILKYCPATNEVFLGVLVYFDRMTKLGTPAGIGGESSK
                     VGKKGKGFAIDSYNVHRLVIAGVTVASKFFSDVFYTNSRYAKVGGLPPTELNSLELQF
                     LLLNDFRLRVSVEEMQRYGDRLLAYAEEAGEDIGTVGVERRRSDASEWGEFEGRHNER
                     GFEGRTFRESSGGRDSRSTRPTVEEANSAFSSTPTRNPASAASANAPLPNPVSIKYAS
                     TQPPLPPNQSSTPVTVPTSPRIVQSKTQPREAQQPQTRAQTQPMKSHTFPVGSSVPSA
                     SAGSRTGTGGGVANAGNGADTVSGGIRDWVRGDDPIAVVGGRMTSPMRD"
     gene            634317..638334
                     /locus_tag="CNH01750"
                     /db_xref="GeneID:3259249"
     mRNA            join(634317..634950,634998..635892,635959..636321,
                     636371..636434,636485..637413,637466..637998,
                     638053..638334)
                     /locus_tag="CNH01750"
                     /product="expressed protein"
                     /transcript_id="XM_024657669.1"
                     /db_xref="GeneID:3259249"
     CDS             join(635010..635892,635959..636321,636371..636434,
                     636485..637413,637466..637998,638053..638112)
                     /locus_tag="CNH01750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513342.1"
                     /db_xref="GeneID:3259249"
                     /translation="MPTNSTSPLSVSRPATTNPDVHVSSPTRPSFMSHRRGLQSSDSA
                     RDKDPMENLEGVHVRGHHQKRVSISSLADPVVNHSRRVSFSSEAIGDGQKSPIYQIPQ
                     RLGRGSLSISPETEVSDKNSIAKPRAKPRPLSFQGSPAASLLSPSSQSKFSITAAGKG
                     LTISPSLARNPSSGFKSIWSASATLPDNTYSGWNSPVNSPKTVGSDSGTIGSAALVAK
                     KRGLSIAIVKDNGGVIPVTPSLGSAGFKSQGTALEGAEMKMICASKNDREIVHATAAS
                     GLITGKLDSAKSSGSKKEIILCKFYHTTGLTCTSRPCRFVHALSSAKSPLPTDDISQY
                     AMLSPTRPIDPTSGTFAFAQQQINQVPKQLKVDSGGIDQDDVEMGERVVLKDQNGQEV
                     TGQVFLMSGGGKGAGGKGRNKYKTVPCKDFAEGHCPYGDYCSFLHDEKTRNVLPTDDK
                     SSRTKDHKPSKAGHKDCLVPSIRVGPDVIHKSRSSGLSAFGTRFSQIAVQVDRSRETV
                     AAPTPRRAVFPASSATLKAHTPPVPTSEPASVPMAVVTSAPPKSNAWSKGPPAPIKKI
                     RSLKKVTIADMGHKRDLNVSLDAPLKTPTSAGPLAVPLSAMSLWTESDPATPFDPMTH
                     RKRMLEIEEQAKKNGHSKVMPKSSLVNLAFDSSPAPSQVFTPSESFLPFMAPTYPWGM
                     PMSPVSVGAYQDPSIPDIEGGLGVIWTPTGWAVQDVAMKHALRSTEMKQKFENAKGRK
                     PMSYYRTRPCKFFAEGHCPHGEECTFLHIIPASSPEPLSSSDSDSADYKPKGQGNRRL
                     KTLPCKFFNSAAGCINGDDCAFLHTRIVPESAPLVARPRPWRTKPCRHYQLGRCMLGD
                     ACHFAHVDDPTWIASGRKTGIMTPVKVENALEQLTAEKVEMTIKRIREMSKERKEDDE
                     EDDEEDDIQIVTYSTLSPSTSSYGSSYAV"
     STS             636564..637367
                     /locus_tag="CNH01750"
                     /standard_name="Xba5"
                     /db_xref="UniSTS:470900"
     gene            638606..640075
                     /locus_tag="CNH01740"
                     /db_xref="GeneID:3259070"
     mRNA            join(638606..638852,639037..639105,639336..639486,
                     639538..639700,639755..640075)
                     /locus_tag="CNH01740"
                     /product="expressed protein"
                     /transcript_id="XM_572583.2"
                     /db_xref="GeneID:3259070"
     CDS             join(638810..638852,639037..639105,639336..639486,
                     639538..639700,639755..639793)
                     /locus_tag="CNH01740"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572583.1"
                     /db_xref="GeneID:3259070"
                     /translation="MLAAFALAVLPLLSSVIAIDGCTRNATVQSGDTCDSISRQYGVS
                     TYQLALVNDATIDENCDNLTPDETVCLGIEGQDCTKVYTVVANDTCAWVQEMYGISNE
                     TLYANNPQIDADCENIYVGEVLCVDTDAFSYPSYNESLYNALAWTYLPYCDE"
     gene            640691..642157
                     /locus_tag="CNH01730"
                     /db_xref="GeneID:3259097"
     mRNA            join(640691..640950,641035..641199,641254..641349,
                     641403..641422,641473..641628,641682..642157)
                     /locus_tag="CNH01730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572348.2"
                     /db_xref="GeneID:3259097"
     CDS             join(640887..640950,641035..641199,641254..641349,
                     641403..641422,641473..641628,641682..642068)
                     /locus_tag="CNH01730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572348.1"
                     /db_xref="GeneID:3259097"
                     /translation="MSTPTVTLNDGVKIPKIGFGLGTTHYAKECVEHLVSALKTGYTY
                     IDCAQMYKNSKSVKDALEKWGGKREDIFLLQKCGSGGGDSESEKNPKVILKGLLQEMG
                     VDYVDLYLLHSPLLFAPKYSINEAWAIMEEIKSEGLAKSIGVSNFREEDLMELQKTWK
                     IVPSVNQIEFHPYNYHADNMVRLQDFCHSNKITIQCYGPLTPLTKVPGGPVDSVVKKI
                     AQAKGYEDSQVLLNWAVQKSQGVVVTTSANEGRQKLQLEAITEKGELTQEEVDEISEA
                     GKKMFVRAFMQQVWDKARK"
     gene            643461..646509
                     /locus_tag="CNH01720"
                     /db_xref="GeneID:3259104"
     mRNA            join(643461..644397,644461..644660,644718..644816,
                     644870..646509)
                     /locus_tag="CNH01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_572558.2"
                     /db_xref="GeneID:3259104"
     CDS             join(643867..644397,644461..644660,644718..644816,
                     644870..646274)
                     /locus_tag="CNH01720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572558.1"
                     /db_xref="GeneID:3259104"
                     /translation="MNKEESWRREGIWERQCHAGPSRLRDEPEHAHYAARDTASRSSN
                     EDGSRRRHHGPTRTRRQIRQNQTLHLSTILPPLFLLPFLGVTSAAPAVIPAQPTRLRL
                     PSIPTVLPTVTTTLQPTRTLDKRVKYLTSVITPSVLPTEIHFVDETTLPYLLTQHADG
                     SWRKAEAGWFLYGRRIALPTDKATPSNDDEDHTEDAAESVTNRTVSIDSDNAMLTNGS
                     NSSVTASNATSTAVPSFAVEKALPNGWGYSSNRTSIYKVPLIAVASVIMAIAIVVLII
                     IYALNRRKKHRKQKRAKERLRRKALAAAGLTEDDIKCSTAETAFKEKLAEMERKHKAK
                     KKRDGQMGLARSKVKGWNARLGTVRRRKGKKEEKEHDAMSLKENKIMEEDIFERETVE
                     QPEIIVSPHLVSPPSPAPSQTPSEQPASVETSAPQSDTSFPVSPTPYFPPAYRPASVR
                     SIPTSTAGPSRPSASAHPPYVSSESSAQNSLAGEKTQAPGYYPAPATEDGEIALAVAS
                     RADGKARLVEPPAVTEEEDPHLRMNHVATDDKRVLERLRMGGSAPPPVQTEAEEGPTA
                     PVVDVDDAGFEIIPTIPEEDEAVRTSRESEREGLAFPPPPQLSARLVQFHNLDSPVPS
                     APPITSPSAPDHQYTTPSAPPLEVPDVEPSAPPLALDAEINGPSAPPLGSDVDSELEA
                     GPDSSHSLPGSHASTDASTMGQSDPDGMVSEERPESIASSIASSRSGSVQGVQGVFLP
                     RYEP"
     gene            646768..649914
                     /locus_tag="CNH01710"
                     /db_xref="GeneID:3259223"
     mRNA            join(646768..648646,648698..648824,648874..649277,
                     649321..649914)
                     /locus_tag="CNH01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657668.1"
                     /db_xref="GeneID:3259223"
     CDS             join(646893..648646,648698..648824,648874..649277,
                     649321..649879)
                     /locus_tag="CNH01710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513421.1"
                     /db_xref="GeneID:3259223"
                     /translation="METELVNHGDVFSSSPGRAQEHEQYKRTKSDNANSSVETRFIFG
                     GDKGQVSIGSMFIPKKKPLGMTRRQVVPTGSLSSVGYQGAAETSATDLRRQRQMGMDK
                     GENELRALGLTSRAEFENGKEERKAGKTRERDQDKRRFQKGALHTSRVSRSCSAAHDF
                     SDESDTKSPESFKKRSLLSSNREADRVFEQLLATEQNLEKLYNQTTSGARSGVTSRKA
                     VDATRKKGKGRESEPVDLRSPTKPTSAFKSSNRGTTSSNRAESNARRSNALRPTSSSR
                     SRSPHKTKETSKTKGRSTLDGVPRNRLVSVTKSEINDRLSSTVVEVSDTENDEDDELA
                     LGSTPPKHQSEGYRDKASAASSSSLSNGKANDVDAFSLMYGSQAPTKPIRNGRRLGRR
                     DSDVLVSPSDESMVFTPKPSRSLAASKRADRTINTTKNKATKRRSSNSSDNDETVVRV
                     GKGKGRPLSVEDSTPKSRNMKYTREGASKADVKAQHEDSDDDYVIHTKKSPVKRRKTT
                     VSQRYGKKTINSDDEDTTPAPFVPEKLTPETQKEREDTTRQPSVRNNDKGFYFFETLS
                     SNMDSSDYDEFDDEFLDGPSILVNADDELDAEKMALLGEDEFTKKEREYLLSHMDWTN
                     LCPYCNLPLPNKPSKHHEYLKAKLHKLSTPAPTDENPNARALSWQKAIEFCSLHHAET
                     TIIPLGIRAGFPVDIDFGNLDRRLETGWIRNELDKIVRQPEESAVFREVKKEVEEVGR
                     MKWSSLAHQSKEERLAAVKPGYYGELGRIIITDHFQLLRRLNYMMPNIPPAKSASELT
                     QDVVTAIDPLSPSDFIANVLVPEAANFLIMQDRGREGFDQAAYEAASKTRTESSKYGE
                     WKFPEASKSSKRVLEDLRSGIDDKRRRLAKIRGKKKMKSEKENLESAGESGDRQEDSI
                     VVEESSKEVHRSSSLYDKGWEEDHWKSAAKLVD"
     gene            complement(650709..655399)
                     /locus_tag="CNH01700"
                     /db_xref="GeneID:3259307"
     mRNA            complement(join(650709..650977,651041..651254,
                     651323..651441,651504..651618,651694..651851,
                     651924..652189,652256..652394,652477..652929,
                     652993..653115,653183..653269,653374..653671,
                     653746..654371,654435..654603,654660..655399))
                     /locus_tag="CNH01700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657667.1"
                     /db_xref="GeneID:3259307"
     CDS             complement(join(650804..650977,651041..651254,
                     651323..651441,651504..651618,651694..651851,
                     651924..652189,652256..652394,652477..652929,
                     652993..653115,653183..653269,653374..653671,
                     653746..654371,654435..654603,654660..655291))
                     /locus_tag="CNH01700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513341.1"
                     /db_xref="GeneID:3259307"
                     /translation="MQMRAQMSAAAQQQASQPFQLSGATNTETMRNVVGAFMSAGRQH
                     EQPAPARRPHKSEARMKKSHREEVWEDEEGGQFGEIDSAMRQVKKDWPFVMESDFSSS
                     SLALSLLSQAPSPSLPQHPGLSSFLRLHDSLSAGLQAAVQANSKSFAASLPAHQNFLD
                     ILERAQEQVRKSKQELKAARDGFAGKGKSELSGIRARERTVRDMLRILDTIDNLRQVP
                     DQLESLVGDKRFLQASLILVRSLETINKPELREIGALSDLRSYFMSQETTITEILIEE
                     LHNHIYLKTFYSDSRWRPYTPGRADLPIIGSQDEDLAFLRSPDPNSTSPNLSGNNTSS
                     TTTNGNANATAGPGTSSKFSRYLSQLSTKPSTRPMLQYDGDPIPSTYTLPAVHSHQQP
                     NALGLGSGTGIVQPGGSHTSLSSLLGTAGNTGNPETDSYVYIENLLEALAVLGRLGQA
                     LDTVAQRAPGEIFALVDGTLDEVEERTERHREEDLSVRPQNLLGNVDPTPSSRTNPPT
                     ATTTAVPSRKSLFSSAETSRIEISLGAAGPPQHAALLKDLFWTLYSKLAAVLEGHRVM
                     YEVSRWISSRPDFKDSTTPKGSSINIPVLEMWRPVQQEVRTLLSNYLTDDRPGSRLDR
                     NPILSINEVLRDPKVSRDKSKSMFRFNDSDSRAIQKEIKPIDDSVQQALRSSVPGLVN
                     MQSDQPVSIAPDTDDRFSPSSSRYRTLVPPNAFNVTTLFHPTLAFIHRASAIVPPGFE
                     SETQGFSTILEDFVVKVFLRQLDEKVTAGFQKAVSGYDAYQVDRGVLADTKQRPLKSS
                     VRVMALIHSLCIMLQTTPFHRENYSRLIVGVIVQYYQQCSARFKDLVSHPATFETDSE
                     RPMVIPAVWAQREDITKCLSEMRSVPTTDRAGMASVSHKEIRLEMELLRDRPVSESNL
                     INSSRKLEALGNLSQSLRWFIAALLDLQWVSEEPVSPEGEQPELDVLKTAPPLSADSD
                     EPRLPLTRAMAQRYQAIIQTYEQLAEMVVNAIRLEIRCKVMCNIGASMQKGDFRLESE
                     ALEPDSDILDLNASLVEFEELAQRTISPDDHSFIFRALGQLVDHCLIAYASKYVKGVN
                     AAGVRKIKRNILSLQQTLRGIATANEQGVLVRATEFWDLYEQGPKKMLEDLKNINGTP
                     PYAFEDYNTMLKLQCKSNTDELNTYLIDLHALSMDVEGWDLGED"
     STS             653234..653428
                     /standard_name="AC9"
                     /db_xref="UniSTS:470901"
     gene            655688..658665
                     /locus_tag="CNH01690"
                     /db_xref="GeneID:3259214"
     mRNA            join(655688..655949,655997..656285,656353..656417,
                     656465..656583,656650..656712,656764..656863,
                     656920..656995,657064..657214,657292..657507,
                     657576..657720,657794..657802,657875..657887,
                     657963..658241,658314..658665)
                     /locus_tag="CNH01690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572346.2"
                     /db_xref="GeneID:3259214"
     CDS             join(655690..655949,655997..656285,656353..656417,
                     656465..656583,656650..656712,656764..656863,
                     656920..656995,657064..657214,657292..657507,
                     657576..657720,657794..657802,657875..657887,
                     657963..658241,658314..658553)
                     /locus_tag="CNH01690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572346.1"
                     /db_xref="GeneID:3259214"
                     /translation="MPDTPPHKHHYTSLRSLMHSPDPGNPAKRDSLTPRQPRPSRNSS
                     SSRSRERRLDPPRKADKDKGRLSTWKLMCLTVSMGGSQIAWTVELGYGTPYLLSLGLS
                     EQLTSLVWLAGPISGLIAQPLIGAISDSSHSRYRRRYWIVTSTMLLVFSGLGLAFTEP
                     IAKALVDLIGGGQGDWDPKTIRLVKNTAIGIAVFSFYCLDFALNALQASLRNLVLDIT
                     PGEQLATANAWHGRFNHVGNIVGFTMGFLNLSHVPIIRLVGGGQFRKVCIVALVLLVM
                     TVWITCWTQEEKETDSIFGERRSKIRDVVGTIYEAVLHLPKPIRRVCIVQIAAFMGWF
                     PYLFYSTTYVAEVMAKELHHKPDIDRATRAGSLALLIYSFVAIIAGTLLPYLAARDRR
                     LLKPTSEKLRDGEIEIENEDEEDEEHVEMERIREMVQQWKAEAAREGRPLKLPTMPFM
                     LRNIWTAGLVIFGCLMMSTFFITKVWQATVMIALVGICWAIACWVPFAIIMEFLKELD
                     DKPPPRISDGRPRPTHARTASTPLGWRSHPTSPAGRASPDERTPLARSYSTADLDGAN
                     EMEYTGQGPVAGGTIMGIHNLAIVFPQFIIAVVASIIFKLADTQPDIQPTSPEIGGPH
                     GQDKNGVAWVLRFGGLMAFVGALVSRKVPPTKTEKAMRRRLADMREESAE"
     gene            658884..661354
                     /locus_tag="CNH01680"
                     /db_xref="GeneID:3259101"
     mRNA            join(658884..659077,659139..659178,659238..659388,
                     659501..659772,659828..660270,660326..660449,
                     660502..661354)
                     /locus_tag="CNH01680"
                     /product="expressed protein"
                     /transcript_id="XM_024657666.1"
                     /db_xref="GeneID:3259101"
     CDS             join(658969..659077,659139..659178,659238..659388,
                     659501..659772,659828..660270,660326..660449,
                     660502..661297)
                     /locus_tag="CNH01680"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513422.1"
                     /db_xref="GeneID:3259101"
                     /translation="MSQRQGRRSMGPTSLPQQTSQERREQGFVEQQKFDDFRRRHREQ
                     NKDIILDNVERKKIIKTLQDEISILQNELLDVRRRNMALESRVKKMERENSRLGGVDV
                     LKALDHLLAAAPALYNLRQSLSSLPIPLHSTSYKQPSNTRPTLTFVGNPTATRPAANG
                     KQRQDLGAVVESEEGDWVDDRRVTSRSRGRGRQTDVGSVAASRSPRPKTPVSPARSSI
                     SPSPKKIISTRKVPAKRRRESGLLSTRPRSCSPEVVSEQEPAIPVQQEPQVMDEEPVG
                     GTKVDEEPLGETSEWEEGPVVEMKPDEALALVQEEEQVDFSRKEKEATIEPGAEIVKV
                     NETESESDPSRPSDLTITDNAEPEGTGRGRRARASVVSYKEPSLVKKMRKPDGIQTQD
                     VIKTLTRKSISPRRVKSSLSPKRTKKDAYNTSPSPPMPLIPEGSLSSRSASTRTANLS
                     ASSQSMRRKSTLPKANSRSRGKQEEFGKMARAEDKGGEDLEEYEDVHDEGEELDLKFG
                     RSLQIGTGSGFRKPSSSSTSSHHSAMRSNAPKTLPTASVPAITLISAPLPANKGESLS
                     AALNVDPRLVISTGSGMTTSSRRQSSARGFRPTSTTRPRDVLTEVRPSNIETKPALEQ
                     DLKKDAGEVARGTRAVGVLQ"
     gene            complement(661503..664891)
                     /locus_tag="CNH01670"
                     /db_xref="GeneID:3259332"
     mRNA            complement(join(661503..661812,661870..661952,
                     662010..663175,663221..664891))
                     /locus_tag="CNH01670"
                     /product="expressed protein"
                     /transcript_id="XM_572557.1"
                     /db_xref="GeneID:3259332"
     CDS             complement(join(661726..661812,661870..661952,
                     662010..663175,663221..664455))
                     /locus_tag="CNH01670"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572557.1"
                     /db_xref="GeneID:3259332"
                     /translation="MDDDYGTGVPDARAPSGSHSYHCSHNRSYSEAPHDVAHSSATSS
                     FASDQPLTAVLGHHPHHPPHSCSPVHIRHHAISTARVPHSRVSSAGHYGTHADEIAYA
                     MLAVVIGRASASDLRTVIGKKRTRCGMIVQNERRPNIQTRRSSSVASVKRPHGSPTSQ
                     TSFKLLTLDPRTLPTLPIPLPPVDHILDPPKDGDFFSSFIPPEKSGWYDSIPRSSSAP
                     SVPFLALERRGSNASLTSAMSVDTHLVAQKTFLNASQPHDHDAPRIIRYNPLEPLISS
                     PETATFDHRAATPQTHQAMLDVRQSEPHGRYNTFELMAHDSAGVTSYLDPDLSATFRK
                     RMAESSSSRNNDGDARVMGPDTMGVSSDNAWVGESRSGKEVFSESEWTFEEPILKAMG
                     DAVRGKIEMIKEIDHYHVAEYGCHKETPNPIIAEVIESLCLRSTSKSPKVFSVTHQAN
                     PDFDTRALQYNLASQASSYRKIGKLPLAPSPLILTSFSFAGFTENALPADTVDFALCA
                     GELSKLQGEISPRPFSAFASQADEKEKQAIKDLVDWLEAKSREVKKGGILVCWMVIRT
                     RQPPESTSSCDSLPHPPKASPYRAPASFPNSPNINLFTPHPHAPLTEIHPSILPHQNH
                     HLTPSTQSTLPTRYRTDIFQLISQALSPAIQSLVTLGEIRTHVAPALVDIPYWPRTLA
                     SVQAALGQAEDWEVIIDRDEVNEDETGDNLEHMLDDMDVDSSSPISKDSEGFDVDKPL
                     KASSRAKTAAESHYPPEEVREWAQAGVRIHRLMHPAWKAFHQGRIDRQAYARRIATYC
                     HSVYGPHLKKVLREKGRMDISQCENTVQEMFKILAEKCELGALSALAIDIGVIVLRRK
                     "
     gene            complement(665315..667255)
                     /locus_tag="CNH01665"
                     /db_xref="GeneID:36392999"
     mRNA            complement(join(665315..666066,666124..666168,
                     666225..666276,666329..666444,666531..666581,
                     666630..667050,667207..667255))
                     /locus_tag="CNH01665"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658690.1"
                     /db_xref="GeneID:36392999"
     CDS             complement(join(665368..666066,666124..666168,
                     666225..666276,666329..666444,666531..666581,
                     666630..666890))
                     /locus_tag="CNH01665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514606.1"
                     /db_xref="GeneID:36392999"
                     /translation="MANHHPLLSALPQPSPTTYGASLSVQTRAKNLLSMSSNTNTSPL
                     KRSKSTIPMPGARPKRLSTTSSLVKRGSIMMMGEFGGDGSGDENAGLKRMNDELNKTV
                     AALRGRISELESAIDHGTGPEVERLTKEVSTLEDLLEETQRDNKAKHAESERQKQYVK
                     DLENLLTELAGPHWRIHHGIVSPHAPTANNVTAPTPLPKPKPIHSLRHSVSFSNTRSG
                     SKLHHRTSSNLELAASSITLPGMALQSVKEVGEADNNTPTGALKRLCVNSSTELKGMG
                     QDTRKAKKELEDVVLVKTPKLNNDLTLVEKCAFSKATPCLKSCDVNHEKLGQILGILS
                     SLDPGKLLALNNAGPCAEPHGDEKAARMRKQESSMLRRMLDEQEKRLNEREGRLKWMV
                     EMVRAEKGKYDSRSC"
     gene            complement(667330..668706)
                     /locus_tag="CNH01660"
                     /db_xref="GeneID:3259017"
     mRNA            complement(join(667330..667578,667630..667707,
                     667763..668035,668088..668166,668214..668297,
                     668359..668706))
                     /locus_tag="CNH01660"
                     /product="small monomeric GTPase, putative"
                     /transcript_id="XM_024657665.1"
                     /db_xref="GeneID:3259017"
     CDS             complement(join(667519..667578,667630..667707,
                     667763..668035,668088..668166,668214..668297,
                     668359..668435))
                     /locus_tag="CNH01660"
                     /codon_start=1
                     /product="small monomeric GTPase, putative"
                     /protein_id="XP_024513340.1"
                     /db_xref="GeneID:3259017"
                     /translation="MADQGYMSSGSGSGRASGGEGSDRNSIVLKVGMVGDSQIGKTSL
                     MVKYVEGSFDEDYIQTLGVNFMEKAISIRNTEITFSIWDLGGQREFVSMLPLVSNDAV
                     AILFMFDLTRKSTLNSVKEWYRQARGFNKTAIPVLIGTKYDQFASFPRAEQEEITRQA
                     KRFSKAMHAPLIFCSTSHSINVQKIFKIVLAKAFDLKCVIPEIDAVGEPILLYVDV"
     gene            668880..671257
                     /locus_tag="CNH01650"
                     /db_xref="GeneID:3259224"
     mRNA            join(668880..669242,669298..669433,669483..669574,
                     669621..670435,670497..670994,671053..671257)
                     /locus_tag="CNH01650"
                     /product="expressed protein"
                     /transcript_id="XM_572344.2"
                     /db_xref="GeneID:3259224"
     CDS             join(668897..669242,669298..669433,669483..669574,
                     669621..670435,670497..670994,671053..671196)
                     /locus_tag="CNH01650"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572344.2"
                     /db_xref="GeneID:3259224"
                     /translation="MSLASHAASVVRSSTRRRTLIAAAHRTQRPLYRLAFLLPARTYA
                     STVTARLDADPVPVIAASKRATPVEGATTILPVLQELIVLLENEIGGDGSWAKRVRRS
                     MEDLAVKRRGRIAVVGDTAAAPRDVVSALLQDPLADSATTRQALVSRHQDANIDVFEI
                     SQGERLNREPQSLSLSSSWLQATGYDVVEVNIRNLETEPVISTLLSTDALIVVLDPIR
                     LTSTPQLSPILPHLLARSPIHFVVNGHLPSGVSQSSIEHTLREQLKQITIEPLDDVHY
                     DPAALKVSFVQAEKALMALEALSGGLSKAASSETKAEAFEVFQREFIQSHVGPLQSTL
                     HQTLSNRASPQLSTAKQVASLALMHISNVILSDRDVARAASHTVSKLRRAAHEGAAKA
                     KHMSVATRGVDGALVEGEVKYEMEKIKRQIETSFQGRLSWLGLLGRLRVDDVALELGG
                     FVGSRFAVDLERQMVFESGQLSHLQSSLSSSSDQIIRQLSHTSTSPTQSFPHPHPFTS
                     PLLANHLSTLSLSIPPLTPTTLLSPILTRRNQLVTQSIPRLQLSAQRALLTTYSTALL
                     GASLSWAAYVPPIEILSAGTAGGLGLLSIVGSLALGQKFWAGAQRKFWRDWNRVTGML
                     KGDLETRLDTVLQTQVLAKPLAASEGLEKLIEKREQRLDALQNDVDKLKSRL"
     gene            complement(671239..674863)
                     /locus_tag="CNH01640"
                     /db_xref="GeneID:3259192"
     mRNA            complement(join(671239..672022,672080..672181,
                     672253..672551,672604..673581,673635..674409,
                     674459..674863))
                     /locus_tag="CNH01640"
                     /product="ATPase, putative"
                     /transcript_id="XM_572343.2"
                     /db_xref="GeneID:3259192"
     CDS             complement(join(671316..672022,672080..672181,
                     672253..672551,672604..673581,673635..674409,
                     674459..674534))
                     /locus_tag="CNH01640"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_572343.2"
                     /db_xref="GeneID:3259192"
                     /translation="MEADVVRLDLVMGVALDGMAAPLGVFGPPALAHSLNPLYQAAPS
                     PFPNLRKESREADDQEEGMGLGFTSMPVAVLGGGGLPMPQMGHMGQQEEDFVAGRANE
                     EWIAFFSRIINAETAEAGKKRIVVLESPLAMSKTFPVWWPSLVEAVQRRRRGLITPGR
                     KKMIPKNGSAEPSLVHPTSIVLQCTPSPLLPHTSPSMFAPTEKEDHELAAEEHVEDVD
                     EQEEATHAAISALEDKFRSMGFNVHHHVEVVKPRSGAKLWWGNEESDPAGRREGDQSR
                     LKAILGKGLSSVLPPFDGQSSDSGNQSRNPLQRLLMSRMGHVNRSEQNESSGAPLVWK
                     AFPIVPLHRNFDAEKESRTLRRRIYSAALITRAVYQLGGELQDPLEILKLSESTGRPL
                     TRKTGPSSVSKGWGNAVVSWSDALHIASIAVGRAVQNGQVDGGGATVHWADIIAARQA
                     AVEEKTMTADQISKHIPAALKRDGAGPAAKGAKKEEAQQVVDPVVENLRKDKKLSQHE
                     KRLLNCIVDPSKLASTTFRDVHLPEKTIDGIRSMISLPLLFPEAFRGGVLKDHATTGA
                     LLFGPPGTGKTLLARAVAAESGARMLAIQPSDVNDMYVGEGEKLVKAVFSLARRLSPC
                     VVFLDEVDALFGARISRGSSGSMSHNLILTEFMQEMDGLSSAIANKDKRVVVIGATNR
                     PFDLDDAVMRRLPRRLLVDLPGVEDRKAILEILLRGEQLGEDVHLDQIAKETDGFSGS
                     DLKHLCVSAALSAVKDTVSVPWRHLSPSSVVSSSLGSEERPRTPLPGGDGRGRGGGGG
                     GLGNEVLVMAPTEGGGGGGGGRKKVRVKKEKASATASYGEESISSAAREESESPDEEQ
                     EQLGVGEVPEQVEEEQLLSADRTRDASPSEDAPEPAKPPPIEEEQTVPKRVLMHKHFK
                     TALEEIRPSASEEGSLPELRKWAEQFGEGGKRRGKKSGFGKGFGFSDEPVRDRDTGYG
                     KVRQDD"
     gene            675209..676319
                     /locus_tag="CNH01630"
                     /db_xref="GeneID:3259171"
     mRNA            join(675209..675293,675346..675579,675617..675664,
                     675715..675854,675912..676319)
                     /locus_tag="CNH01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_572342.2"
                     /db_xref="GeneID:3259171"
     CDS             join(675245..675293,675346..675579,675617..675664,
                     675715..675854,675912..676133)
                     /locus_tag="CNH01630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572342.1"
                     /db_xref="GeneID:3259171"
                     /translation="MVWRTMLVTVSTSFLLGTTFTHWIADHNVLWRSPVTTEAISHSI
                     KYYSLLASAPNGLGWVYIAVGLVLLLSAGGRSIKGYRGSSGEVLFDGGSLVLVASIAY
                     YQLSEVYPAVTMIPSPLPVNLVDHPLYPALTTAVSDLATGNIMTALMLTGLILLQAGR
                     YYAKRPTFPPTTTDESAASTPASASCPSSPETHPIPVSQRSATPFRELTEDEALELDA
                     SGGEESATRTTY"
     gene            complement(676249..677309)
                     /locus_tag="CNH01620"
                     /db_xref="GeneID:3259352"
     mRNA            complement(join(676249..676443,676508..676607,
                     676658..676742,676805..676990,677061..677309))
                     /locus_tag="CNH01620"
                     /product="imidazoleglycerol-phosphate dehydratase,
                     putative"
                     /transcript_id="XM_572341.2"
                     /db_xref="GeneID:3259352"
     CDS             complement(join(676341..676443,676508..676607,
                     676658..676742,676805..676990,677061..677195))
                     /locus_tag="CNH01620"
                     /codon_start=1
                     /product="imidazoleglycerol-phosphate dehydratase,
                     putative"
                     /protein_id="XP_572341.1"
                     /db_xref="GeneID:3259352"
                     /translation="MSERIASVERTTSETHISCTIDLDHIPGVTEQKINVSTGIGFLD
                     HMFTALAKHGGMSLQLQCKGDLHIDDHHTAEDCALALGEAFKKALGERKGIKRYGYAY
                     APLDESLSRAVIDISSRPYFMCHLPFTREKVGDLSTEMVSHLLQSFAFAAGVTLHIDS
                     IRGENNHHIAESAFKALALAIRMAISRTGGDDVPSTKGVLAL"
     gene            677466..680506
                     /locus_tag="CNH01610"
                     /db_xref="GeneID:3258986"
     mRNA            join(677466..678322,678374..678510,678562..678661,
                     678737..679096,679147..679345,679403..679530,
                     679583..679935,680009..680235,680295..680506)
                     /locus_tag="CNH01610"
                     /product="expressed protein"
                     /transcript_id="XM_024657664.1"
                     /db_xref="GeneID:3258986"
     CDS             join(677627..678322,678374..678510,678562..678661,
                     678737..679096,679147..679345,679403..679530,
                     679583..679935,680009..680235,680295..680416)
                     /locus_tag="CNH01610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513433.1"
                     /db_xref="GeneID:3258986"
                     /translation="MSTLPRPSATISSRNNPPSSDTIVASSPLAAVAPDRRLRFHSAE
                     GLGPMKRRKISPEMFEPAATGQTQSPVAGRRLNQQPPPQAACIPIAALLYHSAQVAHQ
                     TSHVHLQQAFVPTEISTDRTSGYSIIKLYSYSSTPQSSQSNRFSHDPQAFAKALGLQL
                     YALDLLRAGLNINSLSDKERVAFSLEFGVVGIKVYMAQQILQSKSKGKEKIQGVQVDC
                     QRLMDDMQDIVGQAFFIAQRQSSLTPMRLELELINARLAFMQKKFNLGKKLVQTALAA
                     SRDNAVHRYSLCLLYLEYVESTGPADFLNIATEFLNEARKNNHQMIVQLALLIKARIT
                     FVHRRWELVPTALAEFASSIGWSDSNPPTDLLSGQKEERTWLACLNIHYLILRALWEG
                     RIGNDSVAKEIMKRAYALMDETADKKVFSELRANGGVITLHIPNSRPLQVQTTPPNIL
                     YMLTYLTTVVGRRDFTGSNATCKSIVHPRVLRETEGVARTEDMWDSGFSSVHGLAQAM
                     ALRKQVISIKGEVMIEQATAMIYRSCFAEGRQLLYETVEQLHDHNLFHPLSPHLCLTF
                     AQHAHHLGLTSSAIRYYKACRDLINSGSELSLIAQVGLLAVQNKLEGLEKNAEGQDEV
                     NALAEKCKGSSSAMFSAAGYFLASLTDDNRVNSKKKLSTAYEISQRSNNNILRLLIFA
                     FTTSTHHYGGRERMLRQLETGRDISKMLGGKDRDDGVGQVVLGMWFARRLKEFYRQEG
                     YQTGVQVAKESEKSHFARLNDLMREAEKVAKGG"
     gene            complement(680468..681151)
                     /locus_tag="CNH01605"
                     /db_xref="GeneID:36392998"
     mRNA            complement(680468..681151)
                     /locus_tag="CNH01605"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658691.1"
                     /db_xref="GeneID:36392998"
     CDS             complement(680565..681062)
                     /locus_tag="CNH01605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514607.1"
                     /db_xref="GeneID:36392998"
                     /translation="MSRLGSLPANLCAHLQNTSRSFHPRACIPYTNSALAISNILLRS
                     GLVSNISLGSPAGPDPASFNTLPVPAKKLWIGLKHRDGQPVLRRMNLVSKPSFRVVVS
                     KEELGRLLVGKRARNVPGVGIGEILIVKTPEDRREGRSNAERYMEGWEAFRAGLGGEV
                     ICRVA"
     gene            681308..682669
                     /locus_tag="CNH01600"
                     /db_xref="GeneID:36392997"
     mRNA            join(681308..681653,681707..681892,682268..682669)
                     /locus_tag="CNH01600"
                     /product="expressed protein"
                     /transcript_id="XM_024657663.1"
                     /db_xref="GeneID:36392997"
     CDS             join(681324..681653,681707..681892,682268..682621)
                     /locus_tag="CNH01600"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513434.1"
                     /db_xref="GeneID:36392997"
                     /translation="MSLLSFSNIAGPSRLPLQVTVTACRRAVAARFYATEAQEPQEPL
                     AAEQSEQSAPVDELSALTLDPSTPATRSGLEKREGRIFYRDWLRYEGEQFRVPQKGQK
                     AKWLGGNVPYPSNPSFRPPPPLSNHIQDQVFADLQRGQSVAELSVKYNISKARVEAIQ
                     KLKEIETEYKRRSLPLQTAFLEGMEPLLGVRTPISPRTRQHDPALARELDLAHEAHPS
                     TAAERLEEQRFDAGIGEEGAFGQRTRESTKPSIERTVWEFMDEESALLEKETQGQKTR
                     EKRQRRKEREART"
     gene            682807..684987
                     /locus_tag="CNH01595"
                     /old_locus_tag="CNH01600"
                     /db_xref="GeneID:3259284"
     mRNA            join(682807..683800,683865..684073,684139..684205,
                     684259..684987)
                     /locus_tag="CNH01595"
                     /old_locus_tag="CNH01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_572585.2"
                     /db_xref="GeneID:3259284"
     CDS             join(682881..683800,683865..684073,684139..684205,
                     684259..684946)
                     /locus_tag="CNH01595"
                     /old_locus_tag="CNH01600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572585.2"
                     /db_xref="GeneID:3259284"
                     /translation="MVAAYQPLPSSENTYPPPHSEPPRQSLRTLLPWPSSNPLPGPPY
                     PLRPTKSRLTPIHIIKYALAVTGGLIIFHYVVVGAFPNSKYTVKFREKFTGYKAWEAD
                     EAYKAATASAEKVLSHLNPSAGQPGTFFRDSFPIKSMLAFWELAEKEVAAKGLDTCND
                     QLGRGLVEGYHSSELAYCVPPGEGDAFEALNTLNMSASWDVASGEQVPATRISCNPVQ
                     DNDFTNWWPYPAAPCVSTNLRTIPDESRKYRAVGCKITDKGVKLNVDMGREKFLGAQM
                     ESVDMEDERAICKERIERTTVLIGRQDQWNPFHVAEDLITTLVTLFIAARTAPALVNS
                     RVQLVFTEGYSMDGNHFTPLWDRVGAWAPRRLSLDPWQEGECLTNAIHSVGAGASLLS
                     AMGVGKSYSCASTITWAASHYYRHLFGLLPPSVSSASTLSQTRRPINVLWLSRAKLDH
                     YAKEHNDWSSWRDVRHINNEKELVTRLKDGLRTMCDQPSSVFGTPGCVFEDARDTPES
                     WTLSSPDSIESDDLPLPVRFAQMDPSVQTIENQVSMVGHATVLISSHGGALGLSLFLP
                     PGSSAIVELQVGGVKGNYHFQHMAYEMGHQYEVLGIERTVDVDQVWESVQRWVEKIAA
                     KGS"
     gene            complement(684976..686467)
                     /locus_tag="CNH01590"
                     /db_xref="GeneID:3259335"
     mRNA            complement(join(684976..685136,685190..685588,
                     685645..685841,685904..686175,686228..686467))
                     /locus_tag="CNH01590"
                     /product="phosphotyrosyl phosphatase activator, putative"
                     /transcript_id="XM_572340.2"
                     /db_xref="GeneID:3259335"
     CDS             complement(join(685039..685136,685190..685588,
                     685645..685841,685904..686175,686228..686410))
                     /locus_tag="CNH01590"
                     /codon_start=1
                     /product="phosphotyrosyl phosphatase activator, putative"
                     /protein_id="XP_572340.1"
                     /db_xref="GeneID:3259335"
                     /translation="MSAPESSPSTFYTVPTKHILSKAHLAAFQRSKTHSDIFNFIEEL
                     NEDIVGKKLTEAGQGSERTRPLISILDSVREIAESTPPVDNKLSRFGNPAFKTFYDKV
                     GDASLELHKRIPGLPEEAIQEVEVYFKESWGNKQRVDYGSGMELNFLSWLLCLAKLGV
                     VTKEDYPFLVLGVFWRYIEVMRYLQSTYWLEPAGSHGVWGLDDYHFLPFLWGSGQLRN
                     HKYLRPKAIHDPEILGEFSKDYMYLSCIEFINSIKTASLRWHSPMLDDISAVKTWEKV
                     NQGMKKMFVAEVLGKLPVMQHALFGSLLPFPTPEEDPELKRALEEEDGQSATDMHGHI
                     HDPSEKGWSMDCCGIPVPSAFAAAQDANSHKGVPTLGNRPGIKPIPFD"
     gene            686573..687825
                     /locus_tag="CNH01580"
                     /db_xref="GeneID:3259363"
     mRNA            join(686573..686666,686724..686823,686875..686890,
                     686950..687041,687095..687470,687533..687649,
                     687707..687825)
                     /locus_tag="CNH01580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657662.1"
                     /db_xref="GeneID:3259363"
     CDS             join(686574..686666,686724..686823,686875..686890,
                     686950..687041,687095..687470,687533..687649,
                     687707..687785)
                     /locus_tag="CNH01580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513339.1"
                     /db_xref="GeneID:3259363"
                     /translation="MVSFSSLLVLLKIIPLFVMSVAAYTDAVMLFGDSLTQAWSAGSF
                     AQRMSEFYLRRADVINRGFGGYNSEWAIPVFEQVFATKKDREQGGIQQVKLITIWLGA
                     NDACLPSSPQHVPLDKYKSNVKHIVNLIRDPSSPYHSQETRIVLISPPPIIETAWIES
                     RLEKWKSFGCEGPEPEQNRDAEVTKQYAEGCKEVGAELGVPVVDFWTAVVEAAGGEKD
                     EQLAPYFYDGLHLTSEGYAVLFKAVSGLILATYPELNPETMPMRMPHWADVDTENPRA
                     AFEKVKKGRLAGEL"
     gene            688066..690006
                     /locus_tag="CNH01575"
                     /db_xref="GeneID:36392996"
     mRNA            join(688066..689247,689324..689695,689786..690006)
                     /locus_tag="CNH01575"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658693.1"
                     /db_xref="GeneID:36392996"
     CDS             join(688081..689247,689324..689695,689786..689875)
                     /locus_tag="CNH01575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514608.1"
                     /db_xref="GeneID:36392996"
                     /translation="MMASPNAIPGPPPVPPLRSRSPLPPSPSPSLARSYTHGGQPARP
                     LPPPGAPSPLSINTNPFPAPPPPAQYSPFTPSQSSQPSAPVSAAVESDLDRSDTLSSV
                     KSLDRTSFSSPSSRRPLPKPPGGVNPSRSLDRGVAPSLAVGEGIVRRGAGRKQPSIVN
                     EECEETLIGLPKSGNSSAGSHSPQAVPHPYLPQQPPAIIIPDVTTQKTIDTYTPAKCP
                     QLPVINIGDSDSSSAVSPDDEGNNMVSEATPKSKKVSALPVSPGIQFTGAPVIAVSSF
                     DTADDMLQGDEISFSVPMINIEGDFSASTKTLPRIASDSSRPPNPPRHQAHIHPNSAI
                     LCAGCQTPIIGRIVNAMNQRWHPHCFMCAECGELLEHVSSYEFEGKAYCHLDYHDKFA
                     HHCHHCKTPIVESRFITLDDEILGQRYYHELHFFCSECGDPFLDPSKSSAPGTEKGKQ
                     GGSDGQEEDGETNEFVIHKGHPYCERCHLRLHKPKCKACTLPIPDIAINAMGAKWHKE
                     CFVCSRCHNDFANNLFFPKDGTAICTICYEQVMS"
     gene            complement(689982..692418)
                     /locus_tag="CNH01570"
                     /db_xref="GeneID:3259169"
     mRNA            complement(join(689982..690412,690471..690533,
                     690582..690618,690673..690788,690838..690879,
                     690939..690994,691049..691159,691213..692418))
                     /locus_tag="CNH01570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572338.1"
                     /db_xref="GeneID:3259169"
     CDS             complement(join(690156..690412,690471..690533,
                     690582..690618,690673..690788,690838..690879,
                     690939..690994,691049..691159,691213..692237))
                     /locus_tag="CNH01570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572338.1"
                     /db_xref="GeneID:3259169"
                     /translation="MPSQSPSPFPETSLGASSQPVDSANNLQWSSAPPPLPPRPPPGA
                     HRKPVPALRNDDLHGQPLQRHSMSPPPVPSRPAAGIAAPPATFTTAYNTAAQSTLPPQ
                     PPPPRLIDEKNSSQPPPGKRRGCYPSTRRGRIWFWGLIALIILAIVIVVAVCASVIPK
                     NNSSSDTNSSSDTNSSSDTNSSPGKSYHGGHPLSIAEGGVDIGQPGDIAVFGKNSTDH
                     FVMTTNRSIVVTRLDPVVFPGSIGAHVHRVHGSSYFTQNLTSATEMQRLANCTTTVVQ
                     DDLSAYWVAGLYYRYPNGSLASVRLDRTSLYYFQKAPTGVPIYPFPDNYNIIAGNPYR
                     RAINYSDPTHISKWFQCYRGGGNDLRTYGFPKSPCSDGLVQAIQFPSCWDGVYAEDGD
                     YSTHVAYPIDNTNGYYCPDDFPKKFITLQFETVFAVYDFPYNGNDQITWVLSNGDTSG
                     YGIHADFMNGWKPETLEAVLNDCRYMNATSEDPISDDPPNCPPLNKSINMDITHSCRL
                     QTPIVNEEVGEHSLLEYLPGCNALWSGNISKPACPSGHIDGGDLDLVSPSVWYREEPY
                     IS"
     gene            692928..694920
                     /locus_tag="CNH01560"
                     /db_xref="GeneID:3259175"
     mRNA            join(692928..693363,693413..694250,694307..694453,
                     694515..694728,694783..694920)
                     /locus_tag="CNH01560"
                     /product="expressed protein"
                     /transcript_id="XM_024657661.1"
                     /db_xref="GeneID:3259175"
     CDS             join(693952..694250,694307..694453,694515..694728,
                     694783..694845)
                     /locus_tag="CNH01560"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513338.1"
                     /db_xref="GeneID:3259175"
                     /translation="MSFSYYPILGLVALAPIFVLSLPFGLDSYFHSPNLFASSLNIAR
                     TLPQSCSVSNIPVPLGDQTTLSVSDDEVSSMIAVGRGIQNYTCTSGAYVSTGALANLF
                     DVTCLYALTAGNFDPSFVNSMLPKMTFVALDYPNTDDLHVAIHHLFVDTPGSTSVGSI
                     SPEFLTETDRVLASKAATLDDPYNPAINVPWLKLASVEGQGTYAKSIFRINTFQGQPP
                     SSCTTENEKISVQYASMYWFTK"
     gene            complement(694233..696547)
                     /locus_tag="CNH01550"
                     /db_xref="GeneID:3259358"
     mRNA            complement(join(694233..695723,695765..696025,
                     696077..696300,696342..696547))
                     /locus_tag="CNH01550"
                     /product="expressed protein"
                     /transcript_id="XM_572555.2"
                     /db_xref="GeneID:3259358"
     CDS             complement(join(694963..695723,695765..696025,
                     696077..696300,696342..696424))
                     /locus_tag="CNH01550"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572555.1"
                     /db_xref="GeneID:3259358"
                     /translation="MQDTSPINCNCCQVNQKALYCPACLREGITLHKELLQNLQARLS
                     TIRQHSQKLLTGTENETKDKADRGLNAWRELRSDVASSEARCHQIKMTISQRQAAISA
                     CRKRIAENNIRDRRESLSMLKSRPSPVSSLRDSIKQVHSQQQVITSRIIHARRVLVRE
                     AVNVFGVRQRPSGDWEIAGIPLPDPETFRVHPSSSINAALSHVIHLVSLITTYLSISL
                     PFVPMPPPPFYHPHVGRPLMKANLPFVSTTKWREKHVLWMSSTASVSSKIKPQSTPPI
                     SNLLAQPSICSIIAKSTSKHKQFLVSFALLSFSIAYLAWSQDVPGIGIRGEVDGDDNA
                     GVLFDEESKVTQGQSVSAESSVTETALISPASILRLIHAITQSPTLGHRSHDPGGART
                     LKHMGFGLDVSKLVSTILRAEELQWDLKGDTEAGDDILSEGWDLLDSGAP"
     gene            696726..698203
                     /locus_tag="CNH01545"
                     /db_xref="GeneID:36392995"
     mRNA            join(696726..697011,697059..697119,697191..697211,
                     697250..697412,697460..697815,697854..697983,
                     698037..698203)
                     /locus_tag="CNH01545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658694.1"
                     /db_xref="GeneID:36392995"
     CDS             join(696882..697011,697059..697119,697191..697211,
                     697250..697412,697460..697815,697854..697983,
                     698037..698069)
                     /locus_tag="CNH01545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514609.1"
                     /db_xref="GeneID:36392995"
                     /translation="MLGGGSFDPGYVMRHPVFLVTFIIAVPSWIIAFAGQCAAEAKYS
                     TSNGRAPVAGTLWFNIWLQLLVIIQLFLAISSDDLALHRFQLSIFLAIATTLAVGGVQ
                     FIFETPGAYIATGVGWLLLTMVNLVWIVYLTSEEDTFLYNILNSGGNGGLSNHNRRIG
                     TTVQRRDSTPGYGGGEMGLGNSIGAMPRGISSNTVNSGGYGGGYAPAAMDGTPQKMTS
                     VREEYNHTGVQSPGIDESVPRLQRAKALYAYSASPDDPNEVSFMKGEILEVVDATGKW
                     FQVRTPAGITGIAPSNYLVLL"
     gene            complement(698151..700481)
                     /locus_tag="CNH01540"
                     /db_xref="GeneID:3259179"
     mRNA            complement(join(698151..700159,700212..700481))
                     /locus_tag="CNH01540"
                     /product="intra-Golgi transport-related protein, putative"
                     /transcript_id="XM_572336.2"
                     /db_xref="GeneID:3259179"
     CDS             complement(join(698445..700159,700212..700272))
                     /locus_tag="CNH01540"
                     /codon_start=1
                     /product="intra-Golgi transport-related protein, putative"
                     /protein_id="XP_572336.1"
                     /db_xref="GeneID:3259179"
                     /translation="MSQPSVSTDSAQAWNGPLLDGDHQSLTALLQPLTSVDVSSSSAS
                     SYLDHLQSLPLPELLRQPSLISIETSTVESDLTNLCFREYPTFISVHKCSSAVKSAFD
                     DFSDSLEKLIGSVPALEDECQTFSSSTSKIQRIRNKASLVQEHQDKLLDLLEIPQLME
                     TCVRNGYYQEAMELLDHSRTISQRYKDVVLVQDVVREVEGVLQLMLTQLLSLLREPIK
                     LPPLIKTVTFLRRLHALDENELALVFISSRYRNFRAQLAYIERDKADPVRYLRRYVDL
                     FREHVYDLIAQFTTIFLDSPSTATHIASFASQAVSELVNLVQTYVPQLSTDAASMSSI
                     LIQLGYCAMSFTRVGLDFAPLIAEPFAATSFSAFSHEISTASKELQELLEESSKLLRP
                     PSQILITADHLSRVLTAETSPPNLPASIDAVRSFPPLAALVNAHLNALNSLRLLAPLS
                     LRSQIYTFHSTSLASDSVTLLQYFFLRSEESVDRLQGGNRERSSHTRTPSAPRVDLLR
                     RNSEVQMTPEARATKKKTAKRTCIAAADMWCNIVVPFLVERLAQGVFGDQNAPIHPEL
                     SREIENISKWIKENGENGHTARLVL"
     gene            700693..703080
                     /locus_tag="CNH01530"
                     /db_xref="GeneID:3259119"
     mRNA            join(700693..700906,700951..701042,701079..701203,
                     701242..701570,701617..701811,701848..702212,
                     702267..702460,702500..702593,702632..702870,
                     702927..703080)
                     /locus_tag="CNH01530"
                     /product="dihydroxy-acid dehydratase, putative"
                     /transcript_id="XM_572335.2"
                     /db_xref="GeneID:3259119"
     CDS             join(700763..700906,700951..701042,701079..701203,
                     701242..701570,701617..701811,701848..702212,
                     702267..702460,702500..702593,702632..702870,
                     702927..702940)
                     /locus_tag="CNH01530"
                     /codon_start=1
                     /product="dihydroxy-acid dehydratase, putative"
                     /protein_id="XP_572335.1"
                     /db_xref="GeneID:3259119"
                     /translation="MLSRRIATASPAAHTRAFHASAAKASKEVIMNRYSRTITQPKAQ
                     GASQAMLYATEGIVNDEDFNKAMVGVASVWYEGNPCNRHILGLGQRVKKSLMNAGIVG
                     YQFGTVGVSDGISMGTSGMSYSLQSRDLIADSVETAAGGHWLDGMVVLPGCDKNMPGA
                     LIALGRLNRPSMMVYGGTIRPGSCGGEVLDIVSAFQSYGRYLQEGQTPEAEKTRYNTI
                     RNACPGPGACGGMYTANTIASASEALGMTLPGSSSFPAEYPEKHAECDAVGETMRKVL
                     EDNLLPRQIMTRQAFENAMALTMALGGSTNVVLHLIAIARSVGINLTIDDFQTVSDRV
                     PLLADLKPSGKYVMEDINTIGGTPSVIHYLIKNGIMTGDEMTITGKTLGENCDRWVEE
                     HGSKWEGQKILRPINDPLKSTGHIRILRGNLAPGGAVSKITGKEGLRFTGKCRAFDDE
                     EGFVKAVESGSIKKGEKTVVVLRYLGPKGGPGMPEMLKPTSLIMGAGLGYDVACLTDG
                     RFSGGSHGFVVGHVVPEAQVGGPIALVQDGDVIHIDAVANTLSVDVSDEEMARRKENW
                     VAPPLKVTHGTLLKYARAVTDASHGCVTDA"
     gene            703642..706110
                     /locus_tag="CNH01520"
                     /db_xref="GeneID:3258993"
     mRNA            join(703642..703788,703859..703995,704044..704201,
                     704257..704402,704443..704707,704761..704833,
                     704884..705304,705357..706110)
                     /locus_tag="CNH01520"
                     /product="2-isopropylmalate synthase, putative"
                     /transcript_id="XM_572334.1"
                     /db_xref="GeneID:3258993"
     CDS             join(703778..703788,703859..703995,704044..704201,
                     704257..704402,704443..704707,704761..704833,
                     704884..705304,705357..706065)
                     /locus_tag="CNH01520"
                     /codon_start=1
                     /product="2-isopropylmalate synthase, putative"
                     /protein_id="XP_572334.1"
                     /db_xref="GeneID:3258993"
                     /translation="MPMLSDPSKRYLPFQPVPFPNRTWPDKTHKKAPIWLSTDLRDGN
                     QSLANPMTNQQKLRFFRHLVQLGFKEIEVAYPAASETDYNFVRELIDRKEVPDDVWIQ
                     VLTPARADLIKRTFEAVAGLKHVIVHMYNATSCLFREVVFNNDRDETIKLAMDHTILI
                     RQLAEKYAESHGTSFRYEYSPETFSQTETPYAVEVCEAVKKAWLGGHGSVWADGRKEE
                     RIIFNLPATVEVATPNCFADQVEIFCNSISEREKCIISLHTHNDRGCAVAAAELGVLA
                     GADRIEGTVLGNGERTGNVDLVTLALNCYSQGISPNLDFSDMFSVIDTVTECTGLPVH
                     PRHPYAGELVFTAFSGSHQDAIKKGFEAQAKRDHAGDQVWSMPYLPIDPADVGCTYEA
                     VIRVNSQSGKGGIAYIVKSALSLDLPRRMQIAFYKVVQECSEATGREMTSKDITTAFR
                     QTYHLGGSIYDGRLVLKSFVTVDLFSSQTPSVAGTPDLSPIRSRSQTRMPPLSLSSSV
                     AEPSPDRSLDRNLPSMSKRLTAKVLVDGKLHEIVGEGNGPLSSFLNALESDLGIVLSV
                     REYTEHAVGAGSDVKAATYVELIPANVDAKDKTQGGFWGVGVDADITASGLKAVVSAA
                     NGFLGQGPIPSQNSI"
     gene            708426..709817
                     /locus_tag="CNH01510"
                     /pseudo
                     /db_xref="GeneID:3259158"
     gene            complement(<712568..>713982)
                     /locus_tag="CNH01500"
                     /db_xref="GeneID:3259289"
     mRNA            complement(join(<712568..712909,712968..713491,
                     713562..>713982))
                     /locus_tag="CNH01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_572554.1"
                     /db_xref="GeneID:3259289"
     CDS             complement(join(712568..712909,712968..713491,
                     713562..713982))
                     /locus_tag="CNH01500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572554.1"
                     /db_xref="GeneID:3259289"
                     /translation="MPRRSAKYKATARARELYRMATILNHKQLKTSLSIPYHALRTSR
                     YLNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLHVNHTEFRKLLCLIKDHPVFVSH
                     GPRKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLER
                     NNVYWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRY
                     GFNILGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVH
                     SEMISQGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYG
                     ILKNRWQSLRSLRVKICNVRDEGVATCWIQACVVLHNLLIDTGDWYNQLDGDADEPDD
                     YIDIERMQERMERVLERHREEEEDEARDARDASNLT"
     gene            715390..728037
                     /locus_tag="CNH01490"
                     /pseudo
                     /db_xref="GeneID:3259159"
     gene            complement(733171..745296)
                     /locus_tag="CNH01480"
                     /pseudo
                     /db_xref="GeneID:3259067"
     gene            complement(745447..747153)
                     /locus_tag="CNH01470"
                     /pseudo
                     /db_xref="GeneID:3259066"
     gene            747154..749550
                     /locus_tag="CNH01460"
                     /pseudo
                     /db_xref="GeneID:3259160"
     gene            complement(751522..754707)
                     /locus_tag="CNH01450"
                     /pseudo
                     /db_xref="GeneID:3259065"
     gene            complement(760912..765093)
                     /locus_tag="CNH01440"
                     /db_xref="GeneID:3259197"
     mRNA            complement(join(760912..761009,761067..761273,
                     761328..761383,761438..761501,761551..762010,
                     762062..762236,762292..762398,762458..762534,
                     762588..762633,762689..762779,762825..763064,
                     763120..763273,763312..763420,763471..763625,
                     763669..763764,763804..764144,764186..764541,
                     764603..764675,764714..764828,764888..765093))
                     /locus_tag="CNH01440"
                     /product="MMS2, putative"
                     /transcript_id="XM_024657660.1"
                     /db_xref="GeneID:3259197"
     CDS             complement(join(761098..761273,761328..761383,
                     761438..761501,761551..762010,762062..762236,
                     762292..762398,762458..762534,762588..762633,
                     762689..762779,762825..763064,763120..763273,
                     763312..763420,763471..763625,763669..763764,
                     763804..764144,764186..764541,764603..764675,
                     764714..764828,764888..764993))
                     /locus_tag="CNH01440"
                     /codon_start=1
                     /product="MMS2, putative"
                     /protein_id="XP_024513337.1"
                     /db_xref="GeneID:3259197"
                     /translation="MATDIRLLVHSVVYPTSHEQYTRDQQALSDLFKEPEFLISLQTL
                     AADKTLSQPERLMASLITGREMKTKWRSKAITPETRKPEVRRRLFSFLEEEDFAIARP
                     QLSLLVAVARIEYPKTWQNLPELFLEPLLSTLPHLANPSSLTPAASTLLINVLWTINA
                     LVKEWRTVRIAQGATVMQTLEQLFTEPLRKILDIWGESERNGGGYLPLEEAGRYAFKI
                     LARFCQWHWSKAKPMQTEEAILRIQYLVGHSVTHASVIQSNRLRLIATKVPSEKTLRS
                     ITKHLRAIGKWWRAMIALDPKGFCKIDGTTAGIGWWWGEVGGVVAGTDGAISNDDSDD
                     SPYPKRFLLLGLLLFKDILPILAADHHDIFTPEFILSAFHLLVDKLLPLTSTDLEALE
                     DEPEEWLIGESTDAEAWAFEFRPCAERVLIALNNACRNVPRENKVIEPAMLKLLSETQ
                     LIPPDNLPSVLRHESVYCALGRLSRSMASYGGVNFESLLTGMGPWISQGKPLHRIVKR
                     RVAWLIGEWMSGDEESAKLHIVWQLLLHLLSERGDASDRAVNLAAAVAIKECVDLWEL
                     PIDYFLPFLEQTVQGLIKLLGEASTLDGKRYVNDTVGVVIERVGDKIMPYLPTLAQSV
                     PVLWHGAIGLEGEWLFKASLVVLTTKLVSAAKESSGGLMELVIPLIEESLQPPAKEFF
                     EEDGLILWQTALYNSASPYQPSPETGLIRILPGLLLVLGSNLDLLPKLLSLLDSYLLL
                     DPVGISQAHGQAIASNLAMALSTSTGNESAVIRILATVSLWTRIAPLPVISSLLLQAG
                     IFHHITTALEDDKASGLVLAAYLEILSRIAMNNPNIFLQMVEESAKIQSQDVHKLLEE
                     ILDAVWRNFDYVGETRLRKVVAMGVGNLLLTGNQQVMERLDGDFMNIFLDVLGEVQQS
                     EGSLSVQETGLAPWIDDNSTLWTEIENTPEGQRRLSLEDNDPAYTVSLKDFILQLLNQ
                     ASSVGLNPYWEKADAGTKRSLEKFLN"
     gene            765245..767056
                     /locus_tag="CNH01430"
                     /db_xref="GeneID:3259165"
     mRNA            join(765245..765393,765431..765538,765581..765849,
                     765891..765985,766035..766093,766147..766237,
                     766287..767056)
                     /locus_tag="CNH01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_572332.2"
                     /db_xref="GeneID:3259165"
     CDS             join(765322..765393,765431..765538,765581..765849,
                     765891..765985,766035..766093,766147..766237,
                     766287..766894)
                     /locus_tag="CNH01430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572332.1"
                     /db_xref="GeneID:3259165"
                     /translation="MDIRKPMFHSRVHIEAGDIVILYMARDNMTAITITPGETFHNKY
                     GRYPHDMLIGQKYGSKIHSPPPHPGYVHVLRPTPELWTLSLPHRTQILYLPDISYITM
                     RLGVRVGGKVIEAGTGSGSMTHSLSRSVGPSGQVMSFEYHRQRFETALKEFESHGLTN
                     VRLQHRNVCKEGFGDAQGVEGVFLDLPAPWEAIPHAVKALRRDIITRICCFSPCLEQV
                     LKTVTCLRSEGFSDISTQEVLIRTHELVTPPPNTTYLSSISSVVSYLREHEQRKEERR
                     LLQIKTAKENNRKVKGIEADDAIPVEGETGSKRKLEQPSVTGSDNAAPANSRPKTNLL
                     WTEPPNTLPSTVLTKPSPEMKGHTSYLTFAILYPESVRLSMVAQETSSRVETPTNITK
                     APETHSQETHYSEGSEIEKIGAMTSKEMDDWMKSGSTSLSI"
     gene            767245..770109
                     /locus_tag="CNH01420"
                     /db_xref="GeneID:3259019"
     mRNA            join(767245..767842,767898..768160,768214..768223,
                     768261..768476,768535..768685,768742..768874,
                     768933..769032,769082..769218,769265..769288,
                     769346..770109)
                     /locus_tag="CNH01420"
                     /product="Ser/Thr protein kinase, putative"
                     /transcript_id="XM_024657659.1"
                     /db_xref="GeneID:3259019"
     CDS             join(767324..767842,767898..768160,768214..768223,
                     768261..768476,768535..768685,768742..768874,
                     768933..769032,769082..769218,769265..769288,
                     769346..769745)
                     /locus_tag="CNH01420"
                     /codon_start=1
                     /product="Ser/Thr protein kinase, putative"
                     /protein_id="XP_024513336.1"
                     /db_xref="GeneID:3259019"
                     /translation="MDRDSPSSLPSTLLEPPPPATIISPPSPTKDQTVTEDTSPSQLE
                     MISSQASSTIESPDSLPQPTTDSPPSISTPLPVSASPAFLRPTSPPFASPSVFTTVRS
                     PSPSSPSLRPKGTHHRRTSSAHRVRETIDGTQTANEDGERMINQYKIGMSLGQGAYAK
                     VELGVDINTGLKYAIKEFSKSRLHHQSLQEKHRASMRSKLRKGRERKAMSGDKGESQE
                     RPPQPMEKEEMSGALDNTQSGDEKMEDPLGLIRREIAVMKKLDHPNLVHLYEAISVST
                     ADALFLVLEYMPGGTLMKVKVGQDDSNAQPTFDREQTREYFRQLCLGLEYLHANEIVH
                     RDIKPENILLSADRQLVKLCDFGVSEMFTKTGDDRIQKSGGSPAFQSPESFQPSGELH
                     GKAVDIWALGVTLYCMLTGTLPFNYPNIIELYAAVVERSPRIPEDWDASLRDLMERML
                     CKDPALRIDMSSLREHPWTTDETRLPMIDTEENLYEVGKQVEEPTQDEIKDAIVTFRG
                     ILYVMRAVHKMRRLHLHRSSPSRGATSSPGDSANVSFASESMDSYVSRDPLTSTTSLS
                     SDGEDGPFKDIAGNKVTSPRQMSLASPADTEKPDATPFMSFGDIEPIKTDVQENVDGV
                     VLVDSPTSENEDAETEKLGSGSSRDL"
     gene            complement(769855..770703)
                     /locus_tag="CNH01410"
                     /db_xref="GeneID:3259178"
     mRNA            complement(join(769855..769990,770050..770110,
                     770179..770303,770352..770422,770478..770703))
                     /locus_tag="CNH01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657658.1"
                     /db_xref="GeneID:3259178"
     CDS             complement(join(769922..769990,770050..770110,
                     770179..770303,770352..770422,770478..770553))
                     /locus_tag="CNH01410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513335.1"
                     /db_xref="GeneID:3259178"
                     /translation="MSDTKIAALQAQLQSSTISFQKIENELASVIEARQRLDSQLSEN
                     ELVLKELNLLKSHNTVYKLIGPALVPQVSSEAKVNVEKRLEFIRSEIKRVESQLKEVE
                     DKAGRKKEEIIVLQQQFQALQAPSAPQQSKA"
     gene            770855..772348
                     /locus_tag="CNH01405"
                     /db_xref="GeneID:36392994"
     mRNA            join(770855..771636,771695..772348)
                     /locus_tag="CNH01405"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658695.1"
                     /db_xref="GeneID:36392994"
     CDS             join(770978..771636,771695..772259)
                     /locus_tag="CNH01405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514610.1"
                     /db_xref="GeneID:36392994"
                     /translation="MPPPGVGPNKRPAPITSSAFAFTLGTPKQKRPKASEQITSLPVN
                     PPPPPSPNYQQKARSESSDVTIQTPFRRRNEQCGTSSKETSGSKARTASPFINPTDHP
                     ISNMRQHFSPAPLDVARRTAGGSSKLQPVSLHTPSRKSQEPESASKPKSFRRVTDRLD
                     QLPAKREESAGTKVALQATRLSGKATVDLAARKRTILAEDEGEIGVSPNGKKITKWNG
                     KGYTPASVQLANLLSSSKASTHLFYTSMQNILNPSRRGPGRNRPPRYEGGMDITTPLQ
                     HIQRAAPIRLKPLSCIPGPTHHCEIFWCKVLKWSSSELIQARDQGEKVLLVLQPFTAD
                     APRMGVDPKLVAARMKDDNNIKNWLVGIWSCSEIQLPAYEHVMEEGRGVLADSAGEGN
                     LWAVFGTRYLIAEDD"
     gene            complement(772288..772975)
                     /locus_tag="CNH01403"
                     /db_xref="GeneID:36392993"
     mRNA            complement(join(772288..772426,772499..772593,
                     772647..772710,772760..772975))
                     /locus_tag="CNH01403"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658696.1"
                     /db_xref="GeneID:36392993"
     CDS             complement(join(772409..772426,772499..772593,
                     772647..772710,772760..772813))
                     /locus_tag="CNH01403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514611.1"
                     /db_xref="GeneID:36392993"
                     /translation="MWGGYWSPLQTMYGYHGAMMSPYYAGGLGIPYMMGMGGLGYGLG
                     ASMYGMGMGMPYPYGMTATNPYAYTGMYGIGY"
     gene            774116..777099
                     /locus_tag="CNH01400"
                     /db_xref="GeneID:3259022"
     mRNA            join(774116..774258,774345..774620,774674..774704,
                     774762..774806,774860..774942,774993..774999,
                     775059..775078,775137..775297,775346..775436,
                     775496..775512,775564..775586,775637..775725,
                     775781..775975,776051..776093,776140..776195,
                     776246..776403,776460..776676,776736..776859,
                     776926..777099)
                     /locus_tag="CNH01400"
                     /product="hexokinase, putative"
                     /transcript_id="XM_024657657.1"
                     /db_xref="GeneID:3259022"
     mRNA            join(774116..774145,774233..774258,774345..774620,
                     774674..774704,774762..774806,774860..774942,
                     774993..774999,775059..775078,775137..775297,
                     775346..775436,775496..775512,775564..775586,
                     775637..775725,775781..775975,776051..776093,
                     776140..776195,776246..776403,776460..776676,
                     776736..776859,776926..777099)
                     /locus_tag="CNH01400"
                     /product="hexokinase, putative"
                     /transcript_id="XM_572328.1"
                     /db_xref="GeneID:3259022"
     CDS             join(774354..774620,774674..774704,774762..774806,
                     774860..774942,774993..774999,775059..775078,
                     775137..775297,775346..775436,775496..775512,
                     775564..775586,775637..775725,775781..775975,
                     776051..776093,776140..776195,776246..776403,
                     776460..776676,776736..776859,776926..776972)
                     /locus_tag="CNH01400"
                     /codon_start=1
                     /product="hexokinase, putative"
                     /protein_id="XP_024513334.1"
                     /db_xref="GeneID:3259022"
                     /translation="MSETPDQLATRVQNLSTAPTTTQRTGSGSAVLENGTNIGSAAGR
                     KASIPAQVDPERIISTSGSGRTSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAGKKTM
                     ADLLRKYESLFTLTPQRMRMIVHAIEETLDNGLQKNGQVVPMIPTYVFGWPTGNEVGD
                     FLALDLGGTNLRVCLVTLLGSGKFEVTQTKYRLTEEQKQGEGQALLDFCAECLNSFIR
                     DTLGRTEKDGILPLGFTFSYPCSQDRIDHGVLIRWTKGFGAPNIEGYDVAAMFKDSLK
                     RMDVPAELTALINDTTGTLIASNYVDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGL
                     PEEQGMAINCEWGAFDSFDHQHLPRTKYDIIIDESSNKPGEQSFEKMIAGLYLGEIFR
                     LVLCELIDSGDLFLGQNTYKLEKAYAFDTAFLSLMEADVTEELLTIIGVFAHFFGLET
                     TLEERQFFKKLAVLVGTRSARLSACGIAAIVSKKGYLEEGCAVGADGSLYNKYPNFAD
                     RVHEALTDIFGESGKKIVTHHAEDGSGVGSAIIAAMTKARKDSGFFVEY"
     CDS             join(774354..774620,774674..774704,774762..774806,
                     774860..774942,774993..774999,775059..775078,
                     775137..775297,775346..775436,775496..775512,
                     775564..775586,775637..775725,775781..775975,
                     776051..776093,776140..776195,776246..776403,
                     776460..776676,776736..776859,776926..776972)
                     /locus_tag="CNH01400"
                     /codon_start=1
                     /product="hexokinase, putative"
                     /protein_id="XP_572328.1"
                     /db_xref="GeneID:3259022"
                     /translation="MSETPDQLATRVQNLSTAPTTTQRTGSGSAVLENGTNIGSAAGR
                     KASIPAQVDPERIISTSGSGRTSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAGKKTM
                     ADLLRKYESLFTLTPQRMRMIVHAIEETLDNGLQKNGQVVPMIPTYVFGWPTGNEVGD
                     FLALDLGGTNLRVCLVTLLGSGKFEVTQTKYRLTEEQKQGEGQALLDFCAECLNSFIR
                     DTLGRTEKDGILPLGFTFSYPCSQDRIDHGVLIRWTKGFGAPNIEGYDVAAMFKDSLK
                     RMDVPAELTALINDTTGTLIASNYVDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGL
                     PEEQGMAINCEWGAFDSFDHQHLPRTKYDIIIDESSNKPGEQSFEKMIAGLYLGEIFR
                     LVLCELIDSGDLFLGQNTYKLEKAYAFDTAFLSLMEADVTEELLTIIGVFAHFFGLET
                     TLEERQFFKKLAVLVGTRSARLSACGIAAIVSKKGYLEEGCAVGADGSLYNKYPNFAD
                     RVHEALTDIFGESGKKIVTHHAEDGSGVGSAIIAAMTKARKDSGFFVEY"
     gene            complement(777077..781558)
                     /locus_tag="CNH01390"
                     /db_xref="GeneID:3259161"
     mRNA            complement(join(777077..777325,777377..777753,
                     777821..778152,778213..778429,778488..778579,
                     778649..778719,778770..779038,779091..779207,
                     779263..779387,779438..779508,779570..779954,
                     780002..780017,780068..780278,780329..780479,
                     780531..780553,780621..780626,780687..780714,
                     780773..780792,780926..781380,781429..781558))
                     /locus_tag="CNH01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657656.1"
                     /db_xref="GeneID:3259161"
     CDS             complement(join(777270..777325,777377..777753,
                     777821..778152,778213..778429,778488..778579,
                     778649..778719,778770..779038,779091..779207,
                     779263..779387,779438..779508,779570..779954,
                     780002..780017,780068..780278,780329..780479,
                     780531..780553,780621..780626,780687..780714,
                     780773..780792,780926..781211))
                     /locus_tag="CNH01390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513333.1"
                     /db_xref="GeneID:3259161"
                     /translation="MASVGHSPYTSKPSPLARTASQTPITPSNLTHASPSPIAPNFPF
                     SQPPTPMKRPFPPESQAGGPPERKFSVDSAQGDHGQQQPQKKKRVSLSCAQCAKRKQK
                     CNREFPCQHCVARKVPELCVPYNPQANNNVNGPDPQTAARLESIEAVLSVVVRHTGGI
                     THYDAIRDWISSLPFQKHLQSAPSTPASPHNLMTHGSVPGPSRAGSTYHLDPQETAHL
                     ERGGSSDDDNLAKVGKGWLGEIDGGLPENMELNEKVKMKLDIHGTPAENLQRLITDCG
                     VSPHKIAELVQELPPKPFADRIIDWFFAKLNFIRYPIDERMFRASYEDLYNKSTALDP
                     SNVRALPLVFIVLALAVRQAPEKWAGNEQTRRLSSLRMYWSSRRSILIATAVQSESLE
                     LVVSRLLSAMYLVLIHDRRLTECWSQLGASLRTAQAIGLHRDGSKLGLDPFQTEYRRR
                     LWSYLYHADKQYSLVLGRPPSISDSYTDTQTPSNIDLTDYDPALGLPPAKPFHEPTPA
                     LFLILRKKLAVVIGKIVHHFQKLNEPAQYSDVEKLQQELDLFVEQLPPHFRMHDPDKS
                     LDSVHFWLPVHRFMLLTEVLVTTIILHRPWLLRKLSSNRYAASRTACFEAAKLDFQIR
                     QDFERVPEFKLFAITGQFKMFNSAMIAGISAIIDPRGPDSDQMRKILTTFLEDNPWHE
                     VATKDATTRKEVQIIQTLSRRAAKIFEDSFGPGEPAAHDKDSAALLLALRQSNDSSTH
                     SNAYPRGVQPEDTPNPGGSGVMQHKMMLPPRAWGPPPGVSFAPVHHGGINQSPASTGS
                     HEDDHSQKLLDHWINANTSLAVGGSSSGGPLPVLDTSGMGYLPLPTMSGAMTPIGLPG
                     GPALTPNPAFAGYGGQAIMEEGGNNFMGHHLTGEFTYPNQFGMLAVEGNGVGVGNGRA
                     GLDSGVENSDEYWNTLIDGILGTTGGMSGPSQSGHA"
     gene            complement(782508..783891)
                     /locus_tag="CNH01380"
                     /db_xref="GeneID:3259275"
     mRNA            complement(join(782508..782837,782958..783140,
                     783210..783248,783312..783467,783529..783693,
                     783753..783891))
                     /locus_tag="CNH01380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572326.2"
                     /db_xref="GeneID:3259275"
     CDS             complement(join(782637..782837,782958..783140,
                     783210..783248,783312..783467,783529..783693,
                     783753..783764))
                     /locus_tag="CNH01380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572326.2"
                     /db_xref="GeneID:3259275"
                     /translation="MNILDTLFGRSMTPAERLRQHQRSLQKAQRELEREKGKLEAQEK
                     KTMADIKRNAKAGNMNACKILAKDLVRTRRYIQKFTQMRVQLQAVSLRMQTLRSNEQM
                     ATAMKGATRAMGQMNRSLNLPQIQKIMNDFERESSTMDMKEEMMSDAVDDAMEDEEEG
                     EGEEVESDKILKEVLDEIGMNMNESLISAPTASPLVPEPLQASRVAVAEGLPSSAAAG
                     GPTNVGNGGVGAGSGMSSEEADLQRRLDALRRD"
     gene            784039..786632
                     /locus_tag="CNH01370"
                     /db_xref="GeneID:3259298"
     mRNA            join(784039..784248,784303..784328,784387..784500,
                     784552..784581,784637..784652,784702..784953,
                     785005..785024,785077..785194,785247..785330,
                     785379..785484,785541..785989,786043..786088,
                     786146..786316,786372..786632)
                     /locus_tag="CNH01370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572325.2"
                     /db_xref="GeneID:3259298"
     CDS             join(784100..784248,784303..784328,784387..784500,
                     784552..784581,784637..784652,784702..784953,
                     785005..785024,785077..785194,785247..785330,
                     785379..785484,785541..785989,786043..786088,
                     786146..786316,786372..786503)
                     /locus_tag="CNH01370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572325.1"
                     /db_xref="GeneID:3259298"
                     /translation="MRLPRLLSVTFSLSALLTTATATITDLDDDFQLRELTEDNFKSS
                     VSQGVWLVEHFSPKCAHCRAFAPTWTQLARDKRHLERLTGFHMAQINCLAQGDLCNSN
                     GIKFYPQIIMYTDGKPSPHYTGDRSYEELSKYIDEHAHTYAETILDPAVQSQEALVIG
                     PANSEGKVQEVDERGLEALKAEGPVLVEYFAPWCGHCKALRPTYEQLALELQGQLNVA
                     AVNCDDHRALCVNSGIKAYPTIRLLHHGTSAEYSGARSLAKLKEFSQRAEKPASLTSI
                     KAGDFDKIVSANEAFFLYLQTFDTTVAEVDSVKKAFEPLLGTVPAYTSADVALYQRLH
                     VVNPPTSTLFAFSSYSTRPVGTMGLPASPNDLRKFINLHRFPTLVRLDASNFQSLMRS
                     DTRAIVVLAGVHKGEEGKKERDKFADVARAWKRGGRRFEQPVWFVWVEGETSRWANWL
                     KRFYGIKKRDLPGVVVIDTPLEEYYDTTIEGTKIEFEGSSIFSVLEGFYQHFLRPKRI
                     ESTLEWGSRSASETLISVGESAVEHPFLFLTVLVGTVALFVYLLQKCLVKDPKDGYSP
                     SRLD"
     gene            786770..787573
                     /locus_tag="CNH01365"
                     /db_xref="GeneID:36392992"
     mRNA            786770..787573
                     /locus_tag="CNH01365"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658697.1"
                     /db_xref="GeneID:36392992"
     CDS             786854..787522
                     /locus_tag="CNH01365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514612.1"
                     /db_xref="GeneID:36392992"
                     /translation="MPTLDPPSLTPLFNLPPSAPQIPKFISYLATSSTPSTPDIKSYP
                     DAIYHNYYDLGLSLCFLPEKGLDSVDIFNCDPNPPALKPGRTVTVYAPPPEVTIHFTS
                     TTLTLPPRDPKFKSTEPPESIARPPFITFTPTTTGRQLVSCLGEPSRKGSGGWTGVWL
                     EWKRVEFKVDGEGNKGEIGVMVELRDPGAAEMTEEVMKKGMGGVWERAAKWEWKSLKL
                     FKPE"
     gene            complement(787543..788684)
                     /locus_tag="CNH01360"
                     /db_xref="GeneID:3259180"
     mRNA            complement(join(787543..787856,787910..787968,
                     788020..788325,788377..788402,788457..788472,
                     788523..788562,788604..788684))
                     /locus_tag="CNH01360"
                     /product="proteasome subunit alpha type 5, putative"
                     /transcript_id="XM_024657655.1"
                     /db_xref="GeneID:3259180"
     CDS             complement(join(787586..787856,787910..787968,
                     788020..788325,788377..788402,788457..788472,
                     788523..788562,788604..788617))
                     /locus_tag="CNH01360"
                     /codon_start=1
                     /product="proteasome subunit alpha type 5, putative"
                     /protein_id="XP_024513332.1"
                     /db_xref="GeneID:3259180"
                     /translation="MFMTRSEYDRGVNTFSPEGRLFQVEYAMEAIKLGSTTVGITTPH
                     GTVLAVEKRVPSPLLESSSIEKIMEIDSHIGCAMSGLTADARTMVEHARVTSQMHAFT
                     YDEPIGVESCTQAVCDLALRFGESVEDDDALMSRPFGVALLIAGIDEKGPQLYHTDPS
                     GTFVRYEAKAIGSGSEAAQQGLQDAYHKQMTLAEAQSLALKVLKQVMEEKLDESNVQL
                     AQVTKEKGFEILGEQALKGVIETLA"
     gene            788798..792237
                     /locus_tag="CNH01350"
                     /db_xref="GeneID:3259205"
     mRNA            join(788798..789966,790020..790234,790284..790396,
                     790449..790538,790604..790886,790950..791061,
                     791140..791208,791268..791367,791425..791587,
                     791650..791886,791972..792237)
                     /locus_tag="CNH01350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657654.1"
                     /db_xref="GeneID:3259205"
     CDS             join(788861..789966,790020..790234,790284..790396,
                     790449..790538,790604..790886,790950..791061,
                     791140..791208,791268..791367,791425..791587,
                     791650..791886,791972..792108)
                     /locus_tag="CNH01350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513331.1"
                     /db_xref="GeneID:3259205"
                     /translation="MRPPTVSHSDILHTAGTTKHKQRNPDNSNDSGSDASIQALEHPP
                     VVRGRKDAPIIIDDSDSEQDARRPAKRVRREDAHPTIPRPSARQAPPPHRNVSSHAQA
                     HRVHGSPSTAGPSEVFSAERPAQPVAGPPKRRLADQPEQPVAGPSRLYASTTVLSPPS
                     IRRTKSHDGKVHESPAKTPRDKRAKRAGSRAPVLSETVPSAHTPRSFSGPSQYAAPAS
                     SPAPHGLPPVEYLDDEEELLAPPNHTPAPTSFPAAPVVLPPLDPAHSDVILRNVLEIL
                     PDLEPEWASAEIAKYHASGHTDRLAEAIVDRALELKGGYPKMIEKAKEKKKEEKPDDG
                     YKLNTYRHAQRSGPQYYALATQYLEAEFSLIPTTYIRSTFVKTCGSLFTPAYYRLLAD
                     SQSNPKPYIELQKPRKSKGISLMSGVRLAGDGGEMEFERELAWLEERLAKENAEKEEA
                     DRKQKIIDEAVANGHGIECGCCFGDEILENMFQCAEGHLFCKECTMRNAETKLGEQQI
                     TITCMDLSGCEAPFPESELGRALSDKTFSLYHRLKQAKELELAAIEGLESCPSCPYSA
                     IIENPDEKLFRCMNEICGQVTCRKCRRKEHIPKTCEEMDKERNLDRRHAVEDAMSTAL
                     IRNCPKCTKPFIKDSGCNKIVCTTCRTMSCYICRKIIKGYEHFDRQRPNYNAAPDKGK
                     CRLWDSDANPDEEAIRAARDAAAAEVMAAAAAEGDQVNAEELNVDMPEARPGHSAIGN
                     RHLAIPANIPEANRLAALLPNDVDIQPILQLDARLRQLRQERADRANQIPAAQQHANV
                     ALNNYNGHIRQHEENIARMINAALARARPGAPIVPPAGPEFRPAVPVIPARAAADPAA
                     RIIAPLPARAARRGGGRR"
     gene            complement(792210..793447)
                     /locus_tag="CNH01345"
                     /db_xref="GeneID:36392991"
     mRNA            complement(join(792210..792307,792371..793191,
                     793259..793447))
                     /locus_tag="CNH01345"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658698.1"
                     /db_xref="GeneID:36392991"
     CDS             complement(join(792223..792307,792371..793137))
                     /locus_tag="CNH01345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514613.1"
                     /db_xref="GeneID:36392991"
                     /translation="MLLHTLSMSTDGFSPFDGVSSTTWPIILFNLNLPPEMRVHVEEV
                     LCAGLLPGDLQDLLFTSFPIPYTSRKNRLRPILFPLRSHDSFISQSRLIVTAPSRVWY
                     KGASIFYKLPAIESTLSFPTDFMHLIFENVLQTLVSLFGGDVKGMEQDVFVIPKKKWE
                     DLGRATAACGASIPSCFGSRPPNFVENRQRCTADSWSFWLLYHASNLLDGCLPSAHYR
                     HFARFSELVGECLQFEMPKERLPGLRRDFAEWVQDFEKLYYRNTQMGEIKLLASRFNV
                     HDMHAKQ"
     gene            793602..794694
                     /locus_tag="CNH01340"
                     /db_xref="GeneID:3259246"
     mRNA            join(793602..793981,794032..794364,794419..794694)
                     /locus_tag="CNH01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_572322.2"
                     /db_xref="GeneID:3259246"
     CDS             join(793669..793981,794032..794364,794419..794618)
                     /locus_tag="CNH01340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572322.1"
                     /db_xref="GeneID:3259246"
                     /translation="MSVPSLKSALKKPTKSFDTPPAGPSKLSVAAAVPEKSKAKAKQS
                     VSIAEKPQRLRGPDLESESEGNASGFEDESASEVEVDEDEEMNTDEEIEKAKEGKPKK
                     STKRKKAPTTAADFGATLTSLLADPLTKSNKKAKTADSTKKAAAAPILALSAHKLPTK
                     ASVSLEAKAKRQLKAEKEEKEDRARVQNVLEGWSGDGVVGGQEFERNLRKTAQKGVVK
                     LFNAILVASKNAEAAQTTLSEKARLKPEAAKKKEKDNILGRGGKEDVLTKESFLEMVR
                     KGSSK"
     gene            complement(794673..797099)
                     /locus_tag="CNH01330"
                     /db_xref="GeneID:3259338"
     mRNA            complement(join(794673..794904,794949..794995,
                     795050..795104,795154..795315,795367..795431,
                     795480..795551,795591..795761,795817..795870,
                     795924..795978,796030..796096,796144..796217,
                     796262..796495,796547..797099))
                     /locus_tag="CNH01330"
                     /product="endodeoxyribonuclease, putative"
                     /transcript_id="XM_024657653.1"
                     /db_xref="GeneID:3259338"
     CDS             complement(join(794724..794904,794949..794995,
                     795050..795104,795154..795315,795367..795431,
                     795480..795551,795591..795761,795817..795870,
                     795924..795978,796030..796096,796144..796217,
                     796262..796495,796547..797040))
                     /locus_tag="CNH01330"
                     /codon_start=1
                     /product="endodeoxyribonuclease, putative"
                     /protein_id="XP_024513330.1"
                     /db_xref="GeneID:3259338"
                     /translation="MLRTMPSLAQSSPTHQSFSALPSPSYSGSPAHHMDKEDKDILLV
                     EGKNSCHRIDLSGSSEDSGRDTIQVDDDSGDEDDLVWALIADDLNSDASTHDIEDRNE
                     EAQEALFEQLIRRTEAMRNPATQTASLQTQFEVSDDDENDFVIDEPYSESLIEDGIQV
                     SDEGRENALKFLQSIVLSFLEQISTSLGTIFSHETSKVHKKELKGLKRRKIYAAEAEQ
                     KKETDQCLETGKIGVTISLKNRKSGSYQAIMLPDSPLQSPDRQSSIMRMTCIMRVAST
                     LYEAILDRNVITLRDVYYRDKQLFERQPVVDKIVDDLVATAGLRRRDFYVCASAKGLI
                     ASSSLVIRYRTGDEIILSATRANLVDPAEKIDVIEAPNGLDWVLIVEKDAIFQSLCGA
                     GILQDERIGHGVLITGKGFPDLATRQILRLIADTFPCVKMYALVDADPHGLKILSTYM
                     YGSKANAYSTDYGDLPLGDRVQWLGLRASHWSDLHISYDHLIPLEQSDIQMAMSMLRD
                     HQTLPVEWKRELSHMLHLHRKAEIEIIIASSWSSDHVGSNGSGDREGDRQPLPDVERL
                     INYIVKNMGF"
     gene            797328..800010
                     /locus_tag="CNH01320"
                     /db_xref="GeneID:3259132"
     mRNA            join(797328..798062,798116..798239,798292..798722,
                     798777..799156,799211..800010)
                     /locus_tag="CNH01320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572320.2"
                     /db_xref="GeneID:3259132"
     CDS             join(797373..798062,798116..798239,798292..798722,
                     798777..799156,799211..799835)
                     /locus_tag="CNH01320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572320.1"
                     /db_xref="GeneID:3259132"
                     /translation="MGKSTKAFKKFASSGKLKDTIQKRRQHQQAKRKSDDIKTQRAKQ
                     RGAAHDPEDESEGEGSEGEDEEDEKEAKRIGKPNAGGKAGGVAKTVEDLFGAGGLDVE
                     DDEESELEELGSEDEDEEDDGDDEEDEGEGDLLDEEAMKKAMKDLAKNDPEFFKYLKE
                     NDEDLLDFGQSSKANKGKGKQDEDDEDDEDEEMESDEDLLEEDEEEEEAERKRITVTL
                     KMLRQWQEGMLRQHSIRSLRKTLIAFRAAAHMNEDDGDQGSGLDTKYIIDSAQVFNKI
                     VVTALKFTPVVISHHFPYKTLPSGKVKLQPPKKTNQTLNRLILSHFSTLLHLIKSLPT
                     TPSSVASKKDEGASGLLLTAVGESTKLIPWVLSARKHLRAYLKVLLDLWSSAGDDVRI
                     ASFLAVRKLFVAGDDAVKDLCLRNIYRSLLPPLRNTTPHTLPSLNLMKNTASELYQLA
                     PSLSYQHAFGFIRMLAVHLRNVVRSSTTGKAGDNQQAFKTVYNWQYVHCIDFWSQVLA
                     GAASVENQKANAGLESPLKPLVYPLVQIALGAVRLLPSSRYFPLRFHILHSLLRIISR
                     TGTYIPLAPFLLEILDSTEFRRANPKKGTIKPLDFEYIIRAPAAYPKTRVFQEGLGEE
                     LVFLLGEYHAAVSTQIAFPEMVLPVILTIKKHIKKGSAGSPKVVSSLKVLVEKLEATR
                     TFIENKRRNVSFAPRDRAEVDRFLEGQGPEVTPVGNWMRLQRKIRDQKRSEVEKALRE
                     EQDEDEDSE"
     gene            800502..805497
                     /locus_tag="CNH01310"
                     /db_xref="GeneID:3259089"
     mRNA            join(800502..800620,800728..801291,801346..801842,
                     801897..801955,802010..802038,802089..802170,
                     802219..802292,802346..802526,802587..802606,
                     802742..802750,802798..802886,802944..802994,
                     803059..803161,803217..803305,803365..803443,
                     803497..803573,803624..803941,803997..804040,
                     804099..804153,804206..804318,804380..804508,
                     804561..804958,805017..805497)
                     /locus_tag="CNH01310"
                     /product="alpha-glucosidase precursor, putative"
                     /transcript_id="XM_024657652.1"
                     /db_xref="GeneID:3259089"
     CDS             join(801126..801291,801346..801842,801897..801955,
                     802010..802038,802089..802170,802219..802292,
                     802346..802526,802587..802606,802742..802750,
                     802798..802886,802944..802994,803059..803161,
                     803217..803305,803365..803443,803497..803573,
                     803624..803941,803997..804040,804099..804153,
                     804206..804318,804380..804508,804561..804958,
                     805017..805270)
                     /locus_tag="CNH01310"
                     /codon_start=1
                     /product="alpha-glucosidase precursor, putative"
                     /protein_id="XP_024513329.1"
                     /db_xref="GeneID:3259089"
                     /translation="MTLLFQFLTLLLPILAGAIPAYRPATLESFQLRDQSSWAVASQQ
                     PDFSGDVTQCKGYAINSDSVRQTSTGGISAQLDLITYCSAYGTDIPSLTLSVEYETSS
                     RLHVHIYDTPVKQFQIDDNILPRPKRTLFGTDSADKSDLKFDYENSPFAFWVTRKSDG
                     EILFDTRKDGIPIHEDPSDILGSPSNYTVMPAHPLVFEDQYLQLSSKLPVGANIYGLG
                     EAVSGSGYRRNSSSTVQTMWARDIADPVDENLYGTHPFYMEVRYNETSCTLASHGVFL
                     RNSNGMDVVLRDGAIQYRVIGGTLDLYFVSGPSPNDVTEQYVSTVGLPQSMPEWSFGF
                     HLCRWGYTSANDTLSVVNRMRDAGIPLETQWNDIDWMRSYREFQFDQNYGEVDYRNLV
                     ETLHSRNQHYIPIFDAAIGHPLNATDRFDVYDKGHELGVWMRNPDGTEYVGAVWPTFA
                     VFPDWFHPKMQEVWTEAFYNYSQIVDFDGIWLDMNEPSSFVDGSASNSTMSLENTTVI
                     PPDYSTVAFPTDWPEGYSNVTGISGNVTVDGALTYGADGDAAKNTALRRSLIGRDDVL
                     TIPYVDVPPYPINNGYGRLSAKTVSPNATHYGGLQEYSVHNLWGSMEEDATNNMFLAL
                     KPGKRPFMVSRSTFAGSGRKTAHWLGDNFSTFAYMKRSIQGVLQFNLFGIPMVGPDVC
                     GFNGNTDEELCNRWMQLGAFFPFFRNHNIKSAISQEPYVWDSVRDASIKAINARYQML
                     PYWSTLFAKSSLAGTPAVIPLFHEFPSPSYLDNDYQFLIGPSVLVTPVLQPNESTVVG
                     QFPTMNDVFWVDWWTHCKLDTSSGEDVTLDLPLGNIGVHVRSGSALLLYDEPGYTVKE
                     TKDNGYAILVVLDGKGYAEGDAKIDDGESLPVTEQTCLTFKSTDSCKLSSTAVGSYTI
                     AGKLKTITIVGVWTEPSEVTLNGSKVQDSQVEYDKSLGRIKITGLVQDLNSAWELMW"
     STS             804298..804799
                     /locus_tag="CNH01310"
                     /standard_name="Sal4"
                     /db_xref="UniSTS:470902"
     gene            complement(805381..811378)
                     /locus_tag="CNH01300"
                     /db_xref="GeneID:3259211"
     mRNA            complement(join(805381..805641,805691..805796,
                     805848..805872,805929..806007,806071..806210,
                     806260..806474,806539..806950,807009..807088,
                     807140..807222,807275..807311,807370..807730,
                     807782..807825,807878..807974,808030..808263,
                     808321..808394,808447..808508,808565..808585,
                     808639..808703,808758..808802,808862..809008,
                     809060..809121,809166..809244,809295..809710,
                     809765..809989,810035..810053,810105..810159,
                     810208..810356,810412..810431,810484..810692,
                     810740..810871,810922..811378))
                     /locus_tag="CNH01300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657651.1"
                     /db_xref="GeneID:3259211"
     CDS             complement(join(805515..805641,805691..805796,
                     805848..805872,805929..806007,806071..806210,
                     806260..806474,806539..806950,807009..807088,
                     807140..807222,807275..807311,807370..807730,
                     807782..807825,807878..807974,808030..808263,
                     808321..808394,808447..808508,808565..808585,
                     808639..808703,808758..808802,808862..809008,
                     809060..809121,809166..809244,809295..809710,
                     809765..809989,810035..810053,810105..810159,
                     810208..810356,810412..810431,810484..810692,
                     810740..810871,810922..811334))
                     /locus_tag="CNH01300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513420.1"
                     /db_xref="GeneID:3259211"
                     /translation="MGDQKLKDAGVEPSRLLTTDAASPEQGLSSMEECLGENDQQRRS
                     SEPLPDRESVQPSSNCNIVEDLELVPIQHTDIPPVTPSQINNPSTVVKLEEQERLHRE
                     NEDWRKNALLNLPPPLPYDLVVEKLTIGVPNRKALRWVPSLFKVFAKRKEKDEEEPGK
                     PKKKWILQDVSCECQNGEVLAILGGSGSGKTTLLNAIANRVSGLPTANGEVAYFSVEP
                     HAGVRRGIKLEKGQMKKRIGFVRQQDFLVECLTVRETLTYAAKLRLPNHLSDEAISFI
                     VEQTIDELGLRDAADTVVGGPLRKGISGGEKRRLSIGCALVTLPSVLILDEPTSGLDA
                     FTSYLLLLTLSQLARRGRTIILSIHAPRSDAFEIFDRIALLSKGEIVYSGLRKDCLAW
                     FYSLGHEVERGVNPLDFLIDVSSVDNRTPENEEASIARVRSLVQAWNNRSPAHWADNL
                     EKASMRSSTSFISIDNLSPQGNNSDEVSSNGVGGDDASRDIGARDEQRPGLWKQTRVL
                     TARAHRNVYRNVPQLVGFAIQAVLLGVIIGVTYYQLPETPTGIQSLKNLSFQLIPGVF
                     YLQQVFWIYKFCTDLVIFDREREDRLYDVIPYVLSDFISYLVPSILSPTIYVVLVYFI
                     SKLRTDELAANLFISIASTILVQFTTQGLALLSASLLRSFSAASMLGNSLNLFQIMSS
                     GFILTNVPVYVAWIRWISPYFYSFRIIATTQFKDRVFDCPAESNANLNQCRGNNVLNG
                     LNFDYTINIGVWFGGLIGLAIIEYALACVVLWGLPAGGVKHASEIDSHHRGKETDVRE
                     SHITRDKIDVSVRNLSLMWKRRGRGPLKDREKIILNDLSLDFPAGEVSAILGPSGAGK
                     STLLQLIAGRQLNPGPLSHYTISGTLLFANQPISRTTQSNVAFVEQDDDWHLPSLTVR
                     ETLTYAAILRLPVKMPKKQKVARAETVLRMLGLKDCADLPIGGALLKGISGGEKRRLS
                     LAVQMINDPAVLVVDEPTSGLDASIALGVMHVLRDIAATGRTVIATIHQPRSDIWKLT
                     DNVTLLAKGGTIAYTGKRSDAVQYFASINHAMPSEFFNPADHLLDLVSIDPRVSYHHQ
                     SLTRVNGLTSQWRIQSVGQENGDEQDKNGADSAIIKHGEGTTPMKIALPVVLERHWKN
                     LWRRKDVFFNRLAQTPLLGALFILFFQRLTYGPAGAQDRIGVTIESTSAIAFVGLLNA
                     MSIFPADRNLYLHEAKSSARYSPATFMITYSLVEVGFELLGGFGYGAIMNVAIGMQTS
                     ARIYFEYSISIWAMVNMGESFAMIFGSWIQTEGLTVTVVSTFLSLIGQVSGVISLSVP
                     AWLAAIAWGTCVKAATRIQIINEAVGLEFHCTNEEISSGACVAQSGEQLLALFNWHDL
                     DTGKFVGVMIAVCIAWRIMAWASLAARVGGIR"
     gene            complement(811602..814625)
                     /locus_tag="CNH01290"
                     /db_xref="GeneID:3259240"
     mRNA            complement(join(811602..812969,813018..813402,
                     813452..813755,813807..813897,813947..814008,
                     814111..814203,814323..814625))
                     /locus_tag="CNH01290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572550.2"
                     /db_xref="GeneID:3259240"
     CDS             complement(join(811817..812969,813018..813402,
                     813452..813755,813807..813897,813947..814008,
                     814111..814203,814323..814457))
                     /locus_tag="CNH01290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572550.1"
                     /db_xref="GeneID:3259240"
                     /translation="MARRFVLYGVASTVFAFGVVSTALRTRANFYAAAVSIGKSSGSM
                     MILGNFTLFNAILLGIGVKNLFFGQLRTIEYEHLWEKLWMFLTESLLALAIFRDDFSI
                     SFMAMFSVLVFLKCFHWITADRVDYMDQIPPPGPPRQFHIRMVSIISLLMLLDFLFVS
                     YSLETILLEGVSAMIIFASEFIILQATIAGSAARYAVGVIDLRRARGREDAPVWEAKS
                     TYLFYIDLSVDFVKLLTYLMFFTVIFLNYGLPLHILRDVYLTFMSFMGRIRDLMRYRR
                     ATRDMDNLYPDATEEELERSGDRTCIICREEMISRNQREREGMQVNEGGPNETPKKLQ
                     CGHVFHFHCLRSWLERQQKCPTCRRDVLTRQRPPGLVYNPPMPQEPLRPAPAARPGDH
                     GRDAQLVELMRQNLNEYFPNDNNNRRDGAARISTTQGTNSRAGESSGSQEGTEQRIQR
                     GIWGGPIVPGRFTPAPLGAAPRISSPSTPFTLHRSGQATPTRTVPQIFANQQEDNDNL
                     PSNPRIPQDSPSYYNNSRVVSGNVTPFSSNPPFSFSNTGAARATREEAGQDDNDVRRQ
                     VADAALRRLGGMTGSGESLPSVREDKGKEREHMQEENELDRWDAVPRVHAQLAPKQFH
                     ALDHDHLSRSNKRPKLDSSAAYTPPFENWTQRIERTSDGTRRGLDERLKLLGQVDERI
                     WGLVGELTRLRSEWEAEDGAVSGTSSRSRSSPGEGAAAPIAASSVSDPPRGDDSGVEQ
                     "
     gene            814842..816609
                     /locus_tag="CNH01280"
                     /db_xref="GeneID:3259293"
     mRNA            join(814842..815402,815455..815512,815568..815579,
                     815629..815712,815759..815873,815920..816188,
                     816248..816609)
                     /locus_tag="CNH01280"
                     /product="DNA-(apurinic or apyrimidinic site) lyase,
                     putative"
                     /transcript_id="XM_572318.1"
                     /db_xref="GeneID:3259293"
     CDS             join(814877..815402,815455..815512,815568..815579,
                     815629..815712,815759..815873,815920..816188,
                     816248..816575)
                     /locus_tag="CNH01280"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase,
                     putative"
                     /protein_id="XP_572318.1"
                     /db_xref="GeneID:3259293"
                     /translation="MARVITSATPKRERSASSPLTELEPEVPAPKAVKPKRAVRSTKP
                     KNEDTKENDNNEDAPAAAKKQRVSKAKAWPPAELEPMLHLPRQGYPAFKLPCSTASSN
                     GGIAPQNDKSQPMLLGAHVSAAGGPATALLRAGLAGANGLALFVKSQRQWKSKPYEDE
                     TVQRFKELMKSKEEGGMGYGPESILVHGSYLINLGNPDPAKWKVSYECFKDDIARCHQ
                     LGIKLYNWHPGSTVGACTKEESFALIAKAINQVHKDVPEVITVIENMANAGSNIVGTA
                     WSDLSSIIKLVEDKSRVRVCIDTCHTFAAGYDIRTPETYAETMKRFDEVVGNKYLAGV
                     HLNDSKANLGANKDLHENIGLGEIGLTAFRCIMRDPLMTGIPLVLETPAPDAPTPAEH
                     LSIWTKEIALLYEIQAIEDDEWDVKKGEIEKRWRKERDAINPPKEKKKPAAKGKAKKA
                     KKVEDDGCSHDED"
     STS             815295..816082
                     /locus_tag="CNH01280"
                     /standard_name="Hind25"
                     /db_xref="UniSTS:470903"
     gene            816734..817982
                     /locus_tag="CNH01277"
                     /db_xref="GeneID:36392990"
     mRNA            join(816734..816982,817042..817982)
                     /locus_tag="CNH01277"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658699.1"
                     /db_xref="GeneID:36392990"
     CDS             join(816811..816982,817042..817616)
                     /locus_tag="CNH01277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514614.1"
                     /db_xref="GeneID:36392990"
                     /translation="MSRISGYSDYLMSRYIRKLILRHGEQPRSKRRRKHKVLRKYDSL
                     KQIMSPQQNSRGSASSSGTYTIFPPKTANLAVSDGSFSPQALTTTPNSTTPLTTSDPR
                     SNSSSKPSDYFTTPTSSPQDIRHPSPSRVNTSDSISRMTGNDSQTSSSSLRRILETGI
                     LRPFKRSKPFSKEENVMWRNILRSPICRPTMTSELPSIASLPISHKDLVKKADEETAG
                     RGRVSNESLVIPQNFDDDSTQSTYSSDRNE"
     gene            817995..820343
                     /locus_tag="CNH01275"
                     /db_xref="GeneID:36392989"
     mRNA            join(817995..818273,818342..818492,818547..818706,
                     818757..818987,819033..820114,820190..820343)
                     /locus_tag="CNH01275"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658700.1"
                     /db_xref="GeneID:36392989"
     CDS             join(818399..818492,818547..818706,818757..818987,
                     819033..820114,820190..820218)
                     /locus_tag="CNH01275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514615.1"
                     /db_xref="GeneID:36392989"
                     /translation="MNQHYNPHISSSRRSSRQSLESDRSTHSVATTPPFELSMGLPPN
                     PAAWRNRSHSAASSAGEIEPPTSASMGGRVSYRDETVPRISRLYASSSNGSTPRTGFV
                     SPTSPDSMELSTGSLLSGPSPLLTRRSTGKSGLSIRSLEQSRNASSVALTRINTALTG
                     ESSFLDHSSDGEKNGKERTKQGRMRQRVSRTFTRVSRWSALALFISKRDSQSNASQKS
                     AISYPISPANTSMLPSSMSADDAASVIIPDRSFPYETKYDIVPPAEFEGNTSQVDLAF
                     PRPNLVSEQSNAVLWRLEEDKDEQTVPTGTSQSVRMYHEPSRRLFRLQEALAKMTGGT
                     TGTGVETTDLPGPSAKAGLSRSPPAQQRPVSINSMDTEVTEIVDNESSDDEAPSFKPK
                     VAAYPSSRGILLGTSSEARLSPISGNIPIEFEGVKLNLRMDDDGKTSSGSEDMGRQSK
                     ELTTSGASANLDITLGNASGDTLGNLGILDSVNNSDENQTLQTRGVSSTSTTLGERRG
                     RIPERLNFVTDADQIPDKQHLSR"
     gene            complement(820235..821148)
                     /locus_tag="CNH01273"
                     /db_xref="GeneID:36392988"
     mRNA            complement(join(820235..820764,820834..820935,
                     820991..821148))
                     /locus_tag="CNH01273"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658701.1"
                     /db_xref="GeneID:36392988"
     CDS             complement(join(820365..820764,820834..820935,
                     820991..820992))
                     /locus_tag="CNH01273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514616.1"
                     /db_xref="GeneID:36392988"
                     /translation="MPPKQGKKYAVAYGRRPGVYNTWQEAEQQVKGYPNAIHKKCKTE
                     EEAYQWIGRAHVAAQSGNNPTPQQVYRIAAQANPQNGQSKNSHEQNGYSRYPTGSFGQ
                     RSTYPQTGYSYDRPETPTAHTAYALGAYMLPATHSQNLYTQSDPWSRRPQEYYYYIKD
                     SDSDDSF"
     gene            821355..822878
                     /locus_tag="CNH01270"
                     /db_xref="GeneID:3259117"
     mRNA            join(821355..821493,821557..821776,821835..821954,
                     822024..822099,822292..822557,822612..822878)
                     /locus_tag="CNH01270"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_572317.1"
                     /db_xref="GeneID:3259117"
     CDS             join(821385..821493,821557..821776,821835..821954,
                     822024..822099,822292..822557,822612..822765)
                     /locus_tag="CNH01270"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_572317.1"
                     /db_xref="GeneID:3259117"
                     /translation="MAEHLMFKGNLAGHNGWVTAIATSSENPDMILTASRDKTVIAWQ
                     LTREDNLYGFPKKILHGHNHFVSDVAISSDGQFALSSSWDHTLRLWDLNTGLTTKKFV
                     GHTGDVLSVSFSADNRQIVSASRDRSIKLWNTLGECKFDIVEDGHTEWVSCVRFSPNP
                     ALPVIISAGWDKTVKVWELSNCKLKTTHHGHTGYLNTLAVSPDGSLAASGGKDGITML
                     WDLNEGKHLYSLDAGDVINALVFSPNRYWLCAATASSIKIFDLESKSLVDDLQPDFDG
                     LSDKARKPECTSLAWSADGQTLFAGFSDNLVRVWAVVA"
     gene            complement(822584..823567)
                     /locus_tag="CNH01260"
                     /db_xref="GeneID:3259247"
     mRNA            complement(join(822584..822949,823003..823083,
                     823135..823262,823360..823567))
                     /locus_tag="CNH01260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572316.2"
                     /db_xref="GeneID:3259247"
     CDS             complement(join(822902..822949,823003..823083,
                     823135..823262,823360..823540))
                     /locus_tag="CNH01260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572316.1"
                     /db_xref="GeneID:3259247"
                     /translation="MSGMNLPPGLRPSSGPPQQGGQRGAPSPEEREAAEARARQQDEM
                     KRTMIAAMLEPAARERLSRISLTRPQLAAQVETLLVNMGQQGQIRGQVSDEALKGLLE
                     QVSNPAPAKSTSSVSQSSRTKTLGGGITIQRKRDDSDSDEYDL"
     gene            823688..825833
                     /locus_tag="CNH01250"
                     /db_xref="GeneID:3259173"
     mRNA            join(823688..823821,823887..824015,824074..824172,
                     824235..824481,824541..824818,824871..825480,
                     825536..825833)
                     /locus_tag="CNH01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_572315.2"
                     /db_xref="GeneID:3259173"
     CDS             join(823732..823821,823887..824015,824074..824172,
                     824235..824481,824541..824818,824871..825480,
                     825536..825687)
                     /locus_tag="CNH01250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572315.1"
                     /db_xref="GeneID:3259173"
                     /translation="MSAEQPATKTSRGPAEEVVAKRLKALGKKLQRFKGYASQKPETL
                     NADQRAGLASLPALEGTVKELEELSKQIEYVELEQAGKVRELKDQAKKDAEAHGLAQV
                     EQFQSTISTPLSLFLRLYNLLHPARASDHDNLTFGRLELPRNMQEEIQATDVLRVGRW
                     YEDLLAGDERAKTIIKCLATGPDGADDEDDRVHHLLKLLAESDSLPAEEEVSAVEERE
                     QPAEKTPAADEIVEEVPQEAAPEEAIAVTEPEPQSQSQVEKQQPKNMVFNFLQEDELA
                     ASQPQISEPSTTQPTQTATPTETIPPEDPIPESEPQPTVRSAIPAFDWAAEDDEQPSD
                     SPAPVENPCDAQPSQTTQAEAKTSIDETSDQIIEKNVLANAHVAQPFPQEAGVSAPPA
                     VDNTAAAPPAAKIMSGGRGRGRGGRGGRGGRGGGQQKGQQNQQQQRQQQAGQVGQKVD
                     DDGFQFVGKSPTAQHGPVPARGRGRGKAYSRGRSGGGGPRPTNDTRTPPQDGQSSPAQ
                     GQQRQQNQRSPRPTRLSSQQAKPTPA"
     gene            826548..828258
                     /locus_tag="CNH01240"
                     /db_xref="GeneID:3259162"
     mRNA            join(826548..826691,826755..826812,826881..826912,
                     826972..827011,827079..827172,827233..827421,
                     827469..827535,827591..827822,827875..828258)
                     /locus_tag="CNH01240"
                     /product="cytochrome-b5 reductase, putative"
                     /transcript_id="XM_572314.2"
                     /db_xref="GeneID:3259162"
     CDS             join(826638..826691,826755..826812,826881..826912,
                     826972..827011,827079..827172,827233..827421,
                     827469..827535,827591..827822,827875..828167)
                     /locus_tag="CNH01240"
                     /codon_start=1
                     /product="cytochrome-b5 reductase, putative"
                     /protein_id="XP_572314.1"
                     /db_xref="GeneID:3259162"
                     /translation="MAAARFLSSARIARPSVISRTAAQYRGYSSAAPSGGANWPLLLS
                     VAGATGVGAYAYLQYNPSVKKEVEAKIKGAEAEKAAAERTAAGISAFVKDTWIPFTLE
                     KVGKYNHNTNIYHFSFGEEGKDKISGGEVASVVLLRSPEGPEQIKDEKDKPIIRPYTP
                     ISPPDQKGSIEFMIKSYSGGKFTPFLSNLSPGQQVLFKGPLQKFKYQPNSFEKGLCIA
                     GGSGITPMWQLINHSLSIPEDKTKWTLIYSNVSEADILLRKEFDALAQKYPGRLDIKY
                     VLDKGPWGWKGETGYVTADLIKKTFPKNEGENIRAFVCGPPGQMKAVSGEKDGMKQGE
                     LAGALKELGYTSDEVFKY"
     gene            complement(828239..>830514)
                     /locus_tag="CNH01230"
                     /db_xref="GeneID:3259111"
     mRNA            complement(join(828239..828338,828390..828463,
                     828513..828651,828706..828793,828849..829390,
                     829440..829555,829607..829676,829735..829971,
                     830016..830213,830266..>830514))
                     /locus_tag="CNH01230"
                     /product="cytochrome b2, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_572313.1"
                     /db_xref="GeneID:3259111"
     CDS             complement(join(828270..828338,828390..828463,
                     828513..828651,828706..828793,828849..829390,
                     829440..829555,829607..829676,829735..829971,
                     830016..830213,830266..830514))
                     /locus_tag="CNH01230"
                     /codon_start=1
                     /product="cytochrome b2, mitochondrial precursor,
                     putative"
                     /protein_id="XP_572313.1"
                     /db_xref="GeneID:3259111"
                     /translation="MGEYVYAQRGWGDEKKLEITSAATMERTARTTIFRRGVQHAAIR
                     SRYPAVASRLPFARRGFSAVAIENKTSEGYRRALLLGGIAATLAATISYTLLRPLHLK
                     DEDLPDPSAPIDQATGRALIPYSEVNKHNKPDDCWVVIDGKVYDLTEFAESHPGGSSP
                     IYRAAGRDATAIFQPIHPPGTVEDGLDPKAMVGLVDPATLPKVVDKKKEDGEQRRVDL
                     AEIIGLPDFDAAAKANLTSKAWAYMSSGATDQYTLDLNRKAFNSILFRPRVLVDVEIA
                     DTRTQMLGQDTSLPIFISPAGMAKLAHPEGECLLAKAAGQSNIIQMISTNASAPLPSI
                     ISSATSPSQPFFMQLYVDRNRPKTESLLGKINSLGLKAIFVTVDAPAPGKREADERSR
                     AEVEVASGISGGKIGSDNKGGGIGRSVGGFIDPKLSWKDIEWLRQHTKLPIGLKGVQT
                     AEDAMKAAKMGVDAIYLSNHGGRALDGSPPAMYTLLEMNKICPEIFKKCEVYIDGGCR
                     RGTDVVKALCLGAKGVGMGRPFLYSLTYGEEGVVHAIEIMRDEIETTMRLLGVTKLDQ
                     LGPHLLNTKALDPLVFDQPMWGPGEKQ"
     gene            830474..832166
                     /locus_tag="CNH01220"
                     /db_xref="GeneID:3259286"
     mRNA            join(830474..830997,831054..831104,831160..831788,
                     831851..831915,831969..832166)
                     /locus_tag="CNH01220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657650.1"
                     /db_xref="GeneID:3259286"
     CDS             join(830808..830997,831054..831104,831160..831788,
                     831851..831915,831969..832032)
                     /locus_tag="CNH01220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513328.1"
                     /db_xref="GeneID:3259286"
                     /translation="MSKPNVLLFGLGGIGGIYASILQLSGKCNVHVVARSNYQKVRNQ
                     GFKIISPKFGNHDGMKFAGVWKSTDEAAASGAEFSYVLCANKALLDAKPSLPDHLRPI
                     ISPATSIVLLQNGVGAEVPLHEAFPNNTIISAVVWTGGKTLPDNEGVEQFNREGLTIG
                     VDYREGGDRKEEDEKLETLVGLLEAGGGDCIVTKDIQSERWVKVIWNCCWNTLTASTL
                     LKTGPFFQSSDLALPLCYSIMNEVVAVAKAKGLTVPDGTTEKLIKQCTDVPYPGLPSS
                     MMADVKAQRPTEVEVILGTPVREGIRLGVPVPTITTLYTLIKAIDYRNQNPDAANA"
     gene            complement(832072..834922)
                     /locus_tag="CNH01210"
                     /db_xref="GeneID:3259278"
     mRNA            complement(join(832072..832374,832437..833024,
                     833083..833838,833892..834003,834060..834922))
                     /locus_tag="CNH01210"
                     /product="Pi-transporter A-1, putative"
                     /transcript_id="XM_572311.2"
                     /db_xref="GeneID:3259278"
     CDS             complement(join(832208..832374,832437..833024,
                     833083..833838,833892..834003,834060..834626))
                     /locus_tag="CNH01210"
                     /codon_start=1
                     /product="Pi-transporter A-1, putative"
                     /protein_id="XP_572311.1"
                     /db_xref="GeneID:3259278"
                     /translation="MALSFILRGENDQTPMIAPGDVPSPTIISLTNTPAIPPTQPLNP
                     SNTSSDDDGAFPPSRFSLDPEKRDPRLSNREFDQSHPLFQDLAPEDSYHDGVYWADLP
                     FNERRKWIDAQSNEETSRELKHIWQMFKKDPLSPLTTYCRTYVMGGFGLFTEGYALFS
                     IGNLSALYKAVWPLCWKTHEVCSSNWIAAVDYLQIIGIILGQILVGIEGDWIGRKFGL
                     VQDALIMTLGLVMLTAAWGTNLEGWVICYGFSQFFYGIGVGGEYPMTSTTAMESKSVA
                     GSQKNDKLHRGRNVVLAFLMQGWGQLFNQAVLIILLLIFHHSGNPPYSEVSAQWTYRV
                     SFAIMAAMTLWLAYFRFYKKKYTSAALRRSKKNMRVNQSGYDLHSLKLVGTHFAGRLV
                     GTTMGWLFNDFLFYGNKLFASTFIEIISPNAAGNVIVTWNWNMVNIGVSLCGYYLAAF
                     LIDHKFYGRKRMQIIGFLGDAVLFMICAIWYTELSSPAHIKGFQTIYYLSSFFQQFGP
                     NCTTFLLAAEVFPVSVRATAHGLSAASGKLGALLPAVIYNYVDTRTRFWIVFPFGFAG
                     VFVTLLFIPDTTGLDLREQDRYWAYVRQGRAHEYHGIAVHPRHLSWWEKIVLKRHLAY
                     DPEKDRMQRVRELRMMYEEKRQAMEEAREHEEHDEEMEEELSHSAYHHFNSEKASLEK
                     HMANSAPSTSPNSPRPFVGMNGNVPAAPLSPISPATLSRLTPSRMAL"
     gene            836352..838023
                     /locus_tag="CNH01200"
                     /db_xref="GeneID:3259153"
     mRNA            join(836352..836593,836658..836702,836776..837098,
                     837156..837501,837556..837675,837732..838023)
                     /locus_tag="CNH01200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572310.2"
                     /db_xref="GeneID:3259153"
     CDS             join(836480..836593,836658..836702,836776..837098,
                     837156..837501,837556..837675,837732..837890)
                     /locus_tag="CNH01200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572310.1"
                     /db_xref="GeneID:3259153"
                     /translation="MISSTAATVFGLVLASVGVQASTPLVRTYQGDSFFDRWTYYGNY
                     DNTTNGDAIFANKSVATSTPELTYVTSDGSAIIRVDNSSTVQYNYKRDTVKITSTDSY
                     PVGSIWVLDAVHLPYGCSVWPAFWSYGAGATWPEEGEIDVIEGVNMGFSNQMALHTED
                     GCSLGSSGSSFTGIVNDTSCYYEDNDNSGCGVTETNNASYGAAFAAAGGGVFVTELAE
                     SGISIWFFSRSDIPDAISNADDEIDTSTLGTPSAYWGTDTCDITKFFGDQSLVFDITL
                     CGDWAGQSSILASTGCSALSGSDTCYTTYVLDASNYDTAYFEINSLKVYSNGSSSNSS
                     SDSSSSSAPSTHRFSALGWLLAGVMGVSALVGMM"
     gene            complement(838568..843526)
                     /locus_tag="CNH01190"
                     /db_xref="GeneID:3259129"
     mRNA            complement(join(838568..839505,839556..839653,
                     839705..842992,843049..843268,843316..843526))
                     /locus_tag="CNH01190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572309.2"
                     /db_xref="GeneID:3259129"
     CDS             complement(join(838734..839505,839556..839653,
                     839705..842992,843049..843268,843316..843332))
                     /locus_tag="CNH01190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572309.1"
                     /db_xref="GeneID:3259129"
                     /translation="MFTKATSHLRPFIRLPSSHSPASPDHFTANPSLLHHLPQHGTSN
                     SVIVQGQHSAQAGGASGHAGRTGYGGGAGAGGGYTGHARAFLSLPQTASFDPSSTLSD
                     ERKKDASSSSSSNTSLLLKHRLSKTPRIVHLNDSVRARRAIEERKGGKDFTVVELEDV
                     PRIHRRDSIAEYTSGRLPLTSTSTRSLSRSHTSFDIFQVGIPQPRSIGLRALSTTSNA
                     PRALEAEDIEAVEELELMTPRAGREVRTIGQPNRVLMDLAGRDLPSTVTAGWQLGGIR
                     RNSTAAVERPSLDLPPADLSSIATHEQKEDKQREEAILQALRQAKQNGNAELVKNLIT
                     HYRSPRSLPPFSPDSLPGVPELSKHYPLPSGYSIRIYNACLIAALAIRSPGQSIAPIL
                     EIYNELLEKDMIPDSMTYGAVIRALAMRERDVRGSQEIWERQKTWGLWRSEISGNQTW
                     DPEVAAENDANIEAYLAENNVLSAVRLFRAAALTGQAGRFVVSIHGTVLDALSKLEKP
                     DVTVMEQLVEHAESHEVPGIISLYKHLFLAYAKIKDASALSQVWNKYRGLAKTASRED
                     WAAACGQREAYDVRIEGAMREPWDIVISAFIEVGELSKAFEVFGEMAEVAEKKTKAEV
                     PPATHRTCGVLVTALARAGEFDLALEWFNSLQASAIVTQNSPHRLTLEHTIVLAEQLL
                     LKGRWFDAADVVIGLGGIRDELAQPSAQHSLRTVAWKTNFALIHHAARSTPEEAARTL
                     ARAQEVLAAVPIQLDLRTVVLHLTLLAQASDYTNMIRVVDLISARKLPANTIQRLNDA
                     CDQIAKEDIPFKYRIELIKAFGRHHADLTPFVAEKLIQAYISEKSKPVDERDLSKESL
                     YILLDAFTVVEQKQVNEGEYDEALEQLMQDLAATDVSEDMKNATSNQAIGYLVKNVIF
                     RFGAERARSMLGAVFGEQEATNLVQPVSPTFIQSETVSGSERLSEAASPSQSHASSAT
                     SAPALSFSQTLTSSIERFTYRNPTITPLEAYALLRDGLSVSQVPRLEIILSLMDHLAR
                     RNDEPKVRELYELAQVVLNSLVRPDVQAQSWYSAENAMLIACCHLGYLEEAGLHRARI
                     VQAGFTPSADAYATMIASSKDTTDDALVARELWEEALGMGVKPHLFLYNTVISKLSKA
                     RKAESALDLFMRMKSERIRPSSVTYGAVINACCRVGDALSAETLFEEMTSQPNFRPRV
                     PPYNTMMQFYLQTQPNRERFLYYYGALQRARVPPSAHTYKLLIDAYATLPPIDIPAME
                     LVFAHLIADKSVRVQGTHWASLISAYGIHAGDAKRAKEVFDKIPEKGGDYEAVVWEAW
                     LNVLSQQGTIEQLEEAHTRMLESGVQPTAYVYNVLINGYARAGNIGRAREVFESMGDS
                     ITGVAAPNNHPVLLTSSGHAKPSTQAATTGVVYREPSTYESMIRAEITCGDQQRATEV
                     LQRMEERGYPMAVYMRGKAALEGEPPKF"
     gene            complement(843643..845280)
                     /locus_tag="CNH01180"
                     /db_xref="GeneID:3259340"
     mRNA            complement(join(843643..843948,844002..844398,
                     844450..844498,844548..845280))
                     /locus_tag="CNH01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_572308.2"
                     /db_xref="GeneID:3259340"
     CDS             complement(join(843847..843948,844002..844398,
                     844450..844498,844548..845247))
                     /locus_tag="CNH01180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572308.1"
                     /db_xref="GeneID:3259340"
                     /translation="MPPAASPPSPHASLRPRPTIADVPIAPRRRLRDGSRAGSVSSGR
                     SNGASRSGSRESSRSSSSRVALLVPAATVTTPSVVASGAPSRSQSRAAQEPIEISESE
                     SENGNGSGDSIVAISPQAVSRGQTLASVHSRRITRSAVTSRSGTHERRTNQSTPVLVH
                     EDSLSSSDEYGPRYTTQEKGKGRAVPSSIPIEISSDEEDELLGLQSVKAKSVETEKEN
                     EGTGLDESSALGTGYHCPICFNAPNPAILTPCGHILCAGCLHSSLLAAIRRNPNPYPN
                     PFASLPHRGRSRGRTRGSTPTRRGHGFSRVKEEQPTHWTADMLRQAYMDQKIAEMEQG
                     LLQQKWPEEERDAAIAGMIEEMEDVQVKEVLNGLWSVDGKWVVEGECPVCRKALAGGY
                     GPPNSGIGGVIPLQVRLSTALQR"
     gene            845473..846517
                     /locus_tag="CNH01170"
                     /db_xref="GeneID:3259000"
     mRNA            join(845473..845577,845627..845638,845848..845926,
                     846000..846103,846167..846383,846441..846517)
                     /locus_tag="CNH01170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572552.2"
                     /db_xref="GeneID:3259000"
     CDS             join(845569..845577,845627..845638,845848..845926,
                     846000..846103,846167..846383,846441..846442)
                     /locus_tag="CNH01170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572552.1"
                     /db_xref="GeneID:3259000"
                     /translation="MPKNKGKGGKNNRRGKKEDGENKRELIFKEDGQEYAQVVKMLGN
                     GRLEAKCQDGESRLAQIRGQMRKKVWIVVGDIILLSLRDFQDDRADVIHRYTPDEARN
                     LKTYGELKDFQLVENQEAGGEEDEEGGIEFEEADIDDI"
     gene            846696..850193
                     /locus_tag="CNH01165"
                     /db_xref="GeneID:36392987"
     mRNA            join(846696..847222,847274..847580,847653..847845,
                     847902..850193)
                     /locus_tag="CNH01165"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658703.1"
                     /db_xref="GeneID:36392987"
     CDS             join(846757..847222,847274..847506)
                     /locus_tag="CNH01165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514617.1"
                     /db_xref="GeneID:36392987"
                     /translation="MSSPFPIPQLTYPSPSNSTSNPATFAPSPLSQFVASALASTTLA
                     PGSNGGGTGNTPNLGTMGISPNFSFGLTPSNLSQGPTSNIPFSQLALLNSTEATNAAL
                     PAENDGTGLLRGLEQADGVLGRMEELLKEIDNVEKGVFGDGEGIGRLEGLYLEYTQLL
                     LGLLGSSQSQLFGALPILPANEQLEKKEPTAQDLAAWAEERASLEFSRKEALRAGGKA
                     VLDVLRASAAAGGK"
     gene            complement(848016..851322)
                     /locus_tag="CNH01160"
                     /db_xref="GeneID:3259360"
     mRNA            complement(join(848016..848355,848409..849142,
                     849202..849255,849307..850216,850270..851322))
                     /locus_tag="CNH01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657649.1"
                     /db_xref="GeneID:3259360"
     CDS             complement(join(848261..848355,848409..849142,
                     849202..849255,849307..850216,850270..850858))
                     /locus_tag="CNH01160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513327.1"
                     /db_xref="GeneID:3259360"
                     /translation="MPRTQQPSTGLGIEDELSFGSDEDLIADVGEIALPATAPNPPSN
                     AKADKDRKSRFKLSGKKKSAEGSVLASAHPQHSTREMRDTSHKKEKKSKEGRSLASAS
                     IVLDPQMESVLDLTSGGAYYNAGSASGGSTPSLPSLTSGSTTSSRKKGGFRNALKGLG
                     MKKESEQSSLFATRQREKLDKLKQVHSIDSFSTGEYSMQPSIDLSLSTYSSRRTDTTM
                     SSVYHHLTPTNAPGTKSRTEREESLHSKHASVSSVTPSQPPSYANTDRQPAASNHKMI
                     LEKFPEAPATKETIPLSSPSTLSSRAPSPFLSPALTSILLPSFPTTASSLENIQILSA
                     TVIRRTDSSSIEKERSSSLRNLAGGLGNGSSPSSKRPVWISQQMILTSFKIGGNTPVG
                     SPNPEAAHVITSESETDAAKTTAHLHLFSIPTTTPRSSLKSSTSPIKPSPPQPQVELE
                     RMMLKADSTAGFWEETNGERKFVMRIGFGYGKGEEREGEGVEWIVEMRNAEQLREWIQ
                     QIKSIAVVIRAEKEGHGHAIREAFSTGSARGDDLALALNMQRLTPSHSIKSRPTSYQS
                     GNTGTPVRNSVSSPIGRPPRKESLPEAPTPSRAPASIVEEDKQEAAKEESPMLLPEEI
                     RGRLDRLDLGLYTPPTRGSNLRQASETSLSPARLNQPIPAKLPPPTVAPPSIPKFAIP
                     APQEKEKKMLTEAEKVRLEAQASTPVPVAPVSVLAGSSTTLHAPEQAADAQSIHSIPS
                     VSSKTSTTTSRRRAAKKMALDIMSEFNESGMGDFEVEEEVPINEDRARAVRFA"
     gene            852815..855319
                     /locus_tag="CNH01150"
                     /db_xref="GeneID:3259315"
     mRNA            join(852815..852937,852996..853531,853587..854089,
                     854149..854456,854506..854704,854759..855319)
                     /locus_tag="CNH01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657648.1"
                     /db_xref="GeneID:3259315"
     mRNA            join(852961..853531,853587..854089,854149..854456,
                     854506..854704,854759..855319)
                     /locus_tag="CNH01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658704.1"
                     /db_xref="GeneID:3259315"
     CDS             join(853072..853531,853587..854089,854149..854456,
                     854506..854704,854759..855076)
                     /locus_tag="CNH01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513326.1"
                     /db_xref="GeneID:3259315"
                     /translation="MFAPSDQQITDPIQVIGPSLLLQVFYSLPLRDLLNCSLVSTTWY
                     TLIDNHSTSIFRDLASDIVSDKRRLQFLKSLGQDEVRDPTLYNASFIRAGTLGSDKKI
                     SWRGICRDAVVTERNWKYGRAKPGWLTPGRNTVWRMKVDPEENVLYTVSRLDGIQCSS
                     ADVEGNSNLLFEYTDVAPYSHMEFVSGFVVFNIGLANALEVHITPSAMRRLTPEQRQA
                     IPPPSISETYGSDYSFTQEDDDAYRSTQASTDIPYRGHLTYYKTLRPATECWAFRARM
                     DNEGQEGERPVLGTAGREAIYLFGLADDRVETIRIRHQHVDRDISYIEFDDHYVFICG
                     PVAMHVYSRQTKQLLNSFPTSYLRDLDAQVQAVYELSESNEIQRLPSAFEGATRVSEI
                     VVKGLWRQDSAFENAERLISERMLLANGGFSACHFTSSDLFCANKYSVLFVVRDYKSV
                     FSIVDKRERSEALSRNLLAIRFKSPINQLYTNGERVVFNTTSEVYLLDASSLPPPPYN
                     LSSSYFADGVWPSIRILSLLDVHTNGLKHSSCLQMDGTKIYLVYWALGEQDGGGIVYD
                     DGQAHLPPAHATADFGMCIKTWDFGHVDY"
     CDS             join(853072..853531,853587..854089,854149..854456,
                     854506..854704,854759..855076)
                     /locus_tag="CNH01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514618.1"
                     /db_xref="GeneID:3259315"
                     /translation="MFAPSDQQITDPIQVIGPSLLLQVFYSLPLRDLLNCSLVSTTWY
                     TLIDNHSTSIFRDLASDIVSDKRRLQFLKSLGQDEVRDPTLYNASFIRAGTLGSDKKI
                     SWRGICRDAVVTERNWKYGRAKPGWLTPGRNTVWRMKVDPEENVLYTVSRLDGIQCSS
                     ADVEGNSNLLFEYTDVAPYSHMEFVSGFVVFNIGLANALEVHITPSAMRRLTPEQRQA
                     IPPPSISETYGSDYSFTQEDDDAYRSTQASTDIPYRGHLTYYKTLRPATECWAFRARM
                     DNEGQEGERPVLGTAGREAIYLFGLADDRVETIRIRHQHVDRDISYIEFDDHYVFICG
                     PVAMHVYSRQTKQLLNSFPTSYLRDLDAQVQAVYELSESNEIQRLPSAFEGATRVSEI
                     VVKGLWRQDSAFENAERLISERMLLANGGFSACHFTSSDLFCANKYSVLFVVRDYKSV
                     FSIVDKRERSEALSRNLLAIRFKSPINQLYTNGERVVFNTTSEVYLLDASSLPPPPYN
                     LSSSYFADGVWPSIRILSLLDVHTNGLKHSSCLQMDGTKIYLVYWALGEQDGGGIVYD
                     DGQAHLPPAHATADFGMCIKTWDFGHVDY"
     gene            complement(855367..856481)
                     /locus_tag="CNH01140"
                     /db_xref="GeneID:3259210"
     mRNA            complement(join(855367..855507,855569..855664,
                     855836..855928,855988..856020,856077..856175,
                     856238..856276,856344..856481))
                     /locus_tag="CNH01140"
                     /product="expressed protein"
                     /transcript_id="XM_572305.2"
                     /db_xref="GeneID:3259210"
     CDS             complement(join(855483..855507,855569..855664,
                     855836..855928,855988..856020,856077..856175,
                     856238..856276,856344..856348))
                     /locus_tag="CNH01140"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572305.1"
                     /db_xref="GeneID:3259210"
                     /translation="MACNCSLEKNIACCSTSEAQDKCTCQKGKCECEACPNSTKTSES
                     GACNCGDKEKVSTCGCNGSGEACTCPPGQCACDKCSKKAKSVSTCGCGGSGAACSCPP
                     GECACDSCPNQAKEKVSSCDCSGSGTA"
     gene            857884..859715
                     /locus_tag="CNH01135"
                     /db_xref="GeneID:36392986"
     mRNA            join(857884..858625,858682..859005,859056..859254,
                     859304..859462,859515..859715)
                     /locus_tag="CNH01135"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658705.1"
                     /db_xref="GeneID:36392986"
     CDS             join(858932..859005,859056..859254,859304..859462,
                     859515..859571)
                     /locus_tag="CNH01135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514619.1"
                     /db_xref="GeneID:36392986"
                     /translation="MGSPPAANCQIGCWTKGGCMWLGKQSPHCIKGLTFRPDAEYLQL
                     PSNQTLVSSFPGAMSRAVALNHLATALMGLAIVFMFFCLKPDEGWSYWSKKLESWANF
                     IAWLAFWFDLAYIVVLRDRISNNDTGFDFHLGNAFWLMLYTVLHRSFLSYQVQTNSVA
                     KT"
     gene            complement(863396..865722)
                     /locus_tag="CNH01130"
                     /db_xref="GeneID:3259093"
     mRNA            complement(join(863396..864527,864578..864755,
                     864810..864935,864995..865113,865169..865722))
                     /locus_tag="CNH01130"
                     /product="pof4 protein, putative"
                     /transcript_id="XM_572304.2"
                     /db_xref="GeneID:3259093"
     CDS             complement(join(863878..864527,864578..864755,
                     864810..864935,864995..865113,865169..865490))
                     /locus_tag="CNH01130"
                     /codon_start=1
                     /product="pof4 protein, putative"
                     /protein_id="XP_572304.1"
                     /db_xref="GeneID:3259093"
                     /translation="MPDPLEYAEEEDLFGSEGEYDTTDPFTLENVNPSVPIATPTTLP
                     IASISRPATQRTRQQVYPHISRSAVSGRNDGEARLQELRNLKKKGKEEPPKFGVRSLK
                     NIAMGVVQANSGRIWDIGDLEYSLVKPFIDEVPMEQLAEIEANSPHIKKDTDWLYELF
                     MLQDYRLFHERCRERQGEPRTTGWRKMYKKAKEDAAERQLQAADRVAARYKQLEEEKK
                     SKSIVVLDRVVPDKRRSRGRGRGGSSIGSSSSSRTAGAASAIAKARAEAQRARIALTH
                     ASGRYVPPAQTQTHAQRVASSQLFKNPFLPSGSTSTSSTGYPPAPSPPQSRLPPPKSL
                     RNSLDRISSIPKSRKQLQHPLSSPISGSFPTSQHSQMRAALPAHLSGRTGTSSPQPSE
                     RFRIDGDRKKKEFKEIRKPQVKNFEAPKLENEKSKEKVDFFGGAGADGGGIFRVKKRK
                     LGTEAGAGGAKRQQ"
     gene            complement(865908..868979)
                     /locus_tag="CNH01120"
                     /db_xref="GeneID:3259198"
     mRNA            complement(join(865908..866927,866980..867436,
                     867484..867703,867751..868284,868337..868979))
                     /locus_tag="CNH01120"
                     /product="Kex protein, putative"
                     /transcript_id="XM_572303.2"
                     /db_xref="GeneID:3259198"
     CDS             complement(join(866000..866927,866980..867436,
                     867484..867703,867751..868284,868337..868951))
                     /locus_tag="CNH01120"
                     /codon_start=1
                     /product="Kex protein, putative"
                     /protein_id="XP_572303.1"
                     /db_xref="GeneID:3259198"
                     /translation="MRTLLSLWGILLALIVPPSLALQRPQPRSYDTHAYYALELDPSI
                     SPAAALQLSKSLGVELVERIGELDGHWLVRTEGWTPEHASITKRSVSHDPILKRWEAL
                     PSSLGKKSLTPLSLKQRAKRHKSYSPRSRHSRDDRTELLYAQNELHLADPMLDQQWHL
                     INTQMKDIELNVTGLWGRGITGEGVHVVIIDDGLDVESKDLKDNFFAEGSYDFNDHTE
                     LPIPRLKDDQHGTRCAGEIAAVPNDVCGVGVAYDSKIAGVRILSAPISDADEAAALNY
                     AYQLNDIYSCSWGPPDDGRSMEAPDGLILKAMVNGVQKGRDGKGSVFVFAAGNGGGSD
                     DQCNFDGYTNSIFSVTVGAVDRKGLHPYYSEMCAAMMVVAPSSGSGDHIHTTDVGKDK
                     CSHSHGGTSAAAPLAVGVFALALSVRPDLTWRDIQHLAVRHAVFFNPDDPAWELTAAG
                     RHFSYKYGYGKLDAGLFVEAAEKWQLVKPQTWYDSPSVYLPTTSPADVTRRQDEAADG
                     PTSSDEETSNPPPVVEPSGSFITEDGVISTYEVTQSMLFDANFERLEHVTVRVWIDHQ
                     RRGDVEVELTSPNGVVSVLCRQRRFDNADSGFPGWKFMSLKHWDENPVGTWTIKVKDQ
                     VNPDKTGRFVAWSLQLWGESVDPALAKLWAPAEEGQPDEEQTGSNPSTTVSQKPKPTA
                     LLPGDHGEASGEATQPGLGSATAHPQPTSTTGDAGNVAEPTGPTDADADEGFFSGISN
                     LASSSTWLAGAGAIIILSGAAIGAFFFIRARRQKRNLFGLSNNGQGARGAYEPVDDVQ
                     MSLLERGRRKFGKSKSESQGTKDLYDAFGDGPSDEEEEDLDERTALRYHDGFLEDDEP
                     NEVGPKTEYKDEPESEPETFKDGEETVGTKDKGKGKGPSEGESGSGSSSSWQDAADEE
                     ARV"
     gene            869166..872046
                     /locus_tag="CNH01110"
                     /db_xref="GeneID:3259348"
     mRNA            join(869166..871564,871614..872046)
                     /locus_tag="CNH01110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572302.2"
                     /db_xref="GeneID:3259348"
     CDS             join(869212..871564,871614..871624)
                     /locus_tag="CNH01110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572302.1"
                     /db_xref="GeneID:3259348"
                     /translation="MGVQIDGEALGTLLKRLSSSSYLSIDDIALLADALVPSSPRLAR
                     ATAYLCLSKACSDLDSKQTDGKAIYDAIFPFINSIFHKSVPKIQEIENDEDAVEIMAP
                     EICVPAVYLLTALFPIAPSASASLLTGKIGDEGDSLGILLELAELPSPLQPALAELFV
                     AAADSKQGRDLVLTRGMEWLKGGVKYEEGSGDVTALCAAALSKLSGSSDADQGKPPSE
                     GQGIESITASNADREELAKKMMAFVEDSSSNYPALQSIIEGLAVLSLRPRVKVLLSSS
                     PKFLKSLIDLSPVPGRKGGSLPVTPRGMIDADNDAKLFESVETSFCYGLASILVNITS
                     PKPILSEQDQEMEKLRKMAISADKSKLNEQDEDAELDSNLEVLKRVKAVLAAGCVNAL
                     SGLIRADSRLVKEAIGRLCRNLVDSPDEEKDRKEWMRRRVLFVKDGGFKVLSIVLRDL
                     LAMATVKPSTKASDTTLSPANPATIDIIPACQALAKLVVTTDPATLFPPPYQVTALNA
                     LTPLYHLLIHPDSLLIQRFEALMALTNITSIDPTISAKLIKASIKPLKVESLFRTSYS
                     SEEVRVITKVEEMMLDDNELVRRAAVQLVCNLTSSQTGYDYFSGEDSTTTPSRARSLL
                     NILVVLTCIDDVPTQSAAGGALAMLTESPIACKYILMGDIHSSSSADQTPPRSPWSRI
                     CGLLETAPEVEYDERTEPIPIISSTPSQPNAELVHRGVIILYNLLEYVVGLPGKEREA
                     EKKRIEADGVQNVLFGVLKVVKDMGDEMIQPVVFSLKMMRENLKCAH"
     gene            complement(872708..874610)
                     /locus_tag="CNH01100"
                     /db_xref="GeneID:3259040"
     mRNA            complement(join(872708..872798,872859..873073,
                     873127..873174,873233..873677,873743..873947,
                     874005..874113,874171..874610))
                     /locus_tag="CNH01100"
                     /product="NADPH dehydrogenase, putative"
                     /transcript_id="XM_572301.2"
                     /db_xref="GeneID:3259040"
     CDS             complement(join(872762..872798,872859..873073,
                     873127..873174,873233..873677,873743..873947,
                     874005..874113,874171..874395))
                     /locus_tag="CNH01100"
                     /codon_start=1
                     /product="NADPH dehydrogenase, putative"
                     /protein_id="XP_572301.1"
                     /db_xref="GeneID:3259040"
                     /translation="MPIAEATDILFSPITLGAMKLQHRVALAPMTRNRAVPSNLNPGT
                     YVPCPLMAEYYTQRTTEGGLVISEALPISLQAADARAVPGIFTEEQIEAWKPIVDAVH
                     QAGGIFVAQLWHQGRTRMVENEYAIISSSAVPIVKSFTGLPGLKPRPMTLEDIERVKK
                     EYAQAAVNCIKAGFDGVEIHGANGYLPEQFLHSNINRRDDKYGGSPENRNRFVLEICQ
                     AVTRVIGPDRFGLRLSPYGFFNEARGDNRVEQWTMLCRDIKGLGWAYVHFMEPRYDEI
                     RSGADKLAELGENNEDVTLDPFVNALENCIPVIVAGGYDADNVRKSRVLEDKKADVVA
                     FGRYFTSNPDLVYRLKHDKPFVQYIRPRFYGPFPDPEVGYTDFPFCHELSGTPERKAL
                     LSSGTAKVLKVAEPGWQLSKSGIQLGGLFAAVTQD"
     gene            877179..878775
                     /locus_tag="CNH01090"
                     /db_xref="GeneID:3259098"
     mRNA            join(877179..877578,877853..877940,877991..878263,
                     878312..878453,878509..878775)
                     /locus_tag="CNH01090"
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572300.2"
                     /db_xref="GeneID:3259098"
     CDS             join(877403..877578,877853..877940,877991..878263,
                     878312..878453,878509..878528)
                     /locus_tag="CNH01090"
                     /codon_start=1
                     /product="general RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572300.1"
                     /db_xref="GeneID:3259098"
                     /translation="MSGLALPKASNAGPSSSSSKPEGIQTLDGEGSLATRPPQKAIAS
                     VPEITAVDGLVPTLQNIVATVNLDCRLDLKTIALHARNAEYNPRRFAAVVMRIRDPRT
                     TALIFASGKMVVTGAKSEDDSRLASRKYARIIQKLGFEAKFAEFKIQNMVGSCDVKFP
                     IRLEGLAFSHGAFSSYEPELFPGLIYRMLKPKVVILIFVSGKIVLTGAKVREEIYMAF
                     NQIYSVLLEFRKTT"
     gene            879050..881257
                     /locus_tag="CNH01080"
                     /db_xref="GeneID:3259265"
     mRNA            join(879050..879347,879410..879469,879536..879557,
                     879620..879714,879765..879918,879981..880038,
                     880105..880429,880485..880534,880593..880625,
                     880675..881007,881063..881257)
                     /locus_tag="CNH01080"
                     /product="lipid particle protein, putative"
                     /transcript_id="XM_572299.2"
                     /db_xref="GeneID:3259265"
     CDS             join(879075..879347,879410..879469,879536..879557,
                     879620..879714,879765..879918,879981..880038,
                     880105..880429,880485..880534,880593..880625,
                     880675..881007,881063..881195)
                     /locus_tag="CNH01080"
                     /codon_start=1
                     /product="lipid particle protein, putative"
                     /protein_id="XP_572299.1"
                     /db_xref="GeneID:3259265"
                     /translation="MQATHLIVLIHGLYGDVHNLDAVKSELLALADPETSNISDKGAS
                     GAEKHNRCIHNERPKKRMETVVYLPKSIKGAHTWDGIDVCAHRVAEELDYEIERLQDE
                     GKDIVGFSVMGYSLGGLIGRYLIGLLHARQPSFFARHRPVSFSTAATPHLGVLKYGTK
                     TNTFVHSIGRKLFSHTGRQLYCMDHETEWGGRNLLEVMADPDGIFINALRLFPRSMLV
                     ANGTRDLTVPYPTASISPVDPFDDSTYLDIEIDENNIIQSYRHIPLDDDSVSNFGSIS
                     TSTTQRIEKDEEEVEVLVTTIYKKPGRIMKVKKRSPPPFPPVLILPLRWPFNYSLLPF
                     IPVLLPLFILYMTIMITWITFHSRRRVQSLRHNQIERQPLLSSSSSMSSTPSSSLSDM
                     TSSVKQTLYEPIKALEDGTSTPPMADPLPTGSAPQPLLTPHQKMMVKALNEAMPNAKR
                     VIAWFPWAYNAHAMLICRSMARFPWQKDGLGVVQAWAKFAFEAGEAECHAKATGAVAH
                     GNT"
     gene            881940..883521
                     /locus_tag="CNH01070"
                     /db_xref="GeneID:3258990"
     mRNA            join(881940..882660,882712..882884,882940..883521)
                     /locus_tag="CNH01070"
                     /product="pyridoxamine-phosphate oxidase, putative"
                     /transcript_id="XM_572553.2"
                     /db_xref="GeneID:3258990"
     CDS             join(881963..882660,882712..882820)
                     /locus_tag="CNH01070"
                     /codon_start=1
                     /product="pyridoxamine-phosphate oxidase, putative"
                     /protein_id="XP_572553.1"
                     /db_xref="GeneID:3258990"
                     /translation="MAFPRSIIKTLDKLILNSTIRTMSTQHVFGTPSTSSDPALPSSA
                     PETVKLTTHNQYLTPRLLASDLSPNPLLQFNSWFASALQPSQGEVAAGRKVNEPEAMT
                     LSTATAQGIPSSRVVLLKTVDKTGFVFFTNYTSRKSEELLANPYAALTFYWREVSKQV
                     RVVGKVEKVSREESVEYFNTRPRGSRIGAWASKQSQPVEEGQLEERVKNEEKHWEGKE
                     VECPEFWGGWRVVPFEVEFWSGQPSRLHDRFRYTRPEGSEGEWEIKKLSP"
     gene            884526..887121
                     /locus_tag="CNH01060"
                     /db_xref="GeneID:3259155"
     mRNA            join(884526..884582,884635..885286,885343..885564,
                     885623..885871,885952..886082,886147..886223,
                     886280..886372,886432..887121)
                     /locus_tag="CNH01060"
                     /product="calmodulin-dependent protein kinase I, putative"
                     /transcript_id="XM_572298.1"
                     /db_xref="GeneID:3259155"
     CDS             join(885099..885286,885343..885564,885623..885871,
                     885952..886082,886147..886223,886280..886372,
                     886432..886929)
                     /locus_tag="CNH01060"
                     /codon_start=1
                     /product="calmodulin-dependent protein kinase I, putative"
                     /protein_id="XP_572298.1"
                     /db_xref="GeneID:3259155"
                     /translation="MMHASKHKMGFSDFRDAILIQPPSFKKKKEYVLEELLGRGGFGK
                     VVKALWAPPEREPKEVALKIINKKLVKGNEQAVLDEISVLKHLDHPNIVHVWDDFESR
                     DKYYIAFELAVGGELFDRISERGKFTERDAVECIRQVLQATAYLHEHNVAHRDLKPEN
                     ILYKTRDADSPLVIADFGIAKHLETPDQECSEAAGSFGYAAPEVLLGKPHGMKVDCWS
                     IGIIAYTLLCGYPPFRSDDRNGLLQEMTRGRIMFHDRYWSKVSRTAKDFVKDMLETDP
                     KKRSTAADALNHPWLTSGQATETDLSAAIRDNFDAKRKWKSALRIIQASNRIRSASRS
                     RSPSLSTSPPSTANTANPSPNSALFVPEVPHVLTPLSMTDEDPMSDEHYYFSADDQGH
                     TEEEEEAKVMTRGGKKKAGSMPVGSGSGVTTGTVTPYTTGNEGSNTPKPTIKVIDGNG
                     ELRPEETDMQTPPATAPVGAGMMGSIRGMMGKLSL"
     gene            887291..888600
                     /locus_tag="CNH01050"
                     /db_xref="GeneID:3259164"
     mRNA            join(887291..887383,887448..887487,887590..888600)
                     /locus_tag="CNH01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_572297.2"
                     /db_xref="GeneID:3259164"
     CDS             join(887371..887383,887448..887487,887590..888367)
                     /locus_tag="CNH01050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572297.1"
                     /db_xref="GeneID:3259164"
                     /translation="MPHKRAKRSVREAETAKKGKNLPPSSDGNPYDDTPRSAARILNS
                     FAVQQKFHESGRKTSEDTGTPRNSATPGVNGKGKGKEKEGLPKILPQETLAEYNRRIE
                     SLLRPSVSQAIQKAESIRAAEAADLKRTKKENKRRARLEKLVKEGKVDKKVLEDFEKG
                     VKEKKRKREMGDEGDSEEEKDEEEAGAKSKQAKETKTFAPMPQPRRLNDIVQAPPTLP
                     TLRKAKDQKEGKGVYGAVGNGGKMPLNAGQKRILEEERERVVRMYREMKAAREAKNKK
                     "
     gene            complement(888408..889414)
                     /locus_tag="CNH01040"
                     /db_xref="GeneID:3259207"
     mRNA            complement(join(888408..888836,888993..889169,
                     889298..889414))
                     /locus_tag="CNH01040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572296.2"
                     /db_xref="GeneID:3259207"
     CDS             complement(join(888532..888836,888993..889169,
                     889298..889343))
                     /locus_tag="CNH01040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572296.1"
                     /db_xref="GeneID:3259207"
                     /translation="MDKEKLAKLQSQVRIGGKGTPRRKVVKKSVTSSQGDDRKLQAAL
                     KKLGVQPITGVEEVNMFKEDGNVLHFGAPRVQVHAALPSNTLAIYGPGQTKELTELVP
                     GILNQLGPDSLANLRRLAESYQSLTARQAAAAAGSGGEGAGEAKEGEGDDEIPDLVDN
                     FDEAEVKKSDLEELE"
     gene            889963..891356
                     /locus_tag="CNH01035"
                     /db_xref="GeneID:36392985"
     mRNA            join(889963..890244,890303..890725,890780..890935,
                     890990..891356)
                     /locus_tag="CNH01035"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658706.1"
                     /db_xref="GeneID:36392985"
     CDS             join(889995..890244,890303..890725,890780..890935,
                     890990..891042)
                     /locus_tag="CNH01035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514620.1"
                     /db_xref="GeneID:36392985"
                     /translation="MLAPRTTRIHRTYIHPTTSKGNVNKENAHALPSKTPSRIGGKQL
                     IGPATGMRMALGAKTEGRDRNVLRQQGEGKGKGREVDDIEPKRLFVNSSKDSIPPSKS
                     LSSMPPIPSLPTRTPAPRRIAPSQSQTLRTPAPTFKFVEPQPTPLPSATRTGRRSRQS
                     LSSTPGKGDLGLDKQKGQQFVTPAPVRWEEDLSLGSVEVEHLEGLEELEEEEDGEPEY
                     MPPPVQELPYDPGWDVPDLKEIFGKIATMPLLFGIGNEMPEPPELIFEEEEVGPLRLC
                     KDDDLEEDWLKPNIADH"
     gene            complement(891748..892333)
                     /locus_tag="CNH01030"
                     /db_xref="GeneID:3259304"
     mRNA            complement(join(891748..891916,891994..892100,
                     892236..892333))
                     /locus_tag="CNH01030"
                     /product="NADH dehydrogenase 10.5K chain, putative"
                     /transcript_id="XM_572295.2"
                     /db_xref="GeneID:3259304"
     CDS             complement(join(891810..891916,891994..892100,
                     892236..892324))
                     /locus_tag="CNH01030"
                     /codon_start=1
                     /product="NADH dehydrogenase 10.5K chain, putative"
                     /protein_id="XP_572295.1"
                     /db_xref="GeneID:3259304"
                     /translation="MSSFAKQIPKAVKEIRLHFCQTSAASAGVRQFVQSSYPAVKSAN
                     PDLKFLIREASNISPRAFVRFERGVESEAQLANLSEPDVGKVLTHLVNQQSGAGVA"
     gene            894073..896875
                     /locus_tag="CNH01020"
                     /db_xref="GeneID:3259268"
     mRNA            join(894073..894834,894887..895633,895686..896875)
                     /locus_tag="CNH01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_572294.2"
                     /db_xref="GeneID:3259268"
     CDS             join(894420..894834,894887..895633,895686..896527)
                     /locus_tag="CNH01020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572294.1"
                     /db_xref="GeneID:3259268"
                     /translation="MKDVVPAVSSTPKAAKFIEYLKTTSTPENQENANSSNNEDLSAT
                     ARRGPKPAVWNYLPPPIEEEVKPRSKKSGWVDKDGNPLPDAPPRKKSIINIIEEKEAQ
                     EEKRAKKAAQAKEKRKRTIEAKKKKKTEEKIEFGLLPKGAGPTEEYPILLALDKQKSL
                     PTKSQAKLKNGEVTRSPRPKHNIVEDINDLVYGPAKTRNGKGNTATDPIDLDHSSEIS
                     DRKSRSDGSTSTLIGSSKANKSGVNAQIGRFSASKASTQRRLPFKESYPSSSNRERSQ
                     LGSPPSLKQPQGLGTPHTDDTAVGCDSMEHPSTMTRIPSSVTQAGDKSTTTASGLPYS
                     SPLAGRGKILGHIRGGKLKGKGKLIEYLPESDLEPNLEDFKSLDVERLERAAETYQSK
                     EIHNPPSPIIARPVPRQFQRLVPINRFQPPSRSPSPMWSTLPVPSKRKISSPSSSSKD
                     SKAFTSNKFRVPSLFPTTRKRSPAQSPSSPRKLTRLTLFTPTSKEEDACRPIPERSLY
                     TINTIRGTTYAPSVVHNDMPGGKSHRLVGIKGRLTLPPGRSGYPSRTNTNGLMTTWKN
                     KNDQQTQISQNGYSGDPAYDYRDYQIRAGPSGTGNDYDEGYEDEAEGDKEDWQSAWKR
                     RNSGGTGVAPGQMMGRRRLERTSIEADEMDAAEQYIFQPHERY"
     gene            complement(896790..898128)
                     /locus_tag="CNH01010"
                     /pseudo
                     /db_xref="GeneID:3259239"
     gene            complement(898130..899591)
                     /locus_tag="CNH01005"
                     /db_xref="GeneID:36392984"
     mRNA            complement(join(898130..898418,898485..899591))
                     /locus_tag="CNH01005"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658707.1"
                     /db_xref="GeneID:36392984"
     CDS             complement(join(898355..898418,898485..899050))
                     /locus_tag="CNH01005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514621.1"
                     /db_xref="GeneID:36392984"
                     /translation="MALYSQTRPHPIPVGVDSGATQHMFKGQHAFSDIRVLPEPIAVM
                     TAQKGTTTFATEIGSVTMIMDAGGTQISLLDLLYVPQLGRNLFSVSAMCHSEYTWRFD
                     QKRAYLQPNNDHSVTIASAPRVPPGQDLSAETWVSLPRRRVCSPATSPRLGDLFPRRS
                     AALEPRIDRTGVDALYNLLSLPQRRCLKQLGHLCWNVQKGDPTAEDEED"
     gene            899761..901906
                     /locus_tag="CNH01000"
                     /pseudo
                     /db_xref="GeneID:3259029"
     gene            complement(902701..905320)
                     /locus_tag="CNH00990"
                     /db_xref="GeneID:3259204"
     mRNA            complement(join(902701..903008,903062..903394,
                     903446..903482,903539..904023,904073..904158,
                     904212..904376,904428..904645,904697..904765,
                     904817..905320))
                     /locus_tag="CNH00990"
                     /product="myo-inositol transporter 2, putative"
                     /transcript_id="XM_572293.2"
                     /db_xref="GeneID:3259204"
     CDS             complement(join(902764..903008,903062..903394,
                     903446..903482,903539..904023,904073..904158,
                     904212..904376,904428..904645,904697..904765,
                     904817..904951))
                     /locus_tag="CNH00990"
                     /codon_start=1
                     /product="myo-inositol transporter 2, putative"
                     /protein_id="XP_572293.1"
                     /db_xref="GeneID:3259204"
                     /translation="MSSTPSQLDKDTGLSKFVENANEIETIEDTGVPPIKPSGFGGHL
                     IDENLVKVEGEDKVTPYLCFLISASAIAGFLFGYDTGVVGVALPLVGTDLGGSVLSSS
                     QQEIITAGTTIGAIFGSAILGGWGDRLGRKVAILIADFFFTVGAVLIAASYSVPQMIV
                     GRIVLGVGVGGAAAIAPLFITETAPTAVRGRCIGVNAFFIPFGQVVSEAIGAGVQDMK
                     NGWRLLFALGAVPSLVQLVLFHYLPESPRILILRGQTDRARHVFSSIYPNATPEMIDY
                     KFRVAQEYVAATTALQSGTTYWQRAKTLFTKGSYRRSIVTVSLIQMAGQLSGFNTLLY
                     YAGTLFGLLGLTNPALGGLIPAGTNAFFVLVGMTLVDKVGRRGLLMFGVPIMLAGLVW
                     NIVAFHYLCIPTGGLLDTSYTYDTKLVGIVIGGIVFFTTGFGLTYSHLAWYQSEFLAL
                     EVRSVGSGIATTANWVANLVVSVSYLTELETLTPSGTYGLYLGFSVVFFIFAIFCYPE
                     TKQLSIDETSLLFEEDWGVKRSRQMRRERREAQRRLADSEMTEVVTAHVQAQKQKDSA
                     VTRSELDNFMARLKNGGRRLSVPQ"
     gene            complement(906523..908692)
                     /locus_tag="CNH00980"
                     /db_xref="GeneID:3259355"
     mRNA            complement(join(906523..906744,906801..907517,
                     907565..907582,907638..907710,907762..908035,
                     908094..908438,908494..908692))
                     /locus_tag="CNH00980"
                     /product="expressed protein"
                     /transcript_id="XM_024657647.1"
                     /db_xref="GeneID:3259355"
     CDS             complement(join(907786..908035,908094..908230))
                     /locus_tag="CNH00980"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513419.1"
                     /db_xref="GeneID:3259355"
                     /translation="MISMIPGKLSTNEDLRKATIALGSSHSGCRYIRGALEAKQGFIV
                     GQRRICSSLQSLYPHDERNNFGKKIISRFPIISRGSNGQWSCDGHDKLSAWGFQFCGI
                     RDVWSGYLILISCYPIIEWERISSGY"
     gene            909343..912612
                     /locus_tag="CNH00970"
                     /db_xref="GeneID:3259088"
     mRNA            join(909343..909913,909965..910528,910578..912612)
                     /locus_tag="CNH00970"
                     /product="transcription factor PacC, putative"
                     /transcript_id="XM_572292.1"
                     /db_xref="GeneID:3259088"
     CDS             join(909538..909913,909965..910528,910578..912391)
                     /locus_tag="CNH00970"
                     /codon_start=1
                     /product="transcription factor PacC, putative"
                     /protein_id="XP_572292.1"
                     /db_xref="GeneID:3259088"
                     /translation="MAYPTLPPNLLSTPNTYSDSVSPTDPEPITPELVSREPEKPAQK
                     AAKTAMNNTSTASKPSESKGETLPCKWTGCSHISDSPDELYDHLCTVHVGRKSTNNLC
                     LTCGWENCGTKCVKRDHITSHLRVHTPLKPHPCAVCGKTFKRPQDLKKHERIHTAEHH
                     QLHKLSKAPTTADPEFNSRVSLSSATRIDRPRSPLSTSLSPTSTSSHSLHSSSSPFDH
                     LLATGFHTDKSVSPTPSALALLHKKQHEELAAYQQKEMLVLQQLAFNQQQSQAYAARL
                     AAEPFGTGAGAKRGQADAFHDLLSDVKKRKVEPVYDQDMIHRLNALVPPSLPTSFPTL
                     PSLGGYNQYQTFPSFNGYPSLPSLHTSIYPTTAPQAQYSNQSPLPIPEIKTEADLAMF
                     NEFMISLGRDAAANKAGPHPMTQSASGSGASNGYSASNSGTPLSETSGGVEDLFNAEE
                     LASLGLAGMPGISIHSGGSHNSNDESTHSLSDASPPAVSFGGLYPSLDAMRNRTNSAP
                     DVSALSGAARRPIAGLPRTSMGNAHNTSTNQSTKPSYLSGMFGHSSSQQYDGTTHNYL
                     HGLSNEHHNDYSHSANNGATNAYASFDSLARNKQSFPAATLAPKMFHNKVYRDVAPLG
                     TAVSKRARESAERTNVEDSDREELYADQESNHGYAVSNERAREERTPKIPVRSLIASI
                     RTLSPSTAADGEDDLKLPAISPSHVEPGTDLPPLYSIQRGGHSSGQYRRASSLSSNST
                     STSGSSSFNSSLAPSNVASGTTTPRGSTPPRGVPTKRHTEDEIVRGVKRLELGPAEPL
                     RSTTPELPDSGTTEQALERDQKPDISALSLSSSPTPPSNNPPPSVSTANEEGKDMTIE
                     EMRRRHAALIKSWLVAVNLQWRRKKMEEMQRQQREEMEELEEGGEAMNVDERERERVE
                     VVA"
     gene            complement(912754..914328)
                     /locus_tag="CNH00960"
                     /db_xref="GeneID:3259279"
     mRNA            complement(join(912754..912962,913046..913096,
                     913166..913227,913314..914328))
                     /locus_tag="CNH00960"
                     /product="expressed protein"
                     /transcript_id="XM_572290.1"
                     /db_xref="GeneID:3259279"
     CDS             complement(join(912860..912962,913046..913096,
                     913166..913227,913314..914189))
                     /locus_tag="CNH00960"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572290.1"
                     /db_xref="GeneID:3259279"
                     /translation="MSTKPRAQTKPTISSPTPLLPLSLPSSPSKRQRTRVPRTVLKLV
                     VGVGVLVYLVWLGAFLWERAVLSPGDAGGFALGSGSFVYTQEKEGVRGEGEGIMSDKP
                     EAYVTFLSSITDPWYFLSTRLLLYQLHHHPHTSDPLRPLVVLTTPQIPAEVETQLEHQ
                     GAEVKRVELLVDGFPIPEGMGDNHHWKDQYTKLHIFNLTDYSRLLYLDNDILLLQSLA
                     PLWETNLPTVKTGGVAGVGERNKLNMVENDKRTRPEEGEVKDYLNAGFMMITPDEKRF
                     GELRKVRGYKPFYMEQALLNHYFDWEGAHPWEELDPLSVSHFPQKEDLARGYYALHAK
                     MWKDEIDKEVVDYWEESVKDMELFWGSSR"
     gene            914352..916262
                     /locus_tag="CNH00950"
                     /db_xref="GeneID:3259031"
     mRNA            join(914352..914578,914629..916262)
                     /locus_tag="CNH00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657646.1"
                     /db_xref="GeneID:3259031"
     STS             914515..915330
                     /locus_tag="CNH00950"
                     /standard_name="Xba10"
                     /db_xref="UniSTS:470904"
     CDS             join(914562..914578,914629..916189)
                     /locus_tag="CNH00950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513325.1"
                     /db_xref="GeneID:3259031"
                     /translation="MLVPSHLRDHLLHSLSPLPNTQPLGLTVLASQPKRTRELFPHAV
                     HPPKCTQQEWLVVFDSEMETDKVSIKDAGDGKSAKHPRVLIAAISAHLYTFSPSVPSV
                     LYISKVDSSGYSSSATPLPLTRHLIRSFILFFLAHCPALRVQLFARAQRQYLFANSAD
                     WKGKKVLGGAGLCKWWKGVYEDVVSSWASSSPSPGPAGSTGLKLKVEKQAMKLRFILP
                     GYDEQEAKALLGAGRPLPEGVEWTYTPPFTSPLIPSASGSGSGSDPKISLATLIPSLP
                     DDPKTRFLQELVSEHPRPPTSSATAKDEQGGQEISNDGSGPGTGRGGREGGKEGKTRK
                     LHEAEEDAAQRKFAENILHSVGIAEFWERMGFRQECASGDVTGFFTLESVTEVESKRK
                     SEESSPDATTPIATAAAAATPAIAKNALLPQAITERLLTALTNLDFASPSLAIEGSTI
                     WLEQTRSIVVGEVGKVGWDLCVGRIEAKAGQAGQTGQANMGVGDGGAREGAGEGVRKR
                     EEVVTMLQPRKKKKVVQ"
     gene            complement(916239..919261)
                     /locus_tag="CNH00940"
                     /db_xref="GeneID:3259280"
     mRNA            complement(join(916239..916472,916558..917006,
                     917078..918030,918082..918248,918302..918425,
                     918469..918547,918605..919261))
                     /locus_tag="CNH00940"
                     /product="transcription initiation factor tfiid 90 kda
                     subunit (tafii-90), putative"
                     /transcript_id="XM_024657645.1"
                     /db_xref="GeneID:3259280"
     CDS             complement(join(916337..916472,916558..917006,
                     917078..918030,918082..918248,918302..918425,
                     918469..918547,918605..919210))
                     /locus_tag="CNH00940"
                     /codon_start=1
                     /product="transcription initiation factor tfiid 90 kda
                     subunit (tafii-90), putative"
                     /protein_id="XP_024513324.1"
                     /db_xref="GeneID:3259280"
                     /translation="MSQSPDPSSVKGGAQGQLAPKSSTPTQQPPLTDSKLLRQFVMEY
                     LQSHGFDKALEKLTEQVEDANLSTTASAAVLGDADVSKEVADGKATAGEQGGEKEAIF
                     RAPGPVPLESNIKRNIPQAQAVSASTMSDRITPEFEAQAKYIIEQLQKKVEAVQEEGG
                     DEKEKELRDGIPVDGAMVDVSDKVAGYEAYRRWVDGGLDVWKAELDNLSFPLFVLSFL
                     DMIHSGFLKTAREFFEKHSAHHRELHSQDLSSLSSVSTEEHIKRNPFCARILSEKYVV
                     PLSRNAYDLLLQWLSGASLDDEWEAGLHSAPGRQKEAIKLIVVSHLNITVTNDSAPLD
                     KVTIASKSGLISSSLPPNTNIDAFNTATQLKLGPPPMTEKLKEQVTRTLQDEGEAQGA
                     NGDANGDIDMTSPFPTNEPVIKLEPETERDPSVISPDESETLPPIPAVFRIADLKREV
                     EAIKDKRKMIRLGPSGSGASAGSGVLPSVVAFTLFDHGENANSVEFSRDSSLMAVGSS
                     ESCVRLWSLKGDKLKKKKVDIEGNLVEDEGLPMRKLVGHSGPVYSLSFDPLYGSAGPP
                     STLLSSSQDGSIRLWSMDTYSNLVVYRGHGKDPVWDVEWGPMGVYFASASRDRTARLW
                     SSDRVAPLRMYTGHLSDVNCVKFHPNSLYLATASTDTSCRLWDVQRGACVRLFLGHTD
                     SVTTLSISPDGKTLASAGLDSSIWLWDLGSARPIKKMEGHTGAVTSLTFSAESSVLVS
                     GGLDGTVRCWDVKSAGGERSVDGMFGGGDARRGEERGGLPMNPGDVWDTAPHTPDLLA
                     TWPTKRTPILKTHYTPRNLCMVAGSFVPPSNHRTSGGEK"
     gene            919407..921319
                     /locus_tag="CNH00930"
                     /pseudo
                     /db_xref="GeneID:3259288"
     gene            complement(919499..920239)
                     /locus_tag="CNH00935"
                     /db_xref="GeneID:36392983"
     mRNA            complement(join(919499..919684,919758..919833,
                     919889..919925,920051..920239))
                     /locus_tag="CNH00935"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658708.1"
                     /db_xref="GeneID:36392983"
     CDS             complement(join(919677..919684,919758..919833,
                     919889..919925,920051..920175))
                     /locus_tag="CNH00935"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514622.1"
                     /db_xref="GeneID:36392983"
                     /translation="MSMRTTKATMTELKLRRLIEHNHRLREELARPRVTVSVASMNLI
                     NYCRATKDPLIPSVWGPLPKSDDPYAPLEQAVCCSVM"
     gene            complement(920244..921383)
                     /locus_tag="CNH00933"
                     /db_xref="GeneID:36392982"
     mRNA            complement(920244..921383)
                     /locus_tag="CNH00933"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658709.1"
                     /db_xref="GeneID:36392982"
     CDS             complement(920390..921223)
                     /locus_tag="CNH00933"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514623.1"
                     /db_xref="GeneID:36392982"
                     /translation="MSSTSPYSAATQHTLTKSLALIAPSILEGATKYITNPTARDKMT
                     EDTIQQLKSGIPEVATSIGSQSPRHMILHVKTPTYHSKLRDSGLQTTVTYSWSTRHPT
                     KAGRSAQTVLARFVPEVWFGASSIGSRPVLSATPSSGPSREEYSEELESIAAGMLTEC
                     LEDIIDEDGDDLGASFETALELMAHKCKQGSAAICQSMGASVIDGLDGEGDPYTFFFE
                     TDNCSLTPGDGGSLSFTGHVTGEGWRNADDEKPEKFNLRPADWNFAVSAEEVRSAKNL
                     L"
     gene            923615..926032
                     /locus_tag="CNH00920"
                     /db_xref="GeneID:3259183"
     mRNA            join(923615..923905,924129..924280,924340..925165,
                     925234..925606,925675..926032)
                     /locus_tag="CNH00920"
                     /product="asparagine synthase (glutamine-hydrolyzing),
                     putative"
                     /transcript_id="XM_572287.2"
                     /db_xref="GeneID:3259183"
     CDS             join(923737..923905,924129..924280,924340..925165,
                     925234..925606,925675..925933)
                     /locus_tag="CNH00920"
                     /codon_start=1
                     /product="asparagine synthase (glutamine-hydrolyzing),
                     putative"
                     /protein_id="XP_572287.1"
                     /db_xref="GeneID:3259183"
                     /translation="MCGIFCCFNRAGDISQYRARAIACSKRQRHRGPDWSGCYMTNNT
                     VLVHERLAIVGVDTGAQPLTNEDESLVLAVNGEIYNHVALRKSLKNKDAVFKTHSDCE
                     VIMHLYKEHDTGLCNMLDGMFSFVLVDKSVSPPRLIAARDPIGITTLYMGWNSQSPDT
                     LYFASELKCIHEECDNLQAFPPGHFYDSKEKKLTRYFNPSWWDSDKGVVPHNDIDYKL
                     LRETLEAAVKKRLMSEVPYGVLLSGGLDSSLIASIAARETDKLAEEQEKLRQERKQAI
                     ASGKWVGDEQPLASWPQLHSFAIGLPGAPDLIAARKAADFLGTIHHEYNFTVQEGLDA
                     IPEVIHHLETYDVTTVRASTPMYLLSRKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPT
                     AKDFHEECVKRVKNLHTADCLRANKSTMAWGLEARVPFLDKTFLEVSMNVDAKYKMFS
                     KGTHQEVDEDGRPKMEKYILRKAFDCSPEGKAYLPDSILWRQKEQFSDGVGYSWIDGM
                     KDHAAAIVSDEKFANRATRWPLDTPDTKEAYWIREIFEHHFPTEAAAKTAVRWVPKQE
                     WGVSSDPSGRAVSIHTAAYADGEAKA"
     gene            complement(926641..928198)
                     /locus_tag="CNH00910"
                     /db_xref="GeneID:3258987"
     mRNA            complement(join(926641..927142,927190..927475,
                     927528..927628,927784..927829,927967..927985,
                     928066..928198))
                     /locus_tag="CNH00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_572285.1"
                     /db_xref="GeneID:3258987"
     CDS             complement(join(926986..927142,927190..927475,
                     927528..927628,927784..927829,927967..927985,
                     928066..928137))
                     /locus_tag="CNH00910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572285.1"
                     /db_xref="GeneID:3258987"
                     /translation="MHVSNLVALAALAGSAAALTINTPASIVECQPASITFSDGTSPY
                     ILAAIPGGQVSAAAIETINDSLTTSPYTWTVNLAAGTNITLKITDATGTIAYSSPIVV
                     QAGSSQSCINATASTSGLSTAAVTTTASDTSAAGGGAATTSASESSSSSSAAQSSSEA
                     SSAAASSSSSASSAASTTAASSTGAASSATSAAATSASGTSGAFANAVVGVPALVAGL
                     FAGVAALL"
     gene            928381..929885
                     /locus_tag="CNH00900"
                     /db_xref="GeneID:3259135"
     mRNA            join(928381..928535,928591..928831,928956..929091,
                     929200..929569,929630..929885)
                     /locus_tag="CNH00900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657644.1"
                     /db_xref="GeneID:3259135"
     CDS             join(928446..928535,928591..928831,928956..929091,
                     929200..929569,929630..929815)
                     /locus_tag="CNH00900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513436.1"
                     /db_xref="GeneID:3259135"
                     /translation="MLPIQKDVSMGAEPLPIPISHLSTPIRHFTYITDSELGHGAPLS
                     ITHPLLPDCDHLKQPPSSPISSTGSGSSSDAEDVWTCTCTSYYESEKQTYLCSAECGD
                     LCDCVAQFGNFYSSTNPQTLKLDALPDNWPLVECSPSCLCGLSCSNRVTQQGVRTPLT
                     IRPTPPKGYGLFYTPSTPQFLPRGAFISLYAGEYILPSEIRSRWSPRSTTDLASDKEG
                     YGEEGQGNYVLSLRLPDQTIHIDPRWKGNVGRFLNHSCGANCVVHYVKWGRGRGWPRA
                     AIFTNRDIHPEEELTFDYANASGEPQRAIQLIQESKTKEDTKGRTRCLCGAEQCRGWI
                     PFDETL"
     gene            930005..933287
                     /locus_tag="CNH00890"
                     /db_xref="GeneID:3259216"
     mRNA            join(930005..930158,930232..930343,930401..931113,
                     931168..931273,931335..933287)
                     /locus_tag="CNH00890"
                     /product="expressed protein"
                     /transcript_id="XM_024657643.1"
                     /db_xref="GeneID:3259216"
     CDS             join(930245..930343,930401..931113,931168..931273,
                     931335..933215)
                     /locus_tag="CNH00890"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513323.1"
                     /db_xref="GeneID:3259216"
                     /translation="MKETPAPLSGHIVYLAPKQFQKCVVPYIARKVENMGGSVGSKPN
                     EATIILVNPSHPKSKDGSVKPLKDQLVRPYHWLTYCATRSILVKLEDMKYQEPIFTYP
                     SQKQDWRPLRAYVSRNLNPLNFGEDRATAQLSCMIQLELGGALVVDKRCDADLIILDY
                     NSGFAKTAMEEKKRFRRFEQRLRDRDWMENCWRTRKLSWEEDDNEKEQKSLEKEKSPK
                     GGKKKNAKKNEDVRVDEASDAGEKAEREAREDSFADEEADHMMRKKIGRPIGKPRIDY
                     THEDDDFLCRYLAAYHPGGSWASRKTYQMLMHSGFDIASRHSYQSWHERFKKNSSSFS
                     ARVERYIKAGIARETLKTEKELKNFRRPNQEDAAADSQGESSVSPLKSNKRKLVSEDD
                     LDNEDADDNVPLRSTRTVKKAKKEGKSPIDPNTNVPSAVKDKGKARAPTPSQTPSISS
                     TKGSSQQSQLEITKVFTEFTDLNPRGGPSDTRYSSRNPQSTSQSEHRLSLLSQSHARR
                     KSGSEDSGRTPDLGAADEPEPAGVYEDPPVFIETVVQKLPDEEEQRLLQTKQQFGKGQ
                     AEKDDMAMDAEEVNDLLITALTEDEEEPKRGEVDGEANKQGVAEAMVEMTEVDVEKSE
                     GTSAAKRSEVRVEISASPRVRVGKQADEPHQPTFPRSVSPPMDIQPATELVRRKTASE
                     SPAKMSAQGYSQSDEAVDLPQPVEEKESSSADTAPVQAQPALLKLIPSPVHTAIDSDA
                     DHHTNHTSSTSFHTPQSSKHRLGRPRPSLLREQILASSTKRRRTQDRLSLSTSSVAGT
                     GAFHKSPVQVVEYDTVYADNAIPPRPPRPSLDTASPITPSVQAENGTAERRPAPPPKP
                     LTWEERSAKVAAGADLAAHMRKQYREKIVDLSNKYGLTVSEVVTRISKLKAGGAKGEH
                     YWDDVEKGFEQALGRKVN"
     gene            933417..935498
                     /locus_tag="CNH00875"
                     /db_xref="GeneID:36392981"
     mRNA            join(933417..934524,934588..934644,934726..935498)
                     /locus_tag="CNH00875"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658710.1"
                     /db_xref="GeneID:36392981"
     CDS             join(933516..934524,934588..934644,934726..935414)
                     /locus_tag="CNH00875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514624.1"
                     /db_xref="GeneID:36392981"
                     /translation="MDRRRVTKPTYQPPHLRRPQIPSGVANKQGGWPSTHGNPYANGS
                     VSDAGVEVDSTYGGCPSTSTNPPRVRGASNTRFPTQTEASFTRNISRPGEGGGRPPRA
                     GAGLAAPGVSDLSSPVGPSRSEQRMSRPSMSRGSEPIPGSSKTSLIPSQSTSRSAICA
                     RPPSTPQILHDRYTSRPSRRDWSAPSPSAPFIPSSSTTASVPAPSRTFLQQRDRSALE
                     SSADDIKPMRSRKEEKWTGNDKEGVMEMEMMQSVSRSGGDGAEGDALKNWRTQEKYRQ
                     YIAEKVESHYRKYGTPLHTLPILPAGSAIGKDERKENRKGKELARAGEELESFGSLVL
                     LFRKLREGVVASGRIDSFAIEVFESSARFAILSNNRPQLLSALSGLVPGLYKAYDATK
                     IRSGEDSLSDRISKLDLEDRGLRDNRVEFTSLLLLYHLVTSGQIAFNELWLELTAPVK
                     RQLRGKFEKNERVTPQEDTSFLRMEELSFAKVASTALSSNAFNPLVFFSLVSPASNAW
                     SSRGSPYEKIILSWAIPQVREEGWKRLVKCYMSVDIPWIASILGQSARNEEETVVMEN
                     WVQEKGKKVEQGRVSLRN"
     gene            939956..943554
                     /locus_tag="CNH00870"
                     /db_xref="GeneID:3259048"
     mRNA            join(939956..940092,940227..940305,940429..940492,
                     940941..941630,941728..943554)
                     /locus_tag="CNH00870"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_024657642.1"
                     /db_xref="GeneID:3259048"
     mRNA            join(939956..940092,940429..940492,940941..941630,
                     941728..943554)
                     /locus_tag="CNH00870"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572280.2"
                     /db_xref="GeneID:3259048"
     CDS             join(941131..941630,941728..943180)
                     /locus_tag="CNH00870"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_024513322.1"
                     /db_xref="GeneID:3259048"
                     /translation="MSFAAPDDRAYYNYSRAPGSAHGPGHESTSPDQRLPSSHGYNKG
                     ASAPNESPNQVYHPEMAGPPGSSHSYPPQPMTPLTGSSAYPPQHPPSGSYYLPPQQQQ
                     QQQSEQPIPSPPSSSNRPPSATGYTPDGQPIIPVGVSGGKMFRCRGYGDCDKVFTRSE
                     HLARHVRKHTGERPFPCHCGKAFSRLDNLRQHAATVHAEQAQLNETMLASLAPIHAAL
                     SQRASREQRRRGEVVEVPKGAVERRRETRKAQAAQAAAAAQAAATNGHSQQNSPYAQY
                     HESQWNAPPHPRPRTNGGYDYPYVPEHSLNDDAGPSRRPSSSAGYGYQQGYYDSARPP
                     TAPGSGSSGESMSGLPYPYRPMSASGRELPVPAHYSESEPPAPAHGPPPQSPMYGNVP
                     PAQQQPPNWSSPPGHGTYPPHDTAAYPPPPEGYYPPAHAAHGSYPPREDVYEYHPPGW
                     QGQYPPAAANGGPYAQGYGTGAPPTAPPPHESPFQYNVPNPGAEGYPYQNYDSRKRRA
                     EDDFGKDDRKHPRPSSSSNSQLPDSSTPAHANGAHGAPHPHPHPGAAPGNGAMDPPRP
                     HDPNWLPATTERRGSLAISALLGSPPKAVRSRPSTADGGTAGAHGYESYHYDPHGQVS
                     DDQQTDGDKEREEKGEVKKHGDKKKL"
     CDS             join(941131..941630,941728..943180)
                     /locus_tag="CNH00870"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572280.1"
                     /db_xref="GeneID:3259048"
                     /translation="MSFAAPDDRAYYNYSRAPGSAHGPGHESTSPDQRLPSSHGYNKG
                     ASAPNESPNQVYHPEMAGPPGSSHSYPPQPMTPLTGSSAYPPQHPPSGSYYLPPQQQQ
                     QQQSEQPIPSPPSSSNRPPSATGYTPDGQPIIPVGVSGGKMFRCRGYGDCDKVFTRSE
                     HLARHVRKHTGERPFPCHCGKAFSRLDNLRQHAATVHAEQAQLNETMLASLAPIHAAL
                     SQRASREQRRRGEVVEVPKGAVERRRETRKAQAAQAAAAAQAAATNGHSQQNSPYAQY
                     HESQWNAPPHPRPRTNGGYDYPYVPEHSLNDDAGPSRRPSSSAGYGYQQGYYDSARPP
                     TAPGSGSSGESMSGLPYPYRPMSASGRELPVPAHYSESEPPAPAHGPPPQSPMYGNVP
                     PAQQQPPNWSSPPGHGTYPPHDTAAYPPPPEGYYPPAHAAHGSYPPREDVYEYHPPGW
                     QGQYPPAAANGGPYAQGYGTGAPPTAPPPHESPFQYNVPNPGAEGYPYQNYDSRKRRA
                     EDDFGKDDRKHPRPSSSSNSQLPDSSTPAHANGAHGAPHPHPHPGAAPGNGAMDPPRP
                     HDPNWLPATTERRGSLAISALLGSPPKAVRSRPSTADGGTAGAHGYESYHYDPHGQVS
                     DDQQTDGDKEREEKGEVKKHGDKKKL"
     gene            complement(943711..946509)
                     /locus_tag="CNH00860"
                     /db_xref="GeneID:3259367"
     mRNA            complement(join(943711..944154,944221..946003,
                     946050..946509))
                     /locus_tag="CNH00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_572279.2"
                     /db_xref="GeneID:3259367"
     CDS             complement(join(944046..944154,944221..946003,
                     946050..946200))
                     /locus_tag="CNH00860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572279.1"
                     /db_xref="GeneID:3259367"
                     /translation="MTLLSKPSRSYANVDHDAEGLSAVGSGPYSSTQQGKKLSKKGDG
                     FKTYRPPISETHLRRSLGYDPHPTSHFAPLPSAFQSHRIKKEQALAGQRAEADHLLQP
                     GYRSYHPSDEADSSVAPRRTAGGLGSLRPSPSTSSFNGSAAIGNGRRAAGVYMDSNGK
                     LHDTEYDPFAGVKDMTRAKSNRRSAFGSERHHRAGSSSSSSSDSGQASYRRPSHDMRE
                     EEEVRRKLQIERQQMDDVSSYVARRKSLLSEREGSGRGSPSIRSSEDGPPTGGSFVTA
                     RTRSQQGYYYPSPLSPSFATQGASFANGYPSRTPTASAFPASAGEGTPPEKSTEMTRA
                     KSPPPPPKYEPPPVERPKPKSKVEVKDGTTKIIGFDGPVRPISPNPPPTEQFSSLRVR
                     SPSLSSSSHHLSPPGAPASAAEGLSAASRSSADLTRQMRSPRPIERRHQARDDIYPET
                     PAQTKRRQEREQRRLVSGHGPPAHALPPSASHNTALAVDTALAENGGARILPEIEIVE
                     DDDPRIVFPKEGKTTRVQKTHDHVIKGPFSHALQARKGSHASSTALNTFASAGNGGFS
                     SAIGHSSSIHDFSSLTRPKSLTGSKPGSSVIDDAGGYLPSRWASGDKNLRVTEDEREK
                     YRPREWGGKYGDLGGRENEWRPTPKDQMKRNLKDIATSARFSLYRTKKKLLRKADL"
     gene            946706..951583
                     /locus_tag="CNH00850"
                     /db_xref="GeneID:3259329"
     mRNA            join(946706..947617,947654..948368,948407..948865,
                     948928..949337,949407..951583)
                     /locus_tag="CNH00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657641.1"
                     /db_xref="GeneID:3259329"
     CDS             join(946917..947617,947654..948368,948407..948865,
                     948928..949337,949407..951489)
                     /locus_tag="CNH00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513321.1"
                     /db_xref="GeneID:3259329"
                     /translation="MKSLFSRLKHLNDKEKPNPSSRGKEKERLSILKPRSSSSVSGAT
                     PPLQSREHIEEPPEEILVGDFENQVTDGFTSGPPDTTEETRNPIANVERKVTFKSPPP
                     TPAASVALNSRLESTSNPQEALPKRIDYRPDPISRASSSRQSFIHSFPRPSSSRKASL
                     PSPSLRGSSHTKLHSGVFSPSPSEMSLATGSTTSFLPVANSWSEMTDPDLVDNIGMQE
                     RTRQEVLWEIVSSEERYLNDLLAINEAFCKPLVHSSTSPRLDFFDPFHPLAHTRSATS
                     PTSSSYAPSIDGSSIHLPIASKFASTAPQFRSPSDSSTSSAAPLTPNEDLLGFGFCSA
                     PSLGAGLGFNSLNSNSARLTVSNTFTSAENRLLEKASTMSLKHQSLPPLPRAPSSAPS
                     RAPSAVSRKSFHKVSKHPRTSSSDIPSREDVELPEDLALVLKAINSGILEGHLKLTAA
                     LRRRYDEQYPLVRSLADIFIAHSYVLREYSIYVLHLEKALQQVTHALSHPNPPPPTSF
                     SKAKRASFPSARSSSARHPSALTAYLTHLESLALASGSPGLLISLSKPFQRLLKYPLM
                     FQNLLYHTDPSLKEYEKTAEMVEEIEGVMRALEDEKVGEEEREGTRDIWGRIAGLDGD
                     KVLLVPKSNRLLISETPVSEVSSSTANLRLSTDPPNSSDCAKPVRPKKSSRKLSDILK
                     GQGGGKDELWVVKFTDMSLLCAKTGTTTLPLSVSPKNGEKRSGNGAGRKGGGRERNMY
                     KFVRVWAWHMDEDEGKEQGRKSAIAQNGSPRTSLSSRAHTLPTIPGTPHNHFASGRVQ
                     AQTHHCSGPSKLTPSKVRSMGDLSPPQYDKSLGLDGLRGFARRSKSFGPTQKRLGEGG
                     EGSEGEEKEDDDDEETVMSFVFGDGDILIPAEPRPRKKVVPKNARDRRVSGVAGSGLS
                     RLDNTKGESDSRPVSRMSGVALSSASGNANVKTATSVRPRPSALRSSTLPPATDSSAS
                     TSDPAIASTTTTAAITRRHQPRAVSLATTTASANAKFANRLRSLPADRDAEGAYVSEG
                     ESVVRRGVGRGSMPPVMARAGSAASNVSAASRLSGPASVKGPPVMGSQPMNRAISHVT
                     NRGNDNKKEGNETIRVRSSSSARQRPWSTTLSSGDAIASGTSAAVSKRASTPASAVSM
                     TIGRRSITPLSATSPTVTAHPIKTAASVTAHATKTGAPVTASTISTRASSRMKPGVGR
                     GRMSTPPSTVANANTDSAASGNTGARAGISAATAARRARVSSLGPRTSTGTLTPSLKA
                     NPGAAAKAAVKPNTTASAESKPASAESKPAPASTLRLAPKPTITNGRATSATGVKPII
                     RAKGTPSPSPSPSVRTTASTCTRTSTRTPQRKGIPTMSSMDTALVEVWKEYGNVDIDK
                     LGSSTPGKAVPKEKAETPESVKAPAGVRRVPAVGGGGRASGLDKSPVKTPGSVRNKAA
                     PVRGRIGEMTKRRDVGKKI"
     STS             950325..950953
                     /locus_tag="CNH00850"
                     /standard_name="Pvu6"
                     /db_xref="UniSTS:470905"
     gene            951738..953812
                     /locus_tag="CNH00830"
                     /db_xref="GeneID:3259100"
     mRNA            join(951738..951792,951853..952012,952083..952239,
                     952293..953193,953250..953812)
                     /locus_tag="CNH00830"
                     /product="cell cycle control protein cwf13, putative"
                     /transcript_id="XM_572276.2"
                     /db_xref="GeneID:3259100"
     CDS             join(951776..951792,951853..952012,952083..952239,
                     952293..953193,953250..953739)
                     /locus_tag="CNH00830"
                     /codon_start=1
                     /product="cell cycle control protein cwf13, putative"
                     /protein_id="XP_572276.2"
                     /db_xref="GeneID:3259100"
                     /translation="MAALTRALPAPLHTSTTEYEEAPAPLPTTPGPQLPKYGQRKGWK
                     PKTAADFNGGGAYPECHVAQYPLDMGKKNKGQGSTLALQVDQDGLVRYDAIAQHGRAP
                     GSRVQSSFKDLVPLANRTDVTESERQMERPDDLSVAETAERTRLALERITHGKIKAAQ
                     PKHVPKTNSDATYIRYTPANQSADEGKQRIIKMTEVQEDPLEPPRFKHKKIPRGPAEP
                     PPPVLQSPPRAATAQDQKDWMIPPCISNWKNNKGYTIPLDKRLAADGRGLQDVHINDN
                     FAKFSESLYIADRHIREEVRARAQLQQLLAQKQKTSKEEELRLLAQRAREDRSGLSSS
                     VSGSVAAASASRLPAETGINLGGYGSESGSEEESDEEEEDEEAIRERNIVREEKRRER
                     EKEMRMSNMGSEMRAKMLAKEANRDISEKIALGLAKPSASKETLLDSRLFNREALSTG
                     FASEDSYNLYDKPLFAGSSAAAAIYRPAGSSRNDESFGGGTEEGIKEEMSKDRFQLGN
                     ATRGFEGAEGVEAREGPVQFEKDTIVALDGSADPFGVEQFMDAARRGGKRTAEDRDEE
                     RRKRARDE"
     gene            955041..957324
                     /locus_tag="CNH00820"
                     /db_xref="GeneID:3259024"
     mRNA            join(955041..955539,955785..955797,955876..955940,
                     955998..956028,956080..956092,956143..956472,
                     956533..956693,956739..957324)
                     /locus_tag="CNH00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_572275.1"
                     /db_xref="GeneID:3259024"
     CDS             join(955533..955539,955785..955797,955876..955940,
                     955998..956028,956080..956092,956143..956472,
                     956533..956693,956739..957111)
                     /locus_tag="CNH00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572275.1"
                     /db_xref="GeneID:3259024"
                     /translation="MSAIYTVFTSPHHAPMPNHLPTLIVTPHGQPNHILYTYLHTEEN
                     RVNYLLTPSPQGDLCVAKLFPPPRPSAGHSSATLPTISHKQGPNAVRCEASRDLRWTI
                     ENTGVMSPIYKIVNQDDTPLYQISKPNPNAEFWTMFYFKYAGHQIPPKRIEFGKIAKN
                     PPEKGGGTRLSITGRTEDEKQVWQTLGVGNEDCVEWVVCCACLNLLDDEILRAAEKRA
                     NPNASGPSSSPASTLTSPASTAARPVPAPLQRVGPAPGPRSASAVLGPGIASSAPAST
                     APMQPMGGHPAMNLAQTYRQNPPPMRAPPARPGQPVPQGYASAPPAGQPQRRRF"
     gene            complement(956864..958597)
                     /locus_tag="CNH00810"
                     /db_xref="GeneID:3259060"
     mRNA            complement(join(956864..957614,957681..957787,
                     957863..958597))
                     /locus_tag="CNH00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_572274.2"
                     /db_xref="GeneID:3259060"
     CDS             complement(join(957420..957614,957681..957787,
                     957863..958493))
                     /locus_tag="CNH00810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572274.2"
                     /db_xref="GeneID:3259060"
                     /translation="MPRLSSPFVQTQLSTLQILTSMYPSETTLTPSTAAFLEAFESGE
                     GEGIKRSEPLEAELSIKVDEEREEEVAIVISLPIIDVDLENRPPNTQAVGDAEPTPLT
                     HIRPKQPIWLPNSSYISVLSSLPSLSPEEEGSEYILTSIEHIRESLLPHLPKEGVEES
                     DGQGKKQEIKRDEGPEQRVWFWFPTLSTKEKRNDIVQYAEEMGLTGFVLAGKPALLCV
                     EGPGLTVERYMSRIKSESWSDIPSYQKKVTERFRRPLIPPDHRAFSKMTEITHLIPKY
                     GQYNHRGEMSEVRRLMEEWGVGEDFGAAVLNSGA"
     gene            958743..961881
                     /locus_tag="CNH00800"
                     /db_xref="GeneID:3259090"
     mRNA            join(958743..958892,958942..959099,959157..959322,
                     959385..959589,959664..959772,959893..959920,
                     959984..960070,960124..960253,960328..960537,
                     960618..960757,960829..960943,960998..961092,
                     961143..961881)
                     /locus_tag="CNH00800"
                     /product="GPI anchor biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_024657640.1"
                     /db_xref="GeneID:3259090"
     CDS             join(958773..958892,958942..959099,959157..959322,
                     959385..959589,959664..959772,959893..959920,
                     959984..960070,960124..960253,960328..960537,
                     960618..960757,960829..960943,960998..961092,
                     961143..961184)
                     /locus_tag="CNH00800"
                     /codon_start=1
                     /product="GPI anchor biosynthesis-related protein,
                     putative"
                     /protein_id="XP_024513320.1"
                     /db_xref="GeneID:3259090"
                     /translation="MDQQSIRVFWPITGVDMSEGKVVGWRLRDTLCVVGIVQDRLWNK
                     VLAQIGEEEDLVGLESIGRAVLDATKNTDVNEKQYIFWVNKERIPLSCSVPTILILYK
                     PLDSSRLQYLTPSSSSPDLHVSGQDRHDPRYQLTIGDDQLSAIVDLINKTRHVQQVLR
                     SLQMESAAEGKKKRRKQASLPSAPRFLFALDTCAQITIFLFSISIPCSSSFRAISTSA
                     DQLCTRMEQSIRGPIRYLTTRNDGGINDRAARYNVFWNTVWLVVNDLVLGYVAHNLIR
                     RHSEWISTTTSTFFSSYVIDMPIHALKWLNDWPVGLKLNTPLSQFFCSTFTFLIQRWG
                     DCVTPSLHSLLPQLMYLLSILSLTGFTTLLAASHDILNLLTLHLLFGYNVMRAVCVWQ
                     IDSLGGLWNLFRGKRWNVLRRRTDSYEYDIDQLFLGTLLFTVSAFLFPTVLSYTALFC
                     LTRGMIFIICRVSEVTRQAMNRFPIFELILWIKEPSRVPGGLNITVQTVPLGDEGEKT
                     EGRFIMRRALVLKSTPKALSDILFHQ"
     gene            complement(961196..962042)
                     /locus_tag="CNH00795"
                     /db_xref="GeneID:36392980"
     mRNA            complement(join(961196..961389,961459..961584,
                     961661..961704,961769..961837,961946..962042))
                     /locus_tag="CNH00795"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658711.1"
                     /db_xref="GeneID:36392980"
     CDS             complement(join(961362..961389,961459..961584,
                     961661..961704,961769..961789))
                     /locus_tag="CNH00795"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514625.1"
                     /db_xref="GeneID:36392980"
                     /translation="MAVFSYTALNSACGSSSCSCSNGNSSDCSHGSSCGSCASNGRTL
                     VNECNSSGANGNCSTCGSPTCNCTSCAC"
     gene            963711..965921
                     /locus_tag="CNH00790"
                     /db_xref="GeneID:3259023"
     mRNA            join(963711..964113,964163..964282,964333..964397,
                     964449..965059,965104..965522,965586..965921)
                     /locus_tag="CNH00790"
                     /product="Endoglucanase E-4 precursor, putative"
                     /transcript_id="XM_572272.1"
                     /db_xref="GeneID:3259023"
     CDS             join(963790..964113,964163..964282,964333..964397,
                     964449..965059,965104..965522,965586..965819)
                     /locus_tag="CNH00790"
                     /codon_start=1
                     /product="Endoglucanase E-4 precursor, putative"
                     /protein_id="XP_572272.1"
                     /db_xref="GeneID:3259023"
                     /translation="MLIPFLALASLSRITTAQLTPSPTYSPPTSSAGLTASSETPNTQ
                     WSNILGNSLWFYDAQRSGRLDEGTYGNRVDWRNDSALEDGSDWGLDLVGGWYDAGDYI
                     KATFPLSFTLFALSWGALTHGQGYGLANQTAYLDGTLRWGFDWLMKAHPSDDVLFIQV
                     GSGDVDNNYWGGDQDIPSPRPGYPINSSYPGTDGWAAASAAFSLGSLLYTPGVSYRPT
                     SSSSPPTSPSLENSTYASQLLAHAESLYSVANSTTPRQTYYAALGDEVAAYASSDWRD
                     NLCASALALALATNNSAYYADAYNYYVQYGLSGTHEVWNWDSSQPAIYVMFAEIASAK
                     PELAQGAGLDVNLTGWQTEVENYFDGLIKEDFSNSYLTEGGLLYWDGDSDEASLNPAM
                     AAAMLMFKYAPMASSTDKTNSYNSFAQSQLNYLLGSNPMSVPYIVGQHPNSPSNPHSA
                     PASGGFNINNIRDDPPTEAHVLYGAVVGGPLSSDQFWDWRDDWVQTEIALDYNAMIPT
                     LASMQLMNNTADPPYVDIAAGTYSIPSGQPCDAALPCRGGGGLSGGEIAGIVVGVIVG
                     VVLLVIVGVWWWWRKRGKRWGSKW"
     gene            966901..969092
                     /locus_tag="CNH00780"
                     /db_xref="GeneID:3259072"
     mRNA            join(966901..967785,967837..968656,968721..969092)
                     /locus_tag="CNH00780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657639.1"
                     /db_xref="GeneID:3259072"
     mRNA            join(966901..967785,967837..968544,968639..968656,
                     968721..969092)
                     /locus_tag="CNH00780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572270.1"
                     /db_xref="GeneID:3259072"
     CDS             join(967114..967785,967837..968544,968639..968656,
                     968721..968795)
                     /locus_tag="CNH00780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513319.1"
                     /db_xref="GeneID:3259072"
                     /translation="MPTESTTSEPPLPTSHTPAGVVKCSICGIGNLSQPMSIPVSDYF
                     GGSAVEFGERVCGRCALARGHGESDIQSQSQYENQSRDRERGWEKESEVRERGRGGVK
                     QESGRTLDDVHEENETAERKGIVRDLKAPTFSQSLPSQLPQPWTTTKPVPSPPSNARG
                     LAASPKPDAATRSKEKMNQPPNPLLDITRTRVRSIGRGPLYPGSVFKGTQTSGRSAYD
                     VEVKFLDVDFADSTLSGYLSISHLTDSHPHLTTFFTGEIIGPKYGFITGPRYAATEHD
                     DLRHWGRFEQFRRPSTRADLVGEELFLRDPLPDRSRGETKGKERDFVFLRIKEQFLVP
                     DHKVKDISGASFAGFYYIMVDMAPTVTVPVSQPATPLSPTFKSPFVPGSPAISRRMSG
                     TAMPALGLGMGMGLGATIGAGVGPGMGMGGEQVSGIDRTRPARPSGTRKESGGRMREK
                     EVRGEPTIRGYYFHSLNQEPFQELFLSHVPQKSKYAFEFR"
     CDS             join(967114..967785,967837..968544,968639..968656,
                     968721..968795)
                     /locus_tag="CNH00780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572270.1"
                     /db_xref="GeneID:3259072"
                     /translation="MPTESTTSEPPLPTSHTPAGVVKCSICGIGNLSQPMSIPVSDYF
                     GGSAVEFGERVCGRCALARGHGESDIQSQSQYENQSRDRERGWEKESEVRERGRGGVK
                     QESGRTLDDVHEENETAERKGIVRDLKAPTFSQSLPSQLPQPWTTTKPVPSPPSNARG
                     LAASPKPDAATRSKEKMNQPPNPLLDITRTRVRSIGRGPLYPGSVFKGTQTSGRSAYD
                     VEVKFLDVDFADSTLSGYLSISHLTDSHPHLTTFFTGEIIGPKYGFITGPRYAATEHD
                     DLRHWGRFEQFRRPSTRADLVGEELFLRDPLPDRSRGETKGKERDFVFLRIKEQFLVP
                     DHKVKDISGASFAGFYYIMVDMAPTVTVPVSQPATPLSPTFKSPFVPGSPAISRRMSG
                     TAMPALGLGMGMGLGATIGAGVGPGMGMGGEQVSGIDRTRPARPSGTRKESGGRMREK
                     EVRGEPTIRGYYFHSLNQEPFQELFLSHVPQKSKYAFEFR"
     gene            969218..971481
                     /locus_tag="CNH00770"
                     /db_xref="GeneID:3259126"
     mRNA            join(969218..969341,969515..969593,969698..969777,
                     969875..970000,970089..970241,970365..970485,
                     970600..970720,970830..971005,971128..971339,
                     971392..971481)
                     /locus_tag="CNH00770"
                     /product="activator 1 41 kda subunit, putative"
                     /transcript_id="XM_024657638.1"
                     /db_xref="GeneID:3259126"
     CDS             join(969271..969341,969515..969593,969698..969777,
                     969875..970000,970089..970241,970365..970485,
                     970600..970720,970830..971005,971128..971292)
                     /locus_tag="CNH00770"
                     /codon_start=1
                     /product="activator 1 41 kda subunit, putative"
                     /protein_id="XP_024513318.1"
                     /db_xref="GeneID:3259126"
                     /translation="MSAFAPRPVVPIKDPKLQPWVEKYRPKTIDDVSSQDNTVAVLRK
                     ALASTNLPHMLFYGPPGTGKTSTILALARQLFGPDLFRARVLELNASDERGISVVREK
                     IKSFARETPRHAPAVSSDGKEYPCPPFKLIILDEADSMTQDAQSALRRIMETYSKITR
                     FCLVCNYVTRIIEPLASRCSKFRFKPLEQGSTRARMEMIAENEGVQTDPGVISLILEL
                     AGGDLRKAITYLQTAQRLHSSIEPPMPVSALSIHEISGVVPEDLITDLLAAMGVDRQT
                     GIDHSLARGFDGVKIAVTRVEREGWSVGQVLEQIHDTLIPIPSIPAIQKSLAGIAIAE
                     CDKGLCEGGDEELQLLDCMLRIKDIMGRQ"
     gene            971796..974413
                     /locus_tag="CNH00760"
                     /db_xref="GeneID:3259201"
     mRNA            join(971796..972634,972725..973258,973434..974413)
                     /locus_tag="CNH00760"
                     /product="expressed protein"
                     /transcript_id="XM_572268.2"
                     /db_xref="GeneID:3259201"
     CDS             join(973070..973258,973434..974219)
                     /locus_tag="CNH00760"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572268.1"
                     /db_xref="GeneID:3259201"
                     /translation="MLHPAKIHNTDFPTKRLRSCLSPTRTRHHSPSFLPSGEAAVAVT
                     SWKRVKTVRWQEENGCAVASFHDTYSHEEYDRTPLEPPTSAERDCVFPERGSRCLSGP
                     RECFFGDFSDEEEDLPPSASDFSDSFIIHTPPPTETNSDDGEHSVRQGCDVDGEGEMQ
                     DGEDGWDECMQRRRMMFARLCTRENGDRHPEFEGYRSLSATLAELLKSVGCDDEDGSI
                     QEHGDEQALEEDGDGEEVRQSRSRSLNIFGLPTLAQRSVTPTPTGTPSLVSTEESDTE
                     YTIASPSMGTPADALSLNGFGFGNESMSLGQKALPIVMVERAQEVGMR"
     gene            974551..>977038
                     /locus_tag="CNH00750"
                     /db_xref="GeneID:3259141"
     mRNA            join(974551..974934,975016..975185,975243..>977038)
                     /locus_tag="CNH00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657637.1"
                     /db_xref="GeneID:3259141"
     CDS             join(974612..974934,975016..975185,975243..977038)
                     /locus_tag="CNH00750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513317.1"
                     /db_xref="GeneID:3259141"
                     /translation="MPAALSPSLTPSLSSEAHSPILRLPPELIDHLLTLVPASLLQLT
                     ALSLLKVFPEHNISKRHLWKHIVVYRAGQLMPLWKKLKENEAMRVGARTFALQSWQGD
                     ADILNNVMRRLDNINTLMLNIGTNFAPEHLQEMFEGPRMKLERMELRFRPYVEQASYY
                     QFLAGSYFDTAIETLTRQWPVCPNFTHISIVQDLPPRSTAPNTARNSATSSLASSFAD
                     LRMANTAPASTAPSSDSEEASGVSTPPTSVDDPDLNPTDAGRSKAYTGHGPFGNPFLN
                     EKLGITRPKHFAQPIVFFDIQCLANFGAAAVAANLTHLRLRVPSRDLARVLIMPPPRG
                     SYNQALFPELRYLDISTTNVRLDTTLSALLKQYSKLEHLVLDRVNLFGFTAREKGLEL
                     CNDLGMVIVNAGLTRSKEKERQIAAWEVAERVRMAEATAEAARQVEVGQREQDEHQGD
                     RETEEDRRAREAQEEIQRNLELMRSRRGHRSAAHSTFSLRERRRAGTSASTASSSANN
                     LPLPPQDKLYMVLPPLPTLKTICIGGEAHTLPANKVAQWEDQFHAGWMEGLERILGWA
                     THLADKYDRGKRKAEEWVVKERGKNGSGSNSTTGTGGSNAAKGRGKGKTSSSSSSAAA
                     AKVLPKPPTDIRLFRFPLPSETISRRNNEGEEENDETEHGKPGPFNLTSGLIEVVPSS
                     PSDRSYLNPYREALADAQLYKDRQEGVGAPCVFCTIPDCEGPARRGAEGEKVDGRGGM
                     GGKHREECGHMVGRRTWGWEGL"
     gene            complement(977141..978767)
                     /locus_tag="CNH00740"
                     /db_xref="GeneID:3258997"
     mRNA            complement(join(977141..977417,977507..977596,
                     977682..977739,977806..977896,977962..978146,
                     978198..978305,978371..978488,978543..978767))
                     /locus_tag="CNH00740"
                     /product="mitotic check point protein bub2, putative"
                     /transcript_id="XM_024657636.1"
                     /db_xref="GeneID:3258997"
     CDS             complement(join(977288..977417,977507..977596,
                     977682..977739,977806..977896,977962..978146,
                     978198..978305,978371..978488,978543..978686))
                     /locus_tag="CNH00740"
                     /codon_start=1
                     /product="mitotic check point protein bub2, putative"
                     /protein_id="XP_024513316.1"
                     /db_xref="GeneID:3258997"
                     /translation="MSTSTEIYGSLHSILSPALIPRHRSSSEISDGLKRIRRIILTEG
                     IPEVPGRPPLRPRIWKLLLKVDNLQAEDYLRWVSMGPSSDSHKIKNDTFRTLATDTQF
                     KGKVKEDMLIRLLEAFVWKITSAETEDESQPFKYVQGMNVLSAPFLFTMPSQLEAFQC
                     FSTFIENGCPLYVQPSLKGVHKGLTLLDKCLEVVDPELYDRLASKNLKAEIYAFPSVM
                     TLCACTPPLEEVLRLWDFLLAFGLHLNILCVIAQLLLIRQDLMDTPSPMKILRTFPPL
                     EARPVIGVTVALVKDIPEELYRELVAHPFSC"
     gene            978865..980576
                     /locus_tag="CNH00730"
                     /db_xref="GeneID:3259152"
     mRNA            join(978865..979023,979080..979115,979186..979309,
                     979456..979553,979639..979714,979770..980576)
                     /locus_tag="CNH00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657635.1"
                     /db_xref="GeneID:3259152"
     CDS             join(978994..979023,979080..979115,979186..979309,
                     979456..979553,979639..979714,979770..979900)
                     /locus_tag="CNH00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513315.1"
                     /db_xref="GeneID:3259152"
                     /translation="MLHEELSTDMDMITQLQDAILDLLTITSTSIEYITKRTQFEQTS
                     ISIPTTLSTPNAANRVEYKAAIETFVADIIRRSKDIQHLIDGLPRPGDSSERAQRLIE
                     LQDEIKIANEEYRQVLEQSKELVKELQLALDHTLGESPNDISIQSANYPAGTPYHNQN
                     NEAN"
     gene            complement(979922..986466)
                     /locus_tag="CNH00720"
                     /db_xref="GeneID:3259200"
     mRNA            complement(join(979922..980129,980219..980373,
                     980454..980523,980585..980655,980712..980726,
                     980780..980782,980862..980881,980944..981098,
                     981164..981348,981410..981491,981545..986024,
                     986077..986139,986191..986271,986371..986466))
                     /locus_tag="CNH00720"
                     /product="histone-lysine n-methyltransferase, h3 lysine-9
                     specific, putative"
                     /transcript_id="XM_024657634.1"
                     /db_xref="GeneID:3259200"
     CDS             complement(join(980084..980129,980219..980373,
                     980454..980523,980585..980655,980712..980726,
                     980780..980782,980862..980881,980944..981098,
                     981164..981348,981410..981491,981545..986024,
                     986077..986139,986191..986271,986371..986392))
                     /locus_tag="CNH00720"
                     /codon_start=1
                     /product="histone-lysine n-methyltransferase, h3 lysine-9
                     specific, putative"
                     /protein_id="XP_024513314.1"
                     /db_xref="GeneID:3259200"
                     /translation="MPGASSEVGAVDNPLVVDSSDSDDDLSVLPANGRVKPSDGKDRS
                     YKKSLTFMRESTVVDLTLSDSDDAVEFVNFPPGPNSTPDRVAQVGLPDKQPSPGRRPR
                     PFMSIANSSSSPEDQNITGLLENHSRETGELPSPPLVEDRAAPNGMKLDGENIVSQSN
                     GISAAQAAVTTSRTSSLTSNLNRPQSVSGAQPAVASSSRSAINSPPRRYLLISQQSPS
                     SRTTPCRSAGTASPTSRPPTPPLPPTQSTPVTVSGLPAPLILSPVPAASSAISPTIPS
                     IPLHASLPYPTLSLPPSATPALPNSFTLSASTILPADSSISALPSTSAAGLPVMPVFI
                     SPATSSPAGPEPSTLQSASEATKSSNQKESPRKTDSKQAPSPSSTHGLWTNTRPFHAS
                     SNLSATSGKSSAASSRSTSRTLLPSRVATSDNVAGPSKTTSVSSTHPPARAPSLSLPS
                     EPERQVHPRSPSHEGVGKREKKSKALSSGTGQSTPSRSSLSTYDVASNRKTKSTGLNA
                     LPQKPSSAGKTSSIPQRTSTLATAMAIRPFVRSPTSPCRPSSFEASGPIQSSGGAVKA
                     AQNQDKIHPLSTTSSISSHSRETTTKAATPSHVTISSPSPSQSTSASTTVHVTQDAQK
                     SATTSPTREKIHPSRRKSQTSDCVVAPTTSQTAASLSYPAGTSDGTGEADKKAAGTTV
                     HAGPSSADFGTFVVPPTTAIASTTVSPSVTPPEDAPFLKSGPTVHPLFRAASAIGGQD
                     TLTETGAVGDVLSQGSKGRASSPRITTTGAVSHLVLPIDVGSKIKPTAAPSLFASGVT
                     IGNVDDQAAAQPQNPAPLPSALSVLSKKNLGSSSKESSVKSAASSVSSSSTLGDSVSG
                     LGRKSHHKSTQSIPQSPLPTTNTSNSSGIEVNSWLNPQPFGPSFAASHLNTHAKKKWK
                     GKEREKEREKEKAREKEKAKEENEQLRRRRMADLEKISANLEKYKGRMGVESRTRSIP
                     RADGENRKRPPSPGISASTDGEVRVVKRSKPAWAIAPENGHVAAAMEKETNDNKKTTD
                     AIKINHQPAAFYTPQFATPTSAAKTTTTPLSVTAGLGPPVNSSSSSSTPSLLSRSINL
                     DIPRETPEERMDDDDGNDSTGGLLVRKTGKNDAVEEQVEQVRLDLDDVSIHGSSPVGP
                     ISTFTSRFRNVSITPSQTQKILEQPGEDVPIRRSAIKINGKQKAQRSKDKSDGSESED
                     DVPLNWPSRKGKGKAAPEPQDNSETQRDDDGVNLGSSNGEEGSSDDHSNPVLPPFLFK
                     DRPAHVRQPLQTLFKGGFVAKHSYQRPLVKSSAVSPVPNANRTSSEPSAKAELLPQKR
                     KRRPKKLTREQWHHIAQNHLSDVDDLLDESSKKRLSPKSAEKLGADLSKLTSPRVFSI
                     VSRSEPRSKGAPIEENDNEYFTDSDSHTSDIALFLQHPDPPPPPERIREAKRNFGTRT
                     IDPWNRQKHTFRSNPALHRAIFEAYIMQSTSMEESGGDDIKVTNEVDADGGPPDFEFV
                     YSDTMLYPDGIPPPELGLGCDCDGPCDPDSETCTCVKRQELYFYDLGLKGFAYDENGK
                     IRENSASIWECNELCGCPPECMNRVIQRGRAKDTGIEIFKTKEKGWGIRARSFIPSGT
                     YIGSYTGELIREAESERRGVTYTAIGRTYVFDLDGWQIRHPPKGLEKIDKRAAELAEA
                     VKMRAKAAMRESQEDAYNAYSVDAFHYGNFTRYFNHSCDPNLAITQAYVKDFHPERPL
                     LVIFTRRDIKKHEELCISYKGIPDDDVPSPEPVKKKKGNKGKKQMSKTSASAHPPEMI
                     ALNSDKGPVEVKDICRCGAKNCDGRMFNYGS"
     gene            986548..987537
                     /locus_tag="CNH00715"
                     /db_xref="GeneID:36392979"
     mRNA            join(986548..986946,987000..987082,987138..987537)
                     /locus_tag="CNH00715"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658713.1"
                     /db_xref="GeneID:36392979"
     CDS             join(986588..986946,987000..987082,987138..987412)
                     /locus_tag="CNH00715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514626.1"
                     /db_xref="GeneID:36392979"
                     /translation="MVNNGSNTSKSSQAKQPKQNSPKKQPQVPRQPDQPQILNKDLFQ
                     RINYTYQAAIFLQDVGGGAGPSSSISVGDGDVHLVTDRKGKRRAVERAGDQGAFKKLA
                     RMGMRETKTMVVHNQLKLDPSLKRSICRVCSTVLIPGLTSRIRNRPNRNTFNKTNQTC
                     LTCSAFLSIPSPPVAHHNNPTESSVAQDQDPLDGPVRAARRKKVTRSKPAFHEYERRD
                     ERTKGHVLWKGEEKVGRWGV"
     gene            complement(987492..988549)
                     /locus_tag="CNH00713"
                     /db_xref="GeneID:36392978"
     mRNA            complement(join(987492..987791,987862..988068,
                     988161..988549))
                     /locus_tag="CNH00713"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658714.1"
                     /db_xref="GeneID:36392978"
     CDS             complement(join(987590..987791,987862..988068,
                     988161..988207))
                     /locus_tag="CNH00713"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514627.1"
                     /db_xref="GeneID:36392978"
                     /translation="MQSCPKMSTSSVQAGIGFPRAPLGSPPPAYIRSPPLPTQRMVTT
                     SQPFNKLQKAKQGRQGGGRRESYDVSSGGTVMGSETVLAVAHSGIDRSPEEASSAAGD
                     KGNCKYERWYPGDASHSGRPAWWNRVLCCGYGMGCLLCPCGGLTCRHVT"
     gene            complement(988551..989855)
                     /locus_tag="CNH00710"
                     /db_xref="GeneID:3259225"
     mRNA            complement(join(988551..988706,988763..988822,
                     988881..988989,989043..989408,989468..989855))
                     /locus_tag="CNH00710"
                     /product="expressed protein"
                     /transcript_id="XM_572263.2"
                     /db_xref="GeneID:3259225"
     CDS             complement(join(988591..988706,988763..988822,
                     988881..988989,989043..989408,989468..989809))
                     /locus_tag="CNH00710"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572263.1"
                     /db_xref="GeneID:3259225"
                     /translation="MVQEITEKTIKTGGDDLDDGLELDPDLLASSDIEDAASDVASEF
                     DGGEQRDQASEDESPLVLEGEETEIAMSPVPEMKKRKAEDVENEGEQDEEAAKAEKKR
                     RKKEKEKERRAKRRQGAELVPSTTAPTHLATTDLSSVLLRSIRESFPSSSAIEIEEVL
                     IPPANLLEPPTYPAPKADPSNAFKPLQQRISELTKGKKEPKGNGAPAVIVLGISGLRC
                     ADIVRGVRGVKGKGEVAKLFAKHFKLADQIKYLERTKVSIAVGTPARVGKLLAEGAIK
                     ISKDTVLLLDIGHQDSKTRTLLTLPEVRDELWKSVFSGAARKALLDNGVKVGAF"
     STS             989542..990077
                     /standard_name="Pvu5"
                     /db_xref="UniSTS:470906"
     gene            990016..992671
                     /locus_tag="CNH00700"
                     /db_xref="GeneID:3259202"
     mRNA            join(990016..990179,990242..990417,990475..990562,
                     990618..990852,990912..991312,991362..992102,
                     992158..992671)
                     /locus_tag="CNH00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_572262.1"
                     /db_xref="GeneID:3259202"
     CDS             join(990036..990179,990242..990417,990475..990562,
                     990618..990852,990912..991312,991362..992102,
                     992158..992589)
                     /locus_tag="CNH00700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572262.1"
                     /db_xref="GeneID:3259202"
                     /translation="MGKAQVKKKTQGWRHNPVRVPDSHLGSGKGEGKADPQKEKQMLP
                     ILNKLRSPEYADRTWACAAISNLIQNDAATRRLFQGKNVVGELIERLSDSVDEVVVEA
                     SGALRNLAIDGGRELCGEMANKGIMSHLGVLISKISTTITSVLSGETMDSDDNLQARK
                     HLLSLSENVILLLWSLAEAGPKTLANVNAMGCEGLLIMILEGRDKLGLGVSLAAAQTL
                     FALSQDNFPFRKSLVIHPTALESLITIAQEDHLPAENAQKAKEASRKSKSKKAAAEPA
                     SEADDLPDGRALLRRMLACGILRNIIRAGSRADEKVGINALTASTILPLVNGLLDVKL
                     EDVCTRVNKLVKDSPPDVKILDKNAKTDHKSTSEVALERIERNLSTVVAALEVLTNVC
                     AGLEDEEDIAAETLEEGGAAAEVVEIEEDDDAAMDEDEMDDEGLISMGREPGAELDIE
                     TFDSGVKINPGATLSHLLTNLHLPERLSLLSRPVSLSFPPASTVPSIHPPTTSILSIL
                     HLHALEALNNLLLTAVASISAAERSAAAQIVASVPVQGLWDSLFSIIQLIGSEPQALQ
                     MKGQEMRMEVLEMTLGCVWGTIKVNPSAVNVQQPQVQILMDSINVIKDEITKTRVVET
                     LSSIAMRESISNAENQSITQNLIQRLTSTSPTPSAEMLVSLLNAIIDIYSDETRSFNS
                     VFVENDYLQVLSGIVGKVRAEVKKIDKRRERNLRVRGDEVYENLVAFIKYRRSLQK"
     gene            complement(992247..994350)
                     /locus_tag="CNH00690"
                     /db_xref="GeneID:3259074"
     mRNA            complement(join(992247..993021,993085..993430,
                     993481..993695,993751..993838,993895..993926,
                     993971..994184,994245..994350))
                     /locus_tag="CNH00690"
                     /product="minor histocompatibility antigen h13, putative"
                     /transcript_id="XM_572261.2"
                     /db_xref="GeneID:3259074"
     CDS             complement(join(992705..993021,993085..993430,
                     993481..993695,993751..993838,993895..993926,
                     993971..994184,994245..994337))
                     /locus_tag="CNH00690"
                     /codon_start=1
                     /product="minor histocompatibility antigen h13, putative"
                     /protein_id="XP_572261.1"
                     /db_xref="GeneID:3259074"
                     /translation="MPQYNTIWATYVSLGVQALIPIAIGSFKSLKTPEDTRRRLRESK
                     KGQISEEYDDEDEEPAGETLTWKESAMFPIMGSVMLLGLWAVLKYFGKKWITIILGVY
                     FGLAGMLAVQSTFSSIIGYLLRVFGISMTTYHVRISAGFRQIFHLPTTLPTMCLIPVS
                     IVLPLLYVYFDRHYILSNILALAFSIETLALLKLDSFFTAFLMLGLLLVYDIFWVFAT
                     PVMVTVAKGIDAPIKILAPKTSPFASPTDFAMLGLGDIIVPGLVIALCLRYDLHRYAA
                     FYKGQNVTPRSKFGKPYFWCGVVSYVLGLGVTIGVMHHFQRAQPALLYLSPACTLGPV
                     LLAFSRGEIKNLWTYDESPEEENKQVLDDTIEAASEAAIRARAEAKAAAEETVSKGED
                     TVDEAQDAGEQKEQMDDDSWMNNTGVIAPEGKPRKKKGGKKK"
     gene            995349..995438
                     /locus_tag="CNH00680"
                     /db_xref="GeneID:3259261"
     tRNA            995349..995438
                     /locus_tag="CNH00680"
                     /product="tRNA-Val"
                     /db_xref="GeneID:3259261"
     gene            complement(995520..997000)
                     /locus_tag="CNH00670"
                     /db_xref="GeneID:3259181"
     mRNA            complement(join(995520..995701,995750..996727,
                     996783..997000))
                     /locus_tag="CNH00670"
                     /product="phosphoserine transaminase, putative"
                     /transcript_id="XM_572260.2"
                     /db_xref="GeneID:3259181"
     CDS             complement(join(995616..995701,995750..996727,
                     996783..996954))
                     /locus_tag="CNH00670"
                     /codon_start=1
                     /product="phosphoserine transaminase, putative"
                     /protein_id="XP_572260.1"
                     /db_xref="GeneID:3259181"
                     /translation="MPDRKDVHNFAAGPSPLPTTVLEDAAKGLLNYADTGMGICELSH
                     RGKEFKAVIEGAEANLRNLLAIPDNYTILFSQGGGTGQFSAVLLNLLSAHRLAHPVPA
                     EEFKPPTIDYVLTGSWSSKAYAEAQRLVLPPFPNCPGFATPRIAASTKATGWTRLPKR
                     EEYDFSKDAAYVYYCENETINGVEFPPASAQDSAYAFPFDLVPEGVNVVADYSSSFIS
                     RPIPNIERHAIIYAGAQKNLGPSGVTVLIVRNDLLVDTTAAAKLGCVPATPITYEYKI
                     LAENASLYNTPPTFPIYVSALVLQHLIDAKGGLTGLEATNREKAKLLYATLDAAESRG
                     KVRTVVREKDARSWMNVTFEIVGEGKEKAFLEGAEKKGFKQLKGHRSVGGIRASIYNA
                     VTVDSVKALCQYINEFGEQ"
     gene            997151..998802
                     /locus_tag="CNH00660"
                     /db_xref="GeneID:3259021"
     mRNA            join(997151..997441,997493..998802)
                     /locus_tag="CNH00660"
                     /product="expressed protein"
                     /transcript_id="XM_572259.2"
                     /db_xref="GeneID:3259021"
     CDS             join(997180..997441,997493..998697)
                     /locus_tag="CNH00660"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572259.1"
                     /db_xref="GeneID:3259021"
                     /translation="MSVVVYPQEDEDCPSFSSTALQILTQDVSSLLSLSLETTASVLH
                     DWFRSSLGMVGFGGDFAPRDRQKPDSEEESGRGLAVVIVGAGEATGQSLTLHLAKSGY
                     TVFPFIPLPSSSPSISTYNDTSSAPTDALSNILLTWSATRKRLCARMPNHPGAVVPII
                     VDPEGVSGEGEVGELADVEKDRKEGEEFICGRFAHAGETVRAYIRENELTLVSIICIS
                     PSPLPSPATPHLSLSPPSPLSTHPPSLTTTATDLLLPRDSLVNTPESTLHSIYRTNVL
                     DPVSVVRELSDVLVSPLGFGPEYWGRGRGKQSQGRVIFINPSPILSPSLQAGSSAGGH
                     VDSMNRHHHRLFQTTNLSSVNSVNSLTTSLRSATARILRDELSVLGVGVCEVVVGPMW
                     EKPRLARCWGGGEEGRKMDMPPTPGPTPTRLLILSRLWAVDDALLFASVRRALEDRYP
                     RYRHYAGLGPLVDDLAGAIPGGGVMTGLGRWVVGKVLG"
     gene            complement(997967..999932)
                     /locus_tag="CNH00650"
                     /db_xref="GeneID:3259350"
     mRNA            complement(join(997967..998976,999038..999111,
                     999173..999335,999381..999536,999593..999932))
                     /locus_tag="CNH00650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572258.2"
                     /db_xref="GeneID:3259350"
     CDS             complement(join(998866..998976,999038..999111,
                     999173..999335,999381..999536,999593..999847))
                     /locus_tag="CNH00650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572258.1"
                     /db_xref="GeneID:3259350"
                     /translation="MISDGDLQSSLKIRSRYNGHYSCMTLPRLASRLAKTMTPADIPT
                     LSQLYRHDHTNALNPTKPKYEFTKQLNDRVSIWRGDITELEADMIVNAANSSLLGGGG
                     VDGAIHRAAGKHLLEECKKLGGAQTGETKFTAGYNLSSKKIAHTVGPVYHSHPPQRAA
                     QLLKSCYQSSLEGCRDSGGGVIGFSSISTGVYGYPIKDATHIALETTRQFLEQDDSIT
                     RVIYVVFSKRDEDVYREIIPQYFPPDPEHGHGSV"
     gene            complement(999945..1000426)
                     /locus_tag="CNH00640"
                     /db_xref="GeneID:3259016"
     mRNA            complement(join(999945..1000182,1000227..1000426))
                     /locus_tag="CNH00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657633.1"
                     /db_xref="GeneID:3259016"
     CDS             complement(1000062..1000175)
                     /locus_tag="CNH00640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513313.1"
                     /db_xref="GeneID:3259016"
                     /translation="MISDHALADLANGLGIAAMACIVLYHFVAVNGKRMEA"
     gene            1001226..1004446
                     /locus_tag="CNH00630"
                     /db_xref="GeneID:3258998"
     mRNA            join(1001226..1001526,1001573..1002391,1002432..1002769,
                     1002834..1002904,1002959..1003100,1003160..1003451,
                     1003516..1003618,1003680..1004072,1004136..1004192,
                     1004250..1004446)
                     /locus_tag="CNH00630"
                     /product="Rab guanyl-nucleotide exchange factor, putative"
                     /transcript_id="XM_572256.2"
                     /db_xref="GeneID:3258998"
     CDS             join(1002142..1002391,1002432..1002769,1002834..1002904,
                     1002959..1003100,1003160..1003451,1003516..1003618,
                     1003680..1004072,1004136..1004192,1004250..1004316)
                     /locus_tag="CNH00630"
                     /codon_start=1
                     /product="Rab guanyl-nucleotide exchange factor, putative"
                     /protein_id="XP_572256.2"
                     /db_xref="GeneID:3258998"
                     /translation="MEVFVLYNVNPALVLSLFPGKSISEKLGVRKEGWMELFGAPRGA
                     SLGAGEQTQSVHVNEEKGGDASSVKSTNTSVKASQGDDEPPKAALEALMYFLSDRRQK
                     LTGAISALPPSSPLPAESSLPAFSSLPAPALHSLPSIIPFAEMSPEELVRMAQVVYTG
                     LMRVYLKARPVLVGSLCRIENWCDVKEVEGLLKEERKFSDLIDLYQGKKMHRKALTML
                     RELAKEEDDKLDRYPPTISYLHKLGAADLDLILESSKWILEEDPGMGLTIFTADEPEI
                     ESLPRDRITSFLSSIDRGACEGYLEYIIWTLGEKGGEFHDTLAELYMVDSRVKVESGA
                     EAGAYDKLLAFLNDSTHYRPYRVMNKLSGKEMPEARAILLGRMGKHEEALKIYVYRLQ
                     DYAAAESYCVKAYQSTNNVFLLLLQLYLRPPPPLSPSPTPKPKPTPKSTPASTHLPPA
                     LSLISKHSTSLPPSSVLDLLPPLVSIADIHPFFIKTLREEHRRKLEGRVMRQLGKGRK
                     DEVEEMLMGLEVKRVRVTDQRICPQCHKRLGMSAIAVHAPRGEVTHLHCKDRFSAKLA
                     ASRE"
     gene            complement(1004409..1007742)
                     /locus_tag="CNH00620"
                     /db_xref="GeneID:3259259"
     mRNA            complement(join(1004409..1004788,1004859..1005062,
                     1005118..1005291,1005344..1005499,1005556..1005654,
                     1005702..1005858,1005910..1006096,1006146..1006356,
                     1006403..1006705,1006767..1006942,1006998..1007067,
                     1007118..1007181,1007231..1007310,1007360..1007742))
                     /locus_tag="CNH00620"
                     /product="cation:cation antiporter, putative"
                     /transcript_id="XM_024657632.1"
                     /db_xref="GeneID:3259259"
     CDS             complement(join(1004474..1004788,1004859..1005062,
                     1005118..1005291,1005344..1005499,1005556..1005654,
                     1005702..1005858,1005910..1006096,1006146..1006356,
                     1006403..1006705,1006767..1006942,1006998..1007067,
                     1007118..1007181,1007231..1007310,1007360..1007683))
                     /locus_tag="CNH00620"
                     /codon_start=1
                     /product="cation:cation antiporter, putative"
                     /protein_id="XP_024513312.1"
                     /db_xref="GeneID:3259259"
                     /translation="MQPPTTPTSNRRSHFPSSRQSFSAGSAAKPRRYQSRQNSFLRLF
                     IGALAITASKTWVIDNHGGEGGGAGWLVLAYWASRVFVEGKQVWDGRRRKAFRLDATS
                     NGIGVKDYILSSFNYVLQSLAFFMSLGSLGPFKTSIIGMTGSLLATAQPTTIRSFGPL
                     LPLILASGYAFAQQLLLKDFQAVIVILVFALTTSVIQGRFLEPKTAGSRETIDGRHSL
                     YRTILSALVATVSVIALYFMGFIPIPVPVSSTASQRFGSFVAAFLVSNIPLSFGQNSP
                     SSAGLRLKTWRDKATFLTCIPILQFFALHPIPTTVDVVILLPISVFSIWAESIFKAQP
                     ELAPSWTFSNHNLSTANHSWSFLSLVPSRWRPHFQTIISTPTSSRIFYFLLLNLAYMG
                     VQMGYGVFTNSLGLISDAIHMLFDCLGLGVGLWASVAAMWKPDGRYTFGYSRVETLSG
                     FANGCFLILISVFIIFEAIQRVYNPPEMETHQLLLVSGIGLAINLWGMWATGGHHHHG
                     HSHGHDHAQVHAAPKVEVHKQGVSQNDAHKYEDHHLDLHSHDHHHKPSASSKVSPRPA
                     SKLQKRKSSGQLKDSGPSATTPQKTNNGHNHDEHCSHDGEKHSHSHNHHKLTHESSTH
                     NDAHAHEDDYDHAHAHGHGHDHDRGHDHAHSHNMRGVFLHVLADTLGSVGVIISTILI
                     RFTGWTGFDPIASLFIAALIMASVIPLVVDSGRILCLDVGEEKESEIRSALTELSSVD
                     GLASYAAPRFWPRCEGELVGSIHIQLAPSPSSFDPTRLSTPPSSSRPRKGDAIYANSE
                     KVVGRVEKVLKKRIKGLTELVVQVEGSEERSFCTCMTGGDQ"
     gene            complement(1007953..1010739)
                     /locus_tag="CNH00610"
                     /db_xref="GeneID:3259071"
     mRNA            complement(join(1007953..1008288,1008345..1008482,
                     1008538..1008600,1008665..1008827,1008880..1009353,
                     1009406..1009528,1009586..1009618,1009668..1009733,
                     1009784..1009846,1009905..1010054,1010120..1010525,
                     1010604..1010739))
                     /locus_tag="CNH00610"
                     /product="helicase, putative"
                     /transcript_id="XM_024657631.1"
                     /db_xref="GeneID:3259071"
     CDS             complement(join(1008100..1008288,1008345..1008482,
                     1008538..1008600,1008665..1008827,1008880..1009353,
                     1009406..1009528,1009586..1009618,1009668..1009733,
                     1009784..1009846,1009905..1010054,1010120..1010525,
                     1010604..1010616))
                     /locus_tag="CNH00610"
                     /codon_start=1
                     /product="helicase, putative"
                     /protein_id="XP_024513311.1"
                     /db_xref="GeneID:3259071"
                     /translation="MSNKVNCPICNISVPEGDINLHLDLKCKGAPPAELSTPQQVFDF
                     TSSLHPKTQPSTSQTSPSTHPGSSQRARASQANLDERRASVGADGKKNIAPVFQTQGA
                     VTKRKAEGKETKVIGGDGFGGGKGAKQRRVNPLAAAQPLAERSRPSEISQYIGQSDIV
                     GLGSLLRVQIEAGKLVGSCILWGPPGCGKTTLARLIAKSSGADFKELSATSSGTQDVR
                     QVFEKAKNGLQMTGRRTVLMIDEIHRFNRAQQDLLLPYVEKGWIQLIGATTENPSFKV
                     NGALLSRCQVFTLHAHSPESLQIILRNAVQTISESEPIPYLPSGLIPFLADVADGDAR
                     QALNGLELALRTCQTMDETASAEKAQRVNSASGEKMEKEGQKDEFDAAVEEAEEDYQK
                     KKRDEEIMDAVRRGLQKGYNRTGEERYDMISALHKCLRGSDGSAAMYWLARMITGGED
                     PLYIARRLIVVASEDVGLADNHALPLAMATYQACQTIGLPECRINLAHCVAYLAEAPK
                     STRSYKAYAAAEQLATMPPLPGVPLQIRNAPTQLMKKLGYGKEYAYNPDYGHPVHNDY
                     LPESLLQHSSHSHDPSQHILKTADQFEADKKWDEEHLDEWERVVNDGVAWEGRYERFG
                     EI"
     STS             1008262..1009050
                     /standard_name="Pst20"
                     /db_xref="UniSTS:470932"
     gene            1012388..1015417
                     /locus_tag="CNH00600"
                     /db_xref="GeneID:3259290"
     mRNA            join(1012388..1013161,1013231..1014620,1014683..1014753,
                     1014808..1014854,1014911..1014944,1015008..1015417)
                     /locus_tag="CNH00600"
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572252.2"
                     /db_xref="GeneID:3259290"
     CDS             join(1012706..1013161,1013231..1014620,1014683..1014753,
                     1014808..1014854,1014911..1014944,1015008..1015160)
                     /locus_tag="CNH00600"
                     /codon_start=1
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572252.1"
                     /db_xref="GeneID:3259290"
                     /translation="MYQQQTMASHPFFSHNNPWARSAICCDQHHGESTSAAMARLAGN
                     IPFSHDENLHDHHLGYHDSSGCTSDCPLDTYCCSGDYCCDKHGSCSSGDECCDDPRCE
                     EAHRPDSRASHQSHHNRSKPEQSRNHNHQQPMSLEEWAGTQEGCNAIQQLIECCNQPD
                     CHIPVCPTDNSEVHPLPADPLSALFASLDAQQQPQPISTAQQPMAPVSSVEASHTCHW
                     GNCHLVFGSMPDLLAHVAADHLNAAGTAHQSDQLLQQAQSAQSAQSTPLALLTERALS
                     SISTNTTGLQSHLPTNSSLQATSLAVNDALLSCMWDDCFPVPEVPAASSTSHSTFHHY
                     NSDNCQAPHNHQHDHSYAAGEPFNPGTMLRHVLEEHLGIPPDIIGWPNEAELQAQAQA
                     ILEKHHHHHHIDPREALVNHSENCNHVHPHPHSHSHGNSAGTGANDSHPHGHALAHSQ
                     FHPNLHPHPHSLPHERSYAHSHSLSHSRPLSHEPLPTPPSTVKTEACTSPAASNDSVA
                     STVLTASQSSKDLICLWPGCTIHTPFASTASLMDHLSEMHIPKGKDCYTCHWGGCGGE
                     EGRVFKSRQKVLRHLQSHIGHKPFVCGVCNQAFSEAAPLTAHMRRHAQEKPFKCEHPG
                     CGKSFAISSSLTIHMRTHNGEKPFVCPYCQKGFVEASNLTKHIRTHTGERPFACSHPG
                     CGKKFSRPDQLKRHMTIHNKPPGEKRRGSGVPAK"
     gene            1016920..1017028
                     /locus_tag="CNH00590"
                     /db_xref="GeneID:3259005"
     tRNA            1016920..1017028
                     /locus_tag="CNH00590"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3259005"
     gene            1017851..1020503
                     /locus_tag="CNH00580"
                     /db_xref="GeneID:3259076"
     mRNA            join(1017851..1017961,1018031..1018308,1018370..1019467,
                     1019517..1019677,1019736..1020347,1020445..1020503)
                     /locus_tag="CNH00580"
                     /product="centromeric DNA binding protein, putative"
                     /transcript_id="XM_024657630.1"
                     /db_xref="GeneID:3259076"
     CDS             join(1017885..1017961,1018031..1018308,1018370..1019467,
                     1019517..1019677,1019736..1020146)
                     /locus_tag="CNH00580"
                     /codon_start=1
                     /product="centromeric DNA binding protein, putative"
                     /protein_id="XP_024513418.1"
                     /db_xref="GeneID:3259076"
                     /translation="MSHITPSRRKEERYIPFNNDPRNIGTRTGLPMPQNVPRDSNGFE
                     IPALFFGSSPENGANRTISSIKSKVAQTPGGRSTYSRADSTPGTARRLTRRLSDLDMD
                     DGLRGGDDLLMDEDDLAIATPGSLFANSEPPPSIILPSRSRLPISSPANASFDSVPSP
                     SVRPSPRKSHYSAASRVSSSLAKTVTKVHELSGDEEEPFLTPGDGLNQEGEPEESPVK
                     SKKKTPRAASSDDDGSPAKDKEAAFPPEGRSASMSGNKPANDYDAGYEGNHTVDFDDL
                     PPMGPIDDYDVETVLRTEREEDDEDAQNVDNNVVEEERTMEEEEMQVSESEDGEERRP
                     VVAKRKKSPKKQEKGKDRARSARSGSTAAQRKRTRPSELGPGDDGYHGNFVTRRSGRQ
                     HYKPLEFWRGEKVEYMRGPGCAVIKEIITIPEDPPVPLALRKSRKNGRARSGSVAVGK
                     RKREDSVEDEEGWDHKTEPTGLVQDYPFGEECYRKIACPKALLDPKLVSGGNFKYQKV
                     FGEGHFMAAGIVYIPVGQIKNTKPSKDNTYVFYVIQGAVQVTIYRTSFVMAPGSQFLV
                     PRGNDYCIENISPDKEAQLFFAQARKIRANEIDADGVSESQAGEAGLPSRKSISASQT
                     QGGKKSNRLPSVREESRDISQSEREDEEEDEEEEEITVKKRRKSKGKSRR"
     gene            1020553..1021867
                     /locus_tag="CNH00570"
                     /db_xref="GeneID:3259326"
     mRNA            join(1020553..1020648,1020704..1020750,1020811..1021073,
                     1021142..1021336,1021392..1021460,1021530..1021593,
                     1021655..1021867)
                     /locus_tag="CNH00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657629.1"
                     /db_xref="GeneID:3259326"
     CDS             join(1020614..1020648,1020704..1020750,1020811..1021073,
                     1021142..1021336,1021392..1021460,1021530..1021593,
                     1021655..1021716)
                     /locus_tag="CNH00570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513310.1"
                     /db_xref="GeneID:3259326"
                     /translation="MTREDHKQDSGLRALRAHLNTRPDLLLAIAMRHATNPLLHPAPD
                     PLTKSPTQTPPSLRLSVPHGSPTYDALGIKLRTKAREVDVDIPLQSTAKTASEVKQAI
                     DKMGEDALKYYKVPKDPQVNVFVPPKFTHTLVLLPLALLIYLAAAPSTSNAANAGRAL
                     VSKYLSDYMIPASLIFSFACHIIVEPLLLIIKIDKHQVPIIPALCYMFTVVLIGFGGL
                     NALDRAVVQERIRLVRSQSADTKKSQ"
     gene            complement(1021862..1024308)
                     /locus_tag="CNH00560"
                     /db_xref="GeneID:3259336"
     mRNA            complement(join(1021862..1022052,1022145..1022253,
                     1022343..1022571,1022654..1022707,1022773..1022881,
                     1022949..1023144,1023185..1023368,1023419..1023509,
                     1023556..1023584,1023637..1023767,1023822..1024308))
                     /locus_tag="CNH00560"
                     /product="sphinganine-1-phosphate aldolase, putative"
                     /transcript_id="XM_572250.1"
                     /db_xref="GeneID:3259336"
     CDS             complement(join(1021976..1022052,1022145..1022253,
                     1022343..1022571,1022654..1022707,1022773..1022881,
                     1022949..1023144,1023185..1023368,1023419..1023509,
                     1023556..1023584,1023637..1023767,1023822..1024253))
                     /locus_tag="CNH00560"
                     /codon_start=1
                     /product="sphinganine-1-phosphate aldolase, putative"
                     /protein_id="XP_572250.1"
                     /db_xref="GeneID:3259336"
                     /translation="MPVFSTLINSTESYQRRFDQMARAVLVYWVLKYVLLDGFRHIKA
                     RGLCGTANEIRNKIKSLVVRIMLAFPSNRAKLNSELAKTRAELKEKLAPSQYPDGVRL
                     TTVRTLPETGRGREWLESEWENLKKLEKADVDNGRVSGAVYHGGDELNAVINEAMAKF
                     VVTNPLHPDVFPGVRKMESEIVSMCLNLFNGPNGAGTTTSGGTESILMSVKTHRDWAR
                     VTKGITRPEMVIPSSAHAAFWKASEYFNIKLHVIPVNQKTRKAEVAAMKRAINPNTIM
                     IVGSAPNFPDGAIDPIPELGALAKRRNVGLHVDCCLGSFIMPFLEKAGFSEGIDPFDF
                     RVPGVTSISCDTHKYAFCPKGTSVIMYRSSELRRFQYYVITDWAGGVYASPSMAGSRP
                     GSVLAGAWAVLNHIGADGYTSSCRQIISAARYLTSSLRTLFPDDLYVLGDPKGPVVAF
                     NSKTINIYAVGDVMSKKGWHLSALGGDGGLHMAFTRLSAKSVDKLIEDLGDALKEVKA
                     SPQGAGGDMVALYGLGQTSAGPHVVGKLAETFLDTLYE"
     gene            1024738..1026939
                     /locus_tag="CNH00550"
                     /db_xref="GeneID:3259136"
     mRNA            join(1024738..1024812,1024857..1025025,1025083..1025221,
                     1025269..1025279,1025326..1025393,1025441..1025628,
                     1025679..1025692,1025736..1026021,1026079..1026249,
                     1026304..1026543,1026701..1026939)
                     /locus_tag="CNH00550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572249.2"
                     /db_xref="GeneID:3259136"
     CDS             join(1024797..1024812,1024857..1025025,1025083..1025221,
                     1025269..1025279,1025326..1025393,1025441..1025628,
                     1025679..1025692,1025736..1026021,1026079..1026249,
                     1026304..1026543,1026701..1026826)
                     /locus_tag="CNH00550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572249.1"
                     /db_xref="GeneID:3259136"
                     /translation="MPELPEVERARKLIEDSCKGYKIASVDAQEDSIIFTGGTDHNEF
                     AKEIAGRSITGCERKGKTFWMTLSGEGRYPVMHFGMTGMIQLKGQEPTWYRRRPKESA
                     DVWPPRFYKFVLKLEPQEGSIADEPRELAFIDGRRLGRLRLVSDPVSSHPPVSELGFD
                     PILNHPTLEEFTKLLVNKKGTVKGVIMDQAFSAGVGNWVADEVLYQARIHPSCPIPAL
                     SEQNIRDLHHQLRAVPLTAISVNADSKLFPSDWLFRWRWSKGTTQKKQMEKDKKSKGK
                     KVVDGEGGEDVEPEDKEFLELPDGSPATIKFIEVGGRTTALVEELQKMPEGVEIKPKI
                     SKGGKRAGAKRKKVAKEEESDEGSELSDQSDLEEQKPKRPLTARQKAAAEKKGINSNL
                     ASQTKTEDNKPSAAKRRAIGARTGGSKNHPDSEVKKEKGSTECRKSKKQVEAVGEKLA
                     KIKPQKGRKKAASTPESSELSDLVE"
     gene            1029135..1031607
                     /locus_tag="CNH00540"
                     /db_xref="GeneID:3259081"
     mRNA            join(1029135..1029446,1029503..1029559,1029614..1029718,
                     1029769..1029853,1029912..1030079,1030130..1030264,
                     1030323..1030732,1030790..1030924,1030983..1031108,
                     1031161..1031607)
                     /locus_tag="CNH00540"
                     /product="galactose transporter, putative"
                     /transcript_id="XM_572246.1"
                     /db_xref="GeneID:3259081"
     CDS             join(1029297..1029446,1029503..1029559,1029614..1029718,
                     1029769..1029853,1029912..1030079,1030130..1030264,
                     1030323..1030732,1030790..1030924,1030983..1031108,
                     1031161..1031442)
                     /locus_tag="CNH00540"
                     /codon_start=1
                     /product="galactose transporter, putative"
                     /protein_id="XP_572246.1"
                     /db_xref="GeneID:3259081"
                     /translation="MGGGAPAGGDFEALLTQRQNEGWRGLFKNGRALGLACFASLGGV
                     LYGYNQGVFGQVQVMYNFEQRYTATLTNPDTKGLLTSILELAAFVGALMAGPLSDRYS
                     RKYSISAWCVVFMMGTAIQTGANSNVACIYAGRWFAGMGVGALSMLVPMFNAELAPPG
                     IRGSLVALQQLAITFGILISYWIGYGTNYIGGTGAGQTTAAWRIPLGLQLIPGVVLCV
                     GACFLPFSPRWLMLRGREEECLTNLARLRSSTEEAPEIQYEFRALQAERLVEREAAKE
                     RYGQEDVNFRVTMLEYKRLFTTRPLLHRLMLGAGAQALQQWTGINAIIYYAPTIFAQI
                     GLTGSGASGTISLLATGIVGVVNFVFTIPAVLFVDNFGRRPLLAWGEANMAISHAIIA
                     AIVAEFGDSFDSNKKAGNAAVFFIYWYIANFAVTWGPLAWVVSAEVFPLDMRAKGMSI
                     SSGVNWLMNFTVAMVTPHMIDNIGYKTYIVFMCFCVVGFLYSIFILPELKGLSLEEVD
                     RVFHDESGAEDRARRERVAAQIGLDKVAEQIQHKEKVNDSEA"
     gene            1032876..1035069
                     /locus_tag="CNH00530"
                     /db_xref="GeneID:3259001"
     mRNA            join(1032876..1032983,1033046..1033088,1033137..1033327,
                     1033396..1033506,1033555..1033650,1033699..1033793,
                     1033841..1033920,1033972..1034212,1034263..1034865,
                     1034914..1035069)
                     /locus_tag="CNH00530"
                     /product="glutamate 5-kinase, putative"
                     /transcript_id="XM_572245.2"
                     /db_xref="GeneID:3259001"
     CDS             join(1032978..1032983,1033046..1033088,1033137..1033327,
                     1033396..1033506,1033555..1033650,1033699..1033793,
                     1033841..1033920,1033972..1034212,1034263..1034865,
                     1034914..1034983)
                     /locus_tag="CNH00530"
                     /codon_start=1
                     /product="glutamate 5-kinase, putative"
                     /protein_id="XP_572245.1"
                     /db_xref="GeneID:3259001"
                     /translation="MSGKSKFTPLTIVIKLGTSSIVSPTYPFVPHLRLLSSIVETVVK
                     LRTQGHRVVLVSSGAIGVGLRRMDLKERGKGLHQKQALAAVGQGRLIALWDNLFSQLD
                     QPIAQILLTRMDISDRTRYLNAQNTFSELLQMGVIPIVNENDTVSVSEIKFGDNDTLS
                     AISSAICHADYLFLLTDVDCLYTDNPRTNPDAKPVRVVRDIEKVKQQVSTSTLGTSLG
                     TGGMSTKLIAAELATAAGTTTVVMHSINVTDIFKVIENGPSPCREVAETPELFEGPLC
                     TRFLRRESALKDRKWWIAHGLHAAGTVVIDEGACRAIRRKESGGRLLPAGVVRVVGPF
                     ASHQAVRLVVRRRRHDDIAALSSVDESTPGSPTPDLSQVPQPATFASPALRHLTIGTT
                     NPITVMSDANNTEPDTPQLQPSMSLSSSIASLDPLSRSVPPSPAITALAERLGTTSLT
                     SIGRGVAEGESDEWEEVEVAKGLAQYNSVEIDRMKGRKSSEIEKLIGYVESEHVVDSI
                     TFL"
     gene            complement(1035688..1038566)
                     /locus_tag="CNH00520"
                     /db_xref="GeneID:3259163"
     mRNA            complement(join(1035688..1036189,1036258..1036326,
                     1036368..1036460,1036514..1036774,1036827..1036902,
                     1036942..1037078,1037126..1037447,1037529..1037696,
                     1037753..1037950,1037992..1038122,1038163..1038566))
                     /locus_tag="CNH00520"
                     /product="intra-Golgi transport-related protein, putative"
                     /transcript_id="XM_572244.2"
                     /db_xref="GeneID:3259163"
     CDS             complement(join(1035755..1036189,1036258..1036326,
                     1036368..1036460,1036514..1036774,1036827..1036902,
                     1036942..1037078,1037126..1037447,1037529..1037696,
                     1037753..1037950,1037992..1038122,1038163..1038501))
                     /locus_tag="CNH00520"
                     /codon_start=1
                     /product="intra-Golgi transport-related protein, putative"
                     /protein_id="XP_572244.1"
                     /db_xref="GeneID:3259163"
                     /translation="MSTNPNTPAPPASRTNPISLRIYKAIGTSFDDVSSREALEIASG
                     MYGPEDPKAKVKAQPEYEELEEDDDTLPKRRTLKGQSAAIARKYLKQDIETCLATGST
                     KFLEAFAEVDQKLNVLREHMQEMQVRCDQVQSELDQANSGTKFLLERADVLRSQRDSA
                     QLRAHLITLFLSRFTLSNSELTALTSREVTIGQPLFDALDHVEKIRTDCEVLLSGEEG
                     KAQAGLDIMSLTSEQLESGYSKIHRYCQFEFRQFTREAQLEASSVMRQAICRLRDRPA
                     LLADAIQTLTSTRQSSILHQFLDALTRGGPGGLPRPIEIHAHDPTRYVGDMLAWVHQT
                     TATEHEFLEGMFGVKEKKRWVGQERGGEEGEEERMASEVLDKDLEGLSRPLKLRIQET
                     IKSQEGIIMTYKIANLLHFYLVTMRKTIGGKAMLVQTLQEIHDQAYIAFYETLDAQGR
                     GLLRFLHPPDATLTPPITLRDAAQILRELLFVYSTSLIDPAERESDADLAKLLDKAVG
                     PCVEMCERMAEMRRGKSGGGEWERDIFMVNSLGYLEHTLEMYDFTTKTLHMLDEKIKT
                     HVESMTFEHHGKLLESCGLAAVMRTIRTRPEDTPLSRLHATSPKSLTSALSKFSTWIS
                     TVDPSTSPRLALLTSPRLAVEIHRKALRKIYDAYGEICERVLDKAEGYEFGETMLRRG
                     RDEVGVALGVGEDWELEEDTEEKSMKQKEQQDEDTEDQGEKGIMQEEHKAQDAGNTED
                     KA"
     gene            1038710..1040480
                     /locus_tag="CNH00510"
                     /db_xref="GeneID:3259094"
     mRNA            join(1038710..1038906,1038994..1039008,1039124..1039132,
                     1039187..1039402,1039483..1039596,1039656..1039737,
                     1039801..1040073,1040158..1040480)
                     /locus_tag="CNH00510"
                     /product="CDP-diacylglycerol-inositol
                     3-phosphatidyltransferase, putative"
                     /transcript_id="XM_572243.2"
                     /db_xref="GeneID:3259094"
     CDS             join(1038737..1038906,1038994..1039008,1039124..1039132,
                     1039187..1039402,1039483..1039596,1039656..1039737,
                     1039801..1040073,1040158..1040232)
                     /locus_tag="CNH00510"
                     /codon_start=1
                     /product="CDP-diacylglycerol-inositol
                     3-phosphatidyltransferase, putative"
                     /protein_id="XP_572243.2"
                     /db_xref="GeneID:3259094"
                     /translation="MMAPTTRSKQSTPVLEPEESTSTSTATSLGPGEGELKQRAREGS
                     RSRTRDEVWDPKYAVDLATTTVDENVFLFVPNLIGYTRVITAAASLFFMPYHPKACTM
                     LYSVSCMLDVVDGQAARALGQTSRFGAVLDMVTDRCTTACLLCFLSSVYPTYSMLFMF
                     LITLDFSSHYIHMYSSLTTGSSSHKTVTSDVSRILWYYYNDSRTLFVFCFANELFFVC
                     LYLNHYWTTPLMANFPIPTAILTSELTAAHPKLVGGVINVLRNLNWPQVVAAMTFPIC
                     AGKQIINVVQFWKASKILVGVDLAERRAAREQKLAAQLRGR"
     gene            1040822..1042790
                     /locus_tag="CNH00500"
                     /db_xref="GeneID:3259054"
     mRNA            join(1040822..1041135,1041213..1041471,1041542..1041721,
                     1041801..1042200,1042293..1042790)
                     /locus_tag="CNH00500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572242.2"
                     /db_xref="GeneID:3259054"
     CDS             join(1040960..1041135,1041213..1041471,1041542..1041721,
                     1041801..1042200,1042293..1042423)
                     /locus_tag="CNH00500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572242.1"
                     /db_xref="GeneID:3259054"
                     /translation="MTDQLRDQLHFGIASASLGLNPIHTFENKFQALQKAGFKFCEVD
                     FGSYMTWVRDQKPDLPESTCPPEWSEANEPDPSDEEIWQALYSLAPDFVRLARKYGVK
                     VVVLQPLNQFDGWPAGTERAMWVRRKAERWLPLCSKLGVEFLQVGSNDWAEACAPDAK
                     TAGDMRWIAELGARQDPPVKIAYEPWCFSDLRGEWEECYKTVQQANHPNLGLCLDTAQ
                     LALAKPYGWNPTTGQGWDRVSYEGMISRLASLPPEKIFYVELSDVLNPKATKPLYQGS
                     PFDEFGKNDKSGKNERFIWVRCARPVPLVGPNGGMDERPEGMEEDGARVVETLKAIMS
                     TGWRGYTFFEVFECLKMEPEDEDIPDRYASACKKSSEMILHVVADLK"
     gene            1043053..1044752
                     /locus_tag="CNH00495"
                     /db_xref="GeneID:36392977"
     mRNA            join(1043053..1043557,1043624..1044752)
                     /locus_tag="CNH00495"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658715.1"
                     /db_xref="GeneID:36392977"
     CDS             join(1043190..1043557,1043624..1044293)
                     /locus_tag="CNH00495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514628.1"
                     /db_xref="GeneID:36392977"
                     /translation="MRGRGHPWCIITVTPLLSISRRQLSFVQPILELKPIKKHALSII
                     PPQNAARAKSITNKEQKKRKMFPSQYTASHFSIHSQGDEGSGSIVSPNTTISSRRKRT
                     AQACTTCRRRKGKCVPPPSIDGPCAFCSSRPGTTCEFVLATNNNEGYSSVPVVFIGDK
                     HIMADPSQTTAFSSTVSGTHGYPYDNPLYPPNPISTQLSWEDAAILQNPTNYLGSQKT
                     GASSDTAGQLRLQPFTPNNSHTARDDASTGNWYFQDTYTDYPHTAPLTLPQQQSSMVF
                     QQQFLGAPPKYNAVSYSDDQRSYYFEQRHSIDPTLEDNGGMYGVYGDPSSLATVLTSS
                     RNTPYPPTSEH"
     gene            complement(1045325..1048073)
                     /locus_tag="CNH00490"
                     /db_xref="GeneID:3259209"
     mRNA            complement(join(1045325..1045823,1045876..1046393,
                     1046447..1046715,1046766..1046862,1046913..1047128,
                     1047179..1047257,1047313..1047475,1047526..1048073))
                     /locus_tag="CNH00490"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_572241.2"
                     /db_xref="GeneID:3259209"
     CDS             complement(join(1045567..1045823,1045876..1046393,
                     1046447..1046715,1046766..1046862,1046913..1047128,
                     1047179..1047257,1047313..1047475,1047526..1047705))
                     /locus_tag="CNH00490"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_572241.1"
                     /db_xref="GeneID:3259209"
                     /translation="MSTVDPTNVVHEKHARPEHLSDADNATILSSNGFRLSEEDIQAA
                     RDVSPSRVSGKGLTWMVTFVAGTGFTLFGYDQGVMSGLLTLPSFEAQFPNTAGGFEGS
                     RTATLQSFMVAIYEIGCMMGAISSIWIGDRLGRRHTISLGGLIMLVGAILQTAAVDYA
                     MMLVARVVTGVGNGLLTSTVPAYQSECSKPHRRGQLVLVEGSLIAFGIMVSYWMDLAF
                     YFTSGSVSWRFPIAFQIVFILVMIICMYTFRLPESPRWLAAKGRNAESLAVLAALSNT
                     TVDDQEVMNTFHGITDTLAAENSGSFKFSEIFTHGKSQHFRRTLLGMAAQCFQQICGI
                     NLITYYLTSVLTGLGLGAVMSRIISGVNGTCYFLTSLIAIAIVERAGRRPLMLWMAGF
                     QAATMAILAGLYDLSTDEENPNKTAQVFSVLMLFLFNTWFSVGYLGMTWLYPAEVTPL
                     RVRAPANALSTASNWVFNFMVVMATGPMFANIGWGTYAFFAAINAVVILPSVYLFFPE
                     TKRYSLEDLDIIFAKANTEGRSPVRVSLHPEEIPPAGSRQAEEILGRAPAPHLKSKTS
                     HVNMITRALSRTSESGKHRDQHHETV"
     gene            complement(1049666..1053880)
                     /locus_tag="CNH00480"
                     /db_xref="GeneID:3259002"
     mRNA            complement(join(1049666..1049827,1049878..1049958,
                     1050014..1050541,1050597..1050668,1050716..1050859,
                     1050911..1051052,1051101..1051169,1051226..1051363,
                     1051420..1051479,1051536..1051597,1051648..1051743,
                     1051795..1052047,1052098..1053067,1053384..1053419,
                     1053473..1053880))
                     /locus_tag="CNH00480"
                     /product="expressed protein"
                     /transcript_id="XM_024657628.1"
                     /db_xref="GeneID:3259002"
     CDS             complement(join(1049768..1049827,1049878..1049958,
                     1050014..1050541,1050597..1050668,1050716..1050859,
                     1050911..1051052,1051101..1051169,1051226..1051363,
                     1051420..1051479,1051536..1051597,1051648..1051743,
                     1051795..1052047,1052098..1053067,1053384..1053419,
                     1053473..1053602))
                     /locus_tag="CNH00480"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513309.1"
                     /db_xref="GeneID:3259002"
                     /translation="MSSRDPKENPTDDSTLEPDNRDNNTQNPPPKKKRRQRQLYSCAE
                     CRRLKLKCDRQVPCSNCTRRGCQELCPNGSKQTVKGNSEDSVELRKRLEAVESLLTQH
                     GVSLPASTSNDNNSNDNEMANRPRSKSDTIEEDAINRRSSVQMTSPPHDQNEAQKERT
                     ASVNVRRSRSPASQPIPGNQPIAAAINSSQIQSQTSHLAEDVHPIPANPISNPTPTYG
                     SMTMVSPPELSRVHFDFNTSADDYRQTWAAGPHPSLSHHHISTVSSVRSDPAQQEQSF
                     GTLVLSHGGGSKYLGPTAASEWLKDQEIQEAQDLSDTPGASRAPSPSQRQCPVRAPVM
                     LDQGGIFPFDVISPSVSTQTILNHLPPRHEASVLAESYYRYFAWHYNVVPRQTFQPIF
                     DRAYKREMSVNRNVGAQELALLYILLAMGALHNLELPPNDPIAEEYSTLSKICLAKGE
                     FMVHCTTTGVMALHVMAHFHLETEKGRNGDSAWPLWGLAMRLIQGMGLHRDGARWNLT
                     PEIVEERRRVFWESHAADVLQANCFSRPSSIPPDYIDTCFPSEDPEFIIPRQEVQNQE
                     KGFWTLKFELVKISGAILDLAMKVNPPSYDTVTTLHEHLCDFEHQVPYHLRCRTALLA
                     LPSIYPDPTQAVRDSPEISKRDLHRTFQQFTLYINISETILFLHRPYFAKALHERLSD
                     PTRSIYGQSYLSVVERCNCIIQLVSTIYALHPYISARHWFLWYHAFNSAVCMGTLILQ
                     TPHNPMATFALSQIDACITLYTSVVQSHASTRLAKNLQWLLRLRHRAHTKMNQNPPDA
                     ATEAMASMHTGNEGDEDIELLGWRTRLIHRATRGTQKATTISPMASSQANHTPSPGTS
                     VTQTITQALQQHFGGDGSGGGGGIAMDHLSSSSNNPINASTDVLLHQFWDPRMLHETF
                     AGQQPVMGNVEPSSVNWWDWDALAGEGSSGNR"
     gene            complement(1054062..1055476)
                     /locus_tag="CNH00470"
                     /db_xref="GeneID:3259233"
     mRNA            complement(join(1054062..1054269,1054322..1054526,
                     1054576..1054627,1054681..1054997,1055049..1055200,
                     1055256..1055476))
                     /locus_tag="CNH00470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572239.2"
                     /db_xref="GeneID:3259233"
     CDS             complement(join(1054109..1054269,1054322..1054526,
                     1054576..1054627,1054681..1054997,1055049..1055200,
                     1055256..1055316))
                     /locus_tag="CNH00470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572239.1"
                     /db_xref="GeneID:3259233"
                     /translation="MFKKFVVDKPLLQLNGTLGEGCVWDTRTQRLYFVDIDQYKLYTY
                     EPSSGKYGYESFDKKVTALASLENGEGLIAAVEDGFAYISFDSLPFPPTSSKQSLIPI
                     SSGASLNCREKRFNDGAVDPAGRFLAGTLGFEHGSKNGKMYSLQAEKDGSYSAPLILD
                     GITCTNGMGWTEDAKTFYFTDSWIKEIAKFDYDITTGKLSNRRVFSNFDGYGEPDGMC
                     MDSEGGIWTCRWASGKVLRLTPDGEIDVEIDFPTAWHITCCIFGGENLDELYVTSAAS
                     DYIGDNLPDRKNGGDLFVVKGLGFRGIERGRFKGTIPNK"
     gene            1055622..1057041
                     /locus_tag="CNH00460"
                     /db_xref="GeneID:3259154"
     mRNA            join(1055622..1055678,1055734..1055879,1055933..1056012,
                     1056062..1056286,1056346..1056547,1056602..1056717,
                     1056772..1057041)
                     /locus_tag="CNH00460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657627.1"
                     /db_xref="GeneID:3259154"
     CDS             join(1055861..1055879,1055933..1056012,1056062..1056286,
                     1056346..1056547,1056602..1056717,1056772..1056975)
                     /locus_tag="CNH00460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513308.1"
                     /db_xref="GeneID:3259154"
                     /translation="MKLEGKAFVVTGGCGSIGGTAAKHIIARGGIALIFDVLPEEAGQ
                     AKVKEYHAERAFYFKADITNVEVFSACIDAALKVIPKGSLFGGVHCAAIAPGRPWDQK
                     LKNSIAHFQKVMHVNSYGTFLVDACIADAINSQYPDEGPFGPRVKEERGCIVNIASVV
                     AKPVPARCLTYGVSKATVLGISSGIADFLGPYGIRVNSVSPAVVASSLMGPDRIPYFE
                     SELEAAAIYPRRLSQPDEVAQGIVYLLENSMMNDFELRVDGGWRGSSNWGGPHDPRSN
                     APSLE"
     gene            1058249..1060704
                     /locus_tag="CNH00450"
                     /db_xref="GeneID:3259262"
     mRNA            join(1058249..1058423,1058479..1058547,1058604..1058821,
                     1058874..1059038,1059090..1059175,1059226..1059710,
                     1059769..1059805,1059859..1060191,1060264..1060704)
                     /locus_tag="CNH00450"
                     /product="myo-inositol transporter 1, putative"
                     /transcript_id="XM_572237.2"
                     /db_xref="GeneID:3259262"
     CDS             join(1058289..1058423,1058479..1058547,1058604..1058821,
                     1058874..1059038,1059090..1059175,1059226..1059710,
                     1059769..1059805,1059859..1060191,1060264..1060496)
                     /locus_tag="CNH00450"
                     /codon_start=1
                     /product="myo-inositol transporter 1, putative"
                     /protein_id="XP_572237.1"
                     /db_xref="GeneID:3259262"
                     /translation="MRATHIENRDNNSLENKHIDHIEGVENGKGSQEPPSPSGFGGHL
                     IDENLVHVEGEDKVTWYLCFLISASAIAGFLFGYDTGVVGVALPLVGTDLGGSELNSS
                     QQEIITAGTTIGAIFGSAILGGWGDRLGRKMAILISDVFFTAGAVIIASSYSVPQIIV
                     GRIILGIGVGGAAVIAPLFITETAPTAVRGRCIGVNAFFIPFGQVVADSIGAGVQNMR
                     GGWRLLFAMGAVPSLLQLLLFHYLPESPRILIVKGDIDRARSVFQRIYPTATREMVDY
                     KLRVAQEYVAATTALQSGTTFWERMKKVWKTGSYRRSIIAVSVLQAAGQFCGFNTLLY
                     YAGTLFGLLGLSNPALGGLIPAGTNAVFVLIGMSTVDKVGRRGLLLIGVPVLLLGLVW
                     NIVGFYYMCKPTGGFLDTSYSYDTTNVGIVIGGIVFYVAGFGLTYSHLVWYQAEYLAL
                     EVRSMGSGVATTVCWIANLIVSVSYLSELETMTPSGTYGFYLSLSVIAFVFIVFCFPE
                     TKQLSIDETSLLFENDWGVKRSVQMRKERHETRKRFKDAELAEAATAHFEARKQKSTS
                     ISPAELSKFMAGLKGGKRKP"
     gene            complement(1061331..1063099)
                     /locus_tag="CNH00440"
                     /db_xref="GeneID:3259291"
     mRNA            complement(join(1061331..1061519,1061585..1061975,
                     1062041..1062220,1062280..1062538,1062591..1063099))
                     /locus_tag="CNH00440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572236.2"
                     /db_xref="GeneID:3259291"
     CDS             complement(join(1061395..1061519,1061585..1061975,
                     1062041..1062220,1062280..1062538,1062591..1062763))
                     /locus_tag="CNH00440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572236.1"
                     /db_xref="GeneID:3259291"
                     /translation="MSIDFSGLRFGVATASLGMNSIHDIYKKFEALQKAGFKYVEVGF
                     GAYMEWVRSELPDLPPSTCPPEWSEADEPDPSDDAIWKALYAKAEDFKKLVAKYGMTC
                     LVLQPLNQFDGWPEGSKRAEWVRRKAEKWLPLCSKLAVEQLQVGSNDYAEANAPDEKT
                     AEDMRWLAELGAKQNPPVKIAYESWCFSKRVSDWEHTWKIVQLGNHPNLGLCIDTAHP
                     PLAPAYGWDPTTGEGWTDEQYASFLERLRAVPKEKIFYVELSEVLKPVVPLGKGSPFD
                     EWREKAQSPRGDGFVWAVCGRPVPLVGRDAGRGVKGPNDMGAARALETFKAVLSTGWR
                     GICMFEFFEALHMEPADPEIPFKYADACALSNKRILEALKA"
     gene            complement(1063622..1066360)
                     /locus_tag="CNH00430"
                     /db_xref="GeneID:3259167"
     mRNA            complement(join(1063622..1063884,1063949..1065428,
                     1066160..1066360))
                     /locus_tag="CNH00430"
                     /product="expressed protein"
                     /transcript_id="XM_572235.1"
                     /db_xref="GeneID:3259167"
     CDS             complement(join(1063801..1063884,1063949..1065127))
                     /locus_tag="CNH00430"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572235.1"
                     /db_xref="GeneID:3259167"
                     /translation="MSTQLQHIMATLSPVSSSSVTATSPVLGTSPSAPATALAGTTIT
                     PLINTGKPKTSKPRKRVNTAEKRSQHNAIERARRETLNSKFLDLARLLPSLASSRRPS
                     KSAIVNGSISHLTYQRKQRLLAAKLLKQVRIERDELLREVNEWRSVSGCALKECSAWT
                     EEMDEVTAVEKEIFGNFVSVDGEEDGDGEMEDGPVLATPIEDNKFMPLNNGMWNEFGY
                     GMNPANGFVNSASDTLSQTSPVGSQAHTTVLTPPMSATEPQTVYNHTPSPSSSQGAAS
                     IVEAPKDGMPTVPSQTNHFNQQLLNWSQQFFQHPMQQPDTATALPRPPQQVSPQSQNQ
                     RFNPMLPEAFNGMFNPLQMGHGVVPGQEQNVSADAFTQQLMASMFPGKYAAQPSISDL
                     QKAVRAGMGLGLGMMGNQWPQENAVEGF"
     gene            complement(1070149..1073626)
                     /locus_tag="CNH00420"
                     /db_xref="GeneID:3259177"
     mRNA            complement(join(1070149..1070404,1070483..1070531,
                     1070585..1070716,1070774..1070864,1070923..1071053,
                     1071111..1071260,1071307..1071759,1071812..1072492,
                     1072543..1072660,1072715..1072824,1072882..1073078,
                     1073129..1073626))
                     /locus_tag="CNH00420"
                     /product="sister chromatid cohesion-related protein,
                     putative"
                     /transcript_id="XM_024657626.1"
                     /db_xref="GeneID:3259177"
     CDS             complement(join(1070283..1070404,1070483..1070531,
                     1070585..1070716,1070774..1070864,1070923..1071053,
                     1071111..1071260,1071307..1071759,1071812..1072492,
                     1072543..1072660,1072715..1072824,1072882..1073078,
                     1073129..1073576))
                     /locus_tag="CNH00420"
                     /codon_start=1
                     /product="sister chromatid cohesion-related protein,
                     putative"
                     /protein_id="XP_024513307.1"
                     /db_xref="GeneID:3259177"
                     /translation="MLEASPETLVFEPTDIFDFDFGLQPQPQLTRQDQDASPTSSAPA
                     VSTNNDVSNSTATLLMEREGISRPTAPRIPTPPPDFEPDENWEDEMAVMEMEREFAEL
                     QDEPSGRDDGNDEQTQSRISGKGKDKETTGYEFLSNGIFDFDVPVASSSRVTLTPPLD
                     IPAISLDQLPKEKEPQSGLVKQTRPCTLPSLMAATADGDMITFQRRWKPQAISPLELQ
                     QRGGKGKAGELLTVPLHKLLDQVNELKSREKALKLQRQIDEEFEGQTKKIQMGTTMWV
                     DKYRPKKFTDLLGEDRVHREVMSWLKEWDKCVFKRQQPQAKKRPFDASDSKPFAVDPL
                     GRPHERVLLLSGPPGYGKTTLASIVARHAGYRILEINASDDRSYQTVQTRIRNAVDAG
                     TSLGAEGKPTCVVIDEIDGAGGGESGFIKALIKLIQDVPAKKKSNTPAKPLRRPIICI
                     CNDLYAPALRPLRSYARIIRFRKPQAQSLVVRLRDICKREGLQSDTRSLNTLVEMTSG
                     DVRSCLNTLQFIKSRSSVVTEEAIRATSLGLKDTSTTLQTAWNAIFIPLAAKKRRAQG
                     SIDDTRYLPRIIPIINSCGEYDKLLLGAFEHYPNLKPLDGTMKNLTKVHEWLAFSDRL
                     QARVTSEQEWELLGYMPWGVGAWYPHLASQGNSSKPTEYPKIDYEAYQTRASNEEVAT
                     AFKNVLPPILRSMFTTSTTLTELIPFLMRIISPPLKPVNANIVKPAEKAVLERLVELM
                     IPLGLTFYKEKAENGQPMMRLEPAIDVFVHYDGKRAEDILASRFMIRQLISQAMDAEL
                     AQKRGGADTEASDTGADGFAKAYGLMGNIAKKPEEKALLPVTDFFGRTVAVIEEDVTA
                     DGVRPQAPPKKKFRPIYKFNEGSLSAVRRSVKMSALM"
     gene            complement(1073733..1075560)
                     /locus_tag="CNH00410"
                     /db_xref="GeneID:3259020"
     mRNA            complement(join(1073733..1074500,1074550..1074721,
                     1074784..1075028,1075105..1075560))
                     /locus_tag="CNH00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_572233.2"
                     /db_xref="GeneID:3259020"
     CDS             complement(join(1073881..1074500,1074550..1074721,
                     1074784..1075028,1075105..1075519))
                     /locus_tag="CNH00410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572233.2"
                     /db_xref="GeneID:3259020"
                     /translation="MPSFTRRIPVANPPPPGTTPSPIHSLPLLPTGLPSMDDLLGGGL
                     PLHSILLVLAPDTQSAWGRLLERYWIAQGLASGQAGVLVGEKEEGEAVVKGCMWTEGG
                     VSGDGSESEGEGGVEGGERKIAWRYEKMGKFQTTVKGNGSNLSLMTTIPPEALSLMQE
                     SGQMSYVAINSDEPSTSRSCVLDEVLKGVWEKLQHADKGRATRLAVHELGSLDWGHIS
                     MSEIHRFIHSLRELLKTKPASALITLPASLILSMGNERESIVRRLSWGVDACVELKGF
                     ADDPTLPPLFPTHGLLTLHSYPTTHALLPSTLKHSTLLGVSQSSTSASSSGGGGGAGE
                     NNLGFRLKRKRFVVETVHLGVEGGVGERRTGGDVREALDGADATHSHAHSHPTMTIPS
                     SGIEPSQPVLASTPQTGVDDKPRGADQDKKPSKPRARVRFGGEEEVIIVGKGGDGSKH
                     DHAHSHTHDHGPRGKDQPQKIALRHDRPDLYEF"
     gene            complement(1075771..1077566)
                     /locus_tag="CNH00400"
                     /db_xref="GeneID:3259263"
     mRNA            complement(join(1075771..1076686,1076747..1076859,
                     1076908..1076982,1077077..1077566))
                     /locus_tag="CNH00400"
                     /product="B2-aldehyde-forming enzyme, putative"
                     /transcript_id="XM_572232.1"
                     /db_xref="GeneID:3259263"
     CDS             complement(join(1076135..1076686,1076747..1076859,
                     1076908..1076982,1077077..1077416))
                     /locus_tag="CNH00400"
                     /codon_start=1
                     /product="B2-aldehyde-forming enzyme, putative"
                     /protein_id="XP_572232.1"
                     /db_xref="GeneID:3259263"
                     /translation="MLALLALFQLLPILALAAHNPPHRRAHERARKNYEHIHGRDAEE
                     SPSIVERDNHYDNRTIVERDHFDNRTLTPRGTTYTGVGTFYYTGLGACGLNSQDSDYM
                     VALNSAQYGSGYPGPQCFKYITIQMGSTTVSGVEILDECPTCDYGSLDLSPGLFTRFA
                     DYDAGTIQITWWFDDDAPAATTTSETPTSTYVPPTSTWVAPSSSSTSTYVWIPPSSSS
                     TPEWVEPSTSPTPSSTTQWYSSPAETSTSTTPTSTWVAPSSTSTSVWVESSTYSSSAP
                     SSTITSSAYSSASAAVNSTNPFAIVSNASNSSVSATISSDTGVSGSANSGSSEVSVEV
                     TGNLEMINALAAQYGQLVVEAALQS"
     gene            complement(1078198..1081012)
                     /locus_tag="CNH00390"
                     /db_xref="GeneID:3259114"
     mRNA            complement(join(1078198..1080762,1080812..1081012))
                     /locus_tag="CNH00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_572231.2"
                     /db_xref="GeneID:3259114"
     CDS             complement(join(1078256..1080762,1080812..1080950))
                     /locus_tag="CNH00390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572231.1"
                     /db_xref="GeneID:3259114"
                     /translation="MASAEIITKRLHIGGLKPEITTIHLKDRFSIFGTVKDVEELQPD
                     ALGNPRPFTFLTLETTPAQLRRCLNIMSGSHWRGALLRIAEAKPRFDVAINAANNSDP
                     GLKAKQIERKRKRVMLSRGEDVGKEAQDMIIVDVKRAEKKKFWVALNIENGDTKATRL
                     VRPVCMRAERPIGVVERKENSRRRARLPPARSFRKVINPIQWGSQMVLFSTEEQVARP
                     NQQEGEWEYEEFEEDDEKETAEDGKVPIGVWKKTVNGEVVQEEVVRGKRRRVEADGYD
                     IEVDLDLGSDDLPVAGSAASSPLFGTRHLAADREGSPLFPVHKNHLGSPVPTSSQESD
                     DEPQQPSSPLFSTRPAEGLEQEELSVSSSSFTSASGSPLQAPSPLFPTRTVPEEDQFL
                     TSPSPTPSSASPPIPDAIPVPAPKCLPAPPIPAVPAPLIQQVRTEKSAALNVLGSLLG
                     GLEGPASTRMEKLTINEWKGFLEDDSDDDSDGEDVEIGRGKKKEREKAPAEAEVIGEE
                     NFKVHEPMIEVFMVEGSGKPQDDAENPSSNEERSSSSDESSSNDDKMDVDPPTGNGDE
                     KQSSQEASSSSESGSSSSSGDDDEQDDDNGDSNGDSDDSDDSDDSDDSDDSDDSDSGN
                     SDSDSDSDSNDSDSDSDSDSDSDPSSDSESDDSDKSPSALYAKPQSSKPTTLKDLFAP
                     TAPSTSLFSGPSTSAAQSATGFSLLANLAEDLELDDELDIPLPVPGAIAAQKEEDELQ
                     PLSMMEGGRGKVKLDLENAAETPMFFAIPMDKETAERTKGKKGESRNPFNELYFGVPK
                     PLTKEMEEYDYDQEGYGPNGYGQEQGREEQEFPLMGFHRQPREGEAAMKGLWEKERGE
                     LTQAWKRRHREAKKQRRRKGGEDID"
     gene            1081164..1082816
                     /locus_tag="CNH00380"
                     /db_xref="GeneID:3258991"
     mRNA            join(1081164..1081281,1081385..1081642,1081692..1081709,
                     1081766..1082016,1082059..1082149,1082197..1082231,
                     1082281..1082471,1082528..1082816)
                     /locus_tag="CNH00380"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_024657625.1"
                     /db_xref="GeneID:3258991"
     CDS             join(1081405..1081642,1081692..1081709,1081766..1082016,
                     1082059..1082149,1082197..1082231,1082281..1082471,
                     1082528..1082711)
                     /locus_tag="CNH00380"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_024513306.1"
                     /db_xref="GeneID:3258991"
                     /translation="MVLTRRQAVSASSTPPPNMPETTPLLPKPGETCEDGERKTISYE
                     ESLMLLPWQTDNDYIRHGYRRATPSIRKCLWSAVSYLHNETVNIHSHSVGAVFFLSLL
                     PLHLIPTHFPTLNQSCSPLPTPPTLHDKVALALYLICAVLCLSLSSWFHTVSCHSKEV
                     CDAAHRGDYIGIVVLIVGSITPGMYYAFYENAFLQVFYMAGIIIAGIVSAYIVLSPHH
                     RSHRWHRTLTFIVLGLSAVVPITHILFTQGLVHAREKMSLDLIVAGGASYIFGALLYA
                     ARIPEKLSPGTFDYFGSSHQIFHCFVLAGAGFQYAALRGMVWGRAMAVGKTIAESEGL
                     L"
     gene            complement(1082777..1085792)
                     /locus_tag="CNH00370"
                     /db_xref="GeneID:3259150"
     mRNA            complement(join(1082777..1082984,1083036..1083894,
                     1083954..1085329,1085380..1085435,1085486..1085518,
                     1085578..1085792))
                     /locus_tag="CNH00370"
                     /product="beta-glucosidase, putative"
                     /transcript_id="XM_024657624.1"
                     /db_xref="GeneID:3259150"
     STS             1082810..1083787
                     /standard_name="Xba20"
                     /db_xref="UniSTS:470933"
     CDS             complement(join(1082836..1082984,1083036..1083894,
                     1083954..1085329,1085380..1085435,1085486..1085518,
                     1085578..1085696))
                     /locus_tag="CNH00370"
                     /codon_start=1
                     /product="beta-glucosidase, putative"
                     /protein_id="XP_024513305.1"
                     /db_xref="GeneID:3259150"
                     /translation="MPTNNTNLDRSFLTANIDDLLKQLTTEEKISLLAGKDWWTTVPI
                     PRLNIPSIKMTDGPGGARGDSFYHMTPACALPSATSLASTFSPDLIHSAGNLLALETL
                     ARNAVCLLAPTINIQRSPLGGRAFESFSEDPTLSGLIAAAYVAGLQEGGVSAAIKHFV
                     GNDQEHERMGEDSVIAPRALREIYLRPFQIALKKSKPQAFMTAYNKLNGTHCSENEWL
                     LEELLRKEWGFDGLVMSDWYGTYSISESINAGLNLEMPGATRWRPNGLVTHLIKAHKI
                     DPRQLDKVAGGVLRWVQKLVKKNEELVYSPPGKEKTRTEDQAEDAKLLRRLAGESIVL
                     LKNELNVLPIREPKKIAVIGPNAKAKVLTGGGSAQLRSAWSSTPWQGLSDNAPQGVEL
                     SYSLGCHSDKFLPILDDSFTCPDGSPGFQLSHFPITSSGDKAEEPVHVETWDSSDMFL
                     ADFTAPGLTKEYFTQLDAVWTPVEDGEYEFGVVVTGKGWFWINGELVIDASREDERST
                     SFFNLGTKEIKGRTRATKNKRYDIRFLHDTRPYSVNNINTPIASAGMRLGYIQVIPAS
                     TLLSNAVSLAASSDVALLVIGLNSGWESEGYDRPDLSLPMDTDKLVNAVAEANPNTIV
                     VIQAGSAVSMPWLDKVKGVVFAWYLGNETGNAIADIIYGYTNPSGRLPMTFPKRELDI
                     PANLNYKSARTRVYYDEGIWVGYKHFNARGIDPLFPFGHGLSYTTFAYSGLHISQVPE
                     SPKNVGADGWRVEVGVQVENIGMEEGAHTVMFWLSPPPESPNGLKHPKWTLQGFQKVY
                     GLKPGAKREIKVTFDKYAVSHWDELWNTWRAELGEWTVRVGLDAQNISGEKATFKIED
                     DLEWRGL"
     gene            1088719..1090933
                     /locus_tag="CNH00360"
                     /db_xref="GeneID:3259232"
     mRNA            join(1088719..1089489,1089722..1089829,1089876..1090238,
                     1090287..1090933)
                     /locus_tag="CNH00360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572228.1"
                     /db_xref="GeneID:3259232"
     CDS             join(1088747..1089489,1089722..1089829,1089876..1090238,
                     1090287..1090695)
                     /locus_tag="CNH00360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572228.1"
                     /db_xref="GeneID:3259232"
                     /translation="MASKSSSIHPYSPLAYPRRRTSLSVALNSHPLQPPYPYSYPSHR
                     RRAGTMPSQRTRRSRDTSTSLTRKTVIAFLVILSLVLLGTVIVLSTVSYYLAIPSWAY
                     LTETEVAWRAEDVIKPLLEQPRPKLSKRVQWGELDSDVLSYSSTGAAASASTISVDSA
                     TMTAETWDEFKEEMEELDAAEEVDEDNATQPESEAVDTDPTATSSIEEDNGQWGIDGM
                     GTGSYWMRNDWDGRVRDTDSWERLYNVTNRPGENIPRLIHQTWKDDQLPEKWRKAWKE
                     CREGMPDYEYMLWTDDLSREFIAKHYPAHLHMYDSYEFPIQRADSIRYFILHHFGGVY
                     MDLDIGCRRRLDPLLQGDWEVILPITKPVGISNDLIFSSKGSAFMDGTVHGLAAFNHK
                     YFSNYPTVMFSTGPMFLSAQYAIFSASHPLTESHPRSEIRVLPKSLYGKNAPISDVPH
                     SFFSHFYGSSWHADDAGFITFLGHWGKRLMWIGVVILICGAIRLIWVKRKAAAGHQYQ
                     LLSILPTTRSPSPSGYDTVEASKTCAGSIHVS"
     gene            1091709..1093226
                     /locus_tag="CNH00350"
                     /db_xref="GeneID:3259113"
     mRNA            join(1091709..1091841,1091901..1091946,1092092..1092142,
                     1092201..1092224,1092282..1092288,1092466..1092725,
                     1092804..1093226)
                     /locus_tag="CNH00350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657623.1"
                     /db_xref="GeneID:3259113"
     CDS             join(1091835..1091841,1091901..1091946,1092092..1092142,
                     1092201..1092224,1092282..1092288,1092466..1092567)
                     /locus_tag="CNH00350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513304.1"
                     /db_xref="GeneID:3259113"
                     /translation="MTRGDQRERDRAKALKAQAAKGTKLAGSPQQRREADAKAVAEKQ
                     ALKAKARAEAEARGELSAYDAKVEKRKQNAQQKK"
     gene            complement(1093473..1095920)
                     /locus_tag="CNH00340"
                     /db_xref="GeneID:3259082"
     mRNA            complement(join(1093473..1093752,1093809..1094783,
                     1094833..1095241,1095297..1095515,1095569..1095640,
                     1095701..1095767,1095840..1095920))
                     /locus_tag="CNH00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_572226.2"
                     /db_xref="GeneID:3259082"
     CDS             complement(join(1093624..1093752,1093809..1094783,
                     1094833..1095241,1095297..1095515,1095569..1095640,
                     1095701..1095767,1095840..1095861))
                     /locus_tag="CNH00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572226.1"
                     /db_xref="GeneID:3259082"
                     /translation="MVDTQYAFRAQKTAGVADAPAWEVSNRIPAETVGSKCYAYSPNG
                     EWLAYAMNNCVEIIPSHSSSPTPVTLQQANIVALKFSPMSSYLFTFERPVKTESGEMY
                     KNAKAWDVKNGEIVGGWYQKTMEDWEPIITPNETHLLRAGPSDLAIFSPPFAPRPSTR
                     LKIEGIRGIFISDPSALPATSTNSRPIPAYHEPAVAIWIGEKKGAPASLGLWSLSSLM
                     GKNALQANGNGDIQTETRDMPPTTARKAFYKADKLTVKWNNAGTMALFLAQSDVDNSG
                     KSYYGETNLYLVGLDGTFDGLVELDKEGPIYDFAWSPISREFTVCYGYMPARTQMFDL
                     KAKPVYSFGENPRNTLVYQPQGKLLLSAGFGNLAGGIDIWDVSTRNKVAEFKASNASH
                     CEWSPCGRYVLTATLSPRLRVDNGVKIWWCNGQLLHIQPVEELYQASFAPQRVTEIGS
                     FPAIVPKAPEANPSVAAYRPKGETDGVAAKPAGAYRPPGARNRPEGENASASFGSSRG
                     KPGVRTVPGAGGRQPPGSAPGASTGAGGDDKKKRQRKRGGKDKEEEKKDEAPTQEAVK
                     PEVKEEAGEDAVAKKIRNLMKKLKAIDELKTKLAAGEILEKTQLKKIESEAQVKSEIK
                     ALGGNV"
     gene            1096104..1097766
                     /locus_tag="CNH00330"
                     /db_xref="GeneID:3259362"
     mRNA            join(1096104..1096201,1096295..1096601,1096756..1096956,
                     1097020..1097336,1097401..1097766)
                     /locus_tag="CNH00330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572225.2"
                     /db_xref="GeneID:3259362"
     CDS             join(1096165..1096201,1096295..1096601,1096756..1096956,
                     1097020..1097336,1097401..1097612)
                     /locus_tag="CNH00330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572225.1"
                     /db_xref="GeneID:3259362"
                     /translation="MHQIGNSIKLLTGNAHPKLAEAVAARLGITLTPCHVSKFRSLET
                     SVQIHSSVRDEDVFIIQSPSPPDVNDHLMELLIMISACKTASAKRITAVIPCYPYARQ
                     DKKDKSRAPITSKLVANLLAVAGADHVITMDLHASQIQGFFDIPVDNLFSEPTMMQYI
                     KSEIPGWRDAIIVSPDAGGAKRATALADQLNLDFALINRKRRRDLAASMCLPTVPPTP
                     TGSDSGSVHSHDIDDESNIVEKMELLVGDVKGKVAILIDDMIDTGHTVRLAAGVLREN
                     GAKEVYALVSHGLLSDTTMENLSDLPVKKLIVTNSIDQTKRVIACNGLLETLDIAPVI
                     AESIRRTHNGESISALFRPHDSF"
     gene            complement(1097740..1099524)
                     /locus_tag="CNH00320"
                     /db_xref="GeneID:3258999"
     mRNA            complement(join(1097740..1097859,1097908..1097985,
                     1098054..1098213,1098318..1098425,1098499..1098533,
                     1098588..1098601,1098659..1098725,1098776..1098790,
                     1098853..1098895,1098945..1098967,1099071..1099524))
                     /locus_tag="CNH00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657622.1"
                     /db_xref="GeneID:3258999"
     CDS             complement(join(1097831..1097859,1097908..1097985,
                     1098054..1098213,1098318..1098425,1098499..1098533,
                     1098588..1098601,1098659..1098725,1098776..1098790,
                     1098853..1098895,1098945..1098967,1099071..1099356))
                     /locus_tag="CNH00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513303.1"
                     /db_xref="GeneID:3258999"
                     /translation="MNFIQWSGQCIAVRKQAGAVLALPPLSFQAHVMHGPPRLIARRM
                     PSKDEALKSSSLASSTLSSCDFYRFNLFTAGQQPKKNMSKRGLSMEEKKTKMLEIFHE
                     SAEFYSLKELEKIAPKSKGIVVQSVKEVLDDLVSDGFVVMDKIGTGNYFWALPSAAGA
                     TKNTALVKATKELEKIDAGISETQAGLVEAEKGREDTEERRTLLAALQQEEQTSIKLK
                     AELAAFGAADPVRYQKKREAVKVCKDAAVTWTDNTLMLLQYAVSLGVEAAAIRGMLGI
                     TEEWEDLKL"
     gene            complement(1099819..1099913)
                     /locus_tag="CNH00310"
                     /db_xref="GeneID:3259260"
     tRNA            complement(1099819..1099913)
                     /locus_tag="CNH00310"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:3259260"
     gene            1100040..1101585
                     /locus_tag="CNH00300"
                     /db_xref="GeneID:3259248"
     mRNA            join(1100040..1100421,1100483..1100732,1100791..1101067,
                     1101125..1101244,1101299..1101585)
                     /locus_tag="CNH00300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572223.2"
                     /db_xref="GeneID:3259248"
     CDS             join(1100089..1100421,1100483..1100732,1100791..1101067,
                     1101125..1101244,1101299..1101335)
                     /locus_tag="CNH00300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572223.1"
                     /db_xref="GeneID:3259248"
                     /translation="MPPRKSKSRDVKSTAPSPSPSIGQRRSSRAPRKEPAPAVEVVEE
                     KDEVSSESEEVDAAEGLETRETDAGEAEQDEQVQEVAEKEHVKSNKGKEKMSMAERMA
                     KIKELRMKMNQSAAQNRRDLVEDHQKAQVTAKELARLEKQRKLAQTLRLKAEAEENGE
                     DIERKKNWEWTIEDNERWQAKLEEQKVKQDTHFHNAEDDAYKKYNRNLRATKADLVAY
                     ERQKEAALGLAPGTLVPARATSSSLAASSSKPGLTGAEDLYRGADTLVYGDNKPSEDA
                     VDRVISKINKDIGKKKRTKKDDEDGEINYINERNKVFNKKISRYFDKYTKEIRANFER
                     GTAL"
     gene            complement(1101427..1103804)
                     /locus_tag="CNH00290"
                     /db_xref="GeneID:3259255"
     mRNA            complement(join(1101427..1101763,1101826..1102206,
                     1102260..1102341,1102396..1102522,1102574..1102662,
                     1102713..1102859,1102908..1103006,1103064..1103137,
                     1103204..1103309,1103390..1103444,1103510..1103804))
                     /locus_tag="CNH00290"
                     /product="cyclin-dependent protein kinase, putative"
                     /transcript_id="XM_572222.2"
                     /db_xref="GeneID:3259255"
     CDS             complement(join(1101633..1101763,1101826..1102206,
                     1102260..1102341,1102396..1102522,1102574..1102662,
                     1102713..1102859,1102908..1103006,1103064..1103137,
                     1103204..1103309,1103390..1103444,1103510..1103511))
                     /locus_tag="CNH00290"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase, putative"
                     /protein_id="XP_572222.1"
                     /db_xref="GeneID:3259255"
                     /translation="MNYVQLEKLGEGTYATVYKGRSRTTSEIVALKEIHLDAEEGTPS
                     TAIREISLMKELKHVNIVRLHDVVHTESKLVLIFEYCEQDLKRYMDIHGDRGALDLNT
                     VKSFTHQLLQGIAFCHDHRVLHRDLKPQNLLINKRGELKIGDFGLARAFGVPVNTFSN
                     EVVTLWYRAPDVLLGSRTYSTSIDIWSVGCIFAEMITGYPLFRGRDNADQLVQIMKIV
                     GTPSDATIAQIKLNSPEIQIKSPLAKHAKQPFQAIIPRAPRDAISLLEHLLQFEPTRR
                     YDAHQAMAHQYFTSGPIAPPTLHENNPAVSSASSLALPPRVAARASQASAAVQAQQAA
                     QAQAQAQAQAQAQAQAAQNAQMMAQQQQQQQQQQQQQQQYEMMMGQQNMQGYYDPQAA
                     AQMQAHQQAQAQAHAAQMQQMAQQGYYMNPNGQHGHHH"
     gene            complement(1104160..1105270)
                     /locus_tag="CNH00285"
                     /db_xref="GeneID:36392976"
     mRNA            complement(join(1104160..1104708,1104773..1104949,
                     1105002..1105270))
                     /locus_tag="CNH00285"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658716.1"
                     /db_xref="GeneID:36392976"
     CDS             complement(join(1104271..1104708,1104773..1104949,
                     1105002..1105232))
                     /locus_tag="CNH00285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514629.1"
                     /db_xref="GeneID:36392976"
                     /translation="MIEPVVDPSLREPPIAGSSRGKRKAKGGSSSGNAASTSRRGRGR
                     PRRARGSDDGVRGVSSTDGQTPNVQDAYNAESSKRLRIASPFKLHAAIQGRKDTLYGS
                     GSSVAGPSRKSSRSGATGMESLASVAVAHDPRRNSSYNRPPYPFGLTPFRYPCHNLDL
                     PPPPPGNPNDPNFRPFDPRAFHEEGAASTLSSNGTTSKSTPIHTPVDPSSSGPSRQYA
                     SATHHHYPARPHHYTGGYRASQAELEANAHAAYESISALLSASQYPVMDELGDNERYG
                     PEQGA"
     gene            complement(1105437..1108223)
                     /locus_tag="CNH00280"
                     /db_xref="GeneID:3259037"
     mRNA            complement(join(1105437..1105661,1105720..1106497,
                     1106547..1106668,1106730..1106914,1106966..1107093,
                     1107143..1107621,1107667..1108223))
                     /locus_tag="CNH00280"
                     /product="ATP dependent RNA helicase, putative"
                     /transcript_id="XM_572221.2"
                     /db_xref="GeneID:3259037"
     CDS             complement(join(1105537..1105661,1105720..1106497,
                     1106547..1106668,1106730..1106914,1106966..1107093,
                     1107143..1107621,1107667..1108168))
                     /locus_tag="CNH00280"
                     /codon_start=1
                     /product="ATP dependent RNA helicase, putative"
                     /protein_id="XP_572221.1"
                     /db_xref="GeneID:3259037"
                     /translation="MAKIDKKTKLKLNKKSVRAPSKPTTEKKPKKYVTADTLTWKPVK
                     TSSFSGIDGGGGMMMLEELEDVGIEWEETDGGRKIAKFVEVESKTSKGKKNAAQEEPN
                     QEGRGDDEKASSASETEEGKKADDKEAVEEDDEEEFPDFAGFAEEDLNAADEEEHPNL
                     DDEPAFNDDLLPEWSSISLHPSLKRSFLASSFTAPTAIQSRAIPAGITGRDVVGVAET
                     GSGKTLAYSLPILHYLLGQRKSKAGIKRPLSALVLCPTRELALQVMDHLNALLKHALA
                     TPDGEKPQGPPRVSVGSVVGGLSAQKQKRILERGCDVIVATPGRLWDLIKADDELATS
                     VRTLRFLVIDEADRMIENGHFAELESIVKLTQRSTAQQGPDDDDPVFQAMATLFEEST
                     AREDMQTFVFSATLSKDLQKNLKRRSRSWKGKGKRSSTLEDLVEKLDFRDENPEVIDL
                     SPEGGVVSSLRESMIESTKDDKDLYLYYFLLRYPGRSIVFVNSIDSIRRLLPLFTLLQ
                     LPVFPLHSHLQQKQRLKNLDRFKSNPKGILIATDVAARGLDIPQVDHVVHFNLPRTAD
                     AYIHRSGRTARAQNEGFALQLVSPDEKSVQRALMKSLERTHELPDLPIEAGFLPSLRE
                     RLRVATEIEKAQHRATKATHDKNWLLEAAEAMDIDIDPSMLDGEDDDPDAPYYKPKKQ
                     DRGKGKASVENLKMELKALLQEKLVARGVSIRYPTSGSKVIVDDLIKSTGHGMLLGAS
                     TSKAYDQVEKTGKRKLGSGRPGAVKKKKVEGR"
     gene            1108361..1109888
                     /locus_tag="CNH00270"
                     /db_xref="GeneID:3259004"
     mRNA            join(1108361..1108557,1108608..1108756,1108812..1108889,
                     1108944..1109104,1109160..1109274,1109333..1109647,
                     1109698..1109888)
                     /locus_tag="CNH00270"
                     /product="DNA repair-related protein, putative"
                     /transcript_id="XM_572220.2"
                     /db_xref="GeneID:3259004"
     CDS             join(1108410..1108557,1108608..1108756,1108812..1108889,
                     1108944..1109104,1109160..1109274,1109333..1109647,
                     1109698..1109790)
                     /locus_tag="CNH00270"
                     /codon_start=1
                     /product="DNA repair-related protein, putative"
                     /protein_id="XP_572220.1"
                     /db_xref="GeneID:3259004"
                     /translation="MSRDAITNAAGTVESTLLHQVFIQSLLSRRVVSEAIALELYKRA
                     VTAVRAYDRQFNPPYAISGHGVASFVTDVSTLLHSVSLEVIRTIDQRSDRAFFVLRNL
                     DASEVASFATDLNSMEVEYLRNLIESIVVSYPANSLAIGQARDVINDSPLTQHKMTKS
                     HAESLLDALVSRGWLYKSKRTRFSLGVRALAELETYLKNEFDQYVKSCAQCRRVVTEG
                     LACSNVGCDCHIHNTCYARNIQQLANPVCPSCSSSFRDLAPKPVGEKAVSIMEDNFKG
                     GRKRKGKGKNVGDMDDEGEEEEGGSSEAEDELDERRESQSQTQNQGSIRRSYVPETQY
                     DEEPSTGSAGPSKRIRRG"
     gene            complement(1109857..1112181)
                     /locus_tag="CNH00260"
                     /db_xref="GeneID:3259010"
     mRNA            complement(join(1109857..1110854,1110904..1111151,
                     1111208..1112063,1112114..1112181))
                     /locus_tag="CNH00260"
                     /product="expressed protein"
                     /transcript_id="XM_024657621.1"
                     /db_xref="GeneID:3259010"
     CDS             complement(join(1110074..1110854,1110904..1111151,
                     1111208..1111291))
                     /locus_tag="CNH00260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513302.1"
                     /db_xref="GeneID:3259010"
                     /translation="MSDTDRPSRVWLFLANLSLCLCSVREDDSERQALYPPDTVLSAP
                     RPRLRPRLSNLSPYGSTTSRRWPSASTSPIKSGGLAGFTGIESNVDAETRREEGKRKM
                     DSISKAFAERMTALDLPPHIHTLNMPFTPSLQPLTTAVSHPTLPTIHTIRPLGSPNRP
                     SAPHLGRSISEPRSLHDLGGFAAHHVPFGSSVVVHGRGISPGVSRGRGRMRSATIGER
                     WTVPGEGTRGRKGLERRSPSGLNKESIDSDEVEQEAKMERSASPSLNLSFGRPVLRSC
                     SNSQSHSCTRRRQSSPLAGHPDQQEPLSMGSCWIDPESHLHSSSRAHSDVRAQEVIHR
                     DLGLNALYSGSAASHPKRIKGKGKGKKTRRMRLSSS"
     gene            1112466..1115517
                     /locus_tag="CNH00250"
                     /pseudo
                     /db_xref="GeneID:3259052"
     mRNA            join(1112466..1114220,1114277..1114957,1115019..1115517)
                     /locus_tag="CNH00250"
                     /pseudo
                     /db_xref="GeneID:3259052"
     gene            complement(1112492..1115481)
                     /locus_tag="CNH00240"
                     /pseudo
                     /db_xref="GeneID:3259041"
     gene            1116610..1117904
                     /locus_tag="CNH00235"
                     /db_xref="GeneID:36392975"
     mRNA            join(1116610..1116850,1116910..1117904)
                     /locus_tag="CNH00235"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658717.1"
                     /db_xref="GeneID:36392975"
     CDS             join(1116662..1116850,1116910..1117581)
                     /locus_tag="CNH00235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514630.1"
                     /db_xref="GeneID:36392975"
                     /translation="MDGEPPSKNGGTFLRLPSRGQLLHALTLTQNTSAMVFTIFLVPH
                     LASPVVAAFAGLDGAEKTMMIARDLYIPLEPILVYIPLTIHLLSSLSRRLLLSTSTSL
                     PKSIRFPTLPHQTLAYPLVFLLIPHIITHRLIPSSSAPPIRELSPSELGWEFVGYNLR
                     SWGAWIAYLGLVGAGAWHALVGGMKVATWLKSLRRRPARGGPSNILSTKRKIYPDDGE
                     KSGSDPAPRVIAKPRKLGLRGLIVVLLGVVSFGLARVTSDTGLVSGMMKRRYDAVFNA
                     TPWAKLYRLF"
     gene            complement(1119377..1121676)
                     /locus_tag="CNH00230"
                     /db_xref="GeneID:3259007"
     mRNA            complement(join(1119377..1119892,1119963..1120236,
                     1120298..1120584,1120642..1121450,1121500..1121676))
                     /locus_tag="CNH00230"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657620.1"
                     /db_xref="GeneID:3259007"
     CDS             complement(join(1119783..1119892,1119963..1120236,
                     1120298..1120584,1120642..1120663))
                     /locus_tag="CNH00230"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513301.1"
                     /db_xref="GeneID:3259007"
                     /translation="MTSSMPIPDGVSEGSYIGTFIGESIPVVKCETNDLLVPATSEIV
                     FEGFLSVTETAPEGPFGEMHGYVFQGNSRDSPVYKVNCITHRDDAILPMSACGRLTDE
                     TQTLIGSLHAVEIGEICRDAGLLVTECFSPFKYQVTWIALQLDGKKLTEMKTTSEELR
                     KKVGDLVFNTKAGSTTHRIVLVGDDIDVYDGTDVLLAFSTQCCPNMDETFFEDVPGFA
                     LIPYMGHGNGNP"
     gene            1121871..1125451
                     /locus_tag="CNH00220"
                     /db_xref="GeneID:3259328"
     mRNA            join(1121871..1121999,1122101..1122123,1122254..1122386,
                     1122436..1122511,1122562..1123868,1123916..1124347,
                     1124405..1124866,1124937..1125451)
                     /locus_tag="CNH00220"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_572216.2"
                     /db_xref="GeneID:3259328"
     CDS             join(1121965..1121999,1122101..1122123,1122254..1122386,
                     1122436..1122511,1122562..1123868,1123916..1124347,
                     1124405..1124866,1124937..1124970)
                     /locus_tag="CNH00220"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_572216.1"
                     /db_xref="GeneID:3259328"
                     /translation="MVAFTATGNRNLTRKIRVTIVAADSLIKRDILRLPDPFAIVSVD
                     SEQIHTTSVIKRTLNPYWNENFDIDVKDSSIVAVQIFDQRKFKRKQDQGFLGVINIKV
                     SDVIDLELGGQEMLTKELKKGSDGQAVQGKLIVYLSTQTNAPISNNPAASSSTNVATP
                     APAASALASNNAAGQSISRPASAIQPAQGAEASVPTSADAIASAVPQPAAQAVGVSSS
                     GAPNVNPTIQAASTGQTGTSTNVGHEFDSHSDQYGPLPVGWERRIDHLGRQYYVDHNT
                     RTTTWNRPSDNELSNSATQATSTGEARARHNQRTLPDEMLDVQQSGANSGGATTPTTG
                     SAQANPVNASNATTAGQGPLPSGWEQRFTPEGRPYFVDHNTRTTTWVDPRRQQLLRFI
                     APGQQGNLSVQPQTVSQLGPLPSGWEMRLTSTARVYFVDHNTKTTTWDDPRLPSSLDQ
                     NVPQYKRDFRRKLIYFRSQPALRSNTGQCHMKVSRDNIFEGSYTEIMRQTPNDLKKRL
                     MIKFEGEDGLDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPNSGVNPEHL
                     NYFKFIGRVVGLGIFHRRFLDAYFIVSFYKMILGKKIALQDLESVDAGLFRGLTWMLE
                     NDITGVIEDTFSITEEHFGEVVTVDLKPGGRDVEVTEDNKKDYVDLVTEYRISKRVSE
                     QFQAFMSGFNELIPQELINVFDERELELLIGGMSEIDVDDWQKHTDYRGYNPSDEVVE
                     WFWKIVKNWPAEKKSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVTQLPKS
                     HTCFNRIDLPAYKSYEALEQKLTIAVEETVGFGQE"
     gene            complement(1125424..1126783)
                     /locus_tag="CNH00210"
                     /db_xref="GeneID:3259301"
     mRNA            complement(join(1125424..1126207,1126297..1126363,
                     1126447..1126783))
                     /locus_tag="CNH00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657619.1"
                     /db_xref="GeneID:3259301"
     CDS             complement(join(1125732..1126207,1126297..1126363,
                     1126447..1126731))
                     /locus_tag="CNH00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513300.1"
                     /db_xref="GeneID:3259301"
                     /translation="MADKSKTERPSWNKEEYATKAKEKDKEAYEHAKATEESLAKGHA
                     PKKQSQYDDLPKPTELLKARTEDLGLTKNLNKTMLVTTTTTGKGPRGAGFYCELCNRT
                     FKDSLAYLDHINGRLHLLKLGQSTHVERSTLSQVRAKIASLRAATHQKVTAQNFDFQS
                     RLKAVKNAQEAERERRKDERRRKKMEREKREERRRMGILDDDEGNRDESGEKMDVDGA
                     EKDVKDGKKDKRQERKEKREQQVKDQQRDREVEKAIRENEDMSTMMGFGGFGTSKRK"
     gene            1126910..1131838
                     /locus_tag="CNH00200"
                     /old_locus_tag="CNH00190"
                     /db_xref="GeneID:3259299"
     mRNA            join(1126910..1127179,1127241..1127848,1127897..1128000,
                     1128050..1128291,1128344..1128509,1128576..1128745,
                     1128822..1129023,1129084..1129357,1129423..1129766,
                     1129856..1129947,1130023..1130208,1130278..1130477,
                     1130561..1130645,1130709..1131022,1131102..1131169,
                     1131242..1131348,1131429..1131838)
                     /locus_tag="CNH00200"
                     /old_locus_tag="CNH00190"
                     /product="expressed protein"
                     /transcript_id="XM_024657618.1"
                     /db_xref="GeneID:3259299"
     CDS             join(1126936..1127179,1127241..1127848,1127897..1128000,
                     1128050..1128291,1128344..1128509,1128576..1128745,
                     1128822..1129023,1129084..1129357,1129423..1129766,
                     1129856..1129947,1130023..1130208,1130278..1130477,
                     1130561..1130645,1130709..1131022,1131102..1131169,
                     1131242..1131348,1131429..1131754)
                     /locus_tag="CNH00200"
                     /old_locus_tag="CNH00190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513417.1"
                     /db_xref="GeneID:3259299"
                     /translation="MFNSPSTRRVQTPRRQQAQQPSSRLQALRVTKSPAPSNAETIRT
                     ERPVDEKEKVFWSKDERHSTTSLGKFPGEVAALIKASDLVVDPVTGQVDSRTGFALVS
                     SPRACIAWNYSKRTHSAPTTYAFPAPLPTSSPSRFPPPVLSALCTSTSEPGMILMSST
                     GEIRYWESMSLALSNVERYQQLFLDLPQGDWIERLVKVDGNNFILTTTSSQAYRLSIT
                     SSAGRLSPVVTPLMRPGGMFGRASPVIFGGKHDRFGIRSVASNGAEVYLMAQRSIQKW
                     SFTSDGQKLVQEYDIYEAIGRELFKNWSSIDISIDLEDVVALDSDSLAVLITYSDSTS
                     PPSHALVLLSVHRSNPPIVNRTISISFTSGQDQRLLDIPRLVIPPGSTMAFVRFGSAV
                     MMVSLDFDAPYEEALTLKDPNNAYIGAGPVTSNSNSPTMVLIPAEGGLMNVEALEPRA
                     SPDSLNQLSTATARLKSKLEQAIFFGQRSDNPLSFELEEDVRGQGDVAEAAELVSGEV
                     VAARSPYTPTIYELRPHLLDRLDRLKALVKYIRTNGLMNQLPQATRRRLSGDGEKVRG
                     ALELWDYQNRLMDQSSGPGPSQAKSLLSISIQVYFSSRHRFLAPSSSPTDEREQDLVR
                     LFFRTEVSNLDKLLTVVFGEFRDKQKGEVDVSERAGWVGEVNQIFIAVERAAAQYREE
                     ESDLYAIDREKPAIEMWTASDSLIDSLDHLYTLTEALIKERTRELGSVIDEAHVAGGP
                     TSRIEAGREELRKEQVVQATLKRQMGWLAAALCTNMEDKCRVVVRRQMDDGADEQEGI
                     MLKAKWDAMKPRVIRPLVSVDRISEAYELAEHHHDFPTLVMLCNDPVAGQGKGDSRIQ
                     VYIEKFGEDFAFELYRWYIDQGQLHALLTQDEVYGSLVTRFFETHHYPELGWIHHIAC
                     KRYGEAAGALTQVLDEGEGKEESGELDFRKVVGSIAKLASMTDISLRGPSEARDQIFQ
                     KIGQQLSLIDIQSSLRTYLLSLFPSTARSSRSIAKHFAPILTRLSHRPGSESGSAFLA
                     LFYNLAERVIGGEAVDLEGMLDLLTLKDNVGREDDGVDALRVLVLDRSLPKARSEVAL
                     LAVWRRIYIRDDWAEISNTVGRSEQAQRTKLKTTMIYRVLKALHSMPEFPQAAVISPY
                     DTSIPPTTAELSARFPSLSSEDIAALKADYDDEVAVLMEYVEKDALEERVKEVKGMIE
                     REWEEEQGREINEAIGAQAESEVVVVEAEDVEADEDVEM"
     gene            complement(1131695..1134219)
                     /locus_tag="CNH00180"
                     /db_xref="GeneID:3259027"
     mRNA            complement(join(1131695..1131958,1132070..1132876,
                     1132965..1133297,1133349..1133430,1133501..1133756,
                     1133808..1133811,1133861..1134219))
                     /locus_tag="CNH00180"
                     /product="SD08430p, putative"
                     /transcript_id="XM_572213.2"
                     /db_xref="GeneID:3259027"
     CDS             complement(join(1131918..1131958,1132070..1132876,
                     1132965..1133297,1133349..1133430,1133501..1133756,
                     1133808..1133811,1133861..1134161))
                     /locus_tag="CNH00180"
                     /codon_start=1
                     /product="SD08430p, putative"
                     /protein_id="XP_572213.2"
                     /db_xref="GeneID:3259027"
                     /translation="MTVRDPSKRAHTATTTARDSMIHRENNTVRPRNVEDITELEEKG
                     LLRRVDDDSPGPSPARRRGKGKEKETRLEKAPVEEEYSTGLTTRRDKEAFALLVLLYL
                     LQGIPLGLTFGTLPFLLKSHLSYSQLAIFALSTWPYSLKLLWSPIVDAWFVKKWGRRK
                     SWIVPVQGLVGLGMWVIGGKIEEWLNVETVDVKFLTAVFGSLILAAATQDIAVDGWAL
                     TLLSQPNLSYASTAQTIGIGIGNALSFTVFLAFNSIDFSNKYFRSPSRPLDYPLVSLG
                     GYMKFWAVVFVGVTVGLAVLKKEDPPSEDDPDMDVKKVYKVMWSIVRLKNIQTFLFVH
                     LICKIGFQVNDSVTSLKLLEKGLSKEDLAVAVLLDFPAQMAVGWLAAKWSRPAPSSSS
                     SSHPLTAGRGAGAGESGNVLKPWLYAFWARLAMAAISTLVVAGFPSNRASSVGTTYFL
                     LIIATTLFSSLTSTVQFVGICAFHTQIADPLIGGTYMTLLNTVSNLGGTWPKPLILRS
                     VDMLTVATCSVSSSSTTTSLRSKLSLSSSASGLGECVTEHGKNLCAQAGGECVMQRDG
                     YYIMSAVCVTLGAGLLVVFILPMVKRLAALPMSAWRVKIPN"
     gene            1134441..1135780
                     /locus_tag="CNH00170"
                     /db_xref="GeneID:3259187"
     mRNA            join(1134441..1134910,1134981..1135189,1135249..1135322,
                     1135391..1135780)
                     /locus_tag="CNH00170"
                     /product="phosphomannomutase, putative"
                     /transcript_id="XM_572212.2"
                     /db_xref="GeneID:3259187"
     CDS             join(1134501..1134910,1134981..1135189,1135249..1135322,
                     1135391..1135513)
                     /locus_tag="CNH00170"
                     /codon_start=1
                     /product="phosphomannomutase, putative"
                     /protein_id="XP_572212.1"
                     /db_xref="GeneID:3259187"
                     /translation="MSAPQPASATIFPPGVTPFAQRRLPKTICMFDVDGTLSLARQSA
                     TPEMFATLRKLRESCAIAFVGGSDLTKILEQVGGDQGLSNFDYGFAENGLIAYKLGQQ
                     LESASFIKHVGEEEYKKLVNWILRYLSEVDIPIKRGTFVEFRNGMINVSPIGRNASIQ
                     ERIDFEKYDKEHGIRGDMVAKLEREFLHLGLTFAIGGQISFDIFPKGWDKTYSLRHIE
                     GEGFEEIHFFGDKTYKGGNDYEIFSDPRTIGHTVTSPEHTMQLLDELFLTTAP"
     gene            1136144..1137985
                     /locus_tag="CNH00160"
                     /db_xref="GeneID:3259142"
     mRNA            join(1136144..1136311,1136374..1136910,1136998..1137293,
                     1137486..1137985)
                     /locus_tag="CNH00160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572211.1"
                     /db_xref="GeneID:3259142"
     CDS             join(1136169..1136311,1136374..1136910,1136998..1137293,
                     1137486..1137667)
                     /locus_tag="CNH00160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572211.1"
                     /db_xref="GeneID:3259142"
                     /translation="MHYTIAFSDNENNIDNDNDNDNGRTTPESELNELSDGEYERERL
                     ENIKHRDALLSSLGLDVPKKPHHLYPQQQQQQPQMEGSAGQLAEKTRMSREDAKKRKV
                     AKEREKELRRVEPVRKSRRVAERAGKDKDGKGTGDDDDQNPLSSSRKPSNSINRYMDP
                     LPKATRPTLPPGPEYSSGQIENEKQPRPLKGDGGRLVFEGRWRGVFTPNVTPEEMFGG
                     GAFGGSFFRDTYSGLLRTPLSSDAALASLPFPPPFPGSDINTIAPNLLTSRIPKPSVN
                     RFQVLAGQSLEEWEKAGWIWPGDPRGWAEWYVRFWDGRRCEDDERQVRRWLNVAGPTG
                     RFKRALLKKIQKAGGQVAVGDEDVGRVLRQCLWQWGYELTEREYEEAMGGP"
     gene            1139882..1145660
                     /locus_tag="CNH00150"
                     /db_xref="GeneID:3259193"
     mRNA            join(1139882..1140227,1140592..1140818,1140967..1141446,
                     1141496..1144544,1144600..1144853,1144901..1144960,
                     1145009..1145660)
                     /locus_tag="CNH00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657617.1"
                     /db_xref="GeneID:3259193"
     mRNA            join(1140410..1140818,1140967..1141446,1141496..1144544,
                     1144600..1144853,1144901..1144960,1145009..1145660)
                     /locus_tag="CNH00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658718.1"
                     /db_xref="GeneID:3259193"
     CDS             join(1141078..1141446,1141496..1144544,1144600..1144853,
                     1144901..1144960,1145009..1145467)
                     /locus_tag="CNH00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513299.1"
                     /db_xref="GeneID:3259193"
                     /translation="MARPIRPAPGPTTPSAGPSTSLRTSARTHRQSASTSVTSTSTSA
                     LTPGPSTPASDGTGARNVSARRAPAVEAKTHGLRSTGSSVERTPCPFPAQFGGRANCG
                     IAEEDEADEVLMGILSAIAFYDNRALSVEEIALTCFQQGWLRPPSAAIEPTTPINNAI
                     RSYIKRCEKAKRHCLLAKYQLAGSVVESVLEVALHPDAFNGSTRPRGAVWFLLSGSGA
                     GSGKAKWKSPFEGLEIPKMPPRKPAPKKQKENKRVDEKKQAVREKSKDKALAPVKIRL
                     VLAGGNGEEESQSEKSRSRSVSVSKDSIISEVKVEPVSKHEGTAPRRYDSSSDSDTSD
                     SDIEIDSSSRLQSSRPMRKGPPPPLVMNGSPRVFGSSRLSQQPPFVDLFFPSPAINTF
                     APPHTSPFPSHSLDNTTWTARYDHNQRHLDYSSSSEEDEVVDLEWGVASDVIIRDSVE
                     DETKAAWSLEDEAKVKEATDALRVLFPLEEPEEDIGLGKGFELIQSESRPTGTDSPSI
                     SEPGSIATSATARNSFRNKLKAIDAGGLPLNDWVVNSSPIPSPNVRPFKAFHQAPPVD
                     FSPTQHFSKLRGSFDPDENMDVDDEPWLDETGELPVKAEDTFSDVDLNSTIDEIASPE
                     HDRRLHTALWAQEAAATIRVKAEPEDFPTPSSIEDEPMQSSRASSTPSYGPSDGPDYD
                     DIGMESVADEKILGPESVSVEELDGWLPTVKTERTPHRGRPRKGGKDKSDGQKLGCWG
                     GIGVCSSGKRATRSHTATSTATRRRKSKSCFERLTPVSDSGSGLATAAGGEDENEVDD
                     AIGTEDLEKARVEADAREEEHRKACKEKAERHRVMLEAYRQTVRAELSDTDITPSPWE
                     APSSATPWGSSSTDSLQLPTPGALSPMVLHSVSNSSLATPGEGQHMMSVDPKALVSPP
                     LQSVFGQGISGKRDLGMGLGVGMLDAALTQQEVDDIMGTSSASTTAPYSTSATTPATP
                     STSTASALAPALQRPATSSPISGSAPSSSVLALQPTPVPVISASAPNEKGIAIVALPT
                     TLSDSAQASSTLVTASTASGQPVHVPKPIAKNTKPIPSSATPSRSSTPSTASSGSGSS
                     RSGGKIATITKPLCPGVDACVVDNIPVYAHLFEGRNGSGKQVLLRRLDTDFVNANALL
                     HALGVSPSKHSEYLDHPISQARLAARHIVQSSTSGMEYSNGVSGIWVHLSEAREFARR
                     AKLAGGSLLASVLREDLFQLFATLAQIKPDHPPSESFGLPFVPRRQTPPTSTMSTNSK
                     STPNLPSLSTTASAPAANHIRSAPSGLSAPINGLKGPLVRTAPATPPDGCPQSKRRRA
                     TISSPLTKKSGVAMGSVALAPAPASAEVGEGAKTGVAVGAGPGAGVPKPTHTTVTAAQ
                     KRATRASFGGLPVKPASG"
     CDS             join(1141078..1141446,1141496..1144544,1144600..1144853,
                     1144901..1144960,1145009..1145467)
                     /locus_tag="CNH00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514631.1"
                     /db_xref="GeneID:3259193"
                     /translation="MARPIRPAPGPTTPSAGPSTSLRTSARTHRQSASTSVTSTSTSA
                     LTPGPSTPASDGTGARNVSARRAPAVEAKTHGLRSTGSSVERTPCPFPAQFGGRANCG
                     IAEEDEADEVLMGILSAIAFYDNRALSVEEIALTCFQQGWLRPPSAAIEPTTPINNAI
                     RSYIKRCEKAKRHCLLAKYQLAGSVVESVLEVALHPDAFNGSTRPRGAVWFLLSGSGA
                     GSGKAKWKSPFEGLEIPKMPPRKPAPKKQKENKRVDEKKQAVREKSKDKALAPVKIRL
                     VLAGGNGEEESQSEKSRSRSVSVSKDSIISEVKVEPVSKHEGTAPRRYDSSSDSDTSD
                     SDIEIDSSSRLQSSRPMRKGPPPPLVMNGSPRVFGSSRLSQQPPFVDLFFPSPAINTF
                     APPHTSPFPSHSLDNTTWTARYDHNQRHLDYSSSSEEDEVVDLEWGVASDVIIRDSVE
                     DETKAAWSLEDEAKVKEATDALRVLFPLEEPEEDIGLGKGFELIQSESRPTGTDSPSI
                     SEPGSIATSATARNSFRNKLKAIDAGGLPLNDWVVNSSPIPSPNVRPFKAFHQAPPVD
                     FSPTQHFSKLRGSFDPDENMDVDDEPWLDETGELPVKAEDTFSDVDLNSTIDEIASPE
                     HDRRLHTALWAQEAAATIRVKAEPEDFPTPSSIEDEPMQSSRASSTPSYGPSDGPDYD
                     DIGMESVADEKILGPESVSVEELDGWLPTVKTERTPHRGRPRKGGKDKSDGQKLGCWG
                     GIGVCSSGKRATRSHTATSTATRRRKSKSCFERLTPVSDSGSGLATAAGGEDENEVDD
                     AIGTEDLEKARVEADAREEEHRKACKEKAERHRVMLEAYRQTVRAELSDTDITPSPWE
                     APSSATPWGSSSTDSLQLPTPGALSPMVLHSVSNSSLATPGEGQHMMSVDPKALVSPP
                     LQSVFGQGISGKRDLGMGLGVGMLDAALTQQEVDDIMGTSSASTTAPYSTSATTPATP
                     STSTASALAPALQRPATSSPISGSAPSSSVLALQPTPVPVISASAPNEKGIAIVALPT
                     TLSDSAQASSTLVTASTASGQPVHVPKPIAKNTKPIPSSATPSRSSTPSTASSGSGSS
                     RSGGKIATITKPLCPGVDACVVDNIPVYAHLFEGRNGSGKQVLLRRLDTDFVNANALL
                     HALGVSPSKHSEYLDHPISQARLAARHIVQSSTSGMEYSNGVSGIWVHLSEAREFARR
                     AKLAGGSLLASVLREDLFQLFATLAQIKPDHPPSESFGLPFVPRRQTPPTSTMSTNSK
                     STPNLPSLSTTASAPAANHIRSAPSGLSAPINGLKGPLVRTAPATPPDGCPQSKRRRA
                     TISSPLTKKSGVAMGSVALAPAPASAEVGEGAKTGVAVGAGPGAGVPKPTHTTVTAAQ
                     KRATRASFGGLPVKPASG"
     gene            1146000..1147904
                     /locus_tag="CNH00140"
                     /db_xref="GeneID:3259243"
     mRNA            join(1146000..1146103,1146166..1146236,1146295..1146689,
                     1146897..1147904)
                     /locus_tag="CNH00140"
                     /product="Rho small monomeric GTPase, putative"
                     /transcript_id="XM_572208.1"
                     /db_xref="GeneID:3259243"
     CDS             join(1146057..1146103,1146166..1146236,1146295..1146689,
                     1146897..1146965)
                     /locus_tag="CNH00140"
                     /codon_start=1
                     /product="Rho small monomeric GTPase, putative"
                     /protein_id="XP_572208.1"
                     /db_xref="GeneID:3259243"
                     /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVSV
                     TIGDDPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEIA
                     HHCPGVPALIVGTQVDLRDDPAQTEKLGRQRMKPITQDMGERLARELGAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPMATKKKSKKCLIL"
     gene            complement(1148351..1150006)
                     /locus_tag="CNH00130"
                     /db_xref="GeneID:3259213"
     mRNA            complement(join(1148351..1148880,1148986..1149177,
                     1149250..1149627,1149699..1150006))
                     /locus_tag="CNH00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_572207.1"
                     /db_xref="GeneID:3259213"
     CDS             complement(join(1148716..1148880,1148986..1149177,
                     1149250..1149627,1149699..1149974))
                     /locus_tag="CNH00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572207.1"
                     /db_xref="GeneID:3259213"
                     /translation="MTYLTAHLPFPSGSSLPPPASHLVISDTLNSPAQFALYHLVNAA
                     LLKQKSQPPSLTQARQINGRGTEYVTKVVWVDFRSEGRSSWEVILKKLGTPLPSPTSP
                     AFIHITPSSLPACISSSSTNANSPRIFPSLSLGTGDATSDRDGRPTLKHVYDTLLPHL
                     QTQAQLRSQPPSNPEQGEGGSELECLLILDGLSDLLSIGVPLREIHRFVRAVYAQIRI
                     SKAALVSTLHTDSLSFLTQPSLSLPLSESETETNLLERLLKIGHGVWWRVENLQSGRS
                     GDVMGEISSHPFGTHHSHPNSNFRAETEKDTYIPRSKPLQYRLEPSTVRVFAKGTGRG
                     FL"
     gene            1150206..1151874
                     /locus_tag="CNH00120"
                     /db_xref="GeneID:3259221"
     mRNA            join(1150206..1150351,1150408..1150472,1150552..1150732,
                     1150821..1150999,1151085..1151234,1151338..1151874)
                     /locus_tag="CNH00120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572206.2"
                     /db_xref="GeneID:3259221"
     CDS             join(1150293..1150351,1150408..1150472,1150552..1150732,
                     1150821..1150999,1151085..1151234,1151338..1151378)
                     /locus_tag="CNH00120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572206.1"
                     /db_xref="GeneID:3259221"
                     /translation="MSLRIATTTARAIPARAVATRSIMTLRRVAVPQASPKGYRQSSI
                     LQDTAKTAHSAFANLASAAPIKKGDKMPDVEIKIDGPEGKVNLGKEKGKNVVVLVPGA
                     FSGVCSNQVPPYITSFSDFKAKGINNVYVVAVNDIFVVNAWKDKMIGEFSSKEGEGVK
                     FAADDTAALASALGLTFDAQPVFGGPRLKRGVLVVNDGVVEYVGVEDSPGDITISAAD
                     KVIKQL"
     gene            complement(1151780..1153983)
                     /locus_tag="CNH00110"
                     /db_xref="GeneID:3259310"
     mRNA            complement(join(1151780..1152053,1152111..1152349,
                     1152410..1153270,1153346..1153557,1153607..1153690,
                     1153746..1153983))
                     /locus_tag="CNH00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_572205.1"
                     /db_xref="GeneID:3259310"
     CDS             complement(join(1152001..1152053,1152111..1152349,
                     1152410..1153270,1153346..1153557,1153607..1153690,
                     1153746..1153910))
                     /locus_tag="CNH00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572205.1"
                     /db_xref="GeneID:3259310"
                     /translation="MSALMDEKYSIEHTENGEVLNKDDGHHHLTQQEMKHGDNALKYI
                     GEERIEVTVEDDKRIRKLTDKYILSLLTWVYFLQILDKTILGYANTFGMSTDTHLVNN
                     QYSLLGSVNAIVQLAWQPFSSYLIVKVPARYLMPAMVFGWGAAQACMAAAHNFGGLMV
                     SRALLGLFEAGCLPLFSLLTSQWYRRSEQPVRVAVWYSTNGLATVVAALLSFGLSHVS
                     SPHIKVWQLIFIICGGITCLTAPVIYFFIDADVPSARFLSEEDKAKGIERLRANQTGT
                     GTNEFKLSHVWELFYDVKSYLFLALALLLNVGASVTTIFGPTLIKGFGFNSRITSLLN
                     MPFGFLQFLAILAGCFAAYKFKIKSAVLASFVIPVIVGLVLLYVENSAAVLKQAPALV
                     GYYLLAFLYGANPIIVSWIVANTGGQTKKALLMSVYNAGSAAGNIIGPLLFQDKDKPH
                     YLPGIKATLGIFCALIACIGFTAAFLFFLNKQRQRQRVAVGKPQFIKDTSMSTKYEAY
                     GGDDVEGRLGQNALLDLTDFKNDEFVYVY"
     STS             1156857..1157655
                     /standard_name="Pst5"
                     /db_xref="UniSTS:470935"
     gene            1157185..1161618
                     /locus_tag="CNH00100"
                     /db_xref="GeneID:3259266"
     mRNA            join(1157185..1158844,1158989..1159065,1159209..1159261,
                     1159485..1159650,1159840..1159854,1160128..1160279,
                     1160437..1160539,1160883..1160995,1161185..1161618)
                     /locus_tag="CNH00100"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024657616.1"
                     /db_xref="GeneID:3259266"
     CDS             join(1157439..1158844,1158989..1159065,1159209..1159261,
                     1159485..1159650,1159840..1159854,1160128..1160279,
                     1160437..1160539,1160883..1160995,1161185..1161334)
                     /locus_tag="CNH00100"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024513298.1"
                     /db_xref="GeneID:3259266"
                     /translation="MALEHHQDAQEPQDQSPWRRRMSHPLPIPTFRPNIPNIPHLRAA
                     LLGYLGELETALRRKLGDDLSEVGGVLHGGGNGSGRGRLPSVSLSSSMSTEDWTTSTE
                     SNDEDSYHGYSSALAGSSSISEVRQRNIATNADSNGSPSANTNAKDDTTTDPSSTKDS
                     YINLLNHLSALREEASNYLPSLSVHMPLSIPNRQWLRSLPSRLSIVDPGLLSPLDKAK
                     IKDELAAVIDFESGAVEGARKRVVDMVHAMLPSEDWAGWERLGWEEQEYGDGWRPGEY
                     GHRRTRSASLGRSGKGKHNQDNDSDYPMMEDEEPEYLFPNRTPASTRALARRRAVRSK
                     SVGAASLPLVKRARMERSQSYAFGSLVSFSPGKTVSEPVEMGSAGGSDREDGDEARDE
                     DGDEVDEVMNEEGKDEGEFISISYLTVDLKSSLIAVETTTDPSVADGLRSSEDGGKLI
                     TYNELPAIWRNNEHIRTGYRFIPLHLKTGPVPLIKSAFAIHNETVNIHSHLIPTLFIF
                     ACIPFIIYNTPLPDAHPLDTAVVIAYLVAAISCLSSSAGWHVLSGCASRKWFEWGACV
                     DYIGISWLIAASFGTVVYNGFYCQPKLTLFYCTTNMLCGALGSYLPFQRWFNERRNKH
                     LRISFFLFLCFAMFAPMVHMFGQYGWHKASAFVAPFMVSIVAYVVGLLFYAFHFPECK
                     WPGKFDIWGSSHQLWHLGIVVAIVLHYRAIFVAHGVKHEYSCAAPGQDISVAMVLERM
                     IGWR"
     gene            complement(1161978..1165958)
                     /locus_tag="CNH00090"
                     /db_xref="GeneID:3259055"
     mRNA            complement(join(1161978..1165286,1165337..1165567,
                     1165615..1165833,1165873..1165958))
                     /locus_tag="CNH00090"
                     /product="hypothetical protein"
                     /transcript_id="XM_572203.2"
                     /db_xref="GeneID:3259055"
     CDS             complement(join(1162161..1165286,1165337..1165567,
                     1165615..1165632))
                     /locus_tag="CNH00090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572203.2"
                     /db_xref="GeneID:3259055"
                     /translation="MSIQVPTGLLSIRRTKLVDVSYTLRVTLNNSIYVDLPVTLISFL
                     SIDPPPMPGGATRGVPMAEWAAVRGTPVPAPHEEEGKSRHTQETPIPAARASSTTLHP
                     DPSQPLVQPPPPLPAFESHSQCESATSTYTSPSNAASATSLPNLFTIPAYSRAQAHAQ
                     AQSSSPHLSAFSGFSPRPETYAYPEDDPQLDIDDENQDTISRAQNRAKGRQRSLMIIR
                     AEMERDDEERKMSFAQGWDADARGGAQTQEGTMEGTYETDVDVERTPMPEPSAYLPRM
                     DTAPERDMPDVERGIEELLEMEEEGWDFDSVDAHPPSHQPYQPYTDQNTEMDQNVDPE
                     HPHQHQQDYGQGQELELLDEERREIERVIPHPSHELKADDEQDEPDEPDRDDESHAWG
                     YEDELALHSEDEGDKGDTPTATPRRTTHSRSRALSSVAPASPVVSAPPAPPALAPEII
                     METKAESEIQEKTEVDEEREDRHVETHLDPVKRRISVRLPPQLLPTFSSSTSIPSPSP
                     DSISSAAPAAQRSPTKSPTKTIIRSGSVPSLCAKVSREALNERLEGVVKKSGIVSSSS
                     MSATTTAPTTATTGRRVSVLSKKESTSSLASVAEVNSGGGGAKVVQKKNSFSFATPGS
                     PLKVKIPLSPAPNTQSPIPSPRKTSRKPSPTKPNSNPTPKPQSNRNRNPSPTKSPLVS
                     SRPMERAPSDTSAKSQTTNGASPHNSQPPPLASPRASDSASSSEGKWLESPRGEEEAQ
                     QLHFLAPASGGGGYQSFSPLISPTSPQDGLEWGLMQQQQQRQGQDQDQEQGLGSPFTF
                     HSLRPPTDSVMSRLSLPRPRSPFSSVSGHHHHYHHDPMAKHDTLPIPFDEISIHASPS
                     STPSSPSSCHSMLPSVKTKIAQMESREEALRKFSVSGSAMLSPPLRLSKTDSERQTVE
                     RMEEIREKEGESGWRNDRGEERKPPVKRKSYTAALAPRANRTGSKAPLSAPRPFIPRQ
                     TSTSTIHSTQSISSGSSSNSNYDYDPIYAPESNTSTPKVPKRLPASPSATTPTASPRN
                     SLVHNGRLPISPASTKSTTTSYGDLMSTPKLDPFGLGYTSGGMNGVGPGMGMAPIGGG
                     LHKVDEEVGHEGLSRESSYEVGGYDSGRCEARVRME"
     STS             1163142..1163268
                     /standard_name="CTG9"
                     /db_xref="UniSTS:470934"
     gene            complement(<1166406..1167904)
                     /locus_tag="CNH00085"
                     /db_xref="GeneID:36392974"
     mRNA            complement(join(<1166406..1167048,1167100..1167904))
                     /locus_tag="CNH00085"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658719.1"
                     /db_xref="GeneID:36392974"
     CDS             complement(join(1166406..1167048,1167100..1167854))
                     /locus_tag="CNH00085"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514632.1"
                     /db_xref="GeneID:36392974"
                     /translation="MPLSPNPSQGLGITLPNCAHPPSPLRISTTSSPPLEPGGQTRAH
                     ADGQGSPIKVAATATAASSGGIAGTRLRVKTNDSFALRPTHSHSPTASISSIPSSPLT
                     YSTGTVKSLRTSKPLGPRSSPREGGTHGLRVEVEEMYRDEAHGEENGGDKDDDRQRLV
                     PSPTADTDADAHAAPSRAPSSASVISTSFSASTHHTSSSKVGRVKSSEVLRRRGAAKE
                     GGKYMQLEGGDGEREDEEIVRSPLSGKDGYREQRLPSYHHQHPSVHAPAPVFAPPAAY
                     AFPYPPRRTGQPETFQATDLPRSASQPMHLYSVPAFFDPTYTTARPAGDDSQDDELRS
                     RPWSESTLDGVRVGTAKRRGRSLSDGAELLARQGTLLDPSCGTPRSSAELGILLGGAR
                     SRRLSRDRLAAAGAGGGVRLEASKKGRARVEVDVVVERECVVEGGDVRGRVEVRVRGG
                     RRAPRGRRQGARGGV"
     gene            complement(1167905..1170157)
                     /locus_tag="CNH00080"
                     /db_xref="GeneID:36392973"
     mRNA            complement(join(1167905..1169190,1169263..1169841,
                     1169914..1170157))
                     /locus_tag="CNH00080"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657615.1"
                     /db_xref="GeneID:36392973"
     CDS             complement(join(1169026..1169190,1169263..1169841,
                     1169914..1170018))
                     /locus_tag="CNH00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513297.1"
                     /db_xref="GeneID:36392973"
                     /translation="MASVLLGEPNSLPSDSAPEKRRKIPKVAFYVAGSAFALTIGMTA
                     MVIPFVRQAAKTMNGPQFMSHRNLEHLASRRFPSPSLSPFASSSIPPRQVRDSSPPVP
                     PPSALKSAIPAYSSASISAEIPISEEDIKHLGEGSKSTLDPVVQAEESAETIKSRLFN
                     AREEKALYGSSLMPLSSNTASEGEGEGGGDKMEGALLGAKALMFATTLVVGFTGLGMW
                     AVGKAMGAEDPADFAVKMRQQLVLSMPQLVTSVNRPGRSTDGFDSEAIEKWVNELERE
                     EVARPS"
     gene            complement(1170350..1172721)
                     /locus_tag="CNH00075"
                     /db_xref="GeneID:36392972"
     mRNA            complement(join(1170350..1170874,1171018..1172524,
                     1172587..1172721))
                     /locus_tag="CNH00075"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658720.1"
                     /db_xref="GeneID:36392972"
     CDS             complement(join(1170721..1170874,1171018..1172524,
                     1172587..1172671))
                     /locus_tag="CNH00075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514633.1"
                     /db_xref="GeneID:36392972"
                     /translation="MASTSTAQKLSYEWPESILTFEGLFNTYSSSRHPFSIFNISLFR
                     WRPSLPSSAMLEPLLTMASNTLHPEQQPTIKALIGLQTYTTQLRDAVRVRQLDMGDKE
                     VQGRLDELVKGYAAAGNVIARILWESDGDKGRIRSHDLHIALKQSIGSFFAVRSLLET
                     SLATRHDTHILGSILPSIPPYHQSFLSPILEHCRHIITSLETNPFRPLAHSKLPNAAH
                     QLSRDLTDTEVTCLLEYLQTINEGLSNIGEIDSLNSTSLVGKVAKAKEKHMKQENEHR
                     PLRVRMEVMLLRCDLLLSMTNKRMSEVKARAARRMSGEESQGAAEEKVESEARNRSKS
                     REKSRSKSIDNMRDMSDTSTNIVPFCAVTSTFSSSDTPSSFIEWEVLTEESLIDCFDF
                     AASFTENDSIAVLTKSINLSDWLGATSPQLKTGTKSKTQSHPCPLSTNMSDDEDFDLD
                     SSTSFISEDDNDEAEGSYYRCPLRTLFALHDRYEEQRLAIWLTLPTSKRGKMTAFMRG
                     GKDGEIGRAWDGLGMNVMSVVCGSSLISYYGLAPDKLSKWTDLIAVRQAKRSRKKGKE
                     DGLISQVRPLNQNDI"
     gene            1173871..1176597
                     /locus_tag="CNH00070"
                     /db_xref="GeneID:3259256"
     mRNA            join(1173871..1174115,1174168..1174348,1174400..1174491,
                     1174567..1174597,1174650..1174842,1174896..1174965,
                     1175025..1175365,1175417..1175621,1175685..1175801,
                     1175854..1175936,1176000..1176115,1176181..1176597)
                     /locus_tag="CNH00070"
                     /product="monosaccharide transporter, putative"
                     /transcript_id="XM_572201.1"
                     /db_xref="GeneID:3259256"
     CDS             join(1173983..1174115,1174168..1174348,1174400..1174491,
                     1174567..1174597,1174650..1174842,1174896..1174965,
                     1175025..1175365,1175417..1175621,1175685..1175801,
                     1175854..1175936,1176000..1176115,1176181..1176391)
                     /locus_tag="CNH00070"
                     /codon_start=1
                     /product="monosaccharide transporter, putative"
                     /protein_id="XP_572201.1"
                     /db_xref="GeneID:3259256"
                     /translation="MSKITVAPSREEVPSLSALGIKAHPDALTLAYDDNALAGSYGGN
                     GLKDLFASRMVLLAASAACIGGLLFGFDQGILSICLTMPQFQDQFPETNAEVNPQASL
                     NKGIMTALLELGAFLGAFMSGYVSDRYSRKGSLAFGMVWFIIGSVLQSASYSFAQLVV
                     GRFIGGIGIGVLSSTAPTYISEIAPPNIRGALLVLEQFSIVLGIVVMYYITYGSRYLS
                     GGGSFRLPFALQMFPCIILGGFLYQLPYSPRWLALRGRDQECLASLCRLRQLPDTDPR
                     VQAEWITIRAEAIRNREVLVKAHPTMTDKSTKSEFKLELASWVDMFRVGSIRQTMIGI
                     LLMFFQQFVGINALVYYAPTLFEQLGLDYELQLTLAGALNIAQLVAVVAAFFLLDKFG
                     RKVFLIVGAIGLTVSHSVVAAMIGTYGDNWPAHKGPAWVGVGFIFGVMIFYGIGWGPV
                     PWAMPAEIHASSRRAKGVAITTCSNWLNNFIIGLITPPLISGTKGYGAFIFFAIWSLL
                     ACLWSVFFVPETKGRTLEQMDAVFKSRTAIEDAQARDDILQIVCKEALNSINNPRQVP
                     KMEIEMLENVDEKKSGTPSTISQV"
     gene            complement(1176618..1178846)
                     /locus_tag="CNH00060"
                     /db_xref="GeneID:3259309"
     mRNA            complement(join(1176618..1177208,1177261..1178218,
                     1178270..1178378,1178441..1178846))
                     /locus_tag="CNH00060"
                     /product="hypothetical protein"
                     /transcript_id="XM_572200.1"
                     /db_xref="GeneID:3259309"
     mRNA            complement(join(1176618..1177208,1177261..1178218,
                     1178270..1178835))
                     /locus_tag="CNH00060"
                     /product="hypothetical protein"
                     /transcript_id="XM_572199.1"
                     /db_xref="GeneID:3259309"
     CDS             complement(join(1176904..1177208,1177261..1178218,
                     1178270..1178752))
                     /locus_tag="CNH00060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572199.1"
                     /db_xref="GeneID:3259309"
                     /translation="MASPKASEAISDSSLSPASYQALPELPKSPRDDPIAYGGHPKNR
                     DRPYPLSLIPFDLNEPYEVSEYLTIRSYDEACQVDYLNQDWADEYRDGGIVDEQMFDD
                     GHVRRYLDRFIQENPKLIATTFRHKANLKTVFYSGKDEEWAKLDLVDVYRRQTGKVLG
                     VPSQSQYTSNSKNGGAITPDASLIGNVNDPSSPSFRKRMLYAVIEVKWMELATLLTGE
                     AKRQSDEKALNYLRQEGVFQTMWYVILGYAISGCIFGLSIINEYFYRIVYLYQHSDSD
                     IPVIALEADSEFLGKTGRHFGYLRDSYSIEELAGLQDFWSSPPNCLISDRANAILNKE
                     ARYHLDATIFLFLNRAASLSKQCFLNGLPLPHIRRSLHPTKANKRTLADLDDEGKKEG
                     VEDIPGDEKLSRKVNRRNGPESDGLCGRGSGHDRVHEGNGASAHRTEAAHARRPMKPQ
                     EFLRGLEELSTVVDVSDVKSSIIASLISNSHTTPSMNPSSISSDCDSFSYTSFGSREK
                     LPVSDHLPAALHPRSHECDPVDTDFDAIDSETGELTLEAYRSRLAMLGVRVKLVTREE
                     MDVLLARGGKENSDC"
     CDS             complement(join(1176904..1177208,1177261..1178218,
                     1178270..1178378,1178441..1178571))
                     /locus_tag="CNH00060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572200.1"
                     /db_xref="GeneID:3259309"
                     /translation="MRSPNTLLSAPTMRHAKLTISIKIGPMSTETGESLMSKCSTTDI
                     HKANLKTVFYSGKDEEWAKLDLVDVYRRQTGKVLGVPSQSQYTSNSKNGGAITPDASL
                     IGNVNDPSSPSFRKRMLYAVIEVKWMELATLLTGEAKRQSDEKALNYLRQEGVFQTMW
                     YVILGYAISGCIFGLSIINEYFYRIVYLYQHSDSDIPVIALEADSEFLGKTGRHFGYL
                     RDSYSIEELAGLQDFWSSPPNCLISDRANAILNKEARYHLDATIFLFLNRAASLSKQC
                     FLNGLPLPHIRRSLHPTKANKRTLADLDDEGKKEGVEDIPGDEKLSRKVNRRNGPESD
                     GLCGRGSGHDRVHEGNGASAHRTEAAHARRPMKPQEFLRGLEELSTVVDVSDVKSSII
                     ASLISNSHTTPSMNPSSISSDCDSFSYTSFGSREKLPVSDHLPAALHPRSHECDPVDT
                     DFDAIDSETGELTLEAYRSRLAMLGVRVKLVTREEMDVLLARGGKENSDC"
     gene            1179074..1180480
                     /locus_tag="CNH00050"
                     /pseudo
                     /db_xref="GeneID:3259075"
     STS             1179768..1180601
                     /standard_name="Sal7"
                     /db_xref="UniSTS:470937"
     gene            complement(1180537..1181962)
                     /locus_tag="CNH00040"
                     /db_xref="GeneID:3259331"
     mRNA            complement(join(1180537..1180883,1180944..1181261,
                     1181346..1181550,1181641..1181709,1181769..1181962))
                     /locus_tag="CNH00040"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657614.1"
                     /db_xref="GeneID:3259331"
     CDS             complement(join(1181152..1181261,1181346..1181550,
                     1181641..1181709,1181769..1181897))
                     /locus_tag="CNH00040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513296.1"
                     /db_xref="GeneID:3259331"
                     /translation="MSEPPEYQKLLNKDTESFDVDVEDQAPTYPPGPSDFVSRVIFVY
                     APPRFGFDDPKEYVGLVGKTKEKTIQNICRYIPELAEYPADHISFRLSSTASAHPRNW
                     PVVTEDIWFTFVSDPPEKLGVIVEPTQKDKDANRARQVKISIIIVCCFIGFWGLVAAI
                     VAMGDHFFPS"
     gene            complement(1185477..1188566)
                     /locus_tag="CNH00030"
                     /db_xref="GeneID:3259220"
     mRNA            complement(join(1185477..1185762,1185821..1185873,
                     1185933..1186102,1186154..1186278,1186343..1186498,
                     1186557..1186664,1186727..1186799,1186850..1186923,
                     1186973..1187094,1187148..1187224,1187278..1187344,
                     1187394..1187561,1187617..1188342,1188430..1188566))
                     /locus_tag="CNH00030"
                     /product="Alpha-L-arabinofuranosidase, putative"
                     /transcript_id="XM_024657613.1"
                     /db_xref="GeneID:3259220"
     STS             1185490..1186409
                     /standard_name="Sal6"
                     /db_xref="UniSTS:470938"
     CDS             complement(join(1185634..1185762,1185821..1185873,
                     1185933..1186102,1186154..1186278,1186343..1186498,
                     1186557..1186664,1186727..1186799,1186850..1186923,
                     1186973..1187094,1187148..1187224,1187278..1187344,
                     1187394..1187561,1187617..1187992))
                     /locus_tag="CNH00030"
                     /codon_start=1
                     /product="Alpha-L-arabinofuranosidase, putative"
                     /protein_id="XP_024513295.1"
                     /db_xref="GeneID:3259220"
                     /translation="MAVYSQHVTVNQSLLQQQAPRDFPNTPSHPKTLASTPILLDVTR
                     LLYPSGPPVTDKLFSGFLEHLGRCIYGGIVDDPKDPSPKWLLEVQDEGKTFQKDRLGW
                     RKDVMGCLAKDGELEIPMLRWPGGNFVSNYHWQDGIGPISERPKRVELAWLSDESNRF
                     GTDEFIDYCRATGAEPYICLNMGTGSLEEALAWVEYCNGTGDTHWANLRRKNTGRDEP
                     HAVKYWGLGNEMWGPWQVGNLLPSEYVRKARQWAHALKLVDPSIVLVSCGETGASDWD
                     REVIQGLLPWADMHSIHFYTMLGHDKMSSVSGYDYEKNVFGPAAAEKHIDICKSLIDL
                     ANIGRTWERMPAKDMKICFDEWNVWDDVKAPGSNGLEQWYDYTDMLGFCAWLNVLVRK
                     HKDIGIACLAQSVNVISPLMTKPDGIVRQTLYYPLQLFSKYMKNGHLLQLPVFPDVYT
                     GPTFPVYIQQGNYKPSYVDSVAILVETEKGASIRVSILNRHPEVDWSSKIGFSGFEVE
                     SVEVHEIYSDDLAAANTFENPDTIIPKITKKNAKEWDGDVLVKKHSWSFIIFNGRFH"
     STS             1186828..1187726
                     /standard_name="Sca1"
                     /db_xref="UniSTS:470936"
     gene            1188744..1191355
                     /locus_tag="CNH00020"
                     /db_xref="GeneID:3259182"
     mRNA            join(1188744..1189065,1189114..1189307,1189363..1189491,
                     1189543..1189560,1189613..1189746,1189798..1189865,
                     1189926..1190082,1190139..1190245,1190297..1190473,
                     1190526..1190648,1190701..1190819,1190881..1191078,
                     1191140..1191355)
                     /locus_tag="CNH00020"
                     /product="glucose transporter, putative"
                     /transcript_id="XM_024657612.1"
                     /db_xref="GeneID:3259182"
     CDS             join(1189019..1189065,1189114..1189307,1189363..1189491,
                     1189543..1189560,1189613..1189746,1189798..1189865,
                     1189926..1190082,1190139..1190245,1190297..1190473,
                     1190526..1190648,1190701..1190819,1190881..1191078,
                     1191140..1191246)
                     /locus_tag="CNH00020"
                     /codon_start=1
                     /product="glucose transporter, putative"
                     /protein_id="XP_024513294.1"
                     /db_xref="GeneID:3259182"
                     /translation="MLPPKIYTFLCGCFAAMGAMLYGYDLGVISYVLVAPDFLKTMDT
                     TDENYIGFITSSMLLGAFVGSIPASLIADAFSRRMAITVAGVVFIIGGILQTAAPNKE
                     AMFAGRFFAGIGIGMLGLLTPLYQSEIAHPSARGMLTATFQFFLGIGSFIAGWIAYGV
                     AQTHFESPMAWRLPLGFQMLPAVPLIFLTFLLPESPRWLIIKGHDEKALRSLARLHAK
                     GDESDPFVLGEFAAIKNKVDAEAVMQQSWRLIFNFEDRTNMRKVLYGIILQFSVQMTG
                     VSAIQYYAPTVYASVGFSTNTSLLINSINSVNALIAQFCCILFVDKIGRRFPLIFGNI
                     LSGTCFAVATALAKQFADGRGSRGQGIGFVVVLYVYNFFFSACIGPLSWIYPVEIMNT
                     AIRAKATAMVNMAAWISNFMIGQVSPKAFANIGWRYYLVFCICSFTNAITFYLFFPET
                     RGRTLEEMDNYFRQMNLIVPLTKDVQKISAHEREAQLVEQGVIQQEVGMQQEVDEKDE
                     KNEKKDEKKEIEHQEVV"
     gene            complement(<1192567..>1193839)
                     /locus_tag="CNH00010"
                     /db_xref="GeneID:3259107"
     mRNA            complement(join(<1192567..1192607,1192728..1193193,
                     1193289..1193431,1193498..1193509,1193560..>1193839))
                     /locus_tag="CNH00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_572195.1"
                     /db_xref="GeneID:3259107"
     CDS             complement(join(1192567..1192607,1192728..1193193,
                     1193289..1193431,1193498..1193509,1193560..1193839))
                     /locus_tag="CNH00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572195.1"
                     /db_xref="GeneID:3259107"
                     /translation="MHMDVEEKKQSYEKLCKTLRYDATREDNYRTDALTVFSQISLGG
                     RSGPPYADIDLNSEDMGYLKSHDMSMAFMETDASKVINRLMPSKTRSKNAAEEISEVP
                     SSSQPSSTTASIRILDTAIVFSYEHSEAGAEGSEFKSTEEEEERKVYLGQCLMYSDAG
                     YQMFRLRRALAVCGTRSARVWALSGRCGCRTFAVETSRPLNNTGPMVAADFFSQVNLD
                     LFPHNLIIPSPSTGSFAIDHGKCGLLELTVSRVCDSILWRAYISLAVPVAPNLPGIVN
                     VINTSIEIWNIKYVYMVSNIVGNTIKTHLNLCPLVKH"
CONTIG      join(AE017348.1:1..1194300)
//
DBGET integrated database retrieval system