GenomeNet

Database: RefSeq
Entry: NC_006694
LinkDB: NC_006694
Original site: NC_006694 
LOCUS       NC_006694            1178688 bp    DNA     linear   CON 11-APR-2018
DEFINITION  Cryptococcus neoformans var. neoformans JEC21 chromosome 9
            sequence.
ACCESSION   NC_006694
VERSION     NC_006694.1
DBLINK      BioProject: PRJNA10698
            BioSample: SAMN03081418
            Assembly: GCF_000091045.1
KEYWORDS    RefSeq.
SOURCE      Cryptococcus neoformans var. neoformans JEC21 (Filobasidiella
            neoformans var. neoformans strain JEC21)
  ORGANISM  Cryptococcus neoformans var. neoformans JEC21
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus;
            Cryptococcus neoformans species complex.
REFERENCE   1  (bases 1 to 1178688)
  AUTHORS   Loftus,B.J., Fung,E., Roncaglia,P., Rowley,D., Amedeo,P., Bruno,D.,
            Vamathevan,J., Miranda,M., Anderson,I.J., Fraser,J.A., Allen,J.E.,
            Bosdet,I.E., Brent,M.R., Chiu,R., Doering,T.L., Donlin,M.J.,
            D'Souza,C.A., Fox,D.S., Grinberg,V., Fu,J., Fukushima,M.,
            Haas,B.J., Huang,J.C., Janbon,G., Jones,S.J., Koo,H.L.,
            Krzywinski,M.I., Kwon-Chung,J.K., Lengeler,K.B., Maiti,R.,
            Marra,M.A., Marra,R.E., Mathewson,C.A., Mitchell,T.G., Pertea,M.,
            Riggs,F.R., Salzberg,S.L., Schein,J.E., Shvartsbeyn,A., Shin,H.,
            Shumway,M., Specht,C.A., Suh,B.B., Tenney,A., Utterback,T.R.,
            Wickes,B.L., Wortman,J.R., Wye,N.H., Kronstad,J.W., Lodge,J.K.,
            Heitman,J., Davis,R.W., Fraser,C.M. and Hyman,R.W.
  TITLE     The genome of the basidiomycetous yeast and human pathogen
            Cryptococcus neoformans
  JOURNAL   Science 307 (5713), 1321-1324 (2005)
   PUBMED   15653466
REFERENCE   2  (bases 1 to 1178688)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1178688)
  AUTHORS   Janbon,G., Paulet,D., Chon,C.C. and Mornico,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-NOV-2015) Institut Pasteur, 25 rue du Dr Roux, Paris
            75015, France
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 1178688)
  AUTHORS   Loftus,B., Amedeo,P., Roncaglia,P., Vamathevan,J., Utterback,T.,
            Van Aken,S. and Fraser,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2004) The Institute for Genomic Research, 9712
            Medical Center Dr, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE017349.
            This record represents the complete annotated sequence of the C.
            neoformans JEC21 genome. A small number of gaps exist which are
            represented by NNNNs within the final sequence. The genome has been
            annotated by TIGR and the annotation data is available for viewing
            and download from the TIGR database
            (http://www.tigr.org/tdb/e2k1/cna1/).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1178688
                     /organism="Cryptococcus neoformans var. neoformans JEC21"
                     /mol_type="genomic DNA"
                     /strain="JEC21"
                     /serotype="D"
                     /db_xref="taxon:214684"
                     /chromosome="9"
                     /note="MAT-alpha"
     gene            complement(<351..2713)
                     /locus_tag="CNI00010"
                     /db_xref="GeneID:3259436"
     mRNA            complement(join(<351..831,892..983,1047..1175,1236..1673,
                     1727..2186,2237..2379,2429..2518,2571..2606,2653..2713))
                     /locus_tag="CNI00010"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657755.1"
                     /db_xref="GeneID:3259436"
     CDS             complement(join(351..831,892..983,1047..1175,1236..1673,
                     1727..2186,2237..2379,2429..2518,2571..2606,2653..2682))
                     /locus_tag="CNI00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513513.1"
                     /db_xref="GeneID:3259436"
                     /translation="MLGSKRKRVSRACDRCHKLGNKCSPSEAPPLCQPCIDYGQKCTY
                     DRPQGRRGAPPKNAPLQPAPSSIRASNTSEWIATNNIDLDTTLQLAEVYRMTVYPVYC
                     FFHWPTFINHVKARRQDNDRSFQASVLAVCAVAAARLRDGACSELLKVWSPPSSQSDS
                     SGITDIAIISNVHGLRSAALSSISSRASGSGPEFDDLRATALLAILGIQNGDFDQLQI
                     MLGQYHGMSAQLAFHDESQWPQGLEKWEVQERRCLYWSIYTLDVFASSVWGGVIRHRR
                     CQSFVSYPDHRLDDALSLSPTLVGELDTVNWIQGWNTVTDLYRAMEEIMDAAAYQNQR
                     AAPHKPPDLPSPFGRPPLSVSESWPVIRYRYDALPSVFKETKPLTGDFVDNVCSFQAA
                     NLSVTLQAVRMAIACCQPMSMADRCQIAGELLDVLANIPTAYMQLISAPFLHQLSAVG
                     SLLGSVVQGPLTISTYLHIRQILLSFANLLACLETPFIPGGGISERLLKHIARIDLFM
                     QSTVDNRKPDHHIFQGESPTVSYPSRARTNTAPQPNPQINGPQLPKIAVVSRAEKPAD
                     ESGPELPFASSLDSNSISQPAFEAISQTGYDDTVFTLPDDLINYWPLDADQQSIFDSF
                     FAPHNSFT"
     gene            4919..6737
                     /locus_tag="CNI00020"
                     /db_xref="GeneID:3259545"
     mRNA            join(4919..5524,5584..5647,5701..5844,5929..6202,
                     6280..6737)
                     /locus_tag="CNI00020"
                     /product="expressed protein"
                     /transcript_id="XM_024657756.1"
                     /db_xref="GeneID:3259545"
     CDS             join(5006..5524,5584..5647,5701..5844,5929..6185)
                     /locus_tag="CNI00020"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513506.1"
                     /db_xref="GeneID:3259545"
                     /translation="MLSHSLLASLRARCAVSLLASSSTSVRSLATQASSTITSIRPSR
                     DEIVNMRLSQRSIQAALEALRADGIVVVEDVVNKEAIDKLNSHMEKDTHTLMARGEKG
                     PFNYNLGNLQQSPPYDPDLFSPSIFVNPFGIQVTNAYLGERPTMSFISANSAVKAEVG
                     QPVHSDADFSHPSIPFAAVVNVGLVDMNPKNGSTQVWLGTHDGTDLSCQEGAHGERAS
                     GRIKQDLLDARKSISPPLQPTIPKGSLIIRDLRLWHAGMPNTTDEIRIMLAMIHFAPW
                     YRQRMTMKLPRSLRPTLEGVDRLGVAADWQDAEVDHLDAPYGNAFDFSQDQ"
     gene            8925..9769
                     /locus_tag="CNI00030"
                     /db_xref="GeneID:3259665"
     mRNA            join(8925..9061,9099..9167,9204..9266,9304..9769)
                     /locus_tag="CNI00030"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657757.1"
                     /db_xref="GeneID:3259665"
     CDS             join(8997..9061,9099..9167,9204..9266,9304..9664)
                     /locus_tag="CNI00030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513505.1"
                     /db_xref="GeneID:3259665"
                     /translation="MKLLLVASALATAISVQAQSESLSQCVLDCMTQTAETVDVCDAN
                     YNQTSCLCTEDFAQETRHCFYNNTCYADIIPFYNFREAECGTLADDIDYAGFIPSNGN
                     STYDLANGTSSAAASGSASASAAASSAATSNAATTSASATASSGAAASSSGAALAAID
                     MVTARGLAVGGMSVAGVLVGGLLLI"
     gene            complement(9871..11272)
                     /locus_tag="CNI00035"
                     /db_xref="GeneID:36393026"
     mRNA            complement(join(9871..10067,10128..10375,10432..10685,
                     10745..10864,10923..11032,11085..11272))
                     /locus_tag="CNI00035"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658721.1"
                     /db_xref="GeneID:36393026"
     CDS             complement(join(9979..10067,10128..10375,10432..10685,
                     10745..10762))
                     /locus_tag="CNI00035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514395.1"
                     /db_xref="GeneID:36393026"
                     /translation="MYMEIQLPEYRSQQACISTTDLCFHSRLVSPQWIEKNIENVSFA
                     YHPSSCITFASVCHRHSKDGWDLKPALLIEVKSSMERYVFCLTLQRCLPNLPTPRCHF
                     LLPALFIFDVASCFLLSGLESFYLDAIIHSMLKVIFEGLMRRDESLEQATSANIAERR
                     YMANDYTNWMTRRIGLSLMPAHRLWSTTHSKLFIHYPSPGLT"
     STS             11629..12192
                     /standard_name="Hae8"
                     /db_xref="UniSTS:470715"
     gene            complement(11943..14248)
                     /locus_tag="CNI00040"
                     /db_xref="GeneID:3259567"
     mRNA            complement(join(11943..12363,12429..12488,12563..12953,
                     13021..13643,13694..13973,14039..14106,14174..14248))
                     /locus_tag="CNI00040"
                     /product="protein transporter, putative"
                     /transcript_id="XM_572757.2"
                     /db_xref="GeneID:3259567"
     CDS             complement(join(12356..12363,12429..12488,12563..12953,
                     13021..13643,13694..13973,14039..14106,14174..14180))
                     /locus_tag="CNI00040"
                     /codon_start=1
                     /product="protein transporter, putative"
                     /protein_id="XP_572757.1"
                     /db_xref="GeneID:3259567"
                     /translation="MGFRFLELVRPFMSILPEVTAPEKKVVFNHKIAWTAVTLLIFLV
                     CSQVPLYGIMSSDSSDPLYWLRAILASNRGTLMELGITPIVTSGMIMQLLAGAQLIDV
                     DFSLKDDRALFGAAQKLFAMIISLGQATVYVLTGLYGSPSSLGAGVCLLLILQLVSAS
                     LIVILLDELLTKGYGLGSGISLFIATNICESIVWKAFSPNTVNTGRGPEFEGAIIALI
                     HLLFTWNDKTRALKEAFYRDRLPNIMNLLATVAVFAAVIYLQGFRIEIPIKSSKMRGQ
                     RGTYPVKLFYTSNMPIMLQSALTSNVFLVSQMLAGRFPDNLLVRLLGVWEPMENNPTQ
                     LGAVSGIAYYMSAPHSLTSALKDPFHTVIYIAFIVTACALFSKTWIEVSGSGPRDVAK
                     QLKDQNMTLAGHRDASIYKELKRIIPTAAAFGGATLGLLSVVADMMGALGSGTGILMA
                     TTIIYGYFELGIKENSGIDATGLGDLLF"
     gene            14406..17434
                     /locus_tag="CNI00050"
                     /db_xref="GeneID:3259794"
     mRNA            join(14406..14520,14577..15264,15365..15700,15778..16063,
                     16130..16192,16272..16291,16370..16453,16533..16829,
                     16925..17434)
                     /locus_tag="CNI00050"
                     /product="tRNA dihydrouridine synthase, putative"
                     /transcript_id="XM_572750.2"
                     /db_xref="GeneID:3259794"
     CDS             join(14432..14520,14577..15264,15365..15700,15778..16063,
                     16130..16192,16272..16291,16370..16453,16533..16829,
                     16925..17239)
                     /locus_tag="CNI00050"
                     /codon_start=1
                     /product="tRNA dihydrouridine synthase, putative"
                     /protein_id="XP_572750.1"
                     /db_xref="GeneID:3259794"
                     /translation="MTDDPAATPRPETSVNARPAFSGQAPIKAEYLINTTPIVESASA
                     SELNNIHPDDAAEGRTDSRDSRDGRDRPDNKRRKPNKQDKKDKKGQNKGRHFPVIREA
                     SVRICRAWETTGICDRADKGDCRYAHSWEGYFEVKPNDISYRPDWSLVGEAPFVVEGE
                     RVVGGEDVVGKTLDLDTVCPVLKDLGYCPFGWRCRFLGAHVKRVAAAVDGEKEKEAGP
                     EKRMGEWQVENWVQSEVENGWKQKETNWPEHEVLNALRRSTASFPFSEAYLKKVDPDK
                     PFTLQNKKPTKQQPHKRKNNVLDEEEAANGPTGIPSAGDDEENAMNATENERNEEKGK
                     VYGEPEAIDVPLRPEEKRRLNWEGGRYLAPLTTVGNLPFRRLCVDYGATITVSEMALA
                     QPLVYGAKEEWALVRRHESEKMFGVQVAGGFPNRMVPAAEVIANTIGKGGGVDFVDVN
                     MGCPIDLVFNQGAGSALMDSPGRLGKLLVGMNRALGDIPLTVKFRTGVAHGKPNAHKL
                     IPRFVTEWGAGALTIHGRSRQQRYSKPADWEYIKTCVTALRESVADANLPPVPIFGNG
                     DCFSAASYYEEMDRSGVDGVMVARGALIKPWIFTEIKERREWDISAVERLEGIKKFAE
                     FGLSHWGSDTQGVNTTRRFLCEALSFQHRYIPIGLLERLPAKLNERPPAYRGRNELET
                     LLASPFAGDWVKISEMFLGKVDEGFSFVPKHKSNAYGGEEAQG"
     gene            17661..19727
                     /locus_tag="CNI00060"
                     /db_xref="GeneID:3259808"
     mRNA            join(17661..18141,18205..18285,18365..18415,18493..18530,
                     18613..18717,18808..18940,19045..19179,19257..19727)
                     /locus_tag="CNI00060"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_572748.2"
                     /db_xref="GeneID:3259808"
     CDS             join(17760..18141,18205..18285,18365..18415,18493..18530,
                     18613..18717,18808..18940,19045..19179,19257..19561)
                     /locus_tag="CNI00060"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_572748.1"
                     /db_xref="GeneID:3259808"
                     /translation="MTKSLYSLFSIILLFAVSSSFAFASPQAQYHQHAMTTSHLLSVH
                     NDSSGHNHTAPSLETLIVTVPVSAEKLAEVKTHFKTVHVFDEGETVTKEAAREVEVWY
                     SNYLGIPKEIEYEDVPNLKLVQLTSAGANLALNSPVLKNEEARKRIDISSASGIHAIS
                     IPQWIISQTVSLYMHLYLQTFNLRTNQTWSRDIPQLPQLNGIKHGNSGKSLYGKTAGL
                     LGYGHIGRETARLLKAFNVNIIAANSNGQKRGDDGYLIPGTGDADGSIPSAYYSTSDE
                     ESFKTFLSKSDILIASLPSTPQTRYLLNQELLSLLPEGAVFLNVGRGDLVKSEDLLAA
                     LASGPLSGVALDVTDPEPLPDYHPLYSHPQVIITPHTSSNIEGYFDVGADLLIENVRR
                     VRKGGKAINKVDPEKGY"
     gene            19919..21794
                     /locus_tag="CNI00070"
                     /db_xref="GeneID:3259795"
     mRNA            join(19919..20128,20227..20387,20487..20655,20738..20880,
                     20987..21063,21143..21794)
                     /locus_tag="CNI00070"
                     /product="expressed protein"
                     /transcript_id="XM_572759.2"
                     /db_xref="GeneID:3259795"
     CDS             join(19978..20128,20227..20387,20487..20655,20738..20880,
                     20987..21063,21143..21668)
                     /locus_tag="CNI00070"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572759.1"
                     /db_xref="GeneID:3259795"
                     /translation="MSRPSIILHATPPLHPLPASDAESLYYAALLQLAAPDGWALTRG
                     DWGDNGGKLPFITHLAHPVPPAHLSSLPSFSDPDEELEDGEKLDAACWKAYIEGNVVD
                     IVNHTYYSLPPNYPSTVAKSQFAGLPFPMNQYIPQRIRSIVKSRLEFVGLWGLGGLNV
                     GDAEDEDRKRQEEQFIIGPGGTTAPRAWTGWRSGQETDKRRRKWGEQQLEQKIKAIFD
                     PLARRLGKKAYFFGERPTTVDLALFAQLAFVLTPTLPNPLLPNILRSSYPSLVGHHDR
                     LLERLFSSWSTVPMAVSQTPARTTWGETFASWLPGPSRSRTQPSSSSSTDSKENSKGG
                     SPSKPKTDKQKAFERGRWLWFAGAAVSMVTYLFVSGVIAFEFGDEEEDEDWVAYEEDG
                     EGEVGETTVLDYEEEE"
     gene            22009..29138
                     /locus_tag="CNI00080"
                     /db_xref="GeneID:3259463"
     mRNA            join(22009..22350,22426..22804,22886..23497,23572..23803,
                     23887..24061,24130..24184,24239..24461,24605..24718,
                     24801..24883,24945..25006,25075..25224,25311..25611,
                     25678..26004,26059..26896,26953..26967,27017..27063,
                     27120..27175,27234..27421,27475..27612,27666..27737,
                     27794..27942,27997..28111,28162..28275,28323..28436,
                     28497..28586,28640..28661,28723..28815,28867..28910,
                     28971..29138)
                     /locus_tag="CNI00080"
                     /product="ATP-dependent bile acid transporter, putative"
                     /transcript_id="XM_024657758.1"
                     /db_xref="GeneID:3259463"
     CDS             join(22478..22804,22886..23497,23572..23803,23887..24061,
                     24130..24184,24239..24461,24605..24718,24801..24883,
                     24945..25006,25075..25224,25311..25611,25678..26004,
                     26059..26896,26953..26967,27017..27063,27120..27175,
                     27234..27421,27475..27612,27666..27737,27794..27942,
                     27997..28111,28162..28275,28323..28436,28497..28586,
                     28640..28661,28723..28815,28867..28910,28971..29083)
                     /locus_tag="CNI00080"
                     /codon_start=1
                     /product="ATP-dependent bile acid transporter, putative"
                     /protein_id="XP_024513508.1"
                     /db_xref="GeneID:3259463"
                     /translation="MSMPSYNASTYASETETLLPRSPPSPRFPTSSDQYADDDHDLPV
                     QIDSFLRNVKICKSALGASLLGTFAMEVWHLSMSAAEVGHRRRSETQQKAVEASMWAD
                     ILGTTIICFLSILYLASLLKPITVPSVSLSPKIQNSSLHRSLCTTTFTSILFLLIAHS
                     SPGVAYTVWTHLSSPRLDDPMAEGVYHLRMVGLILVLSSVGFMRRGPKMYFPPPRLGT
                     GFGLNREPEWESKKKNGHDIGEYGEDGYQNGDEDRRKGVVIKLTPAQEIDDPLTSAAS
                     AITIERQRLPPKVPEEPKSNVFDYNNSSMINFVLLTYIAPLAIRSAHVASLHQSDLPI
                     LEDETRNSGVYETAFASNSASHTKIIGLKRMVGSKTTTSWQLVKTLWAGRGWTVFISF
                     VLETTRNLISFIQIAALHEIIQSFNQSPGEDKSYAYLMCWAMFFGQTVEVLLAAYCCV
                     RENYMLHIPVRMSISSIILAKILRTTDAKALEAHNTIDSNSDDGHVRKGTKEKKTSGA
                     QGRSQVMNLLTIDTNTVASLATHTWGFTNGITTLIIGAGMLYGMLGVSAFVGIACVPL
                     STPLTWLVAKLIYRCDIEWARARDARTGALKEFLLGIKVIKLNAFEPYFMHRISKLRA
                     HEVKWQRWRFTLGTAFNVLADQLPILSILITFAFHTKIMGRPLDAPTAFVALNIFNRV
                     KDGLQTFPQIIQTFLSCKVSLDRLSRYLSQPEIDDDRWESISRRIICRDATITWPIGE
                     GIDKGDTGRFKLEGLDLKVPEGRLSLLCGPLGSGKTLLLRAFLGEAKVEKGSVLAPKS
                     LPDATPILLDNEIEAAVHWTAQHWLNDSIAYAPQQSFIRHGTLRDNILFGQPMWRERY
                     QEVLRQAALLQDLEILEDGDMTEVGENGVTLSGGQKARVNLARCIYSRASTIYLDDIL
                     SAVDAHTAQFIYQECLQGSLLKNRTVVLVTHHVRLVLPAVSYVISLNTEGRIDQACSP
                     SQIDLNTLSESAPKSPINSEDITPAAQLEKKRLINVGALDAKTTRKLYQEEQRAVGRV
                     SGSHYFLIFRAAGGMWYWLILAILYGGHRALTMLRIFWLEHWSANPSPEHLNYNLIVY
                     AAIVSFGIVTGAFRWIWLYGISNVGFYSRGNRRVHDLIMARLFSAPLQFFEKTPQGRL
                     LNVFGQDMWRLDCNVADDFGRTIMASLAIVTSAAVVFFKEPLVTIIAVAFGIPLFWFS
                     GHLNKLRSDIRRLTATASSPLYSLYNEAIDGIVMIRAFGQDKLMMATMKVLNNRERTT
                     YLADWTVYNWVSAFIRILTNVVITATSFVLIERNISPSQAGLILNFALTVSGSLFGLM
                     EQYSHLEQTFVSAERINQYITMSEHESEEGVCPPPEWPQQGRIDVRKLSVRYAPDLPQ
                     VLKNVSFTVEPGMHVGLVGATGSGKSTLALSLFRAIEYMQGEIMIDGVDVSSLILSEL
                     RGRLNMVAQDGMLCSGTLREALDVTGGRSDQDIFDALRKVHLISNEMSQEELDENPFA
                     NLETYVAIEGTNFSQGQRQLLCLARALLKQSKILVMDEATSSVDFETDSKITAMIKEC
                     FRGTTMLVIAHRLATIMQYDMVLVLDQGQIIESGKPQELIHNNQSVFYGLCMAQGKEE
                     YATLCKIAAITA"
     gene            complement(29089..31017)
                     /locus_tag="CNI00090"
                     /db_xref="GeneID:3259701"
     mRNA            complement(join(29089..29331,29396..29685,29777..29879,
                     29940..30018,30069..30129,30185..30286,30344..30537,
                     30599..30753,30828..31017))
                     /locus_tag="CNI00090"
                     /product="farnesyltranstransferase, putative"
                     /transcript_id="XM_024657759.1"
                     /db_xref="GeneID:3259701"
     CDS             complement(join(29474..29685,29777..29879,29940..30018,
                     30069..30129,30185..30286,30344..30537,30599..30753,
                     30828..30890))
                     /locus_tag="CNI00090"
                     /codon_start=1
                     /product="farnesyltranstransferase, putative"
                     /protein_id="XP_024513511.1"
                     /db_xref="GeneID:3259701"
                     /translation="MDYSNLRQTIADPKWSESQENILMEPYIYISQNPGKEIRSKLID
                     AFNQWLEVDKDDLKVITKVVRMLHNASLLMDDVEDNSELRRGLPVAHTIYGVPQTINA
                     ANYVYFLAFQELLQLRSGVMGKGKDKEVDLVAAVNEELLQLHRGQGMDLFWRDSLTCP
                     TEKEYIDMVLGKAGGLLRLAVKLMMAKSDSNVDYVPLVNLISVWFQIRDDYMNLQSPA
                     YKSNKGFCEDLTEGKFSFPVVHGVRADTSNRQILNVLQKRTSSIDLKQHIVDYLSNHT
                     KSFHYTRKVLTELEVQIMEEIKALGGNQRLENVVLALSLEESEEHL"
     gene            31877..34460
                     /locus_tag="CNI00100"
                     /db_xref="GeneID:3259581"
     mRNA            join(31877..32448,32548..32764,32854..32915,32975..33050,
                     33133..33384,33443..33501,33571..34029,34081..34460)
                     /locus_tag="CNI00100"
                     /product="multidrug transporter, putative"
                     /transcript_id="XM_572746.1"
                     /db_xref="GeneID:3259581"
     CDS             join(31920..32448,32548..32764,32854..32915,32975..33050,
                     33133..33384,33443..33501,33571..34029,34081..34388)
                     /locus_tag="CNI00100"
                     /codon_start=1
                     /product="multidrug transporter, putative"
                     /protein_id="XP_572746.1"
                     /db_xref="GeneID:3259581"
                     /translation="MISIITLRDIMSSSLQPALLSNQMSITASLPSLDDANPIDDPNP
                     RTACVTPNLSKLTLLKTPMSEYSPTTPPLSLPVRLDQPISPLSTSAKILSPPAYPGSG
                     TLSDPYVVDFLPSSPLNPYNWSKRYRWAITALIGVTALCPPFASVSYSTTVGEVVEAY
                     GISRELAIAGISLFILGFGLGPLFWAPISEIYGRQIAFAASYPIFTIFNLGTALSHNT
                     VALMVTRFFAGVFGSSPLTNAGAQVGDMWAVNERALATSVFALAPFLGPVLGPIVGGY
                     VTERCGYRWVYWIQFIYAAVMTILSIIVVPETYAPTILRRRARSLQAAALSEGREEYY
                     IAKYDTVKKSKREVILVGLCRPFEMLFTEVIVGCLSIYGALIYGILYLFFTAFPIVFQ
                     QTRGWTVGESGLSFLGMGVGLISGVILNPFLSSHFYSRSRSQLQSHLISSGHAHTHPP
                     PEARLPVCCIGAILAPIGLFWFAWTSAPPVHWIVPIIACLPFGLAFLLIFTSMTNYLI
                     DSYELYAASALAAQAVSRCMFGAIFPLFASQMYETLGLHWAGTLVAFLSLACAPMPFL
                     FHRYGPYLRRKSKYAPSIPSVALNKAGEIEQARTEDEKNEEHSAVNRRRRELEAGGIE
                     PEWAADAGLDAHTDGAGERERAWDVEKGI"
     gene            34640..36559
                     /locus_tag="CNI00110"
                     /db_xref="GeneID:3259678"
     mRNA            join(34640..34887,35024..35206,35282..35367,35441..35525,
                     35611..35936,36101..36559)
                     /locus_tag="CNI00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657760.1"
                     /db_xref="GeneID:3259678"
     CDS             join(34723..34887,35024..35206,35282..35367,35441..35525,
                     35611..35936,36101..36167)
                     /locus_tag="CNI00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513503.1"
                     /db_xref="GeneID:3259678"
                     /translation="MSSFDPFETRIQFINLLRKLNASQQSIQKVTSFAINYGSRCGED
                     LWECVIEQCNKGTLNTRINILYFLDTLVEESLALGPSEAPYGVLLTRDLKTLVDSVVP
                     DTNAGKLNLKSARQILESWRLRRVVDPSVVGEVLKSLEGRKYDSGPSQKRTHEHAFSK
                     TDIVRRMEEDRERHKRLRERIWILPIPSLLPTKNNVAAPTTLSSSTSNASPATPASPH
                     PSALVSFAQHPPQSLHLSASVSAGAGVEDDTAISENALDVEFEQIWDRVPEEGLDDDD
                     ILQMRADMRRAKLEIAPTSTAPIQTDV"
     gene            36793..37889
                     /locus_tag="CNI00120"
                     /db_xref="GeneID:3259681"
     mRNA            join(36793..36890,37030..37142,37229..37234,37353..37702,
                     37792..37889)
                     /locus_tag="CNI00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657761.1"
                     /db_xref="GeneID:3259681"
     CDS             join(36825..36890,37030..37142,37229..37234,37353..37702,
                     37792..37823)
                     /locus_tag="CNI00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513502.1"
                     /db_xref="GeneID:3259681"
                     /translation="MASPALQKSTTPGPLQNIYYERKVATEKPCYICRRPTTTVLATL
                     KMEDWLYACDGHLSDLGFASLIPPPTPASPTPAKPSPEDIRKVVAEYQAREAGRSKSA
                     AGKDKEGEGGPKDQDKGKEKGRESPKSPASPAPASTPTPAPTPTHRKFALHRAIFDMR
                     RNELKRREMGVKAREVGRGLPQVPRTGF"
     gene            38002..40316
                     /locus_tag="CNI00130"
                     /db_xref="GeneID:3259609"
     mRNA            join(38002..38087,38140..38155,38275..38337,38411..38469,
                     38708..39213,39310..39975,40102..40316)
                     /locus_tag="CNI00130"
                     /product="polyadenylation factor 64 kDa subunit, putative"
                     /transcript_id="XM_572946.2"
                     /db_xref="GeneID:3259609"
     CDS             join(38057..38087,38140..38155,38275..38337,38411..38469,
                     38708..39213,39310..39975,40102..40128)
                     /locus_tag="CNI00130"
                     /codon_start=1
                     /product="polyadenylation factor 64 kDa subunit, putative"
                     /protein_id="XP_572946.1"
                     /db_xref="GeneID:3259609"
                     /translation="MPPNASKTVFVANIPYDVSEEQLANVFSEAGPVANVEIKFDANT
                     GRSKGYAFVQFYDEATALSAVRNLQDAPVNGRNLRVELSTDEPGPRRRGPGPGAVGVG
                     AAPGAGGPGVGGPSASLGGPRPMVPAPGPGGAPPFTSTGAGAPGYPPRAPFDPRYPQA
                     HSQSHENTPPPAGVGARRQGGDDIDLRMAPQGIDLLPGQKAVDTISKTLAGIAPGQMG
                     DVMTSMKSLIQTNPDQARQLLSQQPQLAYALFQAMLLLNLVDPSVLSSIQPLAASASA
                     AASGGAASVAPGPGGAGARAPNYPPYPPPTQTQGPPGGQQAFRPPPQALYGGAPPLPN
                     QNQNQNQNQNPPYPPYPSGPGVPGGVSGAGAGIPPPTSTPVPPTPHPAHAVPVGPPGG
                     PAPPAPGLASLPPAAQAALSTLPPDQQQMLLQVLQLSPAQIAALDPTQKASVMQLRQQ
                     FLGTA"
     gene            complement(40454..42033)
                     /locus_tag="CNI00140"
                     /db_xref="GeneID:3259440"
     mRNA            complement(join(40454..41008,41076..41448,41507..41618,
                     41698..41807,41952..42033))
                     /locus_tag="CNI00140"
                     /product="endoplasmic reticulum receptor, putative"
                     /transcript_id="XM_572773.2"
                     /db_xref="GeneID:3259440"
     CDS             complement(join(40727..41008,41076..41448,41507..41618,
                     41698..41807,41952..41992))
                     /locus_tag="CNI00140"
                     /codon_start=1
                     /product="endoplasmic reticulum receptor, putative"
                     /protein_id="XP_572773.1"
                     /db_xref="GeneID:3259440"
                     /translation="MATPANATSVVDAQKRAPQELKNVVDFLRAKAGPKVRLGILNGK
                     RVEYFKGKTAIRTLLSPHYQKLKKVPPVKDEDEAKELMVRLLPFAFFLRTDRPVPETP
                     IPSGQPKPLRLSPQQSFDPLAYYTWFYDGSPLYTYLGGLAMVLIMLAGVMFPLWPVKL
                     RIGVWYLSVGVLGLVGAFLGLAVVRLVFWCVTVLTMKRAIWIFPNLFEDVGFVDSFIP
                     GWDYDEPKKKKKSGTHAKGHTHIKKHKSGSGSASGKAKHGQGHAGGVEVSSPAPSSAL
                     PTAAEVGARTEGESEGVRKRVTVEDADEE"
     gene            complement(42222..43505)
                     /locus_tag="CNI00150"
                     /db_xref="GeneID:3259652"
     mRNA            complement(join(42222..42352,42410..42512,42571..43031,
                     43112..43505))
                     /locus_tag="CNI00150"
                     /product="mitochondrial protein required for respiration,
                     putative"
                     /transcript_id="XM_572772.2"
                     /db_xref="GeneID:3259652"
     CDS             complement(join(42259..42352,42410..42512,42571..43031,
                     43112..43461))
                     /locus_tag="CNI00150"
                     /codon_start=1
                     /product="mitochondrial protein required for respiration,
                     putative"
                     /protein_id="XP_572772.1"
                     /db_xref="GeneID:3259652"
                     /translation="MARPSIRLFSLAFTPRPLGTPRVARLSLRPRTTGAHRPFGSAPS
                     GVNSTASKYTPKSSSSSISILLRPTSLILILVPILTGFLGVWQLKRLRWKLDLIEEVD
                     RNLHKEPMLLPGNINMDALPEFSFRRVLIKGQFTGPPILLGPQTYEGFPGYHLILPFL
                     RPGDGGGSSGGGGSTILVNRGFITTTRANAIRAGSQVPPGLTRDKAGKLVGNGEEVVV
                     EGLLPKTGERTVWMHENKPETNEWFWKDVEKMAEVCGGEEKGVQPVLVDALAEPDQSP
                     TLLMQQGIPVGRPAHVELRNQHAQYAAIWLSLSASTTVMLGYILTRGRGKPKTRRPKL
                     Y"
     gene            complement(43627..46288)
                     /locus_tag="CNI00160"
                     /db_xref="GeneID:3259392"
     mRNA            complement(join(43627..43827,43901..44066,44124..44239,
                     44298..44801,44855..45277,45355..45498,45557..45715,
                     45782..45893,45938..46288))
                     /locus_tag="CNI00160"
                     /product="ubiquitin-like conjugating enzyme, putative"
                     /transcript_id="XM_572740.2"
                     /db_xref="GeneID:3259392"
     CDS             complement(join(43663..43827,43901..44066,44124..44239,
                     44298..44801,44855..45277,45355..45498,45557..45715,
                     45782..45893,45938..46260))
                     /locus_tag="CNI00160"
                     /codon_start=1
                     /product="ubiquitin-like conjugating enzyme, putative"
                     /protein_id="XP_572740.2"
                     /db_xref="GeneID:3259392"
                     /translation="MFARRVPGGFPKLQFTTTTRRCLFCTSPMAPLQFQPLASQPTPA
                     FWAALAAHKLNHLKLDDSHLPITAQIEPAKRVLINKERVDDTADVGIDGSLVVGGDAF
                     EAERGRLPPNAVSVTGTLKIFNTIEEFKDTSAKKRLFDDLVSQMLESFDTDRPVLNPF
                     LLVTFADLKKYVYHYWFAFPALVSSPAWVMDGEFMPVDEIEDIRKLAQSHFQHNTTAF
                     LLKGAAPHLSAAPLSSCSTFYDKTQSEMVTVVFHDTSSLPSNPGWGLRNVLYYLSAKH
                     GITSLVVICLREGSSSTQASLSLSSPPSTAPAKPPQAVGWERHPSGKLSPRVADLGPM
                     MDPTRLAAQAVDLNLKLIKWRLLPALDLDKISGTRCLLLGAGTLGCYVARILMGWGVR
                     NITLVDSSTVSYSNPVRQPLFTFSDCLNGGLPKAPTAAKKLQEIFPGVNAQGVVLGIP
                     MPGHPISSSDDAVEKDVAKLEALVKSHDAVFLLMDSRESRWLPTVLGRKWGKVVVNAA
                     LGFDSFLVMRHGAGAGAGARRIQSDEGGVGEKGLGCYYCNDIVAPTDSLSDRTLDQMC
                     TVTRPGVAPIAAAMAVELLISVLQHPLGVHAPAERPDTAETSTSTKTSPLGCVPHQLR
                     GQMYQWKTQIVEGEAFDRCTGCSDYVLNEYETNGFAFLRRVFNEKDYLEKVTGLDELY
                     RESEKVIEGMEGLDWDSEGEE"
     gene            46326..48591
                     /locus_tag="CNI00170"
                     /db_xref="GeneID:3259511"
     mRNA            join(46326..46541,46614..46976,47028..47335,47420..48591)
                     /locus_tag="CNI00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657762.1"
                     /db_xref="GeneID:3259511"
     CDS             join(46529..46541,46614..46976,47028..47335,47420..48439)
                     /locus_tag="CNI00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513500.1"
                     /db_xref="GeneID:3259511"
                     /translation="MTVYLDDGDGKHTIAVTARLQASALAPSKPQIPPLETVKAHLGW
                     SSSSSLTAKQVSELKRKQWEMFTQDQAKYEAQRRSEGKPAVEGYDVRVGDTLRAVGVL
                     EEWSWKEGVIRQMVVSPSTGGSIQVVAPEEQYIHAQQVDHLHKTLYSRPFEMPNAKPP
                     AKTSTSLRNPTANSSNVQDVQDAEPPSSPGWHPKSDSTVLTLDDSVSDSRLASPSRST
                     SWPALVLGNSPKPKLRHPSRLPPASLTRPTFRRYILHTVISHVEAALQVLLTPEDEGA
                     DNSREGHGSDKGDGGHGDEEKKEKGKEGIERFRKALGYYFPEYRELNQTLQRDQPRPR
                     PRRGKRPRTAKETVGPLIPFTPASLLADPTLSLLGGLVLEREARARVKGLKKEIDSHS
                     PPPPIQNEYTSRRRLYKQTSSFLTPSEKERGLRGMVTTALREMAEAGEIVQVRLETAF
                     TPFLDARATHPDNNTTDTSAYLPLPPPLLFPLLVPLLLSLQSQSQSQSQSLHKHRGRL
                     ATPIPTIKLTNTLTQWGKDGRWERTTLEIVQAGMHWAQERGWVDKREGGWVLQEGYDW
                     V"
     gene            complement(48623..51673)
                     /locus_tag="CNI00180"
                     /db_xref="GeneID:3259385"
     mRNA            complement(join(48623..48933,49030..49090,49162..49232,
                     49324..49423,49492..49617,49683..49786,49881..50069,
                     50139..50255,50316..50475,50530..50768,50831..51445,
                     51498..51673))
                     /locus_tag="CNI00180"
                     /product="nicotinamide mononucleotide permease, putative"
                     /transcript_id="XM_024657763.1"
                     /db_xref="GeneID:3259385"
     CDS             complement(join(48772..48933,49030..49090,49162..49232,
                     49324..49423,49492..49617,49683..49786,49881..50069,
                     50139..50255,50316..50475,50530..50768,50831..51052))
                     /locus_tag="CNI00180"
                     /codon_start=1
                     /product="nicotinamide mononucleotide permease, putative"
                     /protein_id="XP_024513499.1"
                     /db_xref="GeneID:3259385"
                     /translation="MASTPRDGVIIPSDAVTDKELYGDVDIKETVEHVEDKSGGNIPV
                     QDGPLAAEIELLRSMPPEDLAIEERKLLRKIDFTLLPTLFVLLILNYLDRNALASARV
                     QGIEKSLGMVGTQFNSAISLLFVGYILGQIPSNLILSKTRPSIYLSVCVMVWAIVSLC
                     TGFVQNYHQLLAVRILLGFTESPYFPGALFLLSTWYTKKELAYRTAFLYTGSLLSGAF
                     SGLIAAGVQNGLDGKLGMESWRWLFILEGAITGFAALVAIFVLPDYPATTKWLSTREK
                     AVAVWRMERDGGSRDEDDEGLFHSLKLALCDYRLYLLATVIITKTTAGAVTQFFPTVI
                     ATFGFNKVITLLLLAPPYLVTAVLSLLISRLSDRRPERCFHLALPLTVGMIGYIIAVS
                     TLKTGPRYFSLFLMLGGLFGSYNVALAWISSTFPRPRAKRAAAYAIINSLGNIAQIWS
                     PYLYPSTDAPRYTTAFATNSVMAAVAILFCFVLRFFLKRGNAKMDREDAEAEARGEAS
                     EERVRYVL"
     gene            51920..53567
                     /locus_tag="CNI00190"
                     /db_xref="GeneID:3259572"
     mRNA            join(51920..52382,52435..52533,52594..52745,52800..52994,
                     53063..53227,53285..53567)
                     /locus_tag="CNI00190"
                     /product="tartrate dehydrogenase, putative"
                     /transcript_id="XM_572763.2"
                     /db_xref="GeneID:3259572"
     CDS             join(52111..52382,52435..52533,52594..52745,52800..52994,
                     53063..53227,53285..53526)
                     /locus_tag="CNI00190"
                     /codon_start=1
                     /product="tartrate dehydrogenase, putative"
                     /protein_id="XP_572763.1"
                     /db_xref="GeneID:3259572"
                     /translation="MSPVRVPSHGDGWASTPQTKQVYSIASIPADGIGPEVVEAAITV
                     LKAIAKKRGTFQLDFTNFDWSSETYKKTGRYVPDNHLDILRKFDAILFGAVGAPDVPD
                     HISLWGLRLAICQPLQQYANVRRTRVLPGTESPLRNCKPGQLDWVIVRENSEGEYAGH
                     GGRSHNGYNHEVATEISIFTRVGVERIARFAFQLAQSRPRKKLTYVTKSNAQRNGMVM
                     WDEVVNEVAKEFPDVELDHMLVDAMTVRMVLHPESLDTIVATNLHADILSDLAAALAG
                     SIGIAPTANLDPSRQNPSMFEPIHGSAFDITGKGIANPVATFWTAVEMLEWLGEKEAG
                     QQLMEAVEAVCVDGIKTKDLGGSATTKEVTDAVVKRILQG"
     gene            53927..57225
                     /locus_tag="CNI00200"
                     /db_xref="GeneID:3259769"
     mRNA            join(53927..54121,54182..54212,54307..54774,54832..55034,
                     55095..55222,55292..55348,55404..55494,55569..55738,
                     55793..55939,56005..56205,56285..56504,56572..56739,
                     56827..56945,57022..57225)
                     /locus_tag="CNI00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657764.1"
                     /db_xref="GeneID:3259769"
     CDS             join(53990..54121,54182..54212,54307..54774,54832..55034,
                     55095..55222,55292..55348,55404..55494,55569..55738,
                     55793..55939,56005..56205,56285..56504,56572..56739,
                     56827..56945,57022..57172)
                     /locus_tag="CNI00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513498.1"
                     /db_xref="GeneID:3259769"
                     /translation="MSPPPTRARQSSESEPSSANKRARITRHACERCRAGKKKCDGQL
                     PCSACTLSKKECIFSAQRRRLRIPVPNLIDNPTNSSTPSRHIRDQGQYQSPIMFPSIA
                     SSSESYERQSRYNSPSRQHTAGHDGSHTNDMSMGIAVEVEGASEVRARDHDREDGRED
                     RQGHEVHSQNHEHTLARIAHVMANGTVSRYPSPGLTILSPADGRPIVARETDISAKGD
                     LLDRLHRHLTVVFSLRSFPKGHLGEELKDENDNKTRGAGELFFLPSCEDGKAYIRCYF
                     EHATSTYRYLDRRNIEQLTDDFYASNGSLSQKDDVVLLLLLMAIGCLWTPSWTGADPQ
                     MMTQKALQLLRAAQRQLETLSLSQPRLRMVQVHIALCHLYLGMSHFRSAWLAFGTAAR
                     LSQLLRLHRKSPDGTPQELDEPRRQAFWSGYMMDRYLSLVLGCPVIYDERDITQRFPS
                     YPDSGDHSVDTQDEAQRLAGSIAHIKLSQILGHALRKLQSPGELSDLERSLAVQSLNQ
                     ELDRWLAETPRFFHPDGPDTYDLGPFASVPPFFQRQQQIVRSAYHFINLFIHRSFLLD
                     QFINRIPASQPLPPLTVMSPEVTVCVESAISIAKSVSKMRDSPGAKGTFWNSAYFCFA
                     SLTVLLVYLMVYEDAPRRAEIESMIEAAMEGHIQLTGSTRREREQILEESKRISELLR
                     RRQEEPEAAGSKSQYIPPPWPGMEDPFLGSAPNWDPLWQNTLDMLGLDTSMGLGLPLG
                     MGMIEEGGVNAATSSGAFGFL"
     STS             54633..55422
                     /locus_tag="CNI00200"
                     /standard_name="Xba4"
                     /db_xref="UniSTS:470717"
     gene            complement(57219..58493)
                     /locus_tag="CNI00210"
                     /db_xref="GeneID:3259685"
     mRNA            complement(join(57219..57355,57413..57486,57561..58183,
                     58251..58493))
                     /locus_tag="CNI00210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572771.2"
                     /db_xref="GeneID:3259685"
     CDS             complement(join(57232..57355,57413..57486,57561..58183,
                     58251..58401))
                     /locus_tag="CNI00210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572771.2"
                     /db_xref="GeneID:3259685"
                     /translation="MTATAQIPGGVMVQQTAAFVLSQLARHRSSWNKETVCPPLIVGV
                     QGPQGAGKSHLTGLLPAYLEKHYDLRLATMSLDDFYLTHSDQVKLAQSEPDNPLLSGR
                     GPAGTHDLPILEQCLAKLKSINDRVSAKSPTVTKGQSLQLPIYDKSLFKGEGDRSKEV
                     VEVQGPIDVVIFEGWMNGFGPLSNDKLEERYAEAGRQWPSSSLNDPARVMPTILLYSR
                     STLHSINQNLRQYEVLWDQIDCFVQIRPLDLSYVWSWRLQQEHNMKAKNGGNGMTDEQ
                     VRHFINRYMPSYELFQDGIDKETSSWSGKGLRFIVNIQREIVGTESF"
     gene            complement(59067..59158)
                     /locus_tag="CNI00220"
                     /db_xref="GeneID:3259800"
     tRNA            complement(59067..59158)
                     /locus_tag="CNI00220"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3259800"
     gene            complement(59343..61061)
                     /locus_tag="CNI00230"
                     /db_xref="GeneID:3259501"
     mRNA            complement(join(59343..59746,59809..60160,60224..60431,
                     60487..60619,60674..60736,60801..61061))
                     /locus_tag="CNI00230"
                     /product="eukaryotic translation initiation factor 2 alpha
                     subunit, putative"
                     /transcript_id="XM_572732.1"
                     /db_xref="GeneID:3259501"
     CDS             complement(join(59633..59746,59809..60160,60224..60431,
                     60487..60619,60674..60736,60801..60833))
                     /locus_tag="CNI00230"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2 alpha
                     subunit, putative"
                     /protein_id="XP_572732.1"
                     /db_xref="GeneID:3259501"
                     /translation="MPRFYENKYPEVDQLVMVQVQSIEDMGAYVKLLEYDNIEGMILL
                     SELSRRRIRSVQKLIRVGRNEVVVVMRVDPDKGYIDLSKRRVSAEEVVKCEEQYEKGK
                     AVDSIITQVAKKRGVTPESLYEKIAWPLHRQYGHAYEAFKLSISEPEAVFGSLELDEE
                     TLADLRSGIARRLTPKPVKVRADIEVKCFSYAGIDAIKRALTAGEAVSTPDVPIKVRL
                     VAPPLYVMSTTSTDKNAAIELMEKAVEVIGETVRKDKGDITIKMKPKVVSETEDAELK
                     ALMEQFEAANMDQAGDDESSEEDE"
     gene            61236..62510
                     /locus_tag="CNI00240"
                     /db_xref="GeneID:3259774"
     mRNA            join(61236..61627,61695..62114,62173..62256,62315..62510)
                     /locus_tag="CNI00240"
                     /product="enoyl-CoA hydratase, putative"
                     /transcript_id="XM_572730.2"
                     /db_xref="GeneID:3259774"
     CDS             join(61330..61627,61695..62114,62173..62256,62315..62364)
                     /locus_tag="CNI00240"
                     /codon_start=1
                     /product="enoyl-CoA hydratase, putative"
                     /protein_id="XP_572730.1"
                     /db_xref="GeneID:3259774"
                     /translation="MLARTLLKPSQSTYRLTIRAMSTSAEQLVIPSRSPSNNVAILTL
                     NRPKALNALSTPLFNALNSELEKAETDESVRAIVITGGDKVFAAGADIKEMKDKEFAE
                     AYTSNFLGSWNQIASIRKPIVGAVAGYALGGGCELAMLCDILVASPTAVFGQPEITLG
                     IIPGMGGSQRLTSLIGKARAMDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKV
                     AENVSKFGKVAVQAGKEAVNGSLDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKR
                     KPTWSDK"
     gene            complement(62598..64292)
                     /locus_tag="CNI00250"
                     /db_xref="GeneID:3259702"
     mRNA            complement(join(62598..62880,62980..63064,63136..63393,
                     63477..63570,63636..63752,63808..64059,64139..64292))
                     /locus_tag="CNI00250"
                     /product="DNA-binding protein"
                     /transcript_id="XM_572770.2"
                     /db_xref="GeneID:3259702"
     CDS             complement(join(62799..62880,62980..63064,63136..63393,
                     63477..63570,63636..63752,63808..64059,64139..64228))
                     /locus_tag="CNI00250"
                     /codon_start=1
                     /product="DNA-binding protein"
                     /protein_id="XP_572770.1"
                     /db_xref="GeneID:3259702"
                     /translation="MSDKQQLIDMGFDPARIDWALRATNKAGLQPAMDHLLANSDKPI
                     PEAMDEQVDEDDEEAVAAHIKKLGGAVDDSDAVAKSIKCSECGKIFRSQATASFHAEK
                     SGHDQFEESTEEIKPLTEEEKKAKLQELREKLAIKRATQSKEDEKANRANEAIRRKAG
                     QDTGKVREDLKLKEALKDAEQKKREKLEDQKARAAIKAQIEADKRERAEKAAREKALR
                     EGKAIPTSSSPVPTIVPKANTGMKSSENPETRLQIRLATGGTPMTKTFPSDNTLIDVA
                     EWVASEKLEYNVDTIGFSMTFPRKTFSREDMKKSLKENGLTPSAVLIAS"
     gene            64417..65207
                     /locus_tag="CNI00260"
                     /db_xref="GeneID:3259696"
     mRNA            join(64417..64706,64768..65207)
                     /locus_tag="CNI00260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572728.2"
                     /db_xref="GeneID:3259696"
     CDS             join(64455..64706,64768..65037)
                     /locus_tag="CNI00260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572728.1"
                     /db_xref="GeneID:3259696"
                     /translation="MPPFATRPLNSTKSHPIFAQIRRHPFILFGIPFIGIIVGSSFAL
                     QAFTQTRYDYQETKVKSVGKEEELGMKSGRRKIDLKEEYYRLNNPTGDDSSLENSLAM
                     PSSFSSPSSLDASLASAPTPPKKKKFSMASVSQDDYEPVRVPRPVGVPEWGGGRSGEE
                     APMKGYRKEDRWV"
     gene            complement(65233..68799)
                     /locus_tag="CNI00270"
                     /db_xref="GeneID:3259614"
     mRNA            complement(join(65233..66150,66239..68081,68131..68799))
                     /locus_tag="CNI00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_572967.2"
                     /db_xref="GeneID:3259614"
     CDS             complement(join(65484..66150,66239..68081,68131..68782))
                     /locus_tag="CNI00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572967.1"
                     /db_xref="GeneID:3259614"
                     /translation="MNRHTPTPSSHLTSSPPLSYTWSDTSGENDMRPREGNRAPSTST
                     SVWSDEGTAVPRHGDGDDDYGYADEDGHELKGNGVKEGKLIDYDDEPQPHQREMAPGD
                     KLRDLLRQMDEEVRRAAPSESKETVVARQWMGYTRPRQFQPDARDEEIEEEELEEDQE
                     EMREGASPARSSSVTEQESPPTPPPRFGNPYSRRSERRGSPAFAQGRLPSRAAVLLQS
                     TSHMDEGLRAVIEPEPEAKHQQKSPPSQLHAYIASHPELRSSSSSRTHQPVPQSSRSR
                     SKRKEKEIEQDYESEHEPSSPSRHHFEKELSQSASRRHYRTAYSPSRASPPSNALPST
                     ASSHRYPTSPRPLEPKYQHRPIPPTPRRSSIDPLPSTHDEFAMHLKGLEVRAEVELDL
                     DEGVSAVGWEESTVEGDEEEIMYEDGVDRSGHRDRSGTARPDSSRGENLYTHSQSRES
                     LYQAASRSHSSPLSRRLPTSSPSPPALPDLPSHSISGSEEEQEIDTYSLRRARMFSGE
                     RKGKMPMVGNGSDASASASASRSRSYSRSLSVRLNEDEDKEATKEYQMEDEAVKYNAP
                     GEKFLEEVWEGGGVTIEREQSNYHSSDRSSRTPLPTNHRHTPSPVRLPVRHSRARTPP
                     TTFQTGTTPSSTTTSPGQRQPQTLLSSRALSQSQSPTQTPKFPTPLPSSQSNANPVQK
                     QLATPSHSHSQTLALGPTPRPPGAWNITPFPQRPQREPEPPRHQDQIASESGSKTGRV
                     RFSPLRYEATIHREDYEREDEMEKKGKREEERGDVSILTLSLSPRHKNPKSPKSPKNS
                     KSRTSPERQIREGKMDGDIGDISWTAKLARSVTSRISIPMRSTTYNSHLPQLTSAHTH
                     TQTASSKLQTAQQSWLAALSSISTSHPHLHQHNQHAPSNSPTSLALRTSQTLGKGMNK
                     AVGWSRWVWWVLMEMVLLWAVFRVTLDYAGSGVYLGRDPFHPLSRPLGLGPPPSLSSP
                     PSFSVGGTPDMMERDRETNAQRQWAKASRYVNLEIPIPGSLKTLVGKQGSANFFDLVE
                     SWGWGTAFFGEGEPAGTWAGVPT"
     gene            68996..71264
                     /locus_tag="CNI00280"
                     /db_xref="GeneID:3259667"
     mRNA            join(68996..69700,69752..70988,71054..71153,71247..71264)
                     /locus_tag="CNI00280"
                     /product="expressed protein"
                     /transcript_id="XM_024657765.1"
                     /db_xref="GeneID:3259667"
     CDS             join(69061..69700,69752..70314)
                     /locus_tag="CNI00280"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513553.1"
                     /db_xref="GeneID:3259667"
                     /translation="MELSSNTDDDLRDVFKLLYADDDWALTSDSELDDSEQLGNADGS
                     EIDVADDEEQHTIRIYSGRITKKRLFSALDSLLSPGYETDTKRQRIYNPPAPSIPSLI
                     LSTQPMPALPLSKVYAPFSALSLLSRLMTFQPYTYSPQHPLTLSPVRAAMKGWVNEGR
                     EGLKCDVCGARWGLGGLEKVRDEAMKSNLGERLAKGFEERHEKNCAWRICASPGNLYE
                     QLRHLVHPPITSSLAPLASHLLLECLALPSLRLLSPLNPLQVERLVSLFKPSSTFSIP
                     SPATDVASQLALFGWFPYHPNYPTIQISLNTPSSRTEIVCCRICHRRIGLWNFSNEKD
                     GVKRFDVLNEHLVWCPVRIQDGEKEWWSESGLLDGQSTQAKRIGEGGIKGLVKVSEKM
                     EKRSWRRS"
     gene            complement(70484..72410)
                     /locus_tag="CNI00290"
                     /db_xref="GeneID:3259791"
     mRNA            complement(join(70484..70724,70795..70893,70977..71142,
                     71236..71247,71310..71411,71490..72410))
                     /locus_tag="CNI00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657766.1"
                     /db_xref="GeneID:3259791"
     CDS             complement(join(70630..70724,70795..70893,70977..71142,
                     71236..71247,71310..71411,71490..72275))
                     /locus_tag="CNI00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513561.1"
                     /db_xref="GeneID:3259791"
                     /translation="MRPALTLLALLPYLGGTFANTCRAAGTSDAATTAAATVAASGDV
                     SGTSVIGDNLLAGSNTAAGGDANTAKAASVSSGGVAVSATDSSAASATSAAASSAFTG
                     DQYYASSASSVVSASASSAQSAAYPQGSQMGTDLVLSNPSGDCKCGYSISSLNDEYFP
                     YKFAYTFSALSDGDATDGLAAAGWVVNDGEYVGGAANGNRCWGNKDNVNIDSGDLVLT
                     VPKDQTASPNMECAEIAFNETNLFEGVFQTEALLSGVDGTCQAFWLNHSIATQYADEL
                     DIEVISSTIDTDGVWYSNWPPNGDPNNPDSLTSAHTNAPFPDISTNDPRKTYNNYTIA
                     WLSSSTTRYYNGAKQDSPTENQPEHSMIFTINNWSNGGTGWTQGPPTGEDSDLRVKSV
                     LLYYRTQDVQDMATLDSSCTDSDVCKV"
     gene            complement(72780..74931)
                     /locus_tag="CNI00300"
                     /db_xref="GeneID:3259679"
     mRNA            complement(join(72780..73588,73645..73867,73922..74089,
                     74147..74349,74404..74601,74663..74931))
                     /locus_tag="CNI00300"
                     /product="GPI-anchor transamidase, putative"
                     /transcript_id="XM_572769.2"
                     /db_xref="GeneID:3259679"
     CDS             complement(join(72874..73588,73645..73867,73922..74089,
                     74147..74349,74404..74601,74663..74817))
                     /locus_tag="CNI00300"
                     /codon_start=1
                     /product="GPI-anchor transamidase, putative"
                     /protein_id="XP_572769.1"
                     /db_xref="GeneID:3259679"
                     /translation="MSLLARFRRRNPPPPPDPNSVNYTAEHVALAKTIARRQKLSRIF
                     WKNVSKIQAALTFIGVLWLLALPYEGLWKRTYVDEHALQPAQVAVYFDWANVHKADVY
                     LGELERLSSSNSTFTERTDYLQNAFSAAGLHTGNTTTATYAHVTPPRATGMETILVSA
                     NWLSRDGGENLRGVATLLAMGDFLRGQNHWAFDFVLVVGEECQSGLAQFMEQYHSLFS
                     GVIWTGLNIDYPGHSFSHLGVFYEGTNGRLPNQDVINTVSRVAQYTGQVPLRYHDIPD
                     EPLHGIAWLGKYLLGAKHLLHHFAYAALGRASAGHGSLAKYRIDSLTLYCTPATGPHG
                     FHTLGRTLESTLRSFNNLLERLHASYFFYLLPSPNHFIPVGNYLPAAVLLGASLTVGG
                     FDCPSPLEGLVYMSFAFGSALLLWVTGLPTYLFFPTFLFFPRPRGLAHKSLESMSLLL
                     YGALIPTLAMVNFPQSIFLAFLAHLYLRLPGKWPRLVTLAVTPLAIGLAMQGFGKVDL
                     EREWRELGNFGWVGFYVAWIPLWMLGTMLFLGKEKKASGGVVENK"
     gene            75152..78949
                     /locus_tag="CNI00310"
                     /db_xref="GeneID:3259521"
     mRNA            join(75152..75707,75765..77049,77099..77343,77414..77485,
                     77551..77890,77966..78015,78093..78949)
                     /locus_tag="CNI00310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572764.2"
                     /db_xref="GeneID:3259521"
     CDS             join(75611..75707,75765..77049,77099..77343,77414..77485,
                     77551..77890,77966..78015,78093..78742)
                     /locus_tag="CNI00310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572764.1"
                     /db_xref="GeneID:3259521"
                     /translation="MWRTTKQWRPPPIHLLLWLVLVVVVGLLTPVDARSPHPAPLRRA
                     TTATSHLSILPRRPKNGLVPRHSTLLPPPPSTLKHSDTLVLTLDLPDLLPFEVKLFVK
                     PSEHMFHPDARIKHGEQVIGELREEDWRLYTGEVVHPSYIDRLTTLHAIGAHQPLSER
                     SQILGRASVIVHHPGDLDGHDAVWEGSFTVGGELYNVVTRENYERVKTWEDVNVQGMG
                     RMVIFRQSDMRHDQGTNKTIPSCSHDSLAFNDLSNPVFNTFSTHDTSSYSFLNPLGMF
                     WKRDDTGGMTGSSNYISTINDTSGCPDTQKIVYMGVALDCNYVAAYGSPDAARTQVLN
                     NWNQVSALYKSAFKISLGIIELQVQNITCPSTPVSGEEWNVGCDANITLDTRLGDFSA
                     WRGAKGDDGAGLWHLMSACPTDSEVGVAWLGTLCQTDSSEQSSGTVSGTGISTATKTE
                     WSLIAHEIGHGFGAIHDCTSGCSLSGSCCPLTTSTCDANGQFIMNPTTSTTEQTFSGC
                     TLGNICSNIGNRAVSTSCIETPGARDVISLQQCGNGIVEDGEDCDPGGNTTSTCCDSS
                     TCKFTSGAVCDPSNSACCTSSCQYSPSNTTCRPAVNDICDYAEYCTGTSASCPEDKTA
                     EDGTSCGSDGLECASGTCTSLDKQCSTAGATMGLSEACGQRDDTSCVVTCKDPNSTSS
                     CVVLQTPLVDGSPCGYGGHCYNQTCESGSWQATVAAWYRQNLQIAIPVTIIAGLIILA
                     ILFFIARCIYRSCCGRRGARAGGAARNTKYVPANGDAYYGPPPTQSGGGAMPMSAVAA
                     PQPALQRGYESRASVEPLMAGSGSGVGAGYGRPNTDYDHDHRQVYPPGQRYSQGYGDT
                     FEGQGYEYNQAPQYSSFAPGTGGGGGGGGVYGQTGGWVDDRTWNGQYYGRQEAYGR"
     gene            complement(78845..80695)
                     /locus_tag="CNI00320"
                     /db_xref="GeneID:3259480"
     mRNA            complement(join(78845..79145,79228..79500,79577..79669,
                     79729..79792,79850..79921,79972..80053,80108..80402,
                     80451..80695))
                     /locus_tag="CNI00320"
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     putative"
                     /transcript_id="XM_572768.2"
                     /db_xref="GeneID:3259480"
     CDS             complement(join(79003..79145,79228..79500,79577..79669,
                     79729..79792,79850..79921,79972..80053,80108..80402,
                     80451..80577))
                     /locus_tag="CNI00320"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     putative"
                     /protein_id="XP_572768.1"
                     /db_xref="GeneID:3259480"
                     /translation="MTNPLLAHFQDTFFPPCRVGINGFGRIGRAAFRASLERDDLIVV
                     AINHTAPSIDYLLHAIKYDSTHGTSRHANDLSIKDGALYYKDRRIELFSQRDPLLLDW
                     KSAGVEYVVESTGKMTTVATASAHIKSGARKVVISAPSKDAKTIVVGVNRKDYDSSMS
                     VVSNASCTTNCLAPLAKVLNRAFGIEFGMMTTVHASTSSQPILDGYSKKNRRLGRGVG
                     SNIIPTTTGAATAVQLVLPELAGKFTGVSVRVPVDNVSMVDLTVRLNKPVASKEELFR
                     PIREASTGLSSLGPLANVLCVNDDELVSRDFLGWQHSCIVDSAASVMLNDRVFKIIAW
                     YDNEYGYACRLLDLVRFIHEYDNGKVPTPTPSGVQTPSGVHTPILRSI"
     gene            complement(81166..81257)
                     /locus_tag="CNI00330"
                     /db_xref="GeneID:3259801"
     tRNA            complement(81166..81257)
                     /locus_tag="CNI00330"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:3259801"
     gene            81384..82739
                     /locus_tag="CNI00340"
                     /db_xref="GeneID:3259420"
     mRNA            join(81384..81629,81691..81942,81999..82102,82160..82251,
                     82370..82739)
                     /locus_tag="CNI00340"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_024657767.1"
                     /db_xref="GeneID:3259420"
     CDS             join(81883..81942,81999..82102,82160..82172)
                     /locus_tag="CNI00340"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_024513509.1"
                     /db_xref="GeneID:3259420"
                     /translation="MRLQAKSLKSAPPIDVLINNVSFAVAANAPFWEQDLDNVASVMD
                     VNLSGAYDYYSCCA"
     gene            83039..84852
                     /locus_tag="CNI00350"
                     /db_xref="GeneID:3259568"
     mRNA            join(83039..83175,83312..83467,83565..83686,83769..83870,
                     83936..84319,84389..84852)
                     /locus_tag="CNI00350"
                     /product="expressed protein"
                     /transcript_id="XM_024657768.1"
                     /db_xref="GeneID:3259568"
     CDS             join(83152..83175,83312..83467,83565..83686,83769..83870,
                     83936..84319,84389..84740)
                     /locus_tag="CNI00350"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513510.1"
                     /db_xref="GeneID:3259568"
                     /translation="MEKYSNWRPFLPPVSPRSGSSLFVAFLAPLCVVHSLVRGVLLAV
                     LGTLHVLFVDWLCLLFVPIPPLYRAVNGCLTALTCRLALALMGYWWISTEMVSPRRGK
                     TGVSQISKRAPRRGDLILANWTSYVEVLYLAFRHNPTFLLPVYSNDIFQELPKTGRHT
                     GTGSAAINTPTAVVQPPFLGYLPYTLTSLLARTGLPPAQYDVPPNGVYKTLREARRKE
                     KRPVVLFPEGTTGNGRAILKFGEGILAEGDVGGDDEGIVWVKFFRHSPPTAFSPSATC
                     PLPTPLKHLFFSQLYTPTPYSRRSLHIRTLHPAASPSSPSFLPGEILNNQPGGLDAAG
                     KDHKSVWREACAVVLAEVGKVRRVKGMGWAEKKAFLEYWARGGRR"
     gene            85573..87613
                     /locus_tag="CNI00360"
                     /db_xref="GeneID:3259731"
     mRNA            join(85573..85732,85834..85926,86250..86725,86786..87277,
                     87341..87613)
                     /locus_tag="CNI00360"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_572726.2"
                     /db_xref="GeneID:3259731"
     CDS             join(85583..85732,85834..85926,86250..86725,86786..87277,
                     87341..87422)
                     /locus_tag="CNI00360"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_572726.2"
                     /db_xref="GeneID:3259731"
                     /translation="MPFSDKLLFISFIVLLLSIILYITPQPQSKDTMPTALRNVIVVG
                     GSYVGSKAAQELAVVLPPTHRVLLVEPHSHFHHLFAFPRFAVVPTHEHKAFIPFTSVF
                     NDSAIPNPSIHAVVRAKVNAVYPTHVSLDRAWQGETDISYDFLAIATGTRLPAPGSMQ
                     SEDKSNSVEYFKTYQEGVKEAKDIVIVGGGAVGVQMACDIKEVSPEKNVTLVQSRDRV
                     MPKFHPKLHEIISNRFKELGVNLVTNNRVTVPAEGFPNDGSTFSVALKDGTSIPAQLV
                     IPATGQIPNSQLLSTLPPSSTDSLVNPANGFIRVRPTLQLQDTKYSNIFAVGDIADSG
                     AHKAARPAMQHVKVLARNIVAMIDGKQPEEKIEVEPAAIHMTLGLIQNIVFRNPNIAT
                     GDTEPFYKFRDDGKPDMGIEDVWARRGVVVNDPSEYFL"
     gene            88961..91905
                     /locus_tag="CNI00370"
                     /db_xref="GeneID:3259516"
     mRNA            join(88961..90067,90146..90361,90409..90527,90575..90756,
                     90803..91098,91150..91389,91441..91905)
                     /locus_tag="CNI00370"
                     /product="D-aminoacylase, putative"
                     /transcript_id="XM_572724.2"
                     /db_xref="GeneID:3259516"
     CDS             join(89783..90067,90146..90361,90409..90527,90575..90756,
                     90803..91098,91150..91389,91441..91776)
                     /locus_tag="CNI00370"
                     /codon_start=1
                     /product="D-aminoacylase, putative"
                     /protein_id="XP_572724.1"
                     /db_xref="GeneID:3259516"
                     /translation="MSLVQSSSDILFISPTVISGEEYVQPFIADVLISGGRIARIAQP
                     GTLSDQLGAEVRKVEATGYVLCPGFIDLHAHSDLYLLTHPDHEAKISQGCTTEVVGQD
                     GISYAPVQTKAQMKAIREQITGWNGNPNEEDHPGVGLFEWNTVGEYLDCLERNKTATN
                     VAMLVPQGNLRLLACGPWDEVATADEITVQEKLLRQAMLEGAVGMSSGLTYTPGMYAS
                     TSELARLCRVLGEEFPGAFYAPHHRSYGFKALESYAEMLGLGRDTGCPIHLTHATLNF
                     SENKGKAPLLISMIDAARSDGCDISLDTYPYLPGCTTLAALLPSWASSGGPAETLKRL
                     RDEISREKIRRAVEDTGCDGGHGIPTNWDEIQIGSTTHPDLASYSGRRVSEVARSLKV
                     PSIKVFFDVLIKDKLATSCIMHIGNEENVREIMCHETHCSGSDAILHGKTLHPRAYGT
                     FPRFLGHYARDLGIMPLPAMVAHLTSRPAKRLGVYPSRGLIAEGSVADIVVFDPEAIR
                     DKATYEKPKQKAEGIRFVLVNGEVAVDETRLTGMRGGKVLRRREGGKVW"
     STS             89939..90747
                     /locus_tag="CNI00370"
                     /standard_name="Xho2"
                     /db_xref="UniSTS:470721"
     gene            92120..94120
                     /locus_tag="CNI00380"
                     /db_xref="GeneID:3259405"
     mRNA            join(92120..92694,92745..92878,92935..93128,93220..93317,
                     93371..93581,93639..94120)
                     /locus_tag="CNI00380"
                     /product="expressed protein"
                     /transcript_id="XM_572767.2"
                     /db_xref="GeneID:3259405"
     CDS             join(92499..92694,92745..92878,92935..93128,93220..93317,
                     93371..93581,93639..94065)
                     /locus_tag="CNI00380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572767.1"
                     /db_xref="GeneID:3259405"
                     /translation="MSTFTPLSLYSLPSKSALVDEFVGQPLSALRTPALIVDRKKFKD
                     NCERVASNAKERGMKFRAHVKTHKTTEGTRMQVEAAGGVKATIASTMVEVWQIVEAGL
                     VNEGLVNDILYSMPISADKLEDINSVQEIVGAQATIRLMVDHAEQIRILQSFSQKIQR
                     PARWSVFVKVDGGGKRAGAPAESEQMKELIQALVESQDYVEIFGFYSHFGQSYASDSL
                     SAGSSYFAGEINCVQTAAKIARNLGAKGKWTLSVGATPTAHAAVQEAVKEHGPLEGEL
                     ELHAGCYCMCDLQQCATSLVSYSDVAISVLGRVVSVYPLRKEAMCDVGALSVSKDTGR
                     FTGFGRVVKPDYATGWDLGRISQEHGTLVHRQGEDIKEGNELKIGNSVQIIPQHACLV
                     CACFPWLYVVDDGGNEVVDVWVPWKGW"
     gene            complement(94093..97063)
                     /locus_tag="CNI00390"
                     /db_xref="GeneID:3259482"
     mRNA            complement(join(94093..94611,94660..94817,94863..94912,
                     94965..95082,95136..95597,95636..96068,96115..96680,
                     96734..96761,96839..97063))
                     /locus_tag="CNI00390"
                     /product="expressed protein"
                     /transcript_id="XM_024657769.1"
                     /db_xref="GeneID:3259482"
     CDS             complement(join(94327..94611,94660..94817,94863..94912,
                     94965..95082,95136..95597,95636..96068,96115..96680,
                     96734..96761,96839..96904))
                     /locus_tag="CNI00390"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513494.1"
                     /db_xref="GeneID:3259482"
                     /translation="MEPDMFGFKCAHPGCQKTFTRKDHLLRHAANHSQTSYNCPTCRR
                     EFKRYDLLQRHEKRNICGEDPTGSNPFKRSRSESGSQEESAVQRASLPPPINTTTGQQ
                     PGPSSSQTAIFPITSSSTAVPMNAPYDGSLQIPNSSNPPVSDFSVGDIMGDWGFSLWA
                     PEQWEALLHETLAPPFNEPMVDMPWDMPMLPRVQQQESAERGQDNVASAMLVARLQSS
                     FPEFDVPLSWVIEALQTYWTRTAPTFPFIHRGTFDLDTAPTELVLMMAIIGSVHMTPR
                     RDFSHLVQKIRGVLVQECGLDMPISTLQTFCLCHVHDTWYSTAESQFVAQCMWPVMVA
                     HSRKKGIGVVGKPENEIHQEEAWAAWAKEEERRRAAYCVLLIDTQLSAFWNQHCSRQL
                     SIFAHHLTLPCTRRQWEAPTAQEWFRMRGPPPSTPPTPRKSNARSGYLPGLHPEFQVS
                     TVSDGYSSAILAALALEKLSFKVDLENSLTVQMVLIGLIAIAWDCRTRGGMGIRFREG
                     TKHWRSIVFKAVINMRATYEAEVIRMGDAIESRDLRDTFAICNISILSDIPMLCVAAG
                     ATTFCGSTIGPRQYSDAKRRLKLWAKTEDAWTCVWQCARYLRQALFADWGLYTPWAVF
                     LTTLVCRAYNWTSATPESTSQRRQHPTTYSTAHLPIIDRQATIIAWLDKILQTPGRHE
                     STDGEVDALIEYVAGQLELGESTARENAAMLRMLIGHKR"
     gene            complement(97644..100322)
                     /locus_tag="CNI00400"
                     /db_xref="GeneID:3259747"
     mRNA            complement(join(97644..98309,98363..99799,99860..100001,
                     100073..100322))
                     /locus_tag="CNI00400"
                     /product="expressed protein"
                     /transcript_id="XM_572950.2"
                     /db_xref="GeneID:3259747"
     CDS             complement(join(98420..99799,99860..100001,
                     100073..100224))
                     /locus_tag="CNI00400"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572950.1"
                     /db_xref="GeneID:3259747"
                     /translation="MALELLYHSSSPSLYPTNTSSSLLVIRFSGPVRVSSVRITPEGV
                     RCPDGSGVTYPSNWTGQLLFNVSPSNPVNALLSTNITYNAALHPVDYPIDMPQGTTSR
                     MMMLRAPVEKLSISVYGNTDESPGDDPEQENAVKEQRPSELALEKEDPSWLWRWAGDS
                     PDCLIDLLNAYTRPEVISRTLECLDLLSDLDDSIIPSLLERPNALEYLFRIPTSTFSS
                     KIKNNYKWAFHPSVEPLLATDHPFVPLLGPDTSARHAAAWQRLSLGKAALACLIDLGA
                     SVREDDLMRVEKGEEKSNLARLLEMGEKFAQGEDGEGLDMVLDLLDSAELEIVDSIIA
                     QEYLARTIPRLSVIAIALSKNGNRRGNGAIRSLKIGEEHARLVVNALLLCSTEIINGK
                     LTFSIARKLAEPYLPRLESSDPLRIVFTTSHPSPTADALSDPDPTARALARLSHAISS
                     SSSSLALDTSIVPSFSPPLSSSSITHILPPSTILTFLAPHFTSILSTAISPPFGIQPS
                     ATYTSPEMQGANVWAGKVYTSHEFRSRELVGLGIGPGGRAASKHVDEYA"
     gene            complement(100489..102438)
                     /locus_tag="CNI00410"
                     /db_xref="GeneID:3259649"
     mRNA            complement(join(100489..100722,100798..100968,
                     101027..101402,101480..101639,101700..101771,
                     101821..101920,101983..101990,102085..102280,
                     102342..102438))
                     /locus_tag="CNI00410"
                     /product="MAP kinase, putative"
                     /transcript_id="XM_572813.1"
                     /db_xref="GeneID:3259649"
     CDS             complement(join(100572..100722,100798..100968,
                     101027..101402,101480..101639,101700..101771,
                     101821..101920,101983..101990,102085..102280,
                     102342..102388))
                     /locus_tag="CNI00410"
                     /codon_start=1
                     /product="MAP kinase, putative"
                     /protein_id="XP_572813.1"
                     /db_xref="GeneID:3259649"
                     /translation="MDNTPRHLFQTPNNVYILQQPWQFVKELGQGAYGCVSSARNSST
                     GETCAVKKVTNVFQKKILTKRCLRELRLLHHFRGHKNITCLYDMDIVFDPPGSGQFRE
                     VYLYEELMEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLV
                     NADCELKICDFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSID
                     MWSVGCILAELLGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLP
                     IKPRVKFETLYPNASPLALDLLSKLLTFDPAKRYGCEEALEHQYLAVWHDPADEPLCE
                     VPFDFSFEEEDSVSGMRDLILEEVRSFRYLVRQQSMPPARKDSHELPPAPPAPQHPGA
                     GVGPAFHERANSEGDMEEHPGSALEKQLERQKLS"
     gene            102696..106820
                     /locus_tag="CNI00420"
                     /db_xref="GeneID:3259518"
     mRNA            join(102696..103012,103061..103602,103825..106020,
                     106070..106295,106349..106657,106712..106820)
                     /locus_tag="CNI00420"
                     /product="DNA-directed RNA polymerase, putative"
                     /transcript_id="XM_572718.2"
                     /db_xref="GeneID:3259518"
     CDS             join(102716..103012,103061..103602,103825..106020,
                     106070..106295,106349..106657,106712..106762)
                     /locus_tag="CNI00420"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase, putative"
                     /protein_id="XP_572718.2"
                     /db_xref="GeneID:3259518"
                     /translation="MPPKAPVKRTAASSSTTAPRKAPRAGPSTTTATAKRPATTSSTV
                     AKGKAPARPSASTQVDVKPKIEDTRGEEEWADLMKQQYGDKKGADWYSKGVKTVEDKW
                     QLLPAFLKVKGLVKQHLDSFNYFVNVDIKAILAANSLVISDINPKYYIRYTDIRVGRP
                     ARHDANQVASALSPMECRLTDSTYSAPIYVDVEYMGEEKRSKQRGVQIGMLPVMLRSD
                     LCNLKGKNEAELARMGECPMDPGGYFVVKGTEKVILVQEQLSKNRILVMKDKKDEVMA
                     EVTSSTHDRVVKTYVVSKANRLYLRHNSFKEFIPIVIALKAMGLTADKEILQLICGSD
                     ERYQEAFGVSLEEAAKEKTFTRRQALEWIGARVSPNQAKDDSGSNQKLTPSDIAQQAL
                     AAMVLGHVPVRNMNFRPKCIYLATMARRVLMAMIDDHMVDDRDYVGNKRLELAGQLLS
                     LLFEDSFKTFNSELKKRMDKILEKPNRAGPFDAGTLIRQGGDPITQAFVRSISTGNWS
                     LKRFHVERAGVTHVLSRLSFIAALGMMTRISSQFEKTRKVSGPRALQPSQWGMLCPSD
                     TPEGEACGLVKNLALMTHITTDVPETPLVKMAFMLGVEDISLVTGNELYRPGVHMVQV
                     NGTLIGVTNMAKRFVRQFRKLRRAGRMSEFVSIFINHHHKIIYIASDGGRICRPMIIV
                     EKGRSRVTTEHVRLLKEGKVTFDHFLRAGLVEYLDVNEENDSFIACYENEIEEGTTHL
                     EIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQLNRIDTLLYLMTYP
                     QQPMVKTKTIELIGYNKLPAGQNATVAVMSYSGYDIEDALILNRASVDRGFGRCHVLK
                     KVTTPMRTFHNGSHERTAYPDPPPRPDAYTFVDKADGMTAPGATINQYDVMIHRETPV
                     DTRGGGADTQLYKPMPVTHKTPEPILVDKVMLTEGEDGALIKILTRQTRRPELGDKFS
                     SRHGQKGVCGLIVPQADMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELLSGKAGVVAG
                     KLQYGTAFGGSKVVDMSQILIDNGFSYGGKDMLTSGITGQPMEAYVYFGPIYYQKLKH
                     MVMDKMHARPTGPRANLTRQPTEGRSKDGGLRLGEMERDCLIGYGATQLLLERLMISS
                     DAFETQVCESCGMLGYNNWCPKCKSGKGVVGLTIPYAAKLLIQELMGMNIMPKLCLED
                     TV"
     gene            complement(106921..108153)
                     /locus_tag="CNI00430"
                     /db_xref="GeneID:3259599"
     mRNA            complement(join(106921..107813,107863..108153))
                     /locus_tag="CNI00430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572716.2"
                     /db_xref="GeneID:3259599"
     CDS             complement(join(106980..107813,107863..108018))
                     /locus_tag="CNI00430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572716.1"
                     /db_xref="GeneID:3259599"
                     /translation="MASASGYNHHRFARAVLKKSRKWEPSLTVQLFSNHWRFENSPLN
                     FQYDGPMKPFLLAIRSQVIPASLIPFLYDIQPPISFVDGCLVVELQDYRRSPESRSRV
                     VMRPAAETLAQTIDVMLERKGHGWDEQLAMELESRIITATSPPLYLGTSIMATRNATL
                     ALALTSPAHPNLSADGALRQPMAMESDAQSSLEKMRKLIAAGSRAGAGAAPFQPDWLV
                     LRAKEQYEAVRLHRERGGFLPQGSQGPAPSTAGGDDAPRPPATDDKKKKGKKRSNEEE
                     EEKPKPKKKKKQPAASSATAAGDAADGEKKKPAVKKEKGAASEKKKKVEKKKD"
     gene            complement(108166..108254)
                     /locus_tag="CNI00440"
                     /db_xref="GeneID:3259726"
     tRNA            complement(108166..108254)
                     /locus_tag="CNI00440"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:3259726"
     gene            complement(108542..109597)
                     /locus_tag="CNI00450"
                     /db_xref="GeneID:3259782"
     mRNA            complement(join(108542..108643,108688..109160,
                     109209..109597))
                     /locus_tag="CNI00450"
                     /product="expressed protein"
                     /transcript_id="XM_024657770.1"
                     /db_xref="GeneID:3259782"
     CDS             complement(join(108607..108643,108688..109160,
                     109209..109553))
                     /locus_tag="CNI00450"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513514.1"
                     /db_xref="GeneID:3259782"
                     /translation="MLPTHSPLSPVSTYPPSFPQLISPRTSQSLPSSQPPHRPPALPQ
                     NLSQRSWRRKRKRFTLTTFQSFLYHSSFWLCIVIEMALLVGAAWGLGEQAWHTGPQQG
                     WNVVVLSAAYAVFLIISVTHSWSRYLSVKQIMKTMPKPYIPIKPDDLPEKVSRHITTE
                     YSRTAVISHISQATQGEQDGWGRPNTKWEARWLRGYILGTVGVMKEALGAKDGPPLSL
                     EPFYEAADRVNDSGGVRLLVNSWAKYVEKARYGKKEPNEREAGAVERLVEIVVLTMEI
                     KRRKKENG"
     gene            109748..111552
                     /locus_tag="CNI00460"
                     /db_xref="GeneID:3259663"
     mRNA            join(109748..109775,109831..109887,109936..109980,
                     110028..110037,110095..110593,110641..110871,
                     110920..111139,111206..111422,111495..111552)
                     /locus_tag="CNI00460"
                     /product="ATPase, putative"
                     /transcript_id="XM_572783.2"
                     /db_xref="GeneID:3259663"
     CDS             join(109752..109775,109831..109887,109936..109980,
                     110028..110037,110095..110593,110641..110871,
                     110920..111139,111206..111422,111495..111511)
                     /locus_tag="CNI00460"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_572783.1"
                     /db_xref="GeneID:3259663"
                     /translation="MSNSNFLDKAIALVQKAIDEDVKQNYAEAYKQYQDALDYFMMAM
                     KYEKNDKLKELIRKKFTEYLDRAEKLKEHIAKSEEKRSKAKVSATGAAGGSTAGGPDV
                     KGDDGDDPEIKKMRQGLQGAILSESPNVKWEDVAGLAQAKESLKEAVILPIKFPQLFT
                     GKRTPWRGILLYGPPGTGKSYLAKAVATEAKSTFFSVSSSDLVSKWMGESERLVKQLF
                     QMAREQKPAIIFIDEIDSLTGARGEGESEASRRIKTEFLVQMNGVGNEETGVLVLGAT
                     NIPWQLDPAIKRRFEKRIYIPLPDIQARRRMFEINVGSTPHGLTPADFTHLAEQTEGY
                     SGSDIAVIVRDALMQPVRKVLSATHFKEVEVDTPEGPQIKLTPCSPGATNAIEKTWTD
                     IESSELLEPLLGLKDFEKAIAVNRPTVSAKDIEKHIRFTDESGGEGA"
     gene            111825..113255
                     /locus_tag="CNI00470"
                     /db_xref="GeneID:3259803"
     mRNA            join(111825..112243,112298..112875,112940..113255)
                     /locus_tag="CNI00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657771.1"
                     /db_xref="GeneID:3259803"
     CDS             join(111862..112243,112298..112875,112940..113122)
                     /locus_tag="CNI00470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513512.1"
                     /db_xref="GeneID:3259803"
                     /translation="MSDYLRVPYAVNPSHKFGYFDRNPEVPIPLTSPIPPTPPGPPIP
                     PFAREPLSPPWPTTRSELRRGNQEVTAKLQEQIEVEIERERERKRLMSDYVVVHNDFD
                     SSPIAPAELFNLSLLEPSTRFNFFPTDDDEERSRATLMNRMSTQGSPSSIASSSTSSL
                     TETANLMANVSLFGQANSSKTAQDLSPFPESARGSIDPSSRAIDVKVNRKPVDYHLVS
                     NVPKPFRGNASEDRTYTCDASPLNEAPKPDSSEAVIDYNDKDAFSSLLISVFNFRKDA
                     EKMFWRTSELEGRIRNCAYVGEGWELRPVMSRLNGKTVPEGCDVDEYIRTKQDIDMLS
                     LEELSAWLELYGIEGFEQEGDRRPDRRRLWAFLVYGTFTDECHFRH"
     gene            complement(113676..114924)
                     /locus_tag="CNI00480"
                     /db_xref="GeneID:3259787"
     mRNA            complement(join(113676..114105,114168..114299,
                     114353..114506,114560..114924))
                     /locus_tag="CNI00480"
                     /product="expressed protein"
                     /transcript_id="XM_572781.2"
                     /db_xref="GeneID:3259787"
     CDS             complement(join(113731..114105,114168..114299,
                     114353..114506,114560..114657))
                     /locus_tag="CNI00480"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572781.1"
                     /db_xref="GeneID:3259787"
                     /translation="MAKYTLYQLIGKAEHPDGRVISPHVWKTKLDLAYFDQEVKAEGK
                     TFPQIRGELVETTKNSAVTVPTIVDDEGLVITDSWKIAEYLEAEHGSAEKSVFGGQVG
                     KEFAKFVEIWSNTTLANEFRPLIAPAIFEHFDEPSKNYFIKSKFGDDLSRFEAHKSKF
                     SDPSNLNAQLAAARTRLNVIETLLGYKKEKGEPLWLSGKPSHADFCLFGWYAASRINP
                     AVERGVWRHEENPLVGEWLDLILGSGLVDQTQLN"
     gene            115107..117580
                     /locus_tag="CNI00490"
                     /db_xref="GeneID:3259638"
     mRNA            join(115107..116302,116360..116529,116581..116748,
                     116802..117335,117398..117580)
                     /locus_tag="CNI00490"
                     /product="expressed protein"
                     /transcript_id="XM_024657772.1"
                     /db_xref="GeneID:3259638"
     CDS             join(116202..116302,116360..116529,116581..116748,
                     116802..117335,117398..117468)
                     /locus_tag="CNI00490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513515.1"
                     /db_xref="GeneID:3259638"
                     /translation="MFSSTTPLFVAAMALALPATAGTIFTKSNAAMTFYYDVSEGTSS
                     SEACGSSADDPVQSGWATSSGINGGIPYCERSRGYSLKEIDTNNIVAFNSALVAANPA
                     KWCGREVKIYNADGGEFAYSGGSLYIWDGCDACSSSDSGILDLSAPTFVELKGGTCAG
                     NNPTGLTYEVLDNYIVNPSVGLGSGYSEEVGSDDMGVGSTTAAASGSAVAVTSASRPV
                     VTSAQSEVVISAQQTATATAILSLQYSYSSVVQGTDISPFSTDEIALVAVETDANSAG
                     SSALDAVETSAAATSTGTACGDSTCAFGAWQCSGLELQICNYLTIDSLGWETIETCGA
                     TCLITNSGSVDCE"
     gene            117658..119818
                     /locus_tag="CNI00500"
                     /db_xref="GeneID:3259449"
     mRNA            join(117658..118150,118217..118241,118319..118436,
                     118513..118671,118723..119406,119466..119818)
                     /locus_tag="CNI00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_572780.2"
                     /db_xref="GeneID:3259449"
     CDS             join(118047..118150,118217..118241,118319..118436,
                     118513..118671,118723..119406,119466..119533)
                     /locus_tag="CNI00500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572780.1"
                     /db_xref="GeneID:3259449"
                     /translation="MPTLFTVLTILNSLLALGVEAYEVLYELQGATGTVYYDYGWENT
                     GDQCAARFGAGWASDQTAYPGCEQNGPTQTDLKTNRIVAMNQSWMEGDKSAWCGKEVK
                     VFKEDGTELVYDEPLVLWDTCAECAIHVKIDFGVGPYVLLDSEDCGTTAMNPTGLTVQ
                     VVDNQIWAPAPGSDSYSPTSASTLYTGGLYNFPSSGTLSKPWGATISGDAAGDPVVIA
                     TADSQGVAPTGGDIEDVSVTATATGLAKSATGAATSAGMSSAKITSQPEATSDLSTSS
                     TPITSAWFASDEVSVTAIITSAAAAVLSVTSAALDQTSDVVALQSVSSTETITCTDNE
                     GTGYNAGDHICEGNQLMICANTQSGSSAVNWVVQNTCLSRCLVCDTTIVCN"
     gene            119969..120057
                     /locus_tag="CNI00510"
                     /db_xref="GeneID:3259771"
     tRNA            119969..120057
                     /locus_tag="CNI00510"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:3259771"
     gene            121340..123801
                     /locus_tag="CNI00520"
                     /db_xref="GeneID:3259662"
     mRNA            join(121340..121486,121765..122289,122339..122523,
                     122574..122913,122963..123042,123090..123243,
                     123296..123408,123473..123801)
                     /locus_tag="CNI00520"
                     /product="G-protein alpha-subunit"
                     /transcript_id="XM_572793.1"
                     /db_xref="GeneID:3259662"
     CDS             join(121935..122289,122339..122523,122574..122913,
                     122963..123042,123090..123243,123296..123408,
                     123473..123544)
                     /locus_tag="CNI00520"
                     /codon_start=1
                     /product="G-protein alpha-subunit"
                     /protein_id="XP_572793.1"
                     /db_xref="GeneID:3259662"
                     /translation="MGGCMSTPEAPKKTAETKQVPSTSTSSRPPQASTSATATAAGAG
                     TSAANGTANGIKGDTTATNRVGTSGGQGLAAALASTEPPGAQDSKGNKDRSNQIDRQL
                     EDDQKKFRKECKILLLGSGESGKSTIVKQMKIIHQNGYSKDELLSFRGVIYKNVLDSA
                     QALIMAMRKIGVDPEDANNRSYADRILEYRMDAGLDAVIPSEILYNIESLWHDPVIPS
                     VMDRSSEFYLMDSATYFFANIRKIAGPDYVPDEADVLRARTKTTGISETRFNMGQLSI
                     HMFDVGGQRSERKKWIHCFEAVTSIIFCVALSEYDQVLLEESGQNRMQESLVLFESVI
                     NSRWFLRTSVILFLNKIDLFKQKLPKVPLVQYFPEYTGGADINKAAKYILWRFTQTNR
                     ARLSVYPHLTQATDTSNIRLVFAAVKETILQNALRDSGIL"
     gene            124671..126997
                     /locus_tag="CNI00530"
                     /db_xref="GeneID:3259458"
     mRNA            join(124671..125513,125570..125744,126016..126997)
                     /locus_tag="CNI00530"
                     /product="expressed protein"
                     /transcript_id="XM_572779.2"
                     /db_xref="GeneID:3259458"
     CDS             join(125157..125513,125570..125744,126016..126731)
                     /locus_tag="CNI00530"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572779.1"
                     /db_xref="GeneID:3259458"
                     /translation="MTIRRLLTSLAAHQPSGSQSASRLIPPYSHVYSATAPSTLRPPY
                     SYSASPAQGLPLGAHEVRGRSLKAKVKYEIYHREGKVDGWSAWAENVLGNEEQRREVE
                     AAWVDILAGLESIKSSGNQIPQIAFHSLAGHLASESTVDAIRNVGAVVIRDVVPDAEA
                     IGWAREILQAINDAGERGIYWNPALIAARANTSVLSANAQLARSLLGQEVYIQAETVR
                     EGIAPFRTTPSPYNPWSCPRALLAHLTLTPTMSSPTGAAPQPTRLPPSVHAATYTLLR
                     PLFRPLKSKIAFYDSSSYLDPANWVLDPTISHRPSPAPDFPHLAGTEVVLPELLPGDV
                     LFHHTALPFSTQPVGQIFLPINPVEKKGNEAWIARQREAFEKGVPPPGASEVGDDLCV
                     VESKGKRSDISSRAGREAMGYGY"
     gene            complement(127491..127579)
                     /locus_tag="CNI00540"
                     /db_xref="GeneID:3259772"
     tRNA            complement(127491..127579)
                     /locus_tag="CNI00540"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:3259772"
     gene            complement(127704..128683)
                     /locus_tag="CNI00545"
                     /db_xref="GeneID:36393027"
     mRNA            complement(join(127704..128137,128205..128356,
                     128419..128683))
                     /locus_tag="CNI00545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658723.1"
                     /db_xref="GeneID:36393027"
     CDS             complement(join(127840..128137,128205..128356,
                     128419..128484))
                     /locus_tag="CNI00545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514396.1"
                     /db_xref="GeneID:36393027"
                     /translation="MGFFDIFSCCGPRSDKLKDPEQASESATLLPPARAESIISADSL
                     TGYGATEQQHGLTDEQRTRMAAIGREVGSYMLPVSTSPQNRTSSPARRFSTSSAGSSR
                     PPSPSPNRPETTPVNGKLQAPNGNHESKGDNEDGVVRKNLFAGGNMGGNSKAKKGKGK
                     GKGKGKGKGRK"
     gene            128881..132628
                     /locus_tag="CNI00550"
                     /db_xref="GeneID:3259631"
     mRNA            join(128881..129225,129283..129495,129544..129720,
                     129772..129857,129918..129935,129976..130056,
                     130110..130188,130234..130290,130342..130390,
                     130509..131246,131303..131572,131623..131925,
                     131977..132169,132241..132628)
                     /locus_tag="CNI00550"
                     /product="expressed protein"
                     /transcript_id="XM_572778.1"
                     /db_xref="GeneID:3259631"
     CDS             join(128951..129225,129283..129495,129544..129720,
                     129772..129857,129918..129935,129976..130056,
                     130110..130188,130234..130290,130342..130390,
                     130509..131246,131303..131572,131623..131925,
                     131977..132169,132241..132398)
                     /locus_tag="CNI00550"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572778.1"
                     /db_xref="GeneID:3259631"
                     /translation="MPSKRTSSGVSSPTAKSSSTRKSKSTPKKTLPRPITSPPPPPHH
                     HVPAPAPMHLPVHKAGRLSWSLLGFILVVLPFWFSRLHYGLPEPLPPYDADGRPQPSE
                     EIVLSHVQALENIGYRTVGTHEALAGEQYVLNQVLELVEKCNAGGILNCEWWHQKGSG
                     FHAFEIIDHEVLKGYGGISNIILRIAAFHPPSYNISQPKVEKDAILLGSHIDSTMPSP
                     GASDDGIGVGVMLDTARILVERNEAFDGAIIFMWNGGEETLQDGSHLYSTEHSTAPTV
                     KAMINLEAAGSTGGALLFQATSKEMIEAYVHAPFPRGTVIAADVFASGILMSDTDFGQ
                     FEKYLGVSGLDLTTPRDTIKHLEKGTAQHFTSNIQAIVDHLLSPSSPLLSPAPFSPPH
                     VVYFSLFDRVFFHFPMSRADGWYVSIAAVATAFAFRHLSNKKAKAIVVAAVGTPLGIL
                     GGLVGANAFAAVLSATDNGLLWFPHEHLPLLLYVPVSYISLFSIHLMLTHFLSPVERT
                     QLEVTHYYIQLLLSSWYMLLLQSFRVRSAYLYAMITALLLVGAVGNELGRMGRRGLWE
                     GMSFKMTYLVPSACLMALAVEAVTTALDIFTPLAGRMGKEAPAEHIVASLSVICGFVF
                     FPTVLPLFHRVSRMTQRKVVLGLVLSVLGTVVAMVGPWYFPYDEMHPKRVGVIYNYNH
                     TSDKHVAHLAFMDRGPVADIVPSLYSRYGTPDLPLEHTSLTDYDSDWDVLYPVSTFLD
                     TYRFDLPVSEETKKFTWPEMKWGVKDTKWENGVRKMVLTFNFTGLVWPTLAFEASVLD
                     WSFHFDPPPKKMQHHIKIATSVDEPVVNLRLDIRADEGERLRIHWSAFDINQMVPGTA
                     ARDGPDMPASKMLLDLASWSREKYNDDLDLVMSGVVCGVIEV"
     STS             132939..133091
                     /standard_name="CCG5"
                     /db_xref="UniSTS:470718"
     gene            133133..135581
                     /locus_tag="CNI00560"
                     /db_xref="GeneID:3259660"
     mRNA            join(133133..133303,133356..133526,133572..135581)
                     /locus_tag="CNI00560"
                     /product="anthranilate synthase, putative"
                     /transcript_id="XM_572795.1"
                     /db_xref="GeneID:3259660"
     CDS             join(133178..133303,133356..133526,133572..135533)
                     /locus_tag="CNI00560"
                     /codon_start=1
                     /product="anthranilate synthase, putative"
                     /protein_id="XP_572795.1"
                     /db_xref="GeneID:3259660"
                     /translation="MGFTLLIDNYDSFTWNIYADLASVGGNPYVVRNDKITLKEIEGM
                     FSDGELERIVISPGPGHPRTDSGVSRDVIAWGMGKLPILGVCMGLECIVDLLGGEIAY
                     AGEIKHGKTSLVQHDSIGVFHNLPQFLSSTRYHSLSAQIQSLPSVLQVTSTTKESGVI
                     MGVRHRTYTVEAVQYHPESCMSEGGRGLMANFIQMKGGKWGGENAWCGVPAEGEEEQP
                     KAKTNGAPSLPTILNRIHAQRLLDVEQAEKVPATSPANVSTSLSLYASPPLINFRDRM
                     VSTPHTAVMAEIKRASPSKGDIAPTASAPEQALKYALAGASVISVLTEPTWFKGSLLD
                     MLAVRNAVDSLPNRPAILRKDFVLSKYMIDEARLYGADTVLLIVAMLEPQQLKELYDY
                     SVSLGMEPLVEVNNPTELSLALEIGSKVIGVNNRNLHDFNVDMSTTSRVNAALNGRDV
                     VLCALSGISSHEDVEKYVKEGVKGVLVGEALMRASDTKAFLRSLIGLPPLEVVPKSRP
                     LVKICGIRSTDDAKLAISAGADLLGVILVPGTKRCISTSTAREISALVQSARSQSSSK
                     PLEPSLSSPWFTTQSDLLSSRRKPLLVGVFQNQSLSDILSAVEEIGLDLVQLHGDEPQ
                     AWAKFIPVPVVKVFRVSPEGIVRGGEFRRPGLNQAILLDAGGVSGGGGEGKAFPWEHA
                     KRLIQSGEVGSEGHMPLPVILAGGLTPENVGQAIEQAGEGVWCVDVSSGVEGEGGKVK
                     EKVEAFVKAVRG"
     gene            complement(135625..137977)
                     /locus_tag="CNI00570"
                     /db_xref="GeneID:3259672"
     mRNA            complement(join(135625..136624,136677..137712,
                     137773..137830,137870..137977))
                     /locus_tag="CNI00570"
                     /product="expressed protein"
                     /transcript_id="XM_572777.2"
                     /db_xref="GeneID:3259672"
     CDS             complement(join(135644..136624,136677..137712,
                     137773..137830,137870..137954))
                     /locus_tag="CNI00570"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572777.1"
                     /db_xref="GeneID:3259672"
                     /translation="MDRRKDPSRIFYPHGWRELVNGSLEEGFAPIALATIDNLTTEYY
                     VPQNEHLQFLLYLAINPYDHGLSSYEPFTVLYRLLKLHNPRLFAGSIPSHPSASYYRA
                     PPLPSITSDGGSSGGRGRKSLNHQDTSEHPQDDAPSWLTWEKGRSFLHRNVYKYMKRC
                     KDQGVWPLLWTDPAKENRVAGRVRRARKAKDGMGNIKVKEEHKEARRSQSPSKHDDHD
                     EDRPPENVIDAELDIDLDLEQELEHDNEREKPPTPQGWLLLEWLVAVWEKDEMVRRGP
                     YDNPQLEWSPLFLRQLARPYDRTGQLQWSDAGMVMGILKAAFAEPFPDDDEDEDEDED
                     ENENEGEEEEEDEDMIDIEEDEETRVAKEEVKIAKTLRREEGKEMLARRRSTAVRLFR
                     LLLDTAIAPFPPPPSSNLPSRPPSSSPGPEIGPSTSSFPSSPGIGTGTSTRAPTPPTS
                     MSYPPSPSRSAPSVHPPFNPPSLTSSLIHTLAPLPLSSLQSFFMLLIPSPFPSSSPSF
                     SFSHGTDINMSHAAVDTPTTTILPPVPLAPITHIITLLLEHFAGTSRRKGEERRERRR
                     RRLPEPDFEPGYNGLGKPTVEYLCREVLALNPPLQAPAPKGRNGRTKRGKTVQVKVEK
                     GTEKEGQDEKVGMKMAHLKLVLLQTLLRQERNGEKPYSSEQVELETLRSEKGWRRDVE
                     TSFVVSETRSDEDPEGSTALLRVGRMVLLSVDRLVGI"
     gene            138155..139470
                     /locus_tag="CNI00580"
                     /db_xref="GeneID:3259604"
     mRNA            join(138155..138297,138345..138873,138934..139031,
                     139150..139470)
                     /locus_tag="CNI00580"
                     /product="clathrin light chain, putative"
                     /transcript_id="XM_572797.2"
                     /db_xref="GeneID:3259604"
     CDS             join(138174..138297,138345..138873,138934..139031,
                     139150..139265)
                     /locus_tag="CNI00580"
                     /codon_start=1
                     /product="clathrin light chain, putative"
                     /protein_id="XP_572797.1"
                     /db_xref="GeneID:3259604"
                     /translation="MSDDPMADFLAREKAALGDDADFFANPTPSAASGIDAFPDLTSP
                     AVEPESTPVKPPTPQYQGIDAFPDIDTPAVDGTQIKVTGPAGTGEDEDVMKFESAFPD
                     LSGETGSQPASKPIFNALSPQPYGASPYPPTATTAVSRSPHPSILPAPTFNNILPTAD
                     EDTEPIKAWKARQAEEIQKRDEADKKRRDEMSDRAEKAIDQFYEEYNKMKEKNIRENK
                     ESEAEFLEKLQEGVAKGTAWERISDLISLENSQSKTIRPSVPGGSDLARMKEILLALR
                     REGDKAPGAAGF"
     gene            139526..139615
                     /locus_tag="CNI00590"
                     /db_xref="GeneID:3259779"
     tRNA            139526..139615
                     /locus_tag="CNI00590"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:3259779"
     gene            140112..144547
                     /locus_tag="CNI00600"
                     /db_xref="GeneID:3259733"
     mRNA            join(140112..140625,140678..140700,140779..140844,
                     140907..140987,141085..141255,141334..141565,
                     141675..141911,141998..142588,142693..142817,
                     142904..143112,143179..143295,143357..143895,
                     143953..144547)
                     /locus_tag="CNI00600"
                     /product="alpha-1,2-mannosidase, putative"
                     /transcript_id="XM_024657773.1"
                     /db_xref="GeneID:3259733"
     CDS             join(140168..140625,140678..140700,140779..140844,
                     140907..140987,141085..141255,141334..141565,
                     141675..141911,141998..142588,142693..142817,
                     142904..143112,143179..143295,143357..143797)
                     /locus_tag="CNI00600"
                     /codon_start=1
                     /product="alpha-1,2-mannosidase, putative"
                     /protein_id="XP_024513517.1"
                     /db_xref="GeneID:3259733"
                     /translation="MDGLRQRDRPILAQPIPHPPRQNPNPPAPAPQRTIRNVHRFVQR
                     YINPLRPLIFAFVLAVFSLILAVSIFFSPLAFVHRHLSLQDPTNIQDVQNGWVVKYRL
                     GEEESERHLRDGEVIGHADFGDGRKRVCKEEFVQPESQALGWVNVMLGNGGPEPNLSG
                     GMIPAVAPPFGMTRWSPQTRKNYVSMCPYNQTDTKLHGFIATHQPAIWMGESGPVEIS
                     PGLGTAIVTDFDKRGLPFKGEDEYASANYYRNLLDAGDNGEIEVEMSATSRVGHLRFT
                     FNPSLSPPSYSNPSGPTAIPYITLQSSRATYLVHGDKPEARVPYFPKGFVEIDVEKQE
                     VRGWNDERQDHILLGAALPASNFKAYYVARFSKPFKTFGISHHGHIERGVGETRGEGE
                     VLAGWVSFEEEAVTVDVKVGVSFISVEQAGRNIDLEIPRTQSLSTTSYQTRSSWAEKL
                     DRLSVSGATPQNLTVLYTSVAHTLVYPYEIHEFVPVDQDAEGECEGEGRGKGEWQYFS
                     GYLNHPTRGLSYSGFSLWDTFRAQTAWLLLLAPSIVPSMLASMLQDFREGGRLPMWKN
                     LVETNIMVGTHADAVLAQAMEVGVNDFGGFGKNEVWEAVREDAFTPPERDTELRYFDR
                     EEGTPQEARAGLTEYMALGYVAADLHSEAGSRTLDYAYDDHAAAIIASHLSLPSSTID
                     LLRNRSLSYKNMWNAETNFMESRNSDGSWAGEDAGWTEGDHWAYSLDVMHDVPGLIEL
                     MGGNQSFIDFMNRHFDEGHNLHTNEPSHHIPYLYIFAGAPYKTQEWVRSLGQSEYNHT
                     ATGLSGNEDCGQMSAWYIFSALGVYPVDPASAKYVLGAPFFDKITLRLPKAPWYDGDD
                     TGTEMVWEVVAKGASQGKVYVKSLKIDGQEMEGVEVGHDVLVRGGKWVWEMEETPQVW
                     GM"
     gene            complement(143499..145238)
                     /locus_tag="CNI00610"
                     /db_xref="GeneID:3259744"
     mRNA            complement(join(143499..143980,144046..145238))
                     /locus_tag="CNI00610"
                     /product="expressed protein"
                     /transcript_id="XM_572775.1"
                     /db_xref="GeneID:3259744"
     mRNA            complement(join(143499..143983,144046..145238))
                     /locus_tag="CNI00610"
                     /product="expressed protein"
                     /transcript_id="XM_024658724.1"
                     /db_xref="GeneID:3259744"
     CDS             complement(144077..145222)
                     /locus_tag="CNI00610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024514397.1"
                     /db_xref="GeneID:3259744"
                     /translation="MTHPLAMPMDEHAIPMNNLQTVPPSPSNSLNHNLSIAFSRIYDQ
                     IESLKQTQAQNHLQALTDLERTVRLANAGVAEQVRQAVNEGITGMVQQAVRQAVNESM
                     GMMVQSAVRQAMQGIIFSMNYTDGNIQAQAQPLSQQQQQSQLAHPQSQPPNGAPNSNT
                     NNVHATPQGWGMPPAVNGYMSAPNVGAPPGSDPTSSLPNTLHSSLFNFAQGSASTSTL
                     SSNHTHPHQQPAHQPSQPAAHAPPPSEPLVGHAQTKSQASTSQTHPSPGSSNSCFTMS
                     REVKTVPDLWREYTVGLEGQPPVRSVYEGSEKKRKKGKRFKDDSERKFYRRRKRVLDL
                     VETLIKKGIPEDQAAKRVEKLREDRKVTLNKLGEIIPELSPEQLAMI"
     CDS             complement(144077..145222)
                     /locus_tag="CNI00610"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572775.1"
                     /db_xref="GeneID:3259744"
                     /translation="MTHPLAMPMDEHAIPMNNLQTVPPSPSNSLNHNLSIAFSRIYDQ
                     IESLKQTQAQNHLQALTDLERTVRLANAGVAEQVRQAVNEGITGMVQQAVRQAVNESM
                     GMMVQSAVRQAMQGIIFSMNYTDGNIQAQAQPLSQQQQQSQLAHPQSQPPNGAPNSNT
                     NNVHATPQGWGMPPAVNGYMSAPNVGAPPGSDPTSSLPNTLHSSLFNFAQGSASTSTL
                     SSNHTHPHQQPAHQPSQPAAHAPPPSEPLVGHAQTKSQASTSQTHPSPGSSNSCFTMS
                     REVKTVPDLWREYTVGLEGQPPVRSVYEGSEKKRKKGKRFKDDSERKFYRRRKRVLDL
                     VETLIKKGIPEDQAAKRVEKLREDRKVTLNKLGEIIPELSPEQLAMI"
     gene            complement(145636..149494)
                     /locus_tag="CNI00620"
                     /db_xref="GeneID:3259467"
     mRNA            complement(join(145636..145966,146020..146115,
                     146169..146485,146542..146756,146806..149266,
                     149325..149494))
                     /locus_tag="CNI00620"
                     /product="Rab GTPase activator, putative"
                     /transcript_id="XM_572811.2"
                     /db_xref="GeneID:3259467"
     CDS             complement(join(145719..145966,146020..146115,
                     146169..146485,146542..146756,146806..149266,
                     149325..149401))
                     /locus_tag="CNI00620"
                     /codon_start=1
                     /product="Rab GTPase activator, putative"
                     /protein_id="XP_572811.1"
                     /db_xref="GeneID:3259467"
                     /translation="MPYLDLRELNALTQLANRGGLGSAIALTDCVAEEPDQLMYIQND
                     HLIILRDLGDVLIASCEGVVGWVRRENLRFVTLASGSANVSPVLDKPQGESLPITVLT
                     APSPPPPTSPPQGIKPEQNDALDTPLIEFKRNSDPFELESEYPQISPALSLSSPGSSS
                     PRSDSFFPPPRPPKSRYRQSPSSSVNGKAGDGGKEDRERKDSGTSNEDVGGIGGSMMD
                     IPTRQPSPDLLSPSLPPDREESEYDSDRSWDIYGDYARESMYGPLMKIGERSPSSARG
                     GGSPLHRTAGWSSEGEVDDENIKEKVVDALRSAQAVIAPEEVQKAKELKVDEMTPRGP
                     DYPSPITPSALNVFEDTPKNPVVESQASEGTSSGEAAQAPVTAEPIEMVKTSSKCSST
                     NSCSVVTPVSENDDPHSSVHRDTKPIPTPAFIPPRHPNFSPSPSLSQSPFPSPSLNSP
                     WMPGSPSSPHSITATRSAVEASRERQQEGRKSKGLTLVGRMNGDLSSAHGPVPITFLI
                     NKDGIPTAVPMPHGVQSTGAPGVGLGFPLPNQEKRVISPLASPVNLETPAMPAHIHPP
                     APGRSFTEPTARTTSPTTISSSLSGHDTVQDEIPIPSMRPRSRSFSSSVAKTLGVGRK
                     SSTPSALSINTSNSQGSSSPSPNLQQSNHRKLFKSSFGPSTTSLSPQSPHSPGMSVLS
                     RGNSTKHSVVSPIQPPASSQSATFPISSKSSKSSRPTKKMSSRTLPSPVSHKDFAEET
                     VKADGMDFQLIHPQKSSFSPTGSPNLDTIYRISSSEFQGQRNAPKGAVEDLKRRPTMC
                     SVSSSSAYSSRALYDTDEWGFLKEKSPTPEIFQSRSAPGNHRAIESKWLSITSSPLPA
                     NGPPKKVRKLVLEAGIPNSLRGKVWAWFMAKALLARVPGLYHELLEHDKRPEDERIEQ
                     DVLAAYPDHSIFAESNCPGQQDLRYILRAYSHFAPDGYRPEMALIAGALLIHCVAEDS
                     FWLLSGLVNSVLKDFYGKEKVGLKIEAGVFEKLLSSAEPKLAKLFKEIGLQPVEFLGK
                     WFGQLFIRCLPWPTALRVIDAVVCEGTRFLLVASLAVLSLSRDRLLRLPPNHDIILNY
                     LHNLPQDSLLLPAHFMKACEEIKFEEKEYRKIRNAMEKDHVPLAWMKEA"
     gene            complement(149765..151159)
                     /locus_tag="CNI00625"
                     /db_xref="GeneID:36393028"
     mRNA            complement(join(149765..150628,150694..151159))
                     /locus_tag="CNI00625"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658725.1"
                     /db_xref="GeneID:36393028"
     CDS             complement(join(149935..150628,150694..150716))
                     /locus_tag="CNI00625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514398.1"
                     /db_xref="GeneID:36393028"
                     /translation="MVNTRSKSDADTAMSNAPSPITSSPIVDTFISQSPKAPNNDPFT
                     SPLSLYPTPKSLSGSPAPNKSLTKPGPPASESAFRPMTGCATERENEATFGSPTKPEP
                     QPKVKPRHKAKAQLNGKAQPPKAESPIKSTPRPKASQLKGKSQSKTSPQPKAVPQSKA
                     THQCKTVSRNSRKCIISHVTKNDENAPTGNGYTLLDVVAASRIVNDARGSDSNLFGLL
                     LLSVVSELQPSWISGKRTAL"
     gene            complement(151613..152622)
                     /locus_tag="CNI00630"
                     /db_xref="GeneID:3259503"
     mRNA            complement(join(151613..152232,152301..152524,
                     152574..152622))
                     /locus_tag="CNI00630"
                     /product="U1 small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_572762.1"
                     /db_xref="GeneID:3259503"
     CDS             complement(join(151826..152232,152301..152524,
                     152574..152605))
                     /locus_tag="CNI00630"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_572762.1"
                     /db_xref="GeneID:3259503"
                     /translation="MGKYYCDYCDIYLTHDSMNARKAHNSGRNHVANVRDYFAGLGGN
                     QAQSLIDQIIQQHESGGRNQMMMAPSMRLGAGFMNPLATQPGYPGPPPPGAFPTFPPT
                     AGTPPFRPPFPPSSAPGAPPPTMPPFLPPNASAGAAPGIGMGSTPPFPPNTASPNPGM
                     PPFRPPMGMGMPPAPAQAQAQGSPMGMPQQGQQGTFTPTQEVPQGAGAGIHPDRLRML
                     GQ"
     gene            152865..157643
                     /locus_tag="CNI00640"
                     /db_xref="GeneID:3259495"
     mRNA            join(152865..153183,153225..153332,153387..153461,
                     153521..153648,153700..153845,153898..154217,
                     154269..154631,154698..155557,155641..155754,
                     155819..156389,156460..157643)
                     /locus_tag="CNI00640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657774.1"
                     /db_xref="GeneID:3259495"
     CDS             join(152902..153183,153225..153332,153387..153461,
                     153521..153648,153700..153845,153898..154217,
                     154269..154631,154698..155557,155641..155754,
                     155819..156389,156460..156477)
                     /locus_tag="CNI00640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513555.1"
                     /db_xref="GeneID:3259495"
                     /translation="MVKALPKPCQDWDWVGTEVRTPGQITLEHRRRAAGLVTSVVCPR
                     DLTHLGRETTKDDSEVKGNGKGTGEKKGTGCRAKNCKSNYMCYNNLGTEKLLEPDAKA
                     EFVISNLGDVPQERNGPAGLRNLGATCYANAFLQLWFHNVPFRNAVYACVTTETTPLY
                     QLALIFAKLEYGEKNVVDPMGLIDALRLNMGDQQDAAEFSKLFMSLIASEFSKHSDPK
                     LKTLVKDQFEGTMQYITQCECGYESISETTFLEIELSLKDNTTLQSRLDEFTCPEILD
                     GDNKYSCPSCLSKRRATRRQLPVTLPPVIHFSLLRFVFDLKSMSRKKSKASIKYPKEA
                     VLGNSVYELKGIISHQGTSAYHGHFVCETYDESNDTWYICNDELVQPKPVRPHKKIKL
                     EKPGDDKGKLESSKDAYMLVYKRRDGHVSPQFPPAIVMEKVKEENRGLREELNKVGVR
                     KEVLEDEWEHLKGAKVDVIRDLPGTDYIVPRDALAKWIQSPSFQDLYKPFDYSSILCA
                     HSQVDPLKSSDIRTISALAHDKLLLYTSLPEIDVCLICVAEGFVARSSITEQQSALEA
                     FDELNAKAELEEGGEEERWCLPKTWLIHWRTGKLPPQTLPTHSSYTLLCPHNAPLPSS
                     SAPPVTFITSSALSLLHSIFGSFPSFQPGTPPCPECSFEADQNAESLAQWKTDVKLDK
                     SIKRHLDPRPPAFGLDYYVLPKEFIEKWEVYMKTPAGEKPELDMGLGRGRCEHGLLDW
                     DPQMEKQRVISEIGWEMLCQKYGEKEPIKVQFGANPPEGKKVNIASFTPAVCEPCRII
                     RLSSYDELEIPIVFAPGPPTSYSTPASTGNTSGSKSGSGSSRNTSRTLRSRLKTLYIQ
                     ATRQSTIKDLKVSILSQTGITPLLQKIYYKRRTQPQEQEECSGKGNEEEKELDNDLTI
                     GKLGYLKGEELILVEVKEEGNLDDDDDTVDGGNGGKGKNGKNEGFGGTALLARIACPD
                     CTYENDGAAECCEMCMRPFKYD"
     gene            complement(157583..160457)
                     /locus_tag="CNI00650"
                     /db_xref="GeneID:3259459"
     mRNA            complement(join(157583..159518,159576..160219,
                     160278..160457))
                     /locus_tag="CNI00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657775.1"
                     /db_xref="GeneID:3259459"
     CDS             complement(join(157769..159518,159576..160219,
                     160278..160409))
                     /locus_tag="CNI00650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513507.1"
                     /db_xref="GeneID:3259459"
                     /translation="MSTPSVTFPTASASAGPHQRHGDDSSPSRWSGGNTKASDGYSAL
                     FTSGLFHESPTKRSQSQSQCKLSPTTPSRRHRRSSIMHTTPSTSSPRTIKSQGLDGGV
                     ERALDSVMRSLKTMAMGATPRRVDPPPMNQSRWSAWSSDSEGSKSISRLGTPAPGQQQ
                     DGYGYGDGDDGFFKPRKFNDTTRSKNTIRSIKPTKSSRSRNGRKGEATVDRMELDGED
                     VPAVPAMPIMAVPATPGRSRRMINGLVRRLGLTPRKNKPSLPPSQLLPDLPSSPPTVP
                     VTAAEDRTIPRKSSLSTLRSALTKKGSSTTLRSVRSILSTNNASMTLNHFSTDDHPLP
                     LPLPRTHREVSTSSPRTTPGKRLRTPKSSIGQPKLQPGTSPSAFLRDMPRRAPETPKR
                     ESFALDHEGCEATPELSAGNARTGEDMWFGEENGEDIVMADETMDVMEVFTPPPAPVP
                     GTTVRIPESHPFVSSVSIPSSQSCLSPEPDSSNSQGSIKSIESFSLPSPPVSLSSRVT
                     SASASTFISIPTSLSILPAGFTDHSPIPLPNVQKEIVAREKTIPILTVKARRGANGKD
                     KDQTVDGYGKNRLLNGLVPSSGLPRTLGHGIGAPRKLRTAKASLAPGNIMGTGTPLSS
                     KDTNALGLPVPPRPPLDGIIGVKSKMNKMSKLNMMSKLSKAPRGDAGPAVQLQMQNQS
                     QSRPPLGKMSLGTVTSYYDVHTGTFGPSDGVRLQSVLRTQYDEVKGRGRQTDNSTPPP
                     FCGGGNHTYMMSTSVNQSSTKFEDPIVPSTLNLKHSPSPSMMSGCSLGSSVSKGCDSI
                     VTGETGSTRATSGTDEVEEWELEKYLNALESQSVDIGRKGGYI"
     gene            complement(160491..161502)
                     /locus_tag="CNI00655"
                     /db_xref="GeneID:36393029"
     mRNA            complement(join(160491..160605,160656..160779,
                     160864..160952,161062..161214,161283..161502))
                     /locus_tag="CNI00655"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658726.1"
                     /db_xref="GeneID:36393029"
     CDS             complement(join(160683..160779,160864..160952,
                     161062..161214,161283..161471))
                     /locus_tag="CNI00655"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514399.1"
                     /db_xref="GeneID:36393029"
                     /translation="MLSAKRTLSLIEKRIFSHGYHRQQIIRPMSISTANPHTNIAEES
                     LPKPTGLVMQIIVRRDLLTEHKWPVGPLLAQSAHAATAVLHRFRDHPDVKRYLKGEDG
                     RGWETMRKVVLEVPDEAALKSLASKIDDMANPVGYHMWIEQPENTPTALALVPNKRPK
                     GLKRAFDEVGCELFK"
     gene            complement(161749..161830)
                     /locus_tag="CNI00660"
                     /db_xref="GeneID:3259724"
     tRNA            complement(161749..161830)
                     /locus_tag="CNI00660"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3259724"
     gene            161934..163601
                     /locus_tag="CNI00670"
                     /db_xref="GeneID:3259427"
     mRNA            161934..163601
                     /locus_tag="CNI00670"
                     /product="pseudouridylate synthase, putative"
                     /transcript_id="XM_572802.2"
                     /db_xref="GeneID:3259427"
     CDS             162012..163556
                     /locus_tag="CNI00670"
                     /codon_start=1
                     /product="pseudouridylate synthase, putative"
                     /protein_id="XP_572802.1"
                     /db_xref="GeneID:3259427"
                     /translation="MIITFILRRANKMSRYANLTREQLIQKLEALECTSLVPSQEPLP
                     PQTATATKQERRSKKKAEKPFHFPAHPTRHIALLISYHGWPYSGLALQAPATPDGPPV
                     PTVEAELLAALEKTRLIAEGKGWEGCGFGRCGRTDRGVSGEGQVVNLWVRSSRKRGDG
                     GGELGDGWRDAVEPEVEKMEKTVIVQEDEEKGVKEKKSKVIQPPRQPSEFPYPKLLNS
                     VLPPSIRILAWSPIPASFDSRFSCTYRHYRYAFHTRPTPTSPELDLELMRQGAQLLLG
                     EHDYRNFCKLDGSKQIENHTRGVLKAWFEGGKSQGVGDGMMVFNLIGTAFLWHQVRHI
                     IAVLFLVGAKLEPPSIVSDLLDVKRFPSKPNYTMGHPLPLTLHHCGYPDDLIDWRFGG
                     YDGPWQRLSEDEKEKKYNLAMGGREGLDRQLEVARQEAQLRSWQISGSLRKLDSIFGP
                     SRAEKYAGALWPIGGGDYMMSGKYKKVEDRPRGETPDEVNRKWREGKGKIRKEAREAK
                     GMDVDE"
     gene            163651..165143
                     /locus_tag="CNI00680"
                     /db_xref="GeneID:3259399"
     mRNA            join(163651..164045,164124..164235,164303..164622,
                     164768..165143)
                     /locus_tag="CNI00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_572758.2"
                     /db_xref="GeneID:3259399"
     CDS             join(163667..164045,164124..164235,164303..164622,
                     164768..165090)
                     /locus_tag="CNI00680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572758.2"
                     /db_xref="GeneID:3259399"
                     /translation="MPTNDGRVCGRRVRKHFHYVIIPLHALCCLFIVPCPIYFLDRSY
                     TYIALTTMAPKLRVLVSSSSGYPPKAPIPVNSPAPTPISTPGFEGNVWVFVKDYAGDH
                     KEGDGSEYFGKDGRGGMTYGIVVKGKFLEDLTADEVMFGNTFEKPIKDSLPWGTSVAT
                     KFMYFIDPTLELDIYADKPWALSPALATMNYLSLEDGSKVGKDLVVKEDSLEFIKSKA
                     KDEGIAVPTPREGDEKTEINARRKWLADKKNREKIKLGKDVVVGMEFANGLLDFNTLS
                     AALPPPFNAQFPLVKYWDGQPVTYVCQRKAPKGQSPVGQDVFWSVAFEIIDEDLKNEL
                     EKRGAKGAAGEKGTKDDREEEQGKEKGKGNGNNENEKVSDDVD"
     gene            complement(165133..166693)
                     /locus_tag="CNI00690"
                     /db_xref="GeneID:3259634"
     mRNA            complement(join(165133..165511,165566..165808,
                     165895..165977,166045..166167,166254..166416,
                     166478..166693))
                     /locus_tag="CNI00690"
                     /product="ketoreductase, putative"
                     /transcript_id="XM_572756.2"
                     /db_xref="GeneID:3259634"
     CDS             complement(join(165233..165511,165566..165808,
                     165895..165977,166045..166167,166254..166416,
                     166478..166672))
                     /locus_tag="CNI00690"
                     /codon_start=1
                     /product="ketoreductase, putative"
                     /protein_id="XP_572756.1"
                     /db_xref="GeneID:3259634"
                     /translation="MVADTVHVGQHLAGHPSVHLFGHEIVLDVSIPALILSTVGAAFL
                     LRYTLSIFRLFLELTVLPGKDIKSFQSRKGETWAVVTGCTSGIGLEFARQLAAKKFNI
                     ILVGRRQSALTDLSKEIESKYDVHTKSVTVDVSTPGSARDDALTQLELLAQNLDVGIL
                     INNVGASHSMPVAFHETERSEMSRIIETNVTWTYLVTRSILPSMVARSKQKGAPKSLV
                     ITIGSLSGRIPSPLLASYSGTKAALATWTKALAEEVKPQGVIVELVQAAFVVSNMSKI
                     RKSSPFVPTPAPFVRSTLNSIGLPRGAQGRPHERTPFWSHAILDYVVGFAGYVSEMAG
                     IKVILGMHKDIRKRALKKAARDEKKAE"
     gene            166900..168918
                     /locus_tag="CNI00700"
                     /db_xref="GeneID:3259519"
     mRNA            join(166900..167253,167303..167799,167851..168918)
                     /locus_tag="CNI00700"
                     /product="transcription regulator, putative"
                     /transcript_id="XM_572804.2"
                     /db_xref="GeneID:3259519"
     CDS             join(166937..167253,167303..167799,167851..168797)
                     /locus_tag="CNI00700"
                     /codon_start=1
                     /product="transcription regulator, putative"
                     /protein_id="XP_572804.1"
                     /db_xref="GeneID:3259519"
                     /translation="MVTLVEHRAFLNSILDRQAERRRLIDPEAVFPTQPVIRGRIPRA
                     IHHRTPGDDEGERDGWISKENVANYVKEEETIRNDYCEWYGATGECGSNFIMGAEGED
                     ICSEYPALKKLMNLKAQLVSSNSHPPLYFPLSHEPLRDSLLSTFSNFRFDVIRINPLL
                     DWADIAELPIKQISSDPAIVFLWVGRGDQEGLERGRECFARWGFRRAEDIVWVKTNRN
                     KNSGERAAANGALFANQKEHCLMGIKGTIKRSVDVRFAHCNVDTDIIVWEDSGDHEGP
                     RYPPYLYTLIENFCLGTRRLEIFGRPNLARRGWVTAGLEPFSSSSSTADQNNVQLFDP
                     QSYPSLVPESDGKPILPFSPEIDQLRPKSPVRKPPRYNNPSGGNPNNLAGGGIGNSGS
                     RNQGGLAVGGRPSPAPRFAQNGGTSGSGTPMGNRPNLVMPNQTSPIDYSQTQGRMSPV
                     NPMMMQGPTMEQMVAANMGMGGIGVGMNGPMGMPMGMPIGNQYAYGMGINGGQPGFGP
                     PFGAGMGMPVGMGVGMGMGMPMGMDMGMGHMGNMGFDGMMPGQGQGFGQQQLPQMFGN
                     PQMGPRFGGWHGQGGQGQWQ"
     gene            complement(168838..170058)
                     /locus_tag="CNI00705"
                     /db_xref="GeneID:36393030"
     mRNA            complement(join(168838..169436,169491..169633,
                     169692..170058))
                     /locus_tag="CNI00705"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658727.1"
                     /db_xref="GeneID:36393030"
     CDS             complement(join(168936..169436,169491..169633,
                     169692..169866))
                     /locus_tag="CNI00705"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514400.1"
                     /db_xref="GeneID:36393030"
                     /translation="MTLKIQRRKLTAIQKMISVKQTIPFGLLSCLALLGSIKADDSTN
                     NTSWPDWVTNDYDCVIGCLSGFNDTITSVPQDALAQQAFDCTSSTCTGDATGNYYQTF
                     YYIQLFYATGSIYESSDSAPDGYKHAAFTDSTDTTSEAAVSGDWGDDDTVDPTEDIAA
                     SDSASATDSAETTGSADGVDGGSATDTAALAIDTGTENGTVVTGTAADSTASGSKLSS
                     ASHTSSQSDASTASSSVAADISESGAFKTIGGDVAQRIFGAVGAMVFGGLWIGL"
     gene            170847..173536
                     /locus_tag="CNI00710"
                     /db_xref="GeneID:3259396"
     mRNA            join(170847..171007,171061..171373,171433..171797,
                     171857..171907,171957..172159,172214..173171,
                     173226..173536)
                     /locus_tag="CNI00710"
                     /product="long-chain-fatty-acid-CoA-ligase, putative"
                     /transcript_id="XM_572753.2"
                     /db_xref="GeneID:3259396"
     CDS             join(170893..171007,171061..171373,171433..171797,
                     171857..171907,171957..172159,172214..173171,
                     173226..173287)
                     /locus_tag="CNI00710"
                     /codon_start=1
                     /product="long-chain-fatty-acid-CoA-ligase, putative"
                     /protein_id="XP_572753.1"
                     /db_xref="GeneID:3259396"
                     /translation="MAPRKNKEPASWEVDADKPKPDGETRVRRAYCVKDLVTQPAPGI
                     DTVHDLLIYAAKTHGSKKGFASRDILKVITEEKEVTKRVGGKEHKETKKWNYFKLSPY
                     NWMSYEGFLGKVKEIGAGLRVLAADDGRESEKFFNIYSQTSRNWMLVAQACAFNAVPI
                     STAYDSLGPEGLKHAIQETEVHSMFTNADLLPTLLKVIGDTETVKVIVYDGEADPKII
                     EDLKNVREGMKVVTLDEVVEIGKKNPVEAIKAKREEVYCCMYTSGSTGTPKGVLLTHG
                     NVVSAVASVWTLLYEYLTSKDSYLAFLPLAHILEFVVENSFIFAGLPVGYGRVKTLTD
                     ASVRECKGDIAEFKPSIMVGVPAVWELIRKGILTKVDQSGALKKSIFNFALKAKQAAH
                     HYSIPFLAGLTDTIVFDAVRAQTGGNLKILFSGGGAVSKSTQQFLCTALVIMIQGYGL
                     TETTAMATILNPAFMQFGAVGGPVPAAEVKLIDAPEAGYFSTNNPPQGEILVRGPAIF
                     KGYYKRPDLDKEAFTEDGWFRTGDVGQWNKDGTLSIVDRLKNLVKLAGGEYIAIEYLE
                     SIYKSCPLVANGAILANGDHNQPAMVVVAHPHNLPAFAKKNGLGDGEDLEHLCTDDKV
                     TDAALKELNNIGKKAGLKGMELLEAIVLVADEWTPESGFLTAAQKLQRRVIEKHYEDR
                     IKAVYD"
     STS             170927..171502
                     /locus_tag="CNI00710"
                     /standard_name="Sca4"
                     /db_xref="UniSTS:470720"
     gene            complement(173499..177368)
                     /locus_tag="CNI00720"
                     /db_xref="GeneID:3259506"
     mRNA            complement(join(173499..174799,174869..175202,
                     175264..176316,176366..176794,176839..176886,
                     176934..177056,177110..177368))
                     /locus_tag="CNI00720"
                     /product="transporter, putative"
                     /transcript_id="XM_572809.2"
                     /db_xref="GeneID:3259506"
     CDS             complement(join(173589..174799,174869..175202,
                     175264..176316,176366..176794,176839..176886,
                     176934..177056,177110..177310))
                     /locus_tag="CNI00720"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_572809.1"
                     /db_xref="GeneID:3259506"
                     /translation="MSTQQLTSLFGSRLSSAYNQLRGDLGAPQTATDTIGKLVDKIQT
                     SAAVEDRRTAVLGLKGLSRDWKEDVGRRALPSLIAVLEHDAPFDSEIARATLETLMQL
                     CETVEKPTKDDLGLFFTDAFLEVPKPLHSLVNLISASPSFYPRYFAVQFLIQLTTARP
                     AVAQSYIMSSPPPGIDGILAVLDTKSPSATPSMMGGGAAEMLRNEALLLLPPMLAGNQ
                     DLQKIVAFSGAFEKLFQIIDQEGGADGGIVVQDALAAVACLLRFNVSNQNYFRELTLI
                     PQIPRILDFPAPLPADEPTPDEFALQYWSDQKIHNTGLVLGLIRMLVGGPGGGNQNAM
                     VSSGVTRCLLELSLASNAPPSIKSQCLSTLTPILTASSTNQDLLSSLLVSPLLAVQAD
                     DEHPGGGFVRVPAKSAVEALVASIIDGDPTTGGKGLKARAAGVNMFEAYLSSNDEGRI
                     TILSALVTPIADNLNVDPISNAGSLILSGVLELPHSSITPSFDPYRPLFSCLLLSHLI
                     RNSEHAKKLAREISFPSGDTDLDHDPDSAIETEEDKIPLLQLVVGNLMLASREQTESV
                     NRAARSGGAEATREEEEWTRVMVGYLALLCTWLWDSPKSVKEFLSESNNLQALIQPIT
                     QNTSIDPLVQGLSAFLLGVCYEFNREPGEITRATLHPILHSRIGPDQFVSRMARLRED
                     PRFRAVQPDEFELTSLLSSQAPMGEEEEEDMEVWFDWAFVDFWKNHYYTIQRSIAIDP
                     DAPRNVPPADDAETAAIIMSLRSKLKTQTDEVTNLTNKIESLQKEAKGEKGQLIEEVE
                     SLSSQVASLSTQLGESVKRTEELEGELNTLKQSYSDLEKTAAAAQSTATELESVKEEL
                     KQVKEAHEKASSELSLAKMSAKGREGKFKDLENKVKELEEELGEAVKAKEAAEAQAGA
                     AAGADADAGTGRGDSASKAEEEVRKLEEENKKKEEELKKLGEEAKKRKEEATMKEEEA
                     KKQEEEVKKKEEEWNTKQREWEAQVKAREDRVKQLEQNSKSSEEKAKSAEEKTATLES
                     KIKELEEKLATAASASTAAPAETAGGSNKQAKKRAAELDAKVKELEASLVEEKTKREE
                     EAKEHEDLLVLLDELTGKRTRDKRLMKEKGLEVSEDEEGEDEEE"
     gene            177566..180915
                     /locus_tag="CNI00730"
                     /db_xref="GeneID:3259544"
     mRNA            join(177566..178189,178264..178564,178629..180915)
                     /locus_tag="CNI00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_572751.2"
                     /db_xref="GeneID:3259544"
     CDS             join(178312..178564,178629..180670)
                     /locus_tag="CNI00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572751.1"
                     /db_xref="GeneID:3259544"
                     /translation="MLDTTHTRDIRVSPKNGPSYTRPSPSSHSLSNLSTAELHEQLDI
                     DLDDIDVWSEESEDTEDYKGTKPLRVKKKKINFTTGRVVANRRHRRSTISGPRSPHSP
                     RSFTFASPRSPKLPAPKRNPSAATPSSAHAHISQLFFALPAISPSPTMPGPYPFASAL
                     GTKRSSGSSLHLGLGRFTSYDPICPGPSPPVSPAPSPTTRYTFSNVHEHNANYSSSAC
                     TYERKTLPTIPGSPLTPSRAPRKAAELLGAIPPTTISKAGMRKHTASALKPGKHFRPL
                     PNAAITEIERFFGDVPRKPSKTPPGLKSKSNKSKSKPSSHPFAMKPSSHSSSSRSGED
                     VHRKSDRETIGQGETVKHRAPDGSMWLDVEEEQEFAWLMGDALAAVPPAPLPSVAAVE
                     AKVKAKGEAEAKPVEGIVRFIERKEERQRMKQLDEMDVLCGSDGESEKWGMEAFTSIL
                     SIPKPKSSSTKSKPKSKFSRKNPPKTDITASFLEMETPKRRDFSSDISSRDITNLHPW
                     NRHVRSHSNPTPDSPKYEISDPIPLFEDIPLDFTVPRDISAIMRADSGAGSSKLRNGR
                     GLSSSPPRVKNRPPPITLPQSAINARLPVLTATSPSDLAFHRPPSSTVQVQAEPIAAP
                     AHTASGTMPTTPFVRPRAAPAAPALRHRPRATGSSPPPPVPLNSLIPMSPVPPIPPLP
                     TVSATDISKPSNNGKLGPSATTVSISITGSGKPNDMREIRKGEKEDKVSISFFEPVTP
                     VNPTPPAGVKGKGWLKRVVKPLMS"
     gene            complement(180828..183332)
                     /locus_tag="CNI00740"
                     /db_xref="GeneID:3259528"
     mRNA            complement(join(180828..182294,182343..182514,
                     182561..183332))
                     /locus_tag="CNI00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_572954.2"
                     /db_xref="GeneID:3259528"
     CDS             complement(join(181013..182294,182343..182514,
                     182561..183119))
                     /locus_tag="CNI00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572954.1"
                     /db_xref="GeneID:3259528"
                     /translation="MSLFFANSDTPQPDPISGADYLSKLHKFLKSNAPRLAPSAPRNT
                     SRNLTPSIWQQGYTVLTLGLDPNSAPVRNTKGSMGLGFGMPSTKRTPPPKPLLLRLPP
                     DRLLYLLLRWQALPQSLPHVGRTDIPIEEGVVIAARGTEGEGRGKEGDVRSVRSWVGS
                     IRSVSGTLVGGGQNRGWWGSKQAVNEDELLLSLYSMFTLIPALLIHPPNISEPPIAEL
                     VEAGGYTQLGGIDVRVPLDVLRNLQILELEHYDPRALLIPSNPGMRSLTVRDVSDGDE
                     WIYELLTIPSNNSTEPQPRFPNLHHLSLLSASLLTFPTLPLESLTHLDLSYNLLDAIP
                     STLSSLTNLKSLNLSHNLITSLRNAPASVGQISSINLSHNRIDCIVGLDRAMALSRVD
                     LRSNVIYDVGEIGRLALLPEIHEIWCASNPFDAPTAYPPEPAESWRVELGRTFREEGK
                     DIILDGIAWTWSEERKIEAGLISRGIGANGLGGRGYERGWAKPHYGTQTHEDVSPGRP
                     PVAHRRSATHTHTTARSSSPTLPPSQSSSPRTRSPHVLPSPSFPHGPSQLRETSTVSH
                     PASGKSGKGRKKGRRRVINLEGDGNEDDSGAENVRERERNLGDVLEKGLGDDNVKNGG
                     EFQGSNGSAHENGREQSSAPAAVTEVKVVKKKKNKKRSKEPSTAGG"
     gene            complement(183423..183511)
                     /locus_tag="CNI00750"
                     /db_xref="GeneID:3259584"
     tRNA            complement(183423..183511)
                     /locus_tag="CNI00750"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:3259584"
     gene            183684..187140
                     /locus_tag="CNI00760"
                     /db_xref="GeneID:3259469"
     mRNA            join(183684..183947,183993..184058,184109..184453,
                     184506..184643,184690..184773,184825..184968,
                     185017..185194,185249..185433,185487..185669,
                     185726..187140)
                     /locus_tag="CNI00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657776.1"
                     /db_xref="GeneID:3259469"
     CDS             join(183896..183947,183993..184058,184109..184453,
                     184506..184643,184690..184773,184825..184968,
                     185017..185194,185249..185433,185487..185669,
                     185726..187041)
                     /locus_tag="CNI00760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513504.1"
                     /db_xref="GeneID:3259469"
                     /translation="MLAPTYTSSLLFALSATAVRAKSRVCSASDCVDGSSTSPLLAFD
                     SSSLTYLLPGTYSSTSYSPTSPLNASISTSSSSLTISTPDSPVGFTSYSYSGSGNVWT
                     DNDWGMGNWKSIYLPDGWYAVLGQGKVLWGAIPEKSLLPMSISSMGISYAGSSACSPA
                     CSSRGTCTTTNASATCRCDEGWAGSTCDSCATGYYGTSCTAGPSNCTIWDDGYTGTGK
                     CIGTATSASDVCGCDHGTCTSSTECACAAGWTTNSTASPSLCNTCAQGFFQDVSGNCL
                     ACPLGCKTCELQADTKSTATCTSCSLTLTLSTANPDTCVSSTGTCSSGLYYDSSTSSC
                     ESCSPACSTCTGPGASDCLSCASPRVNLQGSCVGYDSTTGKCDSSLSGLDGVFVVNNQ
                     KSECDSCPVGCLNCYIPSFSSAASFDSLICQACQEGYLLENGQCVKQCSGGWFLSEGS
                     ATTNGTCQQCDSSCSTCISTSTTCLSCSSSSMSAHSGSCIPSTSCPSSTVSINGTCVT
                     CPLDCATCSTASTCSTCPSDRPILKNGRCIAYCATDTYYDTSTGTCQACDWTCKNCVG
                     EGSAMCSSCSDGYMLKDGVCVDALCGDAGFANGFGMCFSSFVHKSQKRYLGLLALVGV
                     AIIAGIASWWYVRRERRKTRQATKEFGKRLDERNVNDRLSALRLEKVFGFNRVTFGRG
                     GDRSARTTQEDGGKKNKLRELLLPSKRRSGNEEMEMKKSNFAPDKERDCYDSWRTSNF
                     GKDNWVAPPPYVPSQGVPTPVDVKHTFNKRDSLDSIPTPSHQTFAPSSSTSSFTITRP
                     ATPPRKLQNPYLGSTIIHSMSTPSPPPHSRSLMPPPRPGMGRRESGNSFSSGSLWTPM
                     TGMTSITKITADKERDVRRYSGRQDRQMDVERRPTDYDLL"
     gene            complement(187155..188931)
                     /locus_tag="CNI00780"
                     /db_xref="GeneID:3259554"
     mRNA            complement(join(187155..187338,187402..187506,
                     187567..187657,187709..187848,187905..188010,
                     188062..188931))
                     /locus_tag="CNI00780"
                     /product="expressed protein"
                     /transcript_id="XM_572747.2"
                     /db_xref="GeneID:3259554"
     CDS             complement(join(187237..187338,187402..187506,
                     187567..187657,187709..187848,187905..188010,
                     188062..188870))
                     /locus_tag="CNI00780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572747.1"
                     /db_xref="GeneID:3259554"
                     /translation="MALQRTPPQRVQRLSPNPMVTADEVLQSGASPFQPRNPAVMRSP
                     PAGSQPHSQYQLAPSPTPQSRPPPKQPEAGPEAPQDSAEEVPAEEVGQEQEDEPATHK
                     SLIVDDRPIRPAPAIVIEPEVSMEVDELEIAPAPEPEAGPSTASQQVPEQTGDVEMEE
                     VEPEPELEPQPESAQPSEPIKPPNSSTPPPSESPALAPAPKSPSLPPAPVTPAAKTPR
                     SRTRRQTNQLPAPPAPIQVDDASQAVSQYGKRYQVTYDALERAVKAGTQRWTADNLKD
                     CFPHLAAQMPKAMENAWMSTSHTMRTKIMSNAQELLKHYKAGPALQIIDEIAQEAREH
                     AKLHGGNGNVYTRPDAWRPNLAPHALVAATNLPVLDETYERLRDEYLGLHKDCQERYA
                     SILAKQAQLKQLEENVGDGVVELDKTLKALDGLPVEDMMIWTEAAETKMETRAPEYGE
                     "
     gene            189061..192568
                     /locus_tag="CNI00790"
                     /db_xref="GeneID:3259633"
     mRNA            join(189061..189167,189243..189324,189375..192353,
                     192408..192568)
                     /locus_tag="CNI00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_572745.2"
                     /db_xref="GeneID:3259633"
     CDS             join(189323..189324,189375..192353,192408..192423)
                     /locus_tag="CNI00790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572745.1"
                     /db_xref="GeneID:3259633"
                     /translation="MSDSTTPPDSISRSSSPGQAGPQRRVVSGSLRDRIAKFNNPSAP
                     PPVPKQHVPSAPVSRGMVGNRIPSLDRKSAGILGVTPDKRVPESKGMIGNRIPSVTGG
                     GYSPVPYQNTGSSSGGISTNPAPAVVARDASPAGSASGSVDSSAASATVDSSASPITS
                     RSSTPPSSPGTAGTAATGDVPPSLVAATLPSLNANLGTSTPSSTRAEAGDAVSEFSLS
                     VPSTPMGNSTPPLPAPEYDLVAPNLKLATGSIPHPMAPGITSQSAKFAPSVSSSLATQ
                     SVGSEEEIQMMADVSGVSTPMGTPRAERRGLGEGSVAGEGSVGGDGSVAGDEEGSVND
                     VSGKIDKLDLGENTPPSDETLSTPVKDIKAPTVHEPLESAATDKDLEGPPTPKSAASS
                     SDPSKAQDLVALKQGQLHSSPSNVPSRDIDDMAASVMARNFGEYTIAPEEKKVQGGEA
                     GQFIEDVEIPDEILVPPAQTKQEYGGQEELPIQEVGKEGDKDVIKTDEEKAAEQPDVV
                     VAGKDVPATQSAESEEPGPIKTDSEKAAEEPDVVTVGEDVPPTQSAEGSEPIKTDSER
                     AAEAPDVVLAGDDVPATSSGETANKGVIKTDAEKAAEAPDVVTVGKDVPATQSASQGD
                     EEKVVKTDEEKAAEAPDVVVVGKDVPEVQSAEQDGSTIKIDEEKAAAAPDVITVGEDV
                     PVVQYGDAEDGAGLIKTDEEKAAEKPDVVVVGQDVPATQSAEDNTPITETKVDQPQVA
                     AVGSEILPGDVISSDRDKDVKQFEVEPAPTAPSIQPSAPTFLDVPSPVEIVDEEKTPT
                     GEEAAPDFPTPPAADPDVVDPISETTSSTELESPQQSAVAAFNEPSDAPETPIDKSML
                     KYFPEVPDEEKPRVEVHVSSPAVTPAKSKKESIGNPKSPTGLPASSSERSLGGESDVA
                     DLQGQSKSISHPTLDNITPSKSSLYAVEGDSSDQLDTMTPEAAKRLSKSNSMRKSPKS
                     PLLDDEDPGDFEPGEGWAVVTKGRDA"
     gene            192827..195791
                     /locus_tag="CNI00800"
                     /db_xref="GeneID:3259442"
     mRNA            join(192827..193011,193061..193982,194045..194480,
                     194546..194716,194780..194835,194886..195055,
                     195108..195152,195210..195274,195325..195354,
                     195407..195428,195493..195574,195633..195791)
                     /locus_tag="CNI00800"
                     /product="peptidase, putative"
                     /transcript_id="XM_572743.1"
                     /db_xref="GeneID:3259442"
     CDS             join(192839..193011,193061..193982,194045..194480,
                     194546..194716,194780..194835,194886..195055,
                     195108..195152,195210..195274,195325..195354,
                     195407..195428,195493..195574,195633..195713)
                     /locus_tag="CNI00800"
                     /codon_start=1
                     /product="peptidase, putative"
                     /protein_id="XP_572743.1"
                     /db_xref="GeneID:3259442"
                     /translation="MRATVLTLLGLSASAWATPAPFTVEDMLAAPRPFPAIASPDKQH
                     AIAVVDYWEPRDDSMRREAYLATLNRPEVKHPISLFNTTPSAAADFFWLDDVTIAYLD
                     GSNLFSYPVEYAFSQSNFKPKHNPPRSPRHQKILSFPHGVNPTSLQYEASTKTLAFTG
                     QVWSDGSFYQTRHHDKLYEKKRDSAQVYDDLMVRHWDTWRVSGKVWTLGVVKLININD
                     EWAELDNDINKHHKRRAEFINILNGTDLVSQTDPIDAGSYSISSEHIAVAVKPPYLQT
                     ATHTREDIYLFPLPSSYDSASILPKHVTPHAHGAISEIKFSPDGKKLSWLEMKKDGYE
                     SDRRVVVVYDLMSGKSERWTEVWDRSPKSISWAVDSQSIFLLAEFRGRTLPYHLTHPN
                     HLPTPLLFNGTTVSLTPLNETDILIARQSFRTPTVEWILTLPDPAEDGNAVGDGDGDK
                     IPAVEPLRQLTRWNEHFIRGRLDVQTGEEFWFKGAEGKDVMGWALKPRGWKPDQKAKY
                     PLAFLIHGGPQSAWDDSWSTRWNPALFAAQGYFVVAINPTGSTGYGQEFTDAIQGDWG
                     GKPFKDLLAGYHYVLENYPEIDPERTAGLGASYGGYMVNWINGHNDHFGFKALVCHDG
                     VFDTVTTFFSTEEIYFPTQDFAGTPWTNRATYEKWNPVNHVIEWNTPELVIQGGKDYR
                     LENSQGLGAFTALQLQGVPSRFVYFPDENHWILKPHNSIKWHHEVFRWLEEWIGKPTD
                     ESEAFVVQRE"
     gene            196105..200139
                     /locus_tag="CNI00810"
                     /db_xref="GeneID:3259543"
     mRNA            join(196105..197143,197199..199234,199282..200139)
                     /locus_tag="CNI00810"
                     /product="expressed protein"
                     /transcript_id="XM_572741.2"
                     /db_xref="GeneID:3259543"
     CDS             join(196952..197143,197199..199234,199282..200020)
                     /locus_tag="CNI00810"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572741.1"
                     /db_xref="GeneID:3259543"
                     /translation="MGPLRRQPAMLDLHSASRAVSVEWDDWDKDPWGQEEINHGSLKR
                     QSTDVLGETEDRKRIKEVRQSDKYRKASSIAKRSEPLLRRPVRSSNSPDTTTIVLEPR
                     SRSFSSARFEKTVTYDHASAISPCSEYGEGISLVLGISKPPQRFHASEYPESAYSTER
                     PDLAVFGQPASQPMVREYTSMGWDGENVENRCDTGKVLEGLPLINTSRLERTRKGNSK
                     SPWHQVSRKYSRASPLSNSTGDHDARTHTLLHTMKRGKSKSYQGGLSLNFQSVSLSPS
                     PIAPTPSPTSSSHSSQSFLSASMSDHSVRILTTITAQTRPHMNFLANASDVSILAPST
                     IGIGYSSSADTGSPGSLPESLEAECVDLTETGRRASHASKRDKRHSWMSHTNTVDPET
                     VEIITEELPSTQPLKSDPVYLRPCYILPVGSQTPLHTCSSAQGPKLKRAHTYANLKDL
                     WKLASFPGGLIEVQKDEEPVKQENQGLSSQILEPPAIIQPPSLGPPIDILSRPVSSAI
                     SRDTTTTARGPPTTHSYSPFRSVSMCSPPDTVEELFPESPFNSPQPGNIGKIKRSPFQ
                     ATRNSLKGMLNKSFKGRSLAHAFDNAEQNSQQRESSLKSKISGPLLIRGMRGEMDRKK
                     SDKEWREEVLKDVVGRTLSSQFKLLEEVAKQQRESLLDKEKISQKTPSFGIGLKNRSP
                     IPETLLSAVSICDKENPITADSHADRMKMKSGTRPSMESSLSLRMVTDETFNNPKTEG
                     LTSGHLANSIGRKNLTNQTPPHRLSGKGRPTSAPLLSAWSPPRPKSEKLSQVINPPIV
                     VNHATPRPEESPKTNPHHPPSSPSPSPKAGKSKSGRISRRSSILNLLKSKDSKHQNAS
                     QSPPRPKKMASGTFTLTGSIRSSFLAIIKNHIQTMQQEKRGKYSRTPCIIPPSTLPLR
                     TPIHQHTELYRPLSRARSSFELTLNLEPAKPLLDELLARDDALGFLEGRNKREQRVEV
                     DIEKVLEWRKEVEEDI"
     gene            complement(199722..201799)
                     /locus_tag="CNI00820"
                     /db_xref="GeneID:3259403"
     mRNA            complement(join(199722..200357,200409..200464,
                     200524..200720,200777..200886,200948..201054,
                     201119..201138,201200..201329,201381..201799))
                     /locus_tag="CNI00820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572972.2"
                     /db_xref="GeneID:3259403"
     CDS             complement(join(200211..200357,200409..200464,
                     200524..200720,200777..200886,200948..201054,
                     201119..201138,201200..201267))
                     /locus_tag="CNI00820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572972.1"
                     /db_xref="GeneID:3259403"
                     /translation="MVQKTRPSEKRIHLTRHAQAEHNVADDYTIADAPLTALGQEQSR
                     QLNEATKNGVQKTAELLVTSPLRRPLETMLLGYPELKSRLEKSGKPVILLDILQEVGP
                     YPCDTPTHPISALKASNGGIFSSLDFSTLSPDYASKEGIFSPANGAARAKLARKWLRE
                     RPEKEIVVVAHGDILRYIADGQQSSRPWNNAENKVFTFRSDDDSDDSMVEADYNVEAR
                     DATEAPTSSEIKAGKF"
     gene            205711..207886
                     /locus_tag="CNI00830"
                     /db_xref="GeneID:3259455"
     mRNA            join(205711..206233,206289..206385,206443..206491,
                     206542..206910,206963..207244,207299..207373,
                     207432..207505,207561..207749,207804..207886)
                     /locus_tag="CNI00830"
                     /product="monocarboxylic acid transporter, putative"
                     /transcript_id="XM_024657777.1"
                     /db_xref="GeneID:3259455"
     CDS             join(205824..206233,206289..206385,206443..206491,
                     206542..206910,206963..207244,207299..207373,
                     207432..207505,207561..207641)
                     /locus_tag="CNI00830"
                     /codon_start=1
                     /product="monocarboxylic acid transporter, putative"
                     /protein_id="XP_024513519.1"
                     /db_xref="GeneID:3259455"
                     /translation="MSEEVIELRNLNTLTERTTTVQRFEENREDNESVGSRKADDTPS
                     ERSLAQEDEENQGHEEAVIQYALPPADCGIRAWLFLAGATMMELLIWAIPTSVGVLHV
                     YWTNELFEGRGTATLTLAATLHSGLVYMSTALLGPLVVRATTWQKTIQVVTWIISAAG
                     LIASAFATQPWHLIVTFGIIYPVCGAAYLPCATLLFEWFVKARGTAMGIVYAGMGVGG
                     AVCPFIIDGLLKRYSYKTTMISIGVGFGIIGLISLIPIRHRIPPTSRSHHSEKRWHAA
                     DWSFMKSTALMAGLATILLTSLGNFVPSLWLPSFADDLSLTKPSGTGLVAILNAASVP
                     GNAILGVMSDHISLRVVILISCIGSGLACAFLWGFGTNDGMLVAFTIVFGLLGPSFSA
                     LWTKMNAVISKDNPFAITIVLSLFTFIRGVGNLTSGPISEALLKYNTFKGGAGAYGVS
                     NYGVLLLYSSITILSGGVTGAMFKEKST"
     gene            complement(208268..211882)
                     /locus_tag="CNI00840"
                     /db_xref="GeneID:3259460"
     mRNA            complement(join(208268..208716,208764..208869,
                     208936..209148,209292..209342,209401..209571,
                     209641..209792,209853..210006,210081..210124,
                     210186..210640,210708..211054,211115..211633,
                     211694..211740,211790..211882))
                     /locus_tag="CNI00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657778.1"
                     /db_xref="GeneID:3259460"
     CDS             complement(join(208765..208869,208936..209148,
                     209292..209342,209401..209571,209641..209792,
                     209853..210006,210081..210124,210186..210640,
                     210708..211054,211115..211633,211694..211740,
                     211790..211832))
                     /locus_tag="CNI00840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513501.1"
                     /db_xref="GeneID:3259460"
                     /translation="MSLHLDYAEISRQARRIVDANRAKTIMEQAPQSKSSSKRVKYTR
                     STAGCLACRSRKVKCDETLPACLRCVAAQRECEYPPPGEAGRKRKNGRGRSGDSSHAS
                     ESGAGGEKRARLSESVGGRDDDGQATSRGQRHDVQGHEWMEIGGGTMVRGAGNEGWAM
                     ERTTVQKGQTDPSPLNGTSLSPSDFLGDGTSRMGISPGDPLNFSTTDFSFLNEFIPFV
                     SPPSLSNAQASTSPNNPTSISNSTSNNTVLPLNAVASASASSSKHAPLPQFGNFSKSL
                     LLNRRKIKVGGSELLGQSDGTRTPSVPPYAIHPRLQMVDSFLQAFAHDEALFEFGPSH
                     RHRNLSNNTLTAGSIDVLSNAFPSPTARTLFHHYFNTASRILITMGNIGPNPLLAVCT
                     PLKLLDTNSAASAAIRMSMLSVGVAHFTHETKDAVGKNELGRNWETQRKKLKEMGSKF
                     KKAALSNITLAARAQNGPDQIDSILAACTLLCIRDVISADPTWRDNLEFALYLIGKQG
                     GPQAMLQGTGYSFTRRYLLENLATHDVFASFITGKEPAVLGNYDTWWFDSVETSQTRW
                     EWESVERSFGISRAMVDLVARIAVLDSQKRRLGVTLQGGIEEMWDVAQHFERESHCLL
                     LELDIWGNSLNALPQHVRVTCGDYIYKYMAVVFILADILEQPISTPRIVKCIDHILEL
                     LSEASAMRMSVMLIWPLLIAGVFALPEKRDKVRGLFDAFQGDYCEDLEVARELMDEQW
                     RGIDNGEGKQPWDKVMNKLGKYVLLI"
     gene            complement(212585..214956)
                     /locus_tag="CNI00850"
                     /db_xref="GeneID:3259434"
     mRNA            complement(join(212585..213078,213143..213788,
                     213846..213984,214047..214175,214254..214319,
                     214373..214956))
                     /locus_tag="CNI00850"
                     /product="membrane protein, putative"
                     /transcript_id="XM_024657779.1"
                     /db_xref="GeneID:3259434"
     CDS             complement(join(212752..213078,213143..213788,
                     213846..213984,214047..214175,214254..214319,
                     214373..214547))
                     /locus_tag="CNI00850"
                     /codon_start=1
                     /product="membrane protein, putative"
                     /protein_id="XP_024513529.1"
                     /db_xref="GeneID:3259434"
                     /translation="MSSPDRKSEELVVQMPALETSIMEVEVVPPPPKPQSKWMAIYRS
                     SLFQICVVSALAFCGPAMADAISGLGGGGQATPYTVNAATCASYCAVAVISLLGGPLA
                     SRMGIKGMLIAGAATFAINGSAYYVNSKYGVQWYLIFGRFLYGAGFGFWYVAEAAIIL
                     SYPEEGRRGKYLAIWVGSRNLGQLVGGSISLARNAKTAAAGAIATSTYLIFVAIEAIG
                     FPISFLISPPHKVRRSDGVPIVLAAKKPWKYEFLDLYRAIISPRMLLLMPIGFYSYFY
                     GGVLSTYLTNYFSVRARALSSFIVPTGIIVFTGIYGKFFLDNKHWTQRRRAQIGFAIF
                     MIPSLASFGWLCANQAKFLNTSPKYDWNSAGWANAYVPFYIMQVCGYLCQTYIYWLIS
                     CFTTDVGGNARNGGIFRCVEAVGQAVSYGINSNAKTRFIPLGINFGLAVLCIPSTYVI
                     IQQVPHYRADDVNRPIPYGQEEGTGSVAEEIDDELKKDAELRK"
     gene            215019..217140
                     /locus_tag="CNI00860"
                     /db_xref="GeneID:3259593"
     mRNA            join(215019..215523,215584..215961,216017..216556,
                     216612..216701,216765..217140)
                     /locus_tag="CNI00860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572737.2"
                     /db_xref="GeneID:3259593"
     CDS             join(215244..215523,215584..215961,216017..216556,
                     216612..216701,216765..217027)
                     /locus_tag="CNI00860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572737.1"
                     /db_xref="GeneID:3259593"
                     /translation="MTVSPTYPNQEDRLLPVQNRTESFWLSERDPLLQNAHTTPELPR
                     SADVVIVGSGLTGAMMSYHVYENARKAGRDIKIVMLEADEFCGGATARNGGHCKPMTI
                     FGYRAEAAKHGPKIANQLLTFEAAALQQYAAIVKKEDIDCDMHVTRAFDVCFRKEDAE
                     AGKKDYEARKAAWGEDMAKHDLRVVEDPKELEALTGVRGGYWGASYPAGHLWPYKLAS
                     ALTHIGLSRGLNFQTHTPALSLERSPSQPSQWVVTTPRGSITTTSVVVATNAYTSGFL
                     PEFKSLIFPVRGTACSITPAPSHSHGSIPGPIKYTFGFRHGPGEVDYMIPRQGRGRIP
                     GSGDRSLILGGAKGCFLSNIDQWYDNKNDNEHMPGAQKYFEGFMKKYFVGWNGNKHGN
                     VDRVWSGILGYSSDLLPYVGEVPNKPGVFICAGFTGHGMPRIPGCTAALSSLAFSYLS
                     NGTTTPDANKAFQDALPQPYWLTKERFESKINLIKAAMGQRDKAKLDTTNQADEAILA
                     AKMGDAKL"
     gene            complement(217435..218922)
                     /locus_tag="CNI00870"
                     /db_xref="GeneID:3259472"
     mRNA            complement(join(217435..217683,217743..218267,
                     218326..218346,218411..218922))
                     /locus_tag="CNI00870"
                     /product="haloacid dehalogenase, putative"
                     /transcript_id="XM_024657780.1"
                     /db_xref="GeneID:3259472"
     CDS             complement(join(217514..217683,217743..218267,
                     218326..218346,218411..218426))
                     /locus_tag="CNI00870"
                     /codon_start=1
                     /product="haloacid dehalogenase, putative"
                     /protein_id="XP_024513528.1"
                     /db_xref="GeneID:3259472"
                     /translation="MPSVVFDVVGTCFSYDNGAEALQARLGPKLAKYGIPSKLLFYSW
                     VCSTERDYSYLSQIKQYKAFFAILSNTLTRVLFQAGVPVEALDDFFTADDVDYIMNEY
                     KKLKARPGLAEMMQTLRDGGFEVWCCSDANVDRVKGYFDNAGVEMPLDHILSADMVKA
                     GKPEAAVYKFAREKAGSDQPGEVSVFAASHAWDCAAAKAAGFLTAYTTTYEYDECEVI
                     FGKSDLVAPDLVSLGKGIVEKWGKK"
     gene            218991..220892
                     /locus_tag="CNI00880"
                     /db_xref="GeneID:3259375"
     mRNA            join(218991..219267,219332..219635,219694..219764,
                     219816..220068,220117..220283,220337..220522,
                     220581..220892)
                     /locus_tag="CNI00880"
                     /product="ornithine-oxo-acid aminotransferase, putative"
                     /transcript_id="XM_572817.2"
                     /db_xref="GeneID:3259375"
     CDS             join(219082..219267,219332..219635,219694..219764,
                     219816..220068,220117..220283,220337..220522,
                     220581..220844)
                     /locus_tag="CNI00880"
                     /codon_start=1
                     /product="ornithine-oxo-acid aminotransferase, putative"
                     /protein_id="XP_572817.1"
                     /db_xref="GeneID:3259375"
                     /translation="MPSFEPAVSSHIAPLPSASKPLPLTTSTEGLQALADKHITKGLG
                     RLRDHVFKEGKGLRVLTTENQKLLDFTSGIGVTSLGHAHPDVTAAIISQAQSIIHVQC
                     AIGLSEPYVQLVESLLTMMPDPSLDSFFFWNSGSEAIEAAIKVSRTKTKRNNIVVMQG
                     GYHGRTSGAAALTRSKTSFFRGTGPLMPCVYTTPFPYWHAMGLPKDTPEEVLIEQAIL
                     GIENLLQQQTAPEDTAAIFLEPVIGEGGYIPAPTAYVKHLRKLCDKYGIMLVIDEIQT
                     GFGRTGKTFAIEHTGVTPDIMVYAKGFANGMPISGIVTRKEIMDVMAPGSLGGTYSGN
                     VVACAAALATTRYMRTHDILGNVQARSEQLFKGLREIQEDEANGGWMIEEVRGKGLMI
                     AIEFKDPNSKLTSSHNRGDISLPGNLNKLVQDACYDRGLLVLTTSIYPVLRLIPALVL
                     SEEEVDEALKIIKESVKEVASVIEGN"
     gene            complement(221216..222853)
                     /locus_tag="CNI00890"
                     /db_xref="GeneID:3259775"
     mRNA            complement(join(221216..221548,221605..221681,
                     221740..221820,221872..222311,222361..222462,
                     222516..222853))
                     /locus_tag="CNI00890"
                     /product="tartrate dehydrogenase, putative"
                     /transcript_id="XM_572848.1"
                     /db_xref="GeneID:3259775"
     CDS             complement(join(221218..221548,221605..221681,
                     221740..221820,221872..222311,222361..222462,
                     222516..222564))
                     /locus_tag="CNI00890"
                     /codon_start=1
                     /product="tartrate dehydrogenase, putative"
                     /protein_id="XP_572848.1"
                     /db_xref="GeneID:3259775"
                     /translation="MPSNSRQHNIAVIPGDGIGIEVTASTLKVLRAVQKKVGGFELSF
                     DELDYGSARYKAQGSYTPAGWLDHLRKSDAIFFGAVGDPDVPDHISLWELILPMRQTF
                     QQYVNIRPSSILPGIPSRIVGTKPGDLDWIIVRENTEGEYAGQGGRTHVGTEWEVATE
                     LAVFTRKGVERVMRFAFETAQSRPKKFLTVVSKSNAQRYGLLLWDEVAEIVSKDFPDV
                     KWDKMLVDAMTVRMVAKPTSLDTIVTTNLHGDILSDLAAGLSGSIGIAHSASLDPTRT
                     SPSLFEPVHGAAFDIMGKDLANPIAAIMSAAEMLRWLGENEAADLVEKACKQSIADGQ
                     TTGDLGGKLKTSQVTEAVCKILETL"
     STS             222800..223059
                     /standard_name="AAC22"
                     /db_xref="UniSTS:470722"
     gene            223100..225202
                     /locus_tag="CNI00900"
                     /db_xref="GeneID:3259397"
     mRNA            join(223100..223214,223277..223438,223514..223725,
                     223776..223868,223935..224147,224206..224319,
                     224368..224461,224511..225068,225125..225202)
                     /locus_tag="CNI00900"
                     /product="succinate-semialdehyde dehydrogenase (NAD(P)+),
                     putative"
                     /transcript_id="XM_572819.1"
                     /db_xref="GeneID:3259397"
     CDS             join(223182..223214,223277..223438,223514..223725,
                     223776..223868,223935..224147,224206..224319,
                     224368..224461,224511..225068,225125..225148)
                     /locus_tag="CNI00900"
                     /codon_start=1
                     /product="succinate-semialdehyde dehydrogenase (NAD(P)+),
                     putative"
                     /protein_id="XP_572819.1"
                     /db_xref="GeneID:3259397"
                     /translation="MPSLTQTKDLASLLSDASHFKQKGYINGEWVSASDGATFPLYNP
                     ATGAKLADMPHMPRSQVAEAINAAKAAFPAWAALTAYQRQNYLLKLFKEMEEHSEDLA
                     IILCTENGKPLAESRVEISYGASFLTWNAAEALRTYGQTIPSPFPGTRNTVIKQPIGV
                     CGLITPWNFPNAMITRKMAPALAAGCTVVIKAPAETPLSALAMCVLCERVGIPPGVVN
                     VVTMDKGQREMAAGLELCENVKVSKISFTGSTPVGRLLMKQSSGTLKKLSFELGGNAA
                     FIIFDDADLDLAVNGVILSKFRAAGQTCICANRIFVHSKIYDDFARRLVERVKAFKVG
                     NGIEEGVTIGPLVSQRGVEKVERHVQDAVGLGAKVLVGGKRIDKGEGSCFYEPTVLVD
                     VPRQCAVSNEETFGPLAPLFKFDDEDDVVERANSSEVGLAAYFFTKDLARTHRVAEKL
                     EVGMVAVNTGAIAQSCVPFGGVKQSGFGREGGPSGIDEFMVEKLITIGGL"
     gene            225578..228073
                     /locus_tag="CNI00910"
                     /db_xref="GeneID:3259688"
     mRNA            join(225578..226363,226418..226915,226970..227229,
                     227285..227809,227863..228073)
                     /locus_tag="CNI00910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572821.2"
                     /db_xref="GeneID:3259688"
     CDS             join(225634..226363,226418..226915,226970..227229,
                     227285..227809,227863..227991)
                     /locus_tag="CNI00910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572821.1"
                     /db_xref="GeneID:3259688"
                     /translation="MTSSKPLHQLPFAARTLQSSVPQLPLSSQPSAQRRSTIFKSSTP
                     GIWARVNPMWAPWPIRVSKEEAEDLGINVEKGEKIDAEDIMKSWEPCEVLEQGAENGL
                     DVKSSKRRVKLDPVILGISPSALKDSLPHLDVGDLLEICKTGEQPTSGDPAREIFIDV
                     LSGRKILASDSYGPWATRYSGHQFGGWAGQLGDGRAVSVLETESEQGGRQEIQLKGAG
                     RTPFSRADDGLAHLRSGVREFLGCEAVAALGIPTTRALTLLTIPLPYLPVFREGTIHP
                     SSLLTRVAPSFIRVGHFEALNPPSSAAGGKQFFVGGGGWVDDQTDEEGEDEGNGNFEG
                     LRDLGEWMKEIMEVKEGWKSWVDEVIKKNAEMVAKWQVYGYMNGVINTDNVTLMGITI
                     DYGPYAFMDVFDQKHISNQSDPTGMYAYRNQVSRVQFALSKFIDSVSPLLGYESIHGD
                     IPKGWSEGKTKEDIKEWSEKGKEVMKGWEKSFEEYEEESEMNGWYQRFGLKTKQQFDQ
                     RDIKYDFLNYLQLHNLDFHTAFRGLCEFSPTKASQESGDKYIKEFVPHWVKSAVDESA
                     SDDSLKLVEGDFVQWFGMYAKRANLEDEKFAWGTTDDWEPARAANMRKKNPTFVLRQW
                     ILEELLGKMEEALTDPYKAAQSKDDVDKQKVEEGVRTARRELWKILEMATKPFENWGQ
                     GEGSREELEAQRRLCGVGAKEMFGYQCGCSS"
     gene            complement(228034..229605)
                     /locus_tag="CNI00920"
                     /db_xref="GeneID:3259395"
     mRNA            complement(join(228034..228126,228176..228744,
                     228796..229011,229061..229282,229338..229454,
                     229504..229605))
                     /locus_tag="CNI00920"
                     /product="small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_572846.2"
                     /db_xref="GeneID:3259395"
     CDS             complement(join(228084..228126,228176..228744,
                     228796..229011,229061..229282,229338..229454,
                     229504..229542))
                     /locus_tag="CNI00920"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_572846.1"
                     /db_xref="GeneID:3259395"
                     /translation="MGRLAEAQRRLLEQMMGPEAMGIQAVNLDWWNEKVCRNFLFGTC
                     LHTLFGNTKMDLGPCPKVHSDRILKQFREHAEANPNDPRLSAFRQEHENSLYSFVEDC
                     DRRIRASQRKLEKTPEENRKTVDLMREIGEIELSIQGGTEEIEALGEAGKVEESMEKL
                     AAVDALKAMKAEKEKDLQHLNENAGASGHQKLRVCETCGAMLSVLDSDKRLADHFGGK
                     LHLGYHELRKILSAFSEARMTGRPIPIIPPKSPRADGDEPLPFSAPAIPATAPAAPTG
                     PRSGLNPPMGPSGNEPHTPHHARVPPVEEMPVVGHGDKVKREAGELVEDLKEERAMEE
                     RDKERERYRERERDRDDRHDRNRYDDRDRDRYRDRDRERDSRYGGDRDRKKSYDRERS
                     RSPVKRRVL"
     gene            229741..230533
                     /locus_tag="CNI00925"
                     /db_xref="GeneID:36393031"
     mRNA            join(229741..230109,230174..230533)
                     /locus_tag="CNI00925"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658728.1"
                     /db_xref="GeneID:36393031"
     CDS             join(230016..230109,230174..230331)
                     /locus_tag="CNI00925"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514401.1"
                     /db_xref="GeneID:36393031"
                     /translation="MSDLLDETADGINTDSNGLTCIEPSAWDTILKVTIVLMITELVV
                     GITFMCVRSRRHRVDHEHGMVHAYKGWLERKLKRKGHVK"
     gene            230534..231152
                     /locus_tag="CNI00930"
                     /db_xref="GeneID:3259438"
     mRNA            join(230534..230703,230768..231152)
                     /locus_tag="CNI00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_572735.2"
                     /db_xref="GeneID:3259438"
     CDS             join(230625..230703,230768..230937)
                     /locus_tag="CNI00930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572735.2"
                     /db_xref="GeneID:3259438"
                     /translation="MLDTLPGVSNSGDSTCLEQWLVITVCITVCLLICALFTFTTLSI
                     REIWLIRQSRRGKDKEEDEKEQLVDIADEVGVTHKKTE"
     gene            complement(231998..233012)
                     /locus_tag="CNI00950"
                     /db_xref="GeneID:3259462"
     mRNA            complement(join(231998..232394,232454..232556,
                     232619..232699,232754..233012))
                     /locus_tag="CNI00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657781.1"
                     /db_xref="GeneID:3259462"
     CDS             complement(join(232179..232394,232454..232556,
                     232619..232699,232754..232977))
                     /locus_tag="CNI00950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513497.1"
                     /db_xref="GeneID:3259462"
                     /translation="MSLDHQHLPSPAPTPSAAPPNPAVGPAMTGAPPDQAAIRTAVEN
                     QLLQLSQDLYEMEISAGHVKENRETAVADYMENINKAFINLSNLAGQMTDSVPHQIIE
                     NVDRYKNPHVYTRQTITRATGENQYALGRVLGLESFRRQLHDAISSDFPEIPLPERRH
                     QPIKTSQEEDAPQEGGSTMPNGYSVKIEDGAGPDGQNGQSIVNGMSS"
     gene            233165..235583
                     /locus_tag="CNI00960"
                     /db_xref="GeneID:3259563"
     mRNA            join(233165..233722,233781..234387,234441..234471,
                     234528..234540,234592..234658,234707..234952,
                     235011..235112,235164..235428,235484..235583)
                     /locus_tag="CNI00960"
                     /product="F-box domain-containing protein, putative"
                     /transcript_id="XM_024657782.1"
                     /db_xref="GeneID:3259563"
     CDS             join(233176..233722,233781..234387,234441..234471,
                     234528..234540,234592..234658,234707..234952,
                     235011..235112,235164..235191)
                     /locus_tag="CNI00960"
                     /codon_start=1
                     /product="F-box domain-containing protein, putative"
                     /protein_id="XP_024513496.1"
                     /db_xref="GeneID:3259563"
                     /translation="MFTQVSTPSTPSFPNTPDVVEEMEKLQMNPSQEPTSTSLQINDE
                     EELERFRAQWREELKAKKTGVTSGVNVGNVIWKSKGQGVEREHEDSNGHATLTSPKTS
                     RMAHTLPAFEDDDDVPRAGPSKAVPAMAIIKGANHSKTHSKKFRTDKERAVQTYAKAV
                     ESEQSGQLNEALILYRRAFKMDDDVDKLYTRSVAKATAQQVLEQQGTSENPLPAIPNS
                     ADIVQPSAPVEEPYSFQRHIQLHPDYVKSSAAPIASSKTSSKSALTAILDSLPIAPYE
                     FTFLPEDEDLPIPIASLPAELIDPILAHLDVIWVERFAATCWRARYLTQCSNVWRRLA
                     CRIYREPAILPPGGLTVKDLMQRHAGEWRTTLIEEERVRMDGCYIAVCHYIRPGAGDE
                     WIAITHLITYHRFLRFYPDGSVISFLTTDHPSEIVPVLRPSLRGKGLHFGRWRLIRSD
                     AIHNPEIDSEWVPSKSGEKRPARIIISDLLEPGVEKPKYEFEMELALRQTSRGRWNKL
                     DILEYRSINLTTGETLALSLKNQKPFFFSKVRSYNPPF"
     STS             234783..235573
                     /locus_tag="CNI00960"
                     /standard_name="Hind26"
                     /db_xref="UniSTS:470723"
     gene            complement(235197..241576)
                     /locus_tag="CNI00970"
                     /db_xref="GeneID:3259475"
     mRNA            complement(join(235197..235355,235418..236197,
                     236249..236368,236407..236523,236565..236636,
                     236683..236880,236929..237027,237068..237342,
                     237395..237518,237562..237603,237651..237779,
                     237825..237958,238005..238072,238130..238166,
                     238214..238287,238339..238349,238405..238507,
                     238549..238660,238706..238772,238826..238845,
                     238893..238936,238984..239067,239121..239231,
                     239282..239429,239487..239574,239635..239800,
                     239849..240106,240150..240233,240282..240361,
                     240412..240628,240687..240754,240807..240929,
                     240984..241295,241349..241576))
                     /locus_tag="CNI00970"
                     /product="DNA helicase, putative"
                     /transcript_id="XM_024657783.1"
                     /db_xref="GeneID:3259475"
     CDS             complement(join(235288..235355,235418..236197,
                     236249..236368,236407..236523,236565..236636,
                     236683..236880,236929..237027,237068..237342,
                     237395..237518,237562..237603,237651..237779,
                     237825..237958,238005..238072,238130..238166,
                     238214..238287,238339..238349,238405..238507,
                     238549..238660,238706..238772,238826..238845,
                     238893..238936,238984..239067,239121..239231,
                     239282..239429,239487..239574,239635..239800,
                     239849..240106,240150..240233,240282..240361,
                     240412..240628,240687..240754,240807..240929,
                     240984..241295,241349..241460))
                     /locus_tag="CNI00970"
                     /codon_start=1
                     /product="DNA helicase, putative"
                     /protein_id="XP_024513495.1"
                     /db_xref="GeneID:3259475"
                     /translation="MDFEEDQPLWDGSRQEEEDVYFGKFGYAEGYESPYHPNNSPTPR
                     YDIGLSSRSLNPGQNLTGFSASQFNPSRHTPFPLISDSHSLLTDLALNRSTRQFTPEN
                     SLARDHSAILQRQQSENYGDEIWEDEEFVEAVNESFNHEIDNAKEYDPVITAETIRSR
                     EELRNKAVFNKNGKPLVPLSRLPIDQRKLFKFPCFNNVQSEVFDDVYQSDENLVVSAP
                     TGSGKTTIFELAFLHNLSFRTPDDSLKPLAVYIAPTKALCNEKAKDWQERLSQALPDV
                     ICNEITGDYGNTSTIYNSIRTADLMVTTPEKFDSMTRRSRNLENMSQRLRLIMIDEVH
                     ILRESRGATLEVVISRLKGLGRGIRFVALSATVPNIDDIARWLGPTRNEYGQLSRGVL
                     VGREVISAKEKRAPAVDDMPMAKVYKFGEEYRPVPLQRETYGIESTGNDWALANRLDK
                     ELFPILLRHAAGQPVLVFCPTRKSCQATAESIFQSYEEARAKGLKLPWQHPPGVRLEL
                     QDKKLTELSTCGIAVHHAGLDYGDRRAIEDGFRDGKLHMIASTSTLAVGVNLPAHTVV
                     IKGVMAWQGASSGFQEYSDIDIQQMVGRAGRPQYDTSGVVVVMCERSKVRKYQSMLNS
                     QTVLESCLHENLTEYINSEIGQGTIRSVSSAQEWLRNSFFHIRIQQNPKHYALSDAKD
                     KPVEGAWEEWLDHYVEKALINLEKDGFIERADDDTLIPTETGKIMSSSMISYGTMCSI
                     KAMSPGSTVQDLLEILAGSTEFQDLRIRQGESGFLNKLRINEEIRFPLAEAVKSYADK
                     VFLLLQVTFGNIILEDIAKKTELTSPIQTLMAIYNHAPRIVKAIVQFTLNREYGIAAR
                     SALELHRVVVGKAWEDLPTIFRQIPSIGPKSIRVLGQNGITNFDQLLDVESEKIQLWL
                     NRGHDFARAIHEQARRMPRFHVTMEEENMDYDGTYNVLNLRVNITPKAKVIATESRGK
                     RGGFITQYNLSTLFLNQSGGFIGYRRLELKKLIKNKDNSFIIAVTLSKRCDSVAAIVG
                     VDEVAGCSTVIHYNTNLDDSVYPEDLEDDENVEEPPSQRTLVEPTPELEEELLPNGNV
                     KCHHSCKDKLACQHVCCKSGVPPRKRNKAGARASGRSNVRTAADRIRETQYCVESPRE
                     ELRPVGKAVRRIRQGSQMSRSPSPASNVQAANHKAAIVSEMQPNTRAVERVREARIVR
                     GPLSSTVAIEPRSRSTTPIVPPKAVKNENIASGQIKEPLFLPGSDDDYNARHHENDPS
                     RKAIARSKAMSGSTSRYFDQPKTSGKAKNALSRKPPTMPVTSSASHPSILDLLPGQAT
                     IKNNSDANSHDLGPIHGNFSDDGYETVRESPEMKHSRVFPHSKPSIDWYTEEIVQDDP
                     EKSTEANKSHVVTNAQAPENWEFNIEEMFADISGSPSSPKQLEEEPKSVLNINPSPSL
                     KQPARLIIGGFGRPSIKRQRLHEDQHSSNYSLAQPFAQSDNPDILRANENGPTAQGPS
                     ASMPQNEMDEFEDWYMGEGG"
     gene            complement(241710..243687)
                     /locus_tag="CNI00980"
                     /db_xref="GeneID:3259713"
     mRNA            complement(join(241710..241950,242009..242184,
                     242234..242601,242640..243194,243254..243489,
                     243542..243687))
                     /locus_tag="CNI00980"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572725.2"
                     /db_xref="GeneID:3259713"
     CDS             complement(join(241849..241950,242009..242184,
                     242234..242601,242640..243194,243254..243489,
                     243542..243646))
                     /locus_tag="CNI00980"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572725.1"
                     /db_xref="GeneID:3259713"
                     /translation="MALSLKDMRPLVVHCDTDYIRAGFAVGELFPRPSVTLRACYAIP
                     IASSNKAADANGDSRAADGDVDVPSKSGWLVGEELVGAQKENNWESSLELRWPFRPNK
                     VADDWEGREYIMSHLLALLGINIQTNSSALLLIPPPSPPTFTLSTQALYTQFAFESLN
                     TPMFSILPAPLSGLYALGATTGIMIYIGHEESSAFVITDSIVRWECSTSVQIGQADCE
                     SHFEQLLLEDDLLDQELKTATGNESLDLEEKRKLVKEVANFVWTECTGDDIEVPALNA
                     KAAIVIGAAQTSGEEDTFDVAKKLVGDPTPAPTTNSHKSKKQQAQALAAANKAAAQAA
                     ADAAAQAALPPSIDAIVVTIPSLPEKEIQLGPVRHRICEPLFKGKSIGGDTLYEAVGR
                     AVENDSLSTGEKLAIWEGVGVIGEVAKIKSFSPALVTYLSPYLLSSSELPSDCQPSKM
                     RLLSIPDYFANFKKTTTELAPFLGGTLVAKVAFTDSTGKHSVSKVDYNTKGPEAIYVV
                     TSEDR"
     gene            complement(243978..245183)
                     /locus_tag="CNI00990"
                     /db_xref="GeneID:3259454"
     mRNA            complement(join(243978..244160,244214..244321,
                     244381..244442,244492..244515,244570..244946,
                     245004..245051,245102..245183))
                     /locus_tag="CNI00990"
                     /product="expressed protein"
                     /transcript_id="XM_572844.2"
                     /db_xref="GeneID:3259454"
     CDS             complement(join(244108..244160,244214..244321,
                     244381..244442,244492..244515,244570..244946,
                     245004..245051,245102..245107))
                     /locus_tag="CNI00990"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572844.1"
                     /db_xref="GeneID:3259454"
                     /translation="MGLLDKVTDKVTGHSHGKNSDNYDQSGNESYGSGGQGNNSFGAG
                     KDSYGSSGQGGDTYGSGGQPGGQSGGQSGGFGSSGNNSYGSSGQGGGTYGSGGQSHGS
                     SGLGSSGNDSYGSSGGDSYGSGGLSGGQPGGFGGNQSGGGLGGGNSGGFGGSGGNDSY
                     GSGGNAGGFGGGRGDDSYGSGGKPGGFAGGNNDAFGSGGNPGGLGGGGVRGSEQGGFG
                     GTGRSGY"
     gene            245948..249080
                     /locus_tag="CNI01000"
                     /db_xref="GeneID:3259446"
     mRNA            join(245948..246209,246269..246517,246568..246883,
                     246944..247353,247402..247453,247509..247667,
                     247725..248204,248254..248397,248446..248550,
                     248613..248898,248953..249080)
                     /locus_tag="CNI01000"
                     /product="DNA helicase, putative"
                     /transcript_id="XM_572723.2"
                     /db_xref="GeneID:3259446"
     CDS             join(245992..246209,246269..246517,246568..246883,
                     246944..247353,247402..247453,247509..247667,
                     247725..248204,248254..248397,248446..248550,
                     248613..248726)
                     /locus_tag="CNI01000"
                     /codon_start=1
                     /product="DNA helicase, putative"
                     /protein_id="XP_572723.1"
                     /db_xref="GeneID:3259446"
                     /translation="MTLDILQPKPTPDASVQSFLNRHKQLLELERKAEEEQTRLLNSK
                     CSPSLLEQRGLALNGLGVSGISIGLGGKSLIELHRPLAYHTSPALPPHTFRPGDPVRI
                     EAHVATTSGKSKGKKRESEDEGAVEGVVYRVGPEKVVVAVNESKEIDLPERLRLLKLA
                     NSVTFDRMEKTLAHLERLVLPSGGTPSPPSFNMPLVQALLGKQLPTWKETIPPQNNIE
                     PLGQLSSDEDMKWFGQHLNDSQKESIKFCLKANEVACIHGPPGTGKTHTLVELIFQLL
                     SRPAAPNTTLPPRILITTPSNLALDNLLIRLHILAQQPPYSSLLPRNSFLRMGHPTRV
                     HRDLVKETLDWKAANGDQGELLKDVGKEMQGHLDALGKKRGEKGAVKGKERGKKWGEV
                     RELRKEYRQREGKVVKTVVNGAQIVLATCHSAGSRQLNNMIFDVCIIDEATQAVEAVC
                     WVPILKSKKLILAGDPQQLPPTIMSKENAPPLKDLQEAIDQIKLGDSPSLKSPRTLET
                     TLFERLEKLYGPGIKRVLQVQYRMNEHIAVFPSETLYESALISDASVAKRTLLELPSV
                     KDKTSEDVKDDLEPTVVFFDTADCEFYERTEGDGEATKSSIGEGSKSNENEAEIVARW
                     ARKLISLGIPPIEIGIVTPYQAQVTLISSLLHEEYPEMTIGSVDGLQGQEREAIILSL
                     VRSNPSGEVGFLGEYRRLNVAMTRAKRQLCVVGDSKTVSKGTKYLKKWMDWLEAEADV
                     RWAGEETV"
     gene            complement(248803..250701)
                     /locus_tag="CNI01005"
                     /db_xref="GeneID:36393032"
     mRNA            complement(join(248803..249789,249850..250373,
                     250459..250701))
                     /locus_tag="CNI01005"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658729.1"
                     /db_xref="GeneID:36393032"
     CDS             complement(join(249034..249789,249850..250350))
                     /locus_tag="CNI01005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514402.1"
                     /db_xref="GeneID:36393032"
                     /translation="MAFPYHNVTFCGFGGHVPFLHQNLPPSTPPLQSEGLELSLPKLS
                     NPHQALNLGSTLTPSTAEDRPPDSTHHPESTSALSNHQPPMHHDEDLMMKPKRKRGRP
                     RGSKSRIRTTRPSRNTGRVKAESKAEPPRRKGVKDLQRSKDEAKKRERRRRAYEACTH
                     CRYRRQKCDEGVPCSLCRKDQKACIYLTKLPTELVEMARKRRYSPQTVPPILLFHMQR
                     KSSETEIHLPTSSTNTALDFPPVKSAEPAHTSVGEDNTGDFNDMEVGNAVVSRSIRKS
                     FGEYSGSEPELMTPAAAPRMELSMAAHLPDHSPPQLWEANCIFRRQVQEPAPEPITLP
                     TQPGPLYEFNPGVSSGSIMELFSDGPQALSVAVDEFEWCTEPSRASAVDSGLNLDTNM
                     VASPGFDDNLNQGIDFSGSLGVYWRE"
     gene            251906..254433
                     /locus_tag="CNI01010"
                     /db_xref="GeneID:3259618"
     mRNA            join(251906..252322,252372..252468,252507..252617,
                     252671..253783,253841..254097,254152..254279,
                     254336..254433)
                     /locus_tag="CNI01010"
                     /product="expressed protein"
                     /transcript_id="XM_024657784.1"
                     /db_xref="GeneID:3259618"
     CDS             join(252063..252322,252372..252468,252507..252617,
                     252671..253783,253841..254097,254152..254279,
                     254336..254382)
                     /locus_tag="CNI01010"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513557.1"
                     /db_xref="GeneID:3259618"
                     /translation="MPPRPAPSSGPSTIEPANLSHFAIFNPNLETPAPTRKEGEDRDK
                     DDEDDQKEAAQILFYTSREAGGVSRDKMLRQVGLAKGLMGFADMLAKDNTKFWAIHSH
                     KSRLIVYTPEPDIYIYTCITLAYNADTKDPAPSSQSISDLMLVSALGRGYEDFRFLHG
                     PLSSHTPLTSASSSLIDRYFTRFAFNFESACLSSPSLSQWIAGFPPPSNNTIDQLLQY
                     FKGSNGITSDVYAVAKDGPLAIGSESTPDPALLRYLVHLVQASLPPPIPPINTITTTK
                     HEYSRPLGLSLLGLGTLKRKKDETRKASWATLGGWAPDLRQVGVPSLGSAKQKVSTTS
                     EQVSIKDVKKPSSGNGSTVEKKDSWGFGWGAIGDAVGSVGTVFGLGTAQPVKTPADVS
                     RATHGASETIVSSKPEDNLGLQTSTDEEDDGMEAKKVLSQISTPEIQGSSDIIDSNDS
                     KDHPADVPPAISLSSPTPDSHATSQVTIDENVRPVNVSIPELEDAAEPDVEIDWDSRA
                     AWIVCADGILERRIICWIIRDGIIIAIILPGESTPPFSLPSARSILSLVADVTQVTSA
                     TDVAASDCRQDEGAWIYKFDKDFMVSTGKMGTVEEQTLIDLRGTLKSTPSISEVFAKT
                     SSSHFVLAKQKTDKELYAVCETKDASLTDAEHSLRKLLRSHPEIKM"
     gene            complement(254438..255698)
                     /locus_tag="CNI01020"
                     /db_xref="GeneID:3259571"
     mRNA            complement(join(254438..254620,254705..254972,
                     255064..255253,255323..255368,255429..255499,
                     255561..255698))
                     /locus_tag="CNI01020"
                     /product="peroxisomal protein, putative"
                     /transcript_id="XM_024657785.1"
                     /db_xref="GeneID:3259571"
     CDS             complement(join(254556..254620,254705..254972,
                     255064..255253,255323..255368,255429..255499,
                     255561..255589))
                     /locus_tag="CNI01020"
                     /codon_start=1
                     /product="peroxisomal protein, putative"
                     /protein_id="XP_024513525.1"
                     /db_xref="GeneID:3259571"
                     /translation="MSALQRFLHNPANHDLLSVIKGARNGFVYGVKIRFPHALVMTFL
                     FSHKPWPAKIKGILTATRTHAINLCKFVTIYKLLLILQKKLNGGKERDLDTFVAGGLG
                     GWWVFGERTPINEQMVLYVLSRSLLSLLPRLYNTASPPKTPIEPLAHPLPPLTSPQAN
                     PKPIPPAQLPFAVLAALSWASVMYMFRHRGERIQPGMANSMRYLYRDSETWRDLRTLL
                     WHNK"
     gene            256046..257628
                     /locus_tag="CNI01030"
                     /db_xref="GeneID:3259619"
     mRNA            join(256046..256526,256577..257628)
                     /locus_tag="CNI01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_572970.2"
                     /db_xref="GeneID:3259619"
     CDS             join(256496..256526,256577..257550)
                     /locus_tag="CNI01030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572970.1"
                     /db_xref="GeneID:3259619"
                     /translation="MALTESDGLMITLPSTLPITSSHSQETMTTPPTLTFANSKSLTT
                     PPLNRSLPNLGLADGSTTCAPGYILICIHHDPLSRYTLGINFTAFVGLCPTSPVTTST
                     ADCPAFPSSTPKFADHMRCHVIQRLLHTVMHDHLANMTDCHTWESLVNAVYDYCTWTM
                     ECILLGTDANVRFGVSCYPFLKELEEAARTLRRDSMGEWDDVVQIGVDRLLETLPCGE
                     WTLTKRRIEKERLPEFPKAQTQVKAKREARRPAAPSIPAPAVIPVPAPAPLIIKRKRY
                     SSLRTLMGRAGSVVGRQKMRAKASAVIEKGKVGFHDRQTVQRMEPVSSMSGPASLSCM
                     "
     gene            257752..259396
                     /locus_tag="CNI01040"
                     /db_xref="GeneID:3259718"
     mRNA            join(257752..258486,258542..259396)
                     /locus_tag="CNI01040"
                     /product="inositolphosphorylceramide synthase, putative"
                     /transcript_id="XM_572823.2"
                     /db_xref="GeneID:3259718"
     CDS             join(257823..258486,258542..259263)
                     /locus_tag="CNI01040"
                     /codon_start=1
                     /product="inositolphosphorylceramide synthase, putative"
                     /protein_id="XP_572823.1"
                     /db_xref="GeneID:3259718"
                     /translation="MSAIRTLANPVTACFSTSLSPRAAFHRFLHALSASIRRLDLSRD
                     PSKTLNRLKQHRFTLANTLPRAFMLLCASYSLYIMTTPPFPLKLGIPIAYVAAVILPI
                     TSQFVWPATPIFAWLITFFSARFIPSGRRPEIHVALLPALESVLYGANISDLQTRYTN
                     AFLDVVAWLPYGVLHFTLPFVVAVILWSLGPRGAVQFWGLAFGWMNLLGVVCQLLFPA
                     AAPWYEIIHGLTPADYSMAGSPGGLMRIDRVFHSSGYTNAFGSAPLVFGAFPSLHSGC
                     AVMEALFLSHFFPSLKGLYWGYVGVLWWATMYLSHHYLIDLVGGACLSVLVFYLCMPE
                     GFKDVDQIQWEAVEGDGYEMIGGPRTGTGPDIDLDEEIRKLEEQGEALFEQAIGDEES
                     RIETKGEGNTGAGGNVSGNESGDSADSGKKKGKGKQTAKKPKMKEPRSVSWGETKVMG
                     EGAQVVSEDSS"
     gene            complement(259390..260123)
                     /locus_tag="CNI01050"
                     /db_xref="GeneID:3259394"
     mRNA            complement(join(259390..259771,259877..260123))
                     /locus_tag="CNI01050"
                     /product="30S ribosomal protein S18, putative"
                     /transcript_id="XM_572840.2"
                     /db_xref="GeneID:3259394"
     CDS             complement(join(259439..259771,259877..260068))
                     /locus_tag="CNI01050"
                     /codon_start=1
                     /product="30S ribosomal protein S18, putative"
                     /protein_id="XP_572840.1"
                     /db_xref="GeneID:3259394"
                     /translation="MSFSRLPRLTSVVRALHTSASTRRPAANPTEIFQKAFGERAATQ
                     TSPLMKNEVQDNREQFKANQFAAPQAFTQESIFPTARPFPRPPLLGPPKKIAVKLDPF
                     YITKTNPLVHDMNPNFAYEFVNPMGKIKSRAETGLTWKSQRRVGKLVRRARAMGIISR
                     WTNRPVPGGLGWSY"
     gene            260261..263330
                     /locus_tag="CNI01060"
                     /db_xref="GeneID:3259629"
     mRNA            join(260261..260460,260516..260562,260620..260669,
                     260726..260840,260916..261271,261339..261702,
                     261761..261840,261897..262077,262145..262549,
                     262610..262972,263032..263330)
                     /locus_tag="CNI01060"
                     /product="ribonucleases P/MRP protein subunit, putative"
                     /transcript_id="XM_572825.2"
                     /db_xref="GeneID:3259629"
     CDS             join(260298..260460,260516..260562,260620..260669,
                     260726..260840,260916..261271,261339..261702,
                     261761..261840,261897..262077,262145..262549,
                     262610..262972,263032..263271)
                     /locus_tag="CNI01060"
                     /codon_start=1
                     /product="ribonucleases P/MRP protein subunit, putative"
                     /protein_id="XP_572825.1"
                     /db_xref="GeneID:3259629"
                     /translation="MSKPQGKAGPSKPYGRPQKPIHKTIDLLKKNQAAAAKGKGKENE
                     VLGDVMSLVDEVKRLPGMISVEKFAQTRAMEIHAFQTAIKTAAAQGSTRAFQSLPRHL
                     RRRAASHNPRRVPKRLRSRAAAEIDAGDSIAKKHRKIAKLRAKGNLRDRLSRTAIFRI
                     RQRSKRWLPTHIWHAKRYHMANIWGWRLPITPTLKSFRPAYRAGKRKAIAWDVSYYGV
                     IEVEGMKEEIVKLLTGMTFGKFAGAKFENGARVAEVLVYQPESFPRGLIGPAEILWQP
                     LAQNKSPLNDARRIWIRAHPSIFDQVFSTLKAVSGNILAEKSLSKRVRALQIRDLRGE
                     LESFEIMGPKSGEVLRRVLRLCKSEKGVKSKFFDALGDPAEVPSGTIAGLNVHDPRLH
                     FPPPRIQEHEERLSNDGILRSNDTLPSSELAQSALWDPTARELASEVMYTKYQLDARR
                     HKLGMPGTRLHPTSSDNRIPFILFHRSTRPPLSSTPESFHGFTLLFPSSWAQYLLTSI
                     AYTGTLIGGLNERKVQHREAGTPSFPEHFGQVCVAGGKWEESKAEEAEGRWKRKPPAK
                     RVAFDKLGTSRPWIPDWSTLMGQGVTTLEETALNGEPSTHPYLLPHPFTTRLDASLTP
                     SKLLMNINTFRSQRGLSALPSARQNELFREAVLHVELNVVGRGSPGDMAVICGLTEEE
                     RKAWIGAYEGKSDEFGSAGETSELQRLGEARAPEKNLIGYTSTGNISLSRGKGHALGM
                     ITLAGYLDLLKAAAGEVKGSEWDGKALVCVRNRDGTVARFAEVRVAC"
     STS             262072..263409
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     gene            263656..270075
                     /locus_tag="CNI01070"
                     /db_xref="GeneID:3259786"
     mRNA            join(263656..263911,264282..264397,264455..264824,
                     264878..265147,265206..265297,265349..265664,
                     265717..265746,265786..266036,266108..266425,
                     266492..266600,266653..266691,266740..266931,
                     266988..267078,267134..267503,267565..267647,
                     267697..267770,267821..268854,268907..269033,
                     269088..269383,269443..269600,269652..269724,
                     269775..270075)
                     /locus_tag="CNI01070"
                     /product="transcription regulator, putative"
                     /transcript_id="XM_024657786.1"
                     /db_xref="GeneID:3259786"
     CDS             join(264293..264397,264455..264824,264878..265147,
                     265206..265297,265349..265664,265717..265746,
                     265786..266036,266108..266425,266492..266600,
                     266653..266691,266740..266931,266988..267078,
                     267134..267503,267565..267647,267697..267770,
                     267821..268854,268907..269033,269088..269383,
                     269443..269600,269652..269724,269775..269921)
                     /locus_tag="CNI01070"
                     /codon_start=1
                     /product="transcription regulator, putative"
                     /protein_id="XP_024513521.1"
                     /db_xref="GeneID:3259786"
                     /translation="MGTYPQQHLPSSMLASDTQTGVGISASSSVISSQSPSSKPSSTH
                     RITLRMPQQPESTADLDSESESLTPSPEEINIGQGIGEEVSDQERAGDDESEGEAEQD
                     DFNYDEEEEEDYDEDELMEEGDDDDDDDDPNFGERKKKAKKARVKMDSDRPVKQKKSA
                     GAFPMRKQVDESSDEDYGTKAHKKKYFSKTGVSRKATPGTPYSEDNAFRRGAAKRVVT
                     YNEADVDYGLESEDEAGDTGYHYTAGAPAEAEPADEIDQVMFHWRDENHKDDPKDIPQ
                     VNLRFHIKWKDYSHIHNTDETYAFLKNYKGFKKVENYITKVWTIDQRYHHPEPDAAWK
                     PTQEEMEQYEIDKERIKELQESYKIVERVLDEKEEKRKEGRATLFFVKWTNLQYSDCT
                     WETYEDVMECQGAKEGIEEFHQRQARTTIPARSISYGIDNRPTYQKIPENPPYLACGG
                     ALKPFQLTGLNWLAYVWSKGENGILADEMGLGKTVQSVSFLSYLFHVQHQYGPFLVVV
                     PLSTISAWQAQFKRWAPELNVICYMGSARSRDVIRQFEFGPLKNLKFNVLLTTYEFIL
                     KDRQDLQQIKWQVLAVDEAHRLKNHESQLYEALKSFWSASKLLITGTPLQNNVKELLA
                     LMHFLMPEKFQLANDFDLNDASEDQGAKIKDLHDKLTTLMLRRLKKDVVKELPTKSER
                     ILRVEMSAMQTHYYKNILTKNFAVLSKGGTQQVSLMNVAMELKKASNHPYLFEGAEDR
                     SKPANEILRGLVMNSGKMVCLDMLLSRLKSDGHRVLIFSQMVRLLDIISDYMTARGYV
                     HQRLDGTVPSDVRKKSIEHFNAPGSPDFAFLLSTRAGGLGINLETADTVIIFDSDYNP
                     QNDLQAMARAHRIGQQRHVSIFRLVSKGTIEEDILERAMRKMLLEYAIINKMDTTGAH
                     INGSSTPKDKNVDLSKEELSAILKFGARNMFKTDDSTQNKKLDEMNLDDILNNADAFD
                     TESAAAPGTTSLGGEGFLSQFAAIQDVKADVDNLSWDEIIPEDERGKAEEEENAAATA
                     EIVAASSRKRAAAKAPGTYQDMDLDDHDGSSKPGSPNDKKPKAPGQLKKTPAQRALEL
                     KDRDLRVLIRGIQKWGDIRSRYEPIVKEAKLENKNRVVIIQTCEDIITHGEQTIAAHK
                     AHIRDLQERGEPISSSLRQKAILFTYKGVASINAETVVARYYELKALVEHFKRVEDFP
                     SYTIPHDSLKPTMNWTVEWTAREDSQLLVGIWKHGFGSWEAIAHDPELHLNDKIFLED
                     PKAAKLDPNAPKPGVPGPVHLQRRGDYLCGIIREYEENRRILVEQQAMIASLPAKEGF
                     GFEHPPLPSIAGPSKKPSPSIASSSKDRDSGKGKRRKTPEYTDSEDESSYESMDEDAV
                     KELLRPAKKHLKKLKSGTENLSREEKIVALKECLAGIGARIDEVVAEKAAEGQNATKW
                     RKHCWVFASFFWPRQGVNYSKLMEIHGKMVNESGPTTSKSKAKPKRKTEDDPSKPNKK
                     PRLSDSQKEIKVEGSSGEQL"
     gene            270206..272472
                     /locus_tag="CNI01080"
                     /db_xref="GeneID:3259486"
     mRNA            join(270206..271076,271134..271185,271235..271642,
                     271693..271779,271825..271850,271907..272002,
                     272058..272247,272307..272472)
                     /locus_tag="CNI01080"
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /transcript_id="XM_572720.2"
                     /db_xref="GeneID:3259486"
     CDS             join(270316..271076,271134..271185,271235..271642,
                     271693..271779,271825..271850,271907..272002,
                     272058..272247,272307..272315)
                     /locus_tag="CNI01080"
                     /codon_start=1
                     /product="alpha-1,6-mannosyltransferase, putative"
                     /protein_id="XP_572720.1"
                     /db_xref="GeneID:3259486"
                     /translation="MARFPFFRILLRGNTPAKLLLLFFAVVFFFAFPFSSRPTSIFAD
                     PALREKAEVAPLSELASVYDQVRLDILDARRFNGSHAAEKLRAPKTLPDGTLNFDPDL
                     ETYVARLRGFVNNYLRSAPAHIQIAGSNTLTTLVRRLPAKHRDGDFPSKVWATHPRGM
                     DGVESGFELWGELLPFPLPPSLANQLSPNHEVEFLKPARVGKDWDVEVLDDDALDSAM
                     SEWTGEDIGRGITGEGKWSQLWGKLDKGVLRADLFRYVSMLVEGGIYSDSDTMPISHP
                     YVWGLHAPSILDQDLEVLNDLMVSSLLPKFPTHNRPPRVDSRSIVDSDNSTYVPPYPG
                     LRLTRRAPVYTVENPNPSSILNPSISMVVAIEWDSQIGRTLGMWKQWTWFRATRSWKD
                     CCFPRGLQMVQNLLVSKPFHPIMMDIVATIAQLVETGLYEKLSPLELTGPGPFTDAVF
                     RYLLVQYGVTPDELRALRGPVRVGDILILQEEACHAPRKAIQRLKAFVDSLHLKLGTN
                     RHGRFSPWLFGLGYKDWKSGGVKVAYHGLTGIWK"
     gene            272779..273885
                     /locus_tag="CNI01090"
                     /db_xref="GeneID:3259668"
     mRNA            join(272779..272857,273176..273260,273319..273525,
                     273580..273885)
                     /locus_tag="CNI01090"
                     /product="60S ribosomal protein L19, putative"
                     /transcript_id="XM_572717.1"
                     /db_xref="GeneID:3259668"
     CDS             join(272794..272857,273176..273260,273319..273525,
                     273580..273808)
                     /locus_tag="CNI01090"
                     /codon_start=1
                     /product="60S ribosomal protein L19, putative"
                     /protein_id="XP_572717.1"
                     /db_xref="GeneID:3259668"
                     /translation="MVNLRQQKRLAASVAGVGQRKIWLDPQEAAEIGQANSRSGVRKL
                     LKDGHIIVKPTVIHSRARAREHAAAKRAGRHTGFGKRKGTAEARMPTKVQWLRRMRVL
                     RRLLKKYREAGKIDKHMYHTLYLEAKGNRFKNKRVLMEHIHREKAEKLRTKHLAEQQE
                     ARRVKNKAMRERRANRLAEKRQGIHEVEQEEAKE"
     gene            273931..275686
                     /locus_tag="CNI01100"
                     /db_xref="GeneID:3259590"
     mRNA            join(273931..274372,274430..274586,274636..274674,
                     274731..274856,274915..275002,275062..275129,
                     275186..275386,275443..275498,275565..275686)
                     /locus_tag="CNI01100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657787.1"
                     /db_xref="GeneID:3259590"
     CDS             join(274097..274372,274430..274586,274636..274674,
                     274731..274856,274915..275002,275062..275129,
                     275186..275386,275443..275498,275565..275645)
                     /locus_tag="CNI01100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513493.1"
                     /db_xref="GeneID:3259590"
                     /translation="MRPALRVLPRLRLFRALPVRTYATLNPHTPPPTSPYQVFDEPSK
                     DLQRSRAIIRLRELQAQSGNEPAEGEDELRVVDYLREEVADRLAERIEDLRVPPSSIL
                     EISSHAGQLTQVLQEVLADEVPTGTEQSEIEGRRKWWIVDSSREALWRDDDSYFITPP
                     TRIQASASDFLNHPEIGPLKEQVEAVVSAAGLHWVGDIVGGLTQIRHLLKPDGVFVAA
                     VFGGDTIFELRTSLQLAEQERRGGIANRISPMISSTDAPSLLNRAGFTSITVDVEDII
                     INYPSMWELIADLRDMGESNAILGRRAAVGRDVLTAASSIYQEMYGNEDGSIPATFSI
                     IFLIGWKPGPNQPQPSKRGSGQANLKDVL"
     gene            complement(275706..277137)
                     /locus_tag="CNI01110"
                     /db_xref="GeneID:3259376"
     mRNA            complement(join(275706..276221,276288..276423,
                     276486..276974,277027..277137))
                     /locus_tag="CNI01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657788.1"
                     /db_xref="GeneID:3259376"
     CDS             complement(join(275957..276221,276288..276423,
                     276486..276974,277027..277108))
                     /locus_tag="CNI01110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513491.1"
                     /db_xref="GeneID:3259376"
                     /translation="MVKKEKKKLLTFGPFEQVLLALFVMGFASHPSFPYSPFTAIIGP
                     DGQSTISPLPFLSPPFLAMLLIVYLGYYILRRQEAERDRLKALAKAKPKSSNSSSSTG
                     SSKNKKPLSSSDVRDGKLAAPSNKQVGDPTPKHVSGLSKEDPSAQSFRKNYFLTMQGP
                     GRPALVPFQDGLRPKKGEAAGTMWWDNVPEDAKDLMAPPIDKDKLKASLKNPWQAEML
                     EKDIELLKIAKKQKAEEARYAKVANLLQTMLGFLLCAADMRLGICLLIFFLWRHFTSL
                     HDADMANEEDAVEKEKKEINDKIREAKKAGMSSKEVAYLQIALERLG"
     gene            complement(277149..278342)
                     /locus_tag="CNI01120"
                     /db_xref="GeneID:3259642"
     mRNA            complement(join(277149..277349,277404..277499,
                     277557..277790,277961..278209,278259..278342))
                     /locus_tag="CNI01120"
                     /product="40S ribosomal protein S7, putative"
                     /transcript_id="XM_024657789.1"
                     /db_xref="GeneID:3259642"
     CDS             complement(join(277325..277349,277404..277499,
                     277557..277790,277961..278205))
                     /locus_tag="CNI01120"
                     /codon_start=1
                     /product="40S ribosomal protein S7, putative"
                     /protein_id="XP_024513490.1"
                     /db_xref="GeneID:3259642"
                     /translation="MASINSKVLRSANAPQTAPSEIEQQIAQALLDLEANVPELKSEL
                     RQLAFSSAKEVDVKGGKKAVVIFVPVPMVKAFHKVQQRLTRELEKKLSDKFIVFLSQR
                     RVLPKQSRSSASSQKQKRPRSRTLTAVHEKILEELVFPSEIVGKRTRVAQDGSKLIRV
                     YLDSKDQNNLEYKLDTFSSVYRNLAGKDVVFEFPVVAQE"
     gene            278522..282287
                     /locus_tag="CNI01130"
                     /db_xref="GeneID:3259645"
     mRNA            join(278522..281072,281123..281196,281251..281550,
                     281600..282058,282113..282287)
                     /locus_tag="CNI01130"
                     /product="small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_572829.1"
                     /db_xref="GeneID:3259645"
     CDS             join(278560..281072,281123..281196,281251..281550,
                     281600..282058,282113..282231)
                     /locus_tag="CNI01130"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_572829.1"
                     /db_xref="GeneID:3259645"
                     /translation="MSDEEYPQLQSYTAPQDILDEHAELADEDETPDAFQDKAKSKQV
                     AARQSDYHLRRFNRTDGQGEGEDESYEERMRRINLEKEEEKVRRYKEKMEKEEKERGE
                     MRVDDKTPPRELTGGDTPPRKALIGDETPPRAQAGDVTPPRKKRRWDTEPEVKQEVKE
                     EVKEEVKEEEPKKRRSRWDQTPAEAPPEKKRSRWDQTPAQTASSSVLAAPTNLAKPSG
                     IVLVEDKRYRRMTDEELDSLLPGSEEGYVVVPVPDDYHPAPSVRKMVPQQAEAGFMMQ
                     DETDAARARAAAGGLQGTTEQTEIDGIGTLQFLKPEDTQYFAKVLGEGGGEENDAEYT
                     VEELKERKIMRLLLKIKNGTPPVRKTALRQITDRAREFGAGPLFDKILPLLMERTLED
                     QERHLLVKVIDRVLYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAA
                     GLAHMISTMRPDIDHVDEYVRNTTARAFSVVASALGIPALLPFLRAVCRSKKSWQARH
                     TGIRIIQQIAIMSGCAVLPHLRNLVDAIADGLKDEQQKVRTMTALALAGLAEAAAPYG
                     IESFDNVLKPLWLGIRQHRGKTLAAFLKAIGYIIPLMDPEYAGYYVRECMPILIREFQ
                     TSDEEMRRIVLQVIKQCASTEGVTPSYIKEEVLPEFFKAFWVRRMALDKRNYKQLVET
                     TVELANKAGVAEIVGRTVNDLKDESEPFRKMVMETITKVVSNIGAADVDERLEVLLID
                     GIIYSFQEQTFEDTVMLDGFATVVASLGPRVKPYLPQIVSMILWRLTNKSAKVRMLAA
                     DLTTKLAPIIKSCKEDVLLSKLGVVIFEQLGEEYPDALGSLIAAEGAIANVVGMTEMN
                     PPVKDLLPRMTPILRNRHEKVQEATINLIGRIADRGAEYVPAKEWMRICFELLDLLKA
                     HKRAIRRAAVNSFGYIAKAIGPQDVLSVLLTNLKVQERQSRVCSTVAIAIVAETCGPF
                     TCIPAILNEYRTPELNVRNGCLKALAFVFEYVGEMSKDYIHSVVGLLEDALTDRDHVH
                     RQTACAIVKHLAIGVAGLGYEEALTHLLNLVWPNIFETSPHVIGGVMDAIEAMRLGIG
                     SGVVLSYVLQGLFHPARRVREVYWRMYNTLILGSSDAMVPFYPALGSESDLASGQDYT
                     RHQLMMWI"
     gene            282425..283959
                     /locus_tag="CNI01140"
                     /db_xref="GeneID:3259464"
     mRNA            join(282425..282610,282678..282811,282871..283082,
                     283133..283227,283284..283414,283462..283959)
                     /locus_tag="CNI01140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572831.2"
                     /db_xref="GeneID:3259464"
     CDS             join(282601..282610,282678..282811,282871..283082,
                     283133..283227,283284..283414,283462..283665)
                     /locus_tag="CNI01140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572831.1"
                     /db_xref="GeneID:3259464"
                     /translation="MSKNSECCPPQSNSNPSKPNVPHPTSDPIGYKYKGEFQSVANYD
                     KVYVTGPDNAKHALVVIYDIFGFWDTTIKGSDTLVSHLASTFPTKVLMPDVFKGKPFP
                     ADKDGDKETLQKFFATTAKLDDRLPEVLDFAKELQKSYEKVSILGYCWGGKLTLLSLA
                     EGTPFNAGAVAHPAMIAPEDGEKLSVPLGFYPSHDEPKDVVEKIVNDFKSKPFGDKCG
                     YHLYDTVHHGWAAARANLNDPENVKQFDDVYKRLSEWFASVKA"
     gene            284375..285285
                     /locus_tag="CNI01150"
                     /db_xref="GeneID:3259433"
     mRNA            join(284375..284520,284579..284814,284868..284931,
                     285006..285285)
                     /locus_tag="CNI01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657790.1"
                     /db_xref="GeneID:3259433"
     CDS             join(284502..284520,284579..284814,284868..284931,
                     285006..285121)
                     /locus_tag="CNI01150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513489.1"
                     /db_xref="GeneID:3259433"
                     /translation="MTLDLDERRIPKTLPHVFDLETLAKHFQENPLPPGACKLIDLPG
                     DVFLDTEDDVNVVAAALWVLAVKYDNLPSEERPNHREASRKWLIKHRGEVVERLASKI
                     EPPFHAFTLDLIYKDVAAILDELLANTLPKDKKEPATKTQNK"
     gene            285507..288152
                     /locus_tag="CNI01160"
                     /db_xref="GeneID:3259708"
     mRNA            join(285507..285592,285678..285988,286046..286354,
                     286403..286887,286938..288152)
                     /locus_tag="CNI01160"
                     /product="polyadenylate-binding protein, putative"
                     /transcript_id="XM_572834.2"
                     /db_xref="GeneID:3259708"
     CDS             join(285768..285988,286046..286354,286403..286887,
                     286938..287944)
                     /locus_tag="CNI01160"
                     /codon_start=1
                     /product="polyadenylate-binding protein, putative"
                     /protein_id="XP_572834.1"
                     /db_xref="GeneID:3259708"
                     /translation="MSAETATSPAPAAETPVAPAPATQTTPAEGAPTPAAAAPGGNTV
                     SASLYVGELDPSVTEAMLFEIFNMIGPVASIRVCRDAVTRRSLGYAYVNYLNAADGER
                     ALEHLNYSLIKGQSCRIMWSQRDPALRKTGQGNIFIKNLDQSIDNKALHDTFAAFGDI
                     LSCKVGTDENGKSRGFAFVHYSTGEAADAAIKAVNGMLLNDKKVYVGHHVGKKERLSK
                     VEELRAQFTNVYIKNVDLEVTDAEFEDLVKPFGPTISVALSRDEKGVSKGFGFVNYEN
                     HESARKAVDELNEKEVNGKKLYAGRAQTKSEREAELKKSHEEKRLENEAKSAGVNLYV
                     KNLDDEWDDDRLRAEFEAFGTITSSKVMRDDSGVSRGFGFVCYSSPDEATKAVSEMNG
                     KMIGTKPLYVALAQRKDVRRQALESQIAQRAQQRMQYGAGFPGMQGYMGQPMYGYPPM
                     PGYGQPMPGMPPVRGPMMGYPGAPQNMMQSRPRFNPNGQPLPGGVPAYGMPPQVPYPG
                     APGYPVRPGGARIPAAPNANGPRNGGPSPVGAPQGLPAGSIPRGGQMPARPHEQAAPA
                     PQAGRLDAQSLARAAPAEQKQMLGEALYPLIHETQPELAGKITGMLLEMDNAELLHLV
                     ESQPALQEKVDEALRVLAEWGKDEKPAADEGAEEPKKEEEETKEEEKKE"
     gene            complement(288192..289261)
                     /locus_tag="CNI01170"
                     /db_xref="GeneID:3259573"
     mRNA            complement(join(288192..288365,288463..288574,
                     288676..288955,289016..289261))
                     /locus_tag="CNI01170"
                     /product="thiamine pyrophosphokinase, putative"
                     /transcript_id="XM_572707.2"
                     /db_xref="GeneID:3259573"
     CDS             complement(join(288262..288365,288463..288574,
                     288676..288955,289016..289209))
                     /locus_tag="CNI01170"
                     /codon_start=1
                     /product="thiamine pyrophosphokinase, putative"
                     /protein_id="XP_572707.1"
                     /db_xref="GeneID:3259573"
                     /translation="MPPHFARTWTCEELLRGHATKKYALIIVNQPIRKDLLQRAWQAV
                     DIRLCADGGANRLFDVDHESQYLPDLIKGDLDSLRPDVQAHYASLKVPIKKDEDEYST
                     DLMKCIQEVPEDYALVLLGGLSGRVDQTVHTMSMLHKMDREIYVLDKESMAWVLRPGQ
                     HEIHIDHSTMGQTCGILPVGIDSAHVRTKGLKWDVGNLSTSNHLLPEEPVVWIETSRP
                     ILWTVEIRQIE"
     gene            289360..291552
                     /locus_tag="CNI01180"
                     /db_xref="GeneID:3259738"
     mRNA            join(289360..289445,289501..289540,289578..289605,
                     289644..289671,289712..289810,289850..290021,
                     290069..290145,290197..290259,290312..290795,
                     290856..291043,291113..291340,291395..291552)
                     /locus_tag="CNI01180"
                     /product="vacuolar ATP synthase, putative"
                     /transcript_id="XM_572836.1"
                     /db_xref="GeneID:3259738"
     CDS             join(289395..289445,289501..289540,289578..289605,
                     289644..289671,289712..289810,289850..290021,
                     290069..290145,290197..290259,290312..290795,
                     290856..291043,291113..291340,291395..291484)
                     /locus_tag="CNI01180"
                     /codon_start=1
                     /product="vacuolar ATP synthase, putative"
                     /protein_id="XP_572836.1"
                     /db_xref="GeneID:3259738"
                     /translation="MVHDPRISDSQLAQINAAAAVREYAIEPRMDYRTVSAVNGPLVV
                     LDNVSFPSYNEIVQLTLPDGTIRGGQVLEVSGKKAVVQVFEGTSGVDTKATRISFSGS
                     SMKLAVSEDMLGRVFNGSGNPIDNGPKVFAEDYLDINGSPINPYSRIYPEEMIQTGIS
                     TIDTMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKRPGATKGVHDGHEDNFSIV
                     FAAMGVNMETARFFKRDFEESGSISNSTLFVNLASDPTIERIITPRLALTTAEYFAYQ
                     LEKHVLVVMTDMSSYADALREVSAAREEVPGRRGYPGYLYTDLATLYERAGRVEGRNG
                     SITQVPILTMPNDDITHPIPDLTGYITEGQIFVDRQLSNRQIYPPINVLPSLSRLMKS
                     AIGEKLTRKDHGDVSNQLYAKYAVGKDAASMKAVVGEEALSADDKLALEFLDRFEKEF
                     VGQGAYEARTIFESLDIAWELLRIFPKESLNRISPKILAEFYARRPKGTSAEQPEENK
                     EDNLIDA"
     STS             290924..291704
                     /standard_name="Xho5"
                     /db_xref="UniSTS:470724"
     gene            complement(291438..293291)
                     /locus_tag="CNI01190"
                     /db_xref="GeneID:3259441"
     mRNA            complement(join(291438..291858,291921..292607,
                     292658..292811,292868..293034,293085..293149,
                     293210..293291))
                     /locus_tag="CNI01190"
                     /product="expressed protein"
                     /transcript_id="XM_572697.2"
                     /db_xref="GeneID:3259441"
     CDS             complement(join(291529..291858,291921..292607,
                     292658..292811,292868..293034,293085..293149,
                     293210..293267))
                     /locus_tag="CNI01190"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572697.1"
                     /db_xref="GeneID:3259441"
                     /translation="MLPIEEILITALKEHDYRDNNSVNVDEHIQRIKRQLDDPSSIRP
                     YSKSSTPLSVVSFQCLLQDTGYPMEVYLPGNIETSDHVDWSKLKERWVGWGVEVPGEQ
                     TWVKGKTDLADGLQQLSIEPQPLPSSVHAKYPLPERKGEYVGALLKVYDDASFRPAST
                     HEFIGLLSTSPMPSNEPEEADIVPTIHVLSQRQDTAAHEVTPQDEEIREELLDYLATA
                     FNPPDRTAGEYLLLLLLSSPTARPASLPVLGTLSLNFRRQASSTTSPFKSVISSISPR
                     VVPLPLTIPLLHSHPFSPSMTDTTGLNAGLLQLSEGTVLVVEEDAMGDGGALSEKALG
                     NLKALVNCVKDQKVKYEYPYMDGLKMDCAVRVAVLSQGKSLLPVDVDIPLREDGTAPT
                     KPPSLEAFRSYLARYSSPTHASRLVIPDEISQLIQDHFVQERKSNAADAEEALKRRMK
                     VARIVALSYPHATLNKEVWERTVRLDQEVAKRHAMS"
     gene            293651..294745
                     /locus_tag="CNI01200"
                     /db_xref="GeneID:3259522"
     mRNA            join(293651..293747,293794..293890,293935..294231,
                     294273..294369,294416..294745)
                     /locus_tag="CNI01200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657791.1"
                     /db_xref="GeneID:3259522"
     CDS             join(293704..293747,293794..293890,293935..294231,
                     294273..294369,294416..294684)
                     /locus_tag="CNI01200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513483.1"
                     /db_xref="GeneID:3259522"
                     /translation="MVSNLKYKVVVIGIGGASCSGKTLLAKHIRRALPTDAAIIHQDD
                     LCPPAEEVPYSKQYPDLQDWDDPETCILWSEFRALLRQVRETGRVGDHDTHDHLNKEN
                     KIEVNEQIFERWQRKFEELTKQQREQGVELIWVIVDGFVLYYDKDVVDMLDIRIFLRV
                     PHDVLKDRREERQVYVLQHPDDAAEGGVWIDPPEYFNKIVWPGYLKAHAHVFEDPAVG
                     ELKQEWGPKGRDLHVIRPGEGEEGMTEAFDKSCEAIVDGVKKGRGIYLA"
     gene            complement(294596..296250)
                     /locus_tag="CNI01210"
                     /db_xref="GeneID:3259387"
     mRNA            complement(join(294596..294824,294861..295316,
                     295372..295599,295648..295896,295937..296097,
                     296156..296250))
                     /locus_tag="CNI01210"
                     /product="expressed protein"
                     /transcript_id="XM_024657792.1"
                     /db_xref="GeneID:3259387"
     CDS             complement(join(294688..294824,294861..295316,
                     295372..295599,295648..295828))
                     /locus_tag="CNI01210"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513482.1"
                     /db_xref="GeneID:3259387"
                     /translation="MSNDRRNGIATRRYLAFGNNLCRQLDYRGSLVLKEPKDITDCLQ
                     GWQEVVWHSYACTIAQNSAWEWYGWGLDPLVSRDEPKKLEFDGKQYTRIIGYARPLAF
                     LQVDGHVINQKGQKSVKVWNDVVVTELGATYGYRWQDGVYYFESLQNLLDHENPFGPL
                     EHSLLHQKTPLKLFAAESQVYILAQGAMSHLFEVIDARALPPGLRQTCKDPVTVKLVE
                     DLEGLGVTKLVTGSANRFLALTEGGDAYLLAYNSDPEMIKVPNEEEVRLAGVGPDFVI
                     VVTENNIYVQGSNSFGQLGLLGDNQPEFIKLDIGEFKAEQIEKIYTSRWSTILCVRG"
     gene            296622..300271
                     /locus_tag="CNI01220"
                     /db_xref="GeneID:3259694"
     mRNA            join(296622..296977,297018..297091,297144..297831,
                     297871..300001,300071..300271)
                     /locus_tag="CNI01220"
                     /product="ferric reductase transmembrane component 2
                     precursor, putative"
                     /transcript_id="XM_024657793.1"
                     /db_xref="GeneID:3259694"
     CDS             join(296855..296977,297018..297091,297144..297831,
                     297871..300001,300071..300198)
                     /locus_tag="CNI01220"
                     /codon_start=1
                     /product="ferric reductase transmembrane component 2
                     precursor, putative"
                     /protein_id="XP_024513559.1"
                     /db_xref="GeneID:3259694"
                     /translation="MTVTGSTSAEVAASSYVPPYKATTSYAQSPEVTGSVTSALPADP
                     TVSSGISGADYAASYLDAHMMSWPSYRYAYLFWIILAGLAAIYALSHHLRLSAGSLGA
                     GYSKWGMRRKALGTKDGRRGTVLPSNNTMLSIAFLIILSVVLCLVGYDYINPSSTILN
                     FASYRKRAFVPYGISKAFWTSGNRFGYMAFAMTPLVVLFALKAPPFAFLSLRPFTHLY
                     SDKLALFHRAAAWLVWAFTTVHTILWTIQLFKDKRNGRAVWFTIWNSYHFIFGCIAYG
                     LMTAVMVLSLKPVRKHGFEFFYIAHVVLVFLTIVCSIIHHPVLWFWMAGALILWGCER
                     SVRLIRMTRINGIFGKNKYSALVAGRSYDQYSHRKQDFKQGDPYSTPQRDFGNPYTDK
                     TPPKPLAMGHLPSGDLSDFGGTRGQNGYDEGSFQPLGSYDARHSDSDPAAVSPPYHER
                     VQSVAHSIPPGLPAYMPTTIPIGHAQAQLLPSRTIRLTIRVARPFRWSPGQSVLLYLP
                     ELSWFQSHPFTILNNDPNEIMLLVKARKGLTRRLFNYVRQRSLAAVGINSVKDKRISL
                     ASMRTSNGENNLYVPPIFLKAWVDGPMGSSERVRWKDHSTVVVVCGGSGVSFGAAVCE
                     HVCMSIKNQVGKTRRIRFCWVVREYAEIAWVAGQLRRCQDMVSADQLHIDIFVTKAQR
                     VKDDLAPPKPVFARGAHSRANSFDSAASEMSADSSTDRDEAVDSTLMESYADVIDLTN
                     YEDEEDVDDPVENRLSTKLEQQGKLRRARSRKFAKRKSAAKLSQTPSYPPSRFQSTYS
                     YDNPEESFAHSNQGYGHSPASSLYDSFHESRGHAGHSSIAMSPSASQSMLIHSTSHSV
                     PQSMLSPSTSISMLPTSPPFNAYHGNHQSVRSISDSTYTANDPFTGGSSQGHGSPSVG
                     HSSLTDDTQVAVPNDPFRDIQTALSRTSRTQSMVLLENSGADPKEDAGLWIDEADYAA
                     MCVMSEMARAGKPKLSAVLEEEIEIAQGSLIVATCGPVTLNTVVRNLVSKTISPSRIR
                     RGDRRGHIVVYSEDYEG"
     gene            complement(300244..303716)
                     /locus_tag="CNI01230"
                     /db_xref="GeneID:3259549"
     mRNA            complement(join(300244..300506,300560..301618,
                     301679..302859,302906..303716))
                     /locus_tag="CNI01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657794.1"
                     /db_xref="GeneID:3259549"
     CDS             complement(join(300357..300506,300560..301618,
                     301679..302859,302906..303527))
                     /locus_tag="CNI01230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513481.1"
                     /db_xref="GeneID:3259549"
                     /translation="MSALQPGPLAPPCPPRPLHVHGNSTWTDDEDLSSDDDEAVFFGA
                     HKPEEVHLVAKLSAAVQSPAPFIPRVKKRDSREFLRRKTLLLPTDKRNQKNLNLSAQD
                     SARLYPSQWSDDEGSCSTPARSGHPASASTPSQAGQDPSDLTLKFETWHLSTPRDDES
                     ESAEEASDKENVPVPPCAGVQGPVDAVPLDELYMERQGILDLQGSDQDIPQLNMGGLH
                     LSDFSDQESGAIFQGLDILDEFYLEHVAEEHRSPEHPRSSTPLQSDESNPLDFDSPLE
                     VARAGPVAIPVLSSHHFASIRADVGSPCRNLPPSPILSAPVEQETTSVKLASLESPTH
                     QPASLSIATPSRATALPPADLVQRGAKTLKASTTKHAPPPPAVDTKKAAALKSAIRGQ
                     LDSAVLARINPGAPKSVSGSHTTSSARVVSENSVIEATEKPKQTLPPLQPRPEPRLVK
                     KPHPISRPTIPLSSSVNRTIPRPALASKTALPRPKSTLPTKTTSMLPPPSSIPLKRPA
                     SSQTHATRHPTAVPLSVTRPSHAHPAATFGKPLLGQPARVFREAATPLEITPVFSVAA
                     GGDHSTMSMSRIALKSPAKQNMYKKPLGENHTPRKLGTPMRFGTPRFGTPRFGTPRFG
                     TPRQGQGMFPLSLSMGVGCAALAPTPLSASVHPPITALQTNTAPPPKETVPPVPEPVD
                     DSPPASHTRHAEAAADATSADTTSTPPFSPPQSSTRSSGTMSESRTEQQVSSQPASSS
                     PSPNRPARSKRSTSSSTKSAKPSKRPTTTTPTPTAFPPALTEKQLKTTTARNTARNQV
                     YHCAIDRKVIRQRGPRPPSPTSKIRTTSERDEADKKNSREARAKRRMGIQSGEEEKEK
                     DKKKEKPVIEKLELVKAPGDDDDWTYKTPPPHRPLKRARRTSEAKDQGEKEEEKKKLR
                     WDRVVSVIRDDGNASGSAKSLSDDGKERDGEELKSCIKTKVPLDEHGNVLDAQRPVDN
                     LKRTRVVVTAVFYDGEEHVPAPATATRSKKK"
     gene            304073..309667
                     /locus_tag="CNI01240"
                     /db_xref="GeneID:3259471"
     mRNA            join(304073..304163,304201..304292,304330..306634,
                     306708..308087,308148..308454,308509..308599,
                     308668..308810,308866..309362,309423..309667)
                     /locus_tag="CNI01240"
                     /product="protein kinase, putative"
                     /transcript_id="XM_024657795.1"
                     /db_xref="GeneID:3259471"
     CDS             join(304210..304292,304330..306634,306708..308087,
                     308148..308454,308509..308599,308668..308810,
                     308866..309362,309423..309446)
                     /locus_tag="CNI01240"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_024513480.1"
                     /db_xref="GeneID:3259471"
                     /translation="MSRPLPHPPGHEASSSGPHLPRDASRNSIHAYPTSPLASAPYSA
                     QLPGSAQPHPSSIDRRTLVGVGELSTPRWPGSGVHNRAPSMPHNMGSPSRLPPRPQTP
                     TTVQQGDHSTVRPRPTSATQSPPRPRDTRSPATQRETLTAPNTAAHDGSLYSLASLAQ
                     FNFDSSMEASLAASLATLTSPKMDSPKMSSSDSSKMDSPKMDSPKSPVLPRLESILPP
                     SPGSARSRIYARRQERANAAASISQLPGPSQSLQPPQTLQPLKPPPPPGFADSQTFSQ
                     RASRDSRKTPPNPSRHNPSHDILKQFAVKDFSHLPPSPSSASINQFLRASGSTQNISS
                     GTPPGSASASNAYFPSKGVQREDSQKSQKSQKQQRTTPKPKELDPNVDEALRKLDGLT
                     GTPGKNKAKGKSSGGPSAASSRPGTPVAESKSRSEGKIPSKPSIGSFKDATGSPLSNW
                     IDLTEDLPAIPIPRARIPPNRESSSSASVTGTPNSHDSQSLPTTATTMSSADLASSSN
                     KPRRASGGSDTFAAQAGVHVDQPEETEKSVPPVPPLPQVYVNKKQSMPAQSSAMRPPS
                     YVPMREPSPEPPAVSSPFEPGSPSTTAPVPVPAQPKMHKKWSFSSALNLKSAASSASS
                     VDEMRMTTPQSPQTPWSEIHRAELFSPSSSVHGKESAGGDSGPQGATPLAPPSSKASN
                     VNKRLTPSSIPFFRRSSSSSFQSKASQSVAPLPVPLPETPKQTEKTAAVPSSQSRKSV
                     LGMHFPSMLRGSSSKRGLAQQTSQSQVSAKGKEEVKPTSAPSASATSGWTGRKRGKTL
                     SISGDLPNPFPGLKHQSSADSSFGTRGSAVSSNSDATTISGSNTFDRLPAIMGSPARP
                     PEGARYSNSPRNLPSTTPTKIPRMTQRPAPSPATVTAHSGMPPPPFPTTRKISNTVSG
                     AGEQQQRGGPPVSEFGMVDGIPHMPTTPRLTTSGAHRAHLLAPMSARQETRRVNNRPF
                     DPPPRSKEAYTGAVPPSRRHLPQPPPASTVTSMTLSASAKRASREFKNKRRESKDGQD
                     GSSSGKNSPVKPSKSMHSSMAVPSSSRLPSSYSAGTPGSNYRKLSLADSSPSMSPADD
                     DEASGDAEMEAYIKRRRERAAANKKDDLSDVTEFPRDITPVEPLSQRAFITRNLAKMS
                     DAERKEVLDFDYIYYSPTPGTIRRPSQPGGAMFNHGYDDERGDYLVVEGDHLCYRYEV
                     VGILGKGSFGQVVQCRDHKTGKSVAVKIIRNKKRFHTQALVEVKILQQLIEWDPEDKH
                     FMVRMTDSFSFRNHLCIVTELLSINLYELIKANHFAGFSTVLIRRFTTQMLGSLQLMR
                     SHRIVHCDLKPENILLCHPSKSAIKVIDFGSSCLETEKVYTYIQSRFYRSPEVILGMN
                     YAMAIDMWSLGCILAELYTGVPIFPGENEHEQLACIMEVLGVPDRYLIEKASRRKNFF
                     DATGAPRPFVNAKGRRRRPGSKTLAGVLKCDDELFVDFIARCLTWDPDKRLKPQPAMR
                     HPWILAGRRRYAPTPSRDEKRATTTERSSRLFGTSHTSTRISSKNLSELSTSSMKDKD
                     KSKLLISSPVPLAPAKHPYHASTASTSRIGQAMSSSRLAHQTSARSGSLTTSKLSIG"
     gene            complement(309631..311883)
                     /locus_tag="CNI01250"
                     /db_xref="GeneID:3259676"
     mRNA            complement(join(309631..309810,309862..310149,
                     310203..310475,310526..311077,311123..311284,
                     311325..311462,311517..311654,311709..311883))
                     /locus_tag="CNI01250"
                     /product="expressed protein"
                     /transcript_id="XM_572975.1"
                     /db_xref="GeneID:3259676"
     CDS             complement(join(309671..309810,309862..310149,
                     310203..310475,310526..311077,311123..311284,
                     311325..311462,311517..311654,311709..311862))
                     /locus_tag="CNI01250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572975.1"
                     /db_xref="GeneID:3259676"
                     /translation="MSRTQHPDLTYWQDTVERLTALCSRLQHPRQSTSETEIIDILNG
                     LAVALRDESLRTPIGSLGLPDTLTELLQQAITVDLEEVVKQVGRVAANLAVENDFNRE
                     LLAKAGFIGHVLSPSVLDRNSSHPSDQALVASLYNLVVQGNSLCISVFQQENHLRCLC
                     RLAVDHLQQVHKSNAVGTVDLTIAQWLWSILSVVINDNGDKDCKMSDQLPLLDLFKHF
                     PYWTPPGSLSDFVIESGPEPPLNILLSSCQVIENILSDHSDILKQLIEDDDRLPKAAK
                     HPLELVLDFVEFANLPLSWTNATTEQRDDGESASQEEDFDARKLFGEAKACLVNGIVS
                     FSSESASSTLPLGFFWTRMRSWLDSDVSNRRDLVECALLSYGNSITGDTDAIEYLDGE
                     TTLLPRIKSLLKPDVPATTQHAVVGLLRNLSIPDQNKNVLYEAGVIDDLIGMGVWSEN
                     RDMLGSVQGGVVGIFKNLCRNQSDIASYIMASYKDDLISLCKRTNDQAIKFEGTRVFV
                     NAARNLPKGMDSQGVNALCDERIVKLLVDMMLNASQYPLLENEAVLGLAFLSMFSSAN
                     ALVMEELTAEREGGTGKTRLEQMVANKDLLKEGRENAEALLTLMRDRL"
     gene            311954..323986
                     /locus_tag="CNI01260"
                     /db_xref="GeneID:3259481"
     mRNA            join(311954..312129,312189..312485,312539..313160,
                     313228..313634,313688..313798,313848..313908,
                     313948..314127,314179..314300,314347..314751,
                     314800..315415,315469..315576,315634..315711,
                     315773..318305,318360..318542,318592..318661,
                     318712..318732,318783..318857,318918..319019,
                     319075..319150,319201..319258,319311..319453,
                     319504..320115,320169..322394,322446..322506,
                     322561..322608,322663..322677,322731..322826,
                     322884..322938,322998..323179,323227..323276,
                     323338..323392,323449..323629,323686..323986)
                     /locus_tag="CNI01260"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_024657796.1"
                     /db_xref="GeneID:3259481"
     CDS             join(312091..312129,312189..312485,312539..313160,
                     313228..313634,313688..313798,313848..313908,
                     313948..314127,314179..314300,314347..314751,
                     314800..315415,315469..315576,315634..315711,
                     315773..318305,318360..318542,318592..318661,
                     318712..318732,318783..318857,318918..319019,
                     319075..319150,319201..319258,319311..319453,
                     319504..320115,320169..322394,322446..322506,
                     322561..322608,322663..322677,322731..322826,
                     322884..322938,322998..323179,323227..323276,
                     323338..323392,323449..323629,323686..323826)
                     /locus_tag="CNI01260"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_024513479.1"
                     /db_xref="GeneID:3259481"
                     /translation="MKVKKSAKKQSAPPEDVAALIKRILAASGDDLTIVLKQFQVWRY
                     PRGDLHAWIPVLDRFDNLLAEIIKSYDLTKLQINDFTPKTKDMLLEILRLQRILMENC
                     TNRKLFNSYDRLADLLLTNDLDVLLATIFVLLRPSQQYAISTPLDPAQRHAILQRLLA
                     LSRGWESLVHSGLDLTTIASANEVVIPEHLRQVQVHFYPTVQRQEAPSLDKSPVKMLS
                     SGAMETPTRQRPFVFGKAGTPVVRQGGAASTSSGPSVVDLGDVSTMEVNFTDQLSALA
                     EKNYIPLEEQFATLNKLRLVILMKDREIRRQLLSVRLFALATYVYLASEDAAQSNLFL
                     YEPELVSQLADLLRSSSDVGEQVTTGTLLALCACAHHQAKMGEVMTSVSANVNHGVLV
                     TFFRHLNDRLVAGEAVSFELVDATMSFLAFVATSPSHSNMLMGAGILRLLLEMLNTTG
                     DRRENCIPRAAGLIDHIVFSNPQGLSNFSSIDGVNNLVQRVKTEIELRLQARDEAASE
                     TISEETILSCANNPLKTILRSIQRLMQASGGTEGLRNLVDSDLPKSLKVIFQNSPKFG
                     SRVYALAINTMATFVHNEPTSLAILQEMQLPQTLYAQLEKEVPSSSDVLTAISNAVGA
                     VCLNQSGLEYTVAHPDVINNLVSIVMSTDHAQVFNERENARALGLSLDELSRHHPSLR
                     PVIIKAVVNLLRQAIDTGAAFEPAIDERPDYIIEEMAQQMVPSLETQPAKTSPSNPTL
                     AAFTRIFRVLGGLLRNPTIVKDFVDAGGFDLVFTMTDSPCWPIRFGNTQASTSLAHLT
                     KHAIEHCYPQFIDAIVASIRTSLAQCTDVWSETDAHKKWTAVREGSADAELLGKFKTF
                     HSIFVRLTLFADALYALSVTNSRAATSVIKTFKVQDDPSFITNLGTIHRLCFRYHVLS
                     RSSEPSISEDPSKEGDNVKESGVRYLSTRSHAILTKFFKCLVRLIYSKRGRDQTHRDQ
                     AQALSVCIADILIDHLQPIPDLSANGFSVDGFALGTVMTMLFDGRGLDGHLNTTLFLA
                     FEEKGGFDATLSASTRIISHMEEVTKKHNEDNDTTQGELDTESVAAIKTVLLVLNSFA
                     SPKALLDSPETHAIQFAAPGQPKPSFTATNFFLKIRLAVFPLAHRIWRASWLLNCPTP
                     VIKIAINCFSTLVEGKHEESSGPEAISRAIHIVAQPRPVVVTADPTSVDQLVDMGFPR
                     RGAERALIRSRNNITTATDLLLTMPDEFVDDVSGGDNQAGPNTVLEENNQEIEGESSQ
                     SAERELDSHSGAAHTEIGDRESTPRPADEDVKLKEQLQEVRKKYREGMSDRALEIMDQ
                     AEALVFDLLPCVPSGQAGITFVVDRLSDACINYQSDRDIMISARLRLASVCLRSNDSI
                     VFSDELQARSAEIVHALPLEEVQRPRWLPALLLFAETVYGLQSFIKKVKLGDSPEEEV
                     TAALVSQLRSEVSRLSTICVTTIRADDSTRDELVAAFRLLALLTRVSGVGISPSVIAD
                     CLQPFKKVSEKLAGCHPFLVLVIRHLLDNESTLVEAMQGEIKNWLSPARNKVADIQHF
                     VRQLRHVALREPTCFLRAVKQECALVDPTPPQSVYHIRGKIESKDGPLATGHVDSPLE
                     SLGEETQTMMNFLLGELSQAVRASFEKSDNEKLSTEVKNSAEQAYSGLVMSTLTEILG
                     SYVTAKKAFLNGLKQGTFPGALKAKGGISALINDLICCPVLRPDVSTTPVAGSDPLSL
                     QRLAISSRSTAMVVALCSDVVLVGDKKDVPEDIVSIRRTVLDALAKAIRDTSAVLDNN
                     ARYGRLWALGELVYRLLMARPHTSPRQVNNTGLHMAKTMLEKNFVGILTNALGEIDLN
                     YPDIRNVLVTLLRALEHLSKLSVKWGKANKNQREEVGQHQSEEGNDSSNPSHSDSESD
                     VDMLEDEQSAPDLYRNSALGMIGGELGDEDEDDDMDDEDEEDDMDMGEDLTDDDDDTA
                     SQTSEDESMASALEHDDWADDLDDDAGDSDEDGEMEQEVILGSADEDGEVWDGDSDGQ
                     DSYGTDDEDDLEEEGIHAEGIFDDDVDDPEMDDFDDEEAYDETAFMEPFQDIMSPEAA
                     GPWGWNQPAGRETVRSSGFTRADGQFMADEDLLGGPLASNTRNLTEHPLLTNQASSSH
                     IHSSRLSDILYAIENMRGTDTIQMLENFVANRQHNVMGSNQLAFSRNHDGSMSVSING
                     RVYTVGGQSRNVTSPNVAAEFVPMTTSQRWQEELNMLPMSRNEASSRLVVHIVNHLLP
                     EARRQAAEKEVMDKEAEADRKTSATSAEKIEENGNAIDEEGVGNDDHDWQEDDEDVNM
                     DDSDFDSHVSADEDVVTEEGGADRGPRTLVSIRGRDVDITDTGIDLEFLQALPDEMRA
                     DVVEQHMREQRRHQRPVSSNIPEIASQINTEFLNALPPDIRAEVIMQEEMENARRDQP
                     PPPPSIQTGRTSGHFFTAIANELRVLQQNPLGVASSSGAVHATGDAPSTFNPRHREAI
                     QLLEKPGIAVLVRLLFYPHAFKKSYLFRVLVNLCENSNTRNDLLDLLISVVHDGSGDL
                     PAVDRSFQQMSLRGASVSTPKATPKSKTVDTPSTVIPPGLFSGLQNEHVPTFIAQRCF
                     EALAYIVNSNTNAASYFLTEHEQTAGLRKHTSKKGKGKEKILPQTKFPIVVLLGLLDR
                     PLLAKTPGMMETVTALLLTITKPLADRKSEENGQAVATDKDTDSSAKPPTIQSSQEAS
                     AGPEHVVGKQTSPSIPPSVLKLIVNCLTAGECTSRTFSQTLGAMQNLACLPESKDIIL
                     QELCARCQELGAAAHEQLQELAAALNDEDSDVGSLTLVKFSPPTSTQAQLLRLLKTID
                     YLHLNKVDPDPPADTMTAEEEAVTKVFQSFNFEGLWDQLGQCLSIVEARGSTEQLATV
                     LLPLVEALMVVSKYRTRFSREIRSPSIAPATSEGVDFFVSFTTAHRKVLNTIVRNNPS
                     LLSGSFSLLIRNPRVLEFDNKRTWFFQKLKRKKSSAIPSGTLHLNIRRQYVFEDSFLA
                     LQRWNGEELKYGKLSVKFRHEDGVDVGGVTREWYSVLAQQIFDPNFALFEPCAADQQT
                     YQPNKTSWINDVHLSYFKFVGRVIGKAVYDGRLLDAYFNRAFYKQILGRTVDMRDLES
                     IDPEYHKSLQWMLDNDITGVIDQEFTIEDDQFGEKKTVELKENGANIPVTEGNKEEYV
                     RLVVSYRLDNSIRDQIKSFLEGFYDIIPQELIQIFEPDQLELLISGITTVDVDELKNA
                     TQLNGWKATDPEVAWFWRALRSFSQEERSRFLMFVTSSSRVPLGGFSQLQGSSGTQPL
                     QLQKLHGKEGGLPQASTCFNLLLLPTYASYEQLRERLQFAITETGGFGKA"
     gene            complement(323910..326694)
                     /locus_tag="CNI01270"
                     /pseudo
                     /db_xref="GeneID:3259380"
     gene            complement(370721..372549)
                     /locus_tag="CNI01280"
                     /pseudo
                     /db_xref="GeneID:3259406"
     gene            complement(381428..384317)
                     /locus_tag="CNI01290"
                     /pseudo
                     /db_xref="GeneID:3259408"
     gene            385846..386860
                     /locus_tag="CNI01295"
                     /db_xref="GeneID:36393033"
     mRNA            join(385846..386430,386483..386584,386639..386860)
                     /locus_tag="CNI01295"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658730.1"
                     /db_xref="GeneID:36393033"
     CDS             join(386311..386430,386483..386584,386639..386764)
                     /locus_tag="CNI01295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514403.1"
                     /db_xref="GeneID:36393033"
                     /translation="MQFSDLVRECLEFEYSRDRLSGLTIFRPDQVNDDLWKKILEDVR
                     RSAVRTFGDKVDKETWKWTGYEERVLVMGLVADKHIDIFGAARCNSKWPIRSLGMQYL
                     KNKAQTARKKRSS"
     gene            complement(388527..390163)
                     /locus_tag="CNI01300"
                     /db_xref="GeneID:3259410"
     mRNA            complement(join(388527..388709,388753..388919,
                     388969..389037,389097..389234,389300..389353,
                     389404..389457,389519..389594,389675..389808,
                     389881..390010,390069..390163))
                     /locus_tag="CNI01300"
                     /product="2,4-dichlorophenoxyacetate alpha-ketoglutarate
                     dioxygenase, putative"
                     /transcript_id="XM_024657797.1"
                     /db_xref="GeneID:3259410"
     CDS             complement(join(388577..388709,388753..388919,
                     388969..389037,389097..389234,389300..389353,
                     389404..389457,389519..389594,389675..389808,
                     389881..389994))
                     /locus_tag="CNI01300"
                     /codon_start=1
                     /product="2,4-dichlorophenoxyacetate alpha-ketoglutarate
                     dioxygenase, putative"
                     /protein_id="XP_024513477.1"
                     /db_xref="GeneID:3259410"
                     /translation="MTINYTPLHPTFVAEASGVDFDNITPEVVEEIKKGLAKYGVLIF
                     RKTGLNDKKHVEMSSFFGELDDVKPYNKLGRINRLAYDELFDVSNVDAEGNIFQPTGQ
                     RAIINRGNTIFHCDSSFNPRRAGYSLLLAHELPPAGTGGNTEFADTRTAYDDLPEERK
                     ETIKDWVLWHSQHHSRRVANPGEPLLDQEKFLPTSHPFGKHKLVQVHEPSGRTNLYIA
                     NHAYKIESLPLEHGQAEIKTLLDHCSSPRYVCSVEWKNDGDLVIWDNTCVMHRAVPGA
                     FEGKYKRDMRRTTVHDSSSYAWGLNTVGDTWRSGLP"
     gene            complement(392735..395472)
                     /locus_tag="CNI01310"
                     /db_xref="GeneID:3259605"
     mRNA            complement(join(392735..393168,393225..393450,
                     393512..393642,393691..393893,393941..394164,
                     394217..394376,394429..394593,394649..394686,
                     394750..394801,394854..394866,394938..395472))
                     /locus_tag="CNI01310"
                     /product="transporter, putative"
                     /transcript_id="XM_572856.1"
                     /db_xref="GeneID:3259605"
     CDS             complement(join(392893..393168,393225..393450,
                     393512..393642,393691..393893,393941..394164,
                     394217..394376,394429..394593,394649..394686,
                     394750..394801,394854..394866,394938..395213))
                     /locus_tag="CNI01310"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_572856.1"
                     /db_xref="GeneID:3259605"
                     /translation="MTTENEKDMAHHPTFREEVDIGFAGESAEYAQAPRLTQTANLKD
                     MNPLDITASTEKGEVDGRQQQQPEQGQSGVLTGARLYLVFVALMLCVFMFALDQSIVS
                     TAIPVIVSDFNAFDQVAWIITGYFLTQCGLILLVGQVLTILKAKWMLLGAIFFFELGS
                     LICGVAKDMDTLIGGRAIQGIGASGMFVSILAVIAVVTRVDQRAAFMASFGFVFVVSS
                     VVGPLLGGAFTDHVSWRWCFYINLPFGGFAAAAVVFLLPARDPEHADTAPPDRTVLGK
                     LRRLDWIGTGLIFCAITCLLLALAWGGNQYAWNNWRIPFLFTLGGLLVIAFGVWQWRY
                     DKYALIPLSLLKNRTVLACSGAIFFFMLAMLGGTYQLPLFYQAGRGHSPEKSGVDIIA
                     FMLATCVAILISGGLTTKFGRYYPFLLIGPPFAAVGFGLLYTIDVNTPNAKIIGYQIL
                     AGFGIGLSFQNVLVAVQAEYHDRPSLLPQATGVVSFFQLTGAALGVGIINTVQSVYLN
                     TEIKRLAPEVDFNLVRQSVSAIYTLPADQQSAVIEAYVISITNSLIPIIVAVGLAMVF
                     GAFIRNHNLLKKGGAGSAHMA"
     gene            395944..398981
                     /locus_tag="CNI01320"
                     /pseudo
                     /db_xref="GeneID:3259531"
     mRNA            join(395944..397684,397741..398421,398483..398981)
                     /locus_tag="CNI01320"
                     /pseudo
                     /db_xref="GeneID:3259531"
     gene            complement(395956..398945)
                     /locus_tag="CNI01330"
                     /pseudo
                     /db_xref="GeneID:3259778"
     gene            399824..401328
                     /locus_tag="CNI01340"
                     /db_xref="GeneID:3259749"
     mRNA            join(399824..400252,400331..400363,400432..400723,
                     400777..401022,401081..401328)
                     /locus_tag="CNI01340"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_572858.2"
                     /db_xref="GeneID:3259749"
     CDS             join(400111..400252,400331..400363,400432..400723,
                     400777..401022,401081..401243)
                     /locus_tag="CNI01340"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_572858.2"
                     /db_xref="GeneID:3259749"
                     /translation="MPRLTNESTVNLRTGRKMPRLGLGSGGLRDQTAVDAVEHAMKVG
                     YLMVDTAQQYQNEREVGTGIAKSGIPRSQIFICTKWQPRPDGSIERPTPEQVCQEAHQ
                     SVLRLDQSGSGKEYLDLMLIHHPRPDPDGRAVHWKGLALAQKEGWVKDIGVSNFNVKH
                     LEALPGPLPAVNQLELHPWCQQREVVDYCSEKGIVLQAFCPLVRIRKDKFEDPVVVKV
                     AKKHERAEAHILLRWSLQKGFIPIPKASSAERIEANKDLYNFELDSEDMEELDGLDQG
                     ASGRVSGIDPAHLPD"
     gene            401678..404689
                     /locus_tag="CNI01350"
                     /db_xref="GeneID:3259690"
     mRNA            join(401678..402072,402145..402196,402269..402341,
                     402402..402496,402564..402659,402720..402753,
                     402818..402874,402931..402997,403058..403471,
                     403562..403782,403850..403968,404029..404147,
                     404211..404689)
                     /locus_tag="CNI01350"
                     /product="transporter, putative"
                     /transcript_id="XM_572860.2"
                     /db_xref="GeneID:3259690"
     CDS             join(401716..402072,402145..402196,402269..402341,
                     402402..402496,402564..402659,402720..402753,
                     402818..402874,402931..402997,403058..403471,
                     403562..403782,403850..403968,404029..404147,
                     404211..404450)
                     /locus_tag="CNI01350"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_572860.2"
                     /db_xref="GeneID:3259690"
                     /translation="MTRQKKQFVHHPSLAIPHSDLSTYPVDTGLLFLVLPQSVCLLSS
                     YIFSLVNNLTFTLPRDKVLETMTLGERERLLQPAPAPPGTTLYSEPNHSEDIETTDEH
                     KLSYNRVGLNARRFWILCASMWIASFLNAFDGTVVATLLGPISSSFKATNLASWLGTS
                     YMLSVCCFTPIYGRLCNIIGRQGSMLLALAIFTTGNLLCAFAPSMEALIAARALAGMG
                     GGGLSIIGSTIMSDIVPITHRGIFQGLANLAFGSGMGLGAPIGALINDCLNWRWAFWV
                     QIPVLLFASYLVHSNVRYDVPSRPSSGAATPNPAAVKQTAMQLFKRIDFLGCFLLAGW
                     VGAALIAISLNINSTATNAYNWSDPIMIGLFATSAVLFVLFLFVELKWAAEPVMPFEL
                     LVSRTPVAVAINNFVLSVANFAILYSVPLYFTTVRQMSASNAGAHLIPNSFVGVIGSL
                     GAGLIVRRTHKYYWLNTFCACFGVIGCFLISTWRLGTSEWMLWTNMSFTSFAMGAVTT
                     LTIVALIADVGPEHVAIATSLSYVFRTIGQVLGVALSGALTQAVLTWELEKRIRGPNA
                     EEIIASIRESSASIRYLPEPLKSIAIASYQKGLHAVFICTVVLSVITLLSGLGIRELD
                     MKQIMSGGKQAKQVQNESEEEEA"
     gene            complement(404674..406559)
                     /locus_tag="CNI01355"
                     /db_xref="GeneID:36393034"
     mRNA            complement(join(404674..404973,405023..405344,
                     405402..405436,405480..405858,405931..406052,
                     406114..406125,406190..406559))
                     /locus_tag="CNI01355"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658731.1"
                     /db_xref="GeneID:36393034"
     CDS             complement(join(404917..404973,405023..405344,
                     405402..405436,405480..405858,405931..406052,
                     406114..406125,406190..406234))
                     /locus_tag="CNI01355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514404.1"
                     /db_xref="GeneID:36393034"
                     /translation="MLRKPMTPLLNLLEEINKFIQHHNPIFYEFVEKTLFPNVAVRNK
                     ASKVLFSIISIGILQVIVPIFRWPLTLLASFLQFTFLYSSGIKQLRKGFASSQSAAKV
                     KSILTVYVVTSTLQLVPGFIFDTRYHFGALWDFFLPFVLFIVPWKDAPEQTLAASLCD
                     TLFATLSTSIGTLFAPILPDHDGQITAMLASVTVALMFWAGYLAAQAAFFIAWAFVGL
                     STVNALGQPLKTKEASSVKYYKQMTVWHNLMAIWLWRILISAIEGINVPGIASATGLI
                     LHFVPTFYLWATVFMLSMLVTKKSADHHHNADTWYARCLTRSRTITK"
     gene            406772..408714
                     /locus_tag="CNI01360"
                     /db_xref="GeneID:3259714"
     mRNA            join(406772..406894,406944..407010,407061..407201,
                     407254..407627,407679..407746,407809..408714)
                     /locus_tag="CNI01360"
                     /product="expressed protein"
                     /transcript_id="XM_572784.2"
                     /db_xref="GeneID:3259714"
     CDS             join(406821..406894,406944..407010,407061..407201,
                     407254..407627,407679..407746,407809..408479)
                     /locus_tag="CNI01360"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572784.1"
                     /db_xref="GeneID:3259714"
                     /translation="MAIAFPQPFMHPKTLPVGLVTEAAKDTIFRDKTSEDPHTPLPLD
                     QDSYFQFSAAASNLKNVSYTISGGDEGAESRGDELNGGVWTSEEEEFIKLVMSRPARD
                     FSVPFPPDALPPSAVIDEITDYIAIPGIAAHASVDGQTATHGDNQLQLWPHTWQETRI
                     KVLQIALEQSRFGRDVKERKLPREIRNHRPGLRRMDSMDFLDQEKTEGVSEDHLGRAL
                     RLSSSLQSSAQDEKTNIMFQQPIAIESLRPQSHSVTSSEPLIPANPVSRAFRRCNSKS
                     SRPSSLLQRGRSFTAADLQMEDENLEEDDRGTTFLTARGEQASSSTRAIGTHQYEKKI
                     NLIQPMTSITSQSTSETSSKPPARLIRSNSSYSVANAAPYSSQKMFLSTPQPSTAQSS
                     IMPLSLQPSMKLSVSKSRRTNNGRDFNQPAFKKAKRRDGNEYQVKPGGIPIQHSLLQG
                     GLQSPFEEKKGLDL"
     gene            408965..411032
                     /locus_tag="CNI01370"
                     /db_xref="GeneID:3259450"
     mRNA            join(408965..409606,409661..409742,409804..409901,
                     409954..410601,410652..411032)
                     /locus_tag="CNI01370"
                     /product="expressed protein"
                     /transcript_id="XM_572979.2"
                     /db_xref="GeneID:3259450"
     CDS             join(409206..409606,409661..409742,409804..409901,
                     409954..410601,410652..410862)
                     /locus_tag="CNI01370"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572979.1"
                     /db_xref="GeneID:3259450"
                     /translation="MSSATDRIPALIAHYLATHYPTALDPFLQAAQIAAPDFSHPPNP
                     DLRTVVEDWSSQQLATSLAMATIDESDIDAPARDGTWKGWKLKDMMKAKLSAGVGLRS
                     TDRGFHGVSAANLLTVAAVNVPSREFDTSSAIYRTSCSLDIVTTSVDKTLKIIDYSSG
                     EVNKVLQPHRAAILTFAFHPQNQRYLLTGSMDGTTVLTDILTCKTLQTFSSTKFVVRV
                     LFSSDGHFMATASYDHHIVVYAATSSALPPPTHEDDIPLDDTDHWSLACEPDLQYTEV
                     HRIQVDANPEAILFHPDSTWLMYTTRSSYQLYYVRLPSESCPPDDEWQIKTKSFNPHP
                     MDTHVSFSVLNMALHPSGRMVACQTGDHKGGAGERILLYGVEPEETERLGCLWTGSGG
                     DDYVLPRMAWVPDGSGIVTTTHNGFLNLIALNGEIRSSVKVHGTSNSGKAVSEVVRDC
                     CIIPGEAGGWEVISIGYDRSIRISVIDGY"
     gene            complement(410887..413086)
                     /locus_tag="CNI01380"
                     /db_xref="GeneID:3259640"
     mRNA            complement(join(410887..411062,411123..411673,
                     411733..412172,412232..412499,412570..412821,
                     412899..413086))
                     /locus_tag="CNI01380"
                     /product="endoplasmic reticulum protein, putative"
                     /transcript_id="XM_024657798.1"
                     /db_xref="GeneID:3259640"
     CDS             complement(join(411014..411062,411123..411673,
                     411733..412172,412232..412499,412570..412821,
                     412899..413051))
                     /locus_tag="CNI01380"
                     /codon_start=1
                     /product="endoplasmic reticulum protein, putative"
                     /protein_id="XP_024513567.1"
                     /db_xref="GeneID:3259640"
                     /translation="MRFRNSLPSCLQTALPSPLHTNMARTNPKKSTQNEKKDWGEVTP
                     EAVQALCLANAPRSLLYRHPVLRRIYLVIFVLTTLLTLLPLWSLLYLPRSNRPRRSWT
                     LQRCLRVRWSRRLCGVVARCEIDYLGRDLNLDLDPMRLSHSHPMTVPPAPLHLLQGHP
                     KEMLELLHQSRGSWDPHFIYRANRAATGAWGAWNSRDEKELSKEYGFEPVKAFWFTGE
                     KGAPDEKPKPRQDGGPVILHFHGGGYLCGTAAETDLTSSICKALVSYSPVHHILSVDY
                     RLAPVGPWPLPLLDAISAYHYLVKIEGIPEQDIVIGGDSAGGHLAMALTRWLRDEGDH
                     VGLSMPRGIVLMSPWGDLGFTNAWGADEYKYNADSDTIDDTFGPFACSLLLRALPLSI
                     LYSSPYLSPASSTLSATSLFNNFPPTYIVYGGAERLAKSTETLYSRIQLARRAADKVL
                     VPDRLFASPDAVHDFVIFPWMAREASQVYEDLDKWLRELLTTDICSPAAASKESLKQP
                     KKITDQCRLTRQRTLESLRSHKSPRMCAAPDSGMLELVQDMQEEGMSMIEIPKLDLGS
                     TAIT"
     gene            complement(413192..414715)
                     /locus_tag="CNI01390"
                     /db_xref="GeneID:3259500"
     mRNA            complement(join(413192..413746,413803..414715))
                     /locus_tag="CNI01390"
                     /product="expressed protein"
                     /transcript_id="XM_572971.2"
                     /db_xref="GeneID:3259500"
     CDS             complement(join(413250..413746,413803..414622))
                     /locus_tag="CNI01390"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572971.1"
                     /db_xref="GeneID:3259500"
                     /translation="MAANHGVFFHPPQPLSSPSAPFFTPSRKRRAASPTPDSDPLSPW
                     QQSASPTTFADTPHREKRRRPNLAHGFSSLSISPTATQSTTVPDQPRADDDDEGIGPS
                     VYPRNDDVKVEVLPDNTNRLSSYQHRSHRTHTDQWDPYHPRPCSSSSSPSPTTSTDET
                     YDSDATFTRNVPRIKRYDGTAQQADEIVQPDGSSMFTGPDLGVEDVTGIPPPLRARRP
                     REEDIEGMEHAGKKRRGNEMDIDMSTMDENTEDGSVEEKDKLRGRKTVWYEPEKDRIV
                     ITSLSDSDSRSSRSPSPETESRYLSQPGEQGFTISPSLLTHLMNVHRNKDLRGPLQDL
                     LENNQKSLTLYRPLGIPADRWKESIVKTWEDARNYDDSGRFEEIDDTEDFGNNIRSTG
                     NNDEGMDIEGTVPAWQGGAWNTGEAGMGEGGAVSGDGDVDMAMDVE"
     gene            414959..416896
                     /locus_tag="CNI01400"
                     /db_xref="GeneID:3259492"
     mRNA            join(414959..415302,415358..415412,415454..416135,
                     416184..416257,416316..416702,416773..416896)
                     /locus_tag="CNI01400"
                     /product="choline kinase, putative"
                     /transcript_id="XM_572982.2"
                     /db_xref="GeneID:3259492"
     CDS             join(415007..415302,415358..415412,415454..416135,
                     416184..416257,416316..416702,416773..416838)
                     /locus_tag="CNI01400"
                     /codon_start=1
                     /product="choline kinase, putative"
                     /protein_id="XP_572982.1"
                     /db_xref="GeneID:3259492"
                     /translation="MVVTPTRPPVEPSGPPLSPLALASTAPRNSSDSYFAAQAGSRPL
                     PRHRRTSGSSFSKLSEFSLDPPLLDKTDQYAASPDQIDENGVTGVRHVALSVDASEWR
                     QPVFKQKVLAILRRLHVPRWSSTLLTPTNIHLQKVSGALTNAVFFVSFNPAPNPTSPS
                     ESPLLTPTIPPSDPSHPPPLTPDQYPHTLLFRVYGPSSEALISRSEELRILHVLSTQY
                     GIGPRVFGTFTNGRVEEFFPSRALTAQELRDPSISRGIARRMRELHSVDLRRLGYEQG
                     RATEPALWICLKEWSEAAEDVITSLTALGGTLEAWVERFSLHRIREEVTIYRNFVESQ
                     SGKGSGVVFAHNDTQYGNLLRLDVELPPNTPEHCRYIVIDFEYASPNPRGYDIANHFH
                     EWRANYHHPTHSHSLIPHFPYPTPIQREDFYRSYLSVEVDGRNGEEVVGKRKDVPADK
                     VAALEREVRIWSPGCSINWALWGLVQAEEQVCALATKKEGYVPEFDYLSYAAERLEMF
                     RDEAKKLGVPL"
     gene            417034..419768
                     /locus_tag="CNI01410"
                     /db_xref="GeneID:3259538"
     mRNA            join(417034..417218,417274..417536,417598..417679,
                     417738..418014,418066..418210,418261..418360,
                     418406..418528,418580..418837,418892..419395,
                     419449..419768)
                     /locus_tag="CNI01410"
                     /product="dynein intermediate chain, putative"
                     /transcript_id="XM_572785.2"
                     /db_xref="GeneID:3259538"
     CDS             join(417102..417218,417274..417536,417598..417679,
                     417738..418014,418066..418210,418261..418360,
                     418406..418528,418580..418837,418892..419395,
                     419449..419715)
                     /locus_tag="CNI01410"
                     /codon_start=1
                     /product="dynein intermediate chain, putative"
                     /protein_id="XP_572785.1"
                     /db_xref="GeneID:3259538"
                     /translation="MSDRRRQEIEEKRARLAELRRARDERKQLLAQAEKGSAEPLSTS
                     RRDVNELVDSLLARPATPLTGPSSTRPSTIGTPARPSGSTPPASIPGTPGGRVSRLSN
                     DGSLSRVAGSTAGGASVGVPGTVDQENMPSPSPSQAVDFVDHQAELFELPSKSAKAAP
                     VTYSKAIQTMTSMSTSTDDADVDDAQSEGEDGTGRRRRRKGEADESGKETEDEMRKRI
                     LEELDEERKALEKELRELREKTEELKIAELSDEQRQAIFAAPDFTSFIEESTRIVQRA
                     LSDGYDYIKDYTIGIDGAFDESEGQKVKLFCAFSDERWTNGRSVTDVDWSPKFPELSV
                     ASYNKNPSAVNDPDGIVAVWNLHLLERPEFVFHSPSDVLSVNFSPYHPTLIFGGTYSG
                     QVLLWDTRAKHLPVLKTPLSATAHTYPIYAMKMVGTQNANNLISSSTDGLVCSWLADM
                     LAQPQEALPLTMPAHNKTDEVSITCFDFPDNETSTFWIGTEEGSVYQANRYDRASAKA
                     GINPDEAYRGHAAPVTGIHFHPGTGSIDFSNLFLTSSVDWTVKLWRTKAANTTKGASG
                     TQANGNGEDKTVAPVHSFEEASDYVFDVKWHPHHPAVFGTVDGSGKFDLWNLNQDVEV
                     PIISTNVSPRAINKLAWDRSATARKVALGSSDGKVYIYDVAEKLVVPRDSEWVETQKN
                     VQSLAASKDGANGVLGNESVSGSAGRYRL"
     gene            complement(419788..420912)
                     /locus_tag="CNI01420"
                     /db_xref="GeneID:3259728"
     mRNA            complement(join(419788..419989,420048..420289,
                     420348..420538,420600..420912))
                     /locus_tag="CNI01420"
                     /product="expressed protein"
                     /transcript_id="XM_024657799.1"
                     /db_xref="GeneID:3259728"
     CDS             complement(join(419820..419989,420048..420289,
                     420348..420538,420600..420824))
                     /locus_tag="CNI01420"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513520.1"
                     /db_xref="GeneID:3259728"
                     /translation="MRPTLTFLAFLPLVAAFDCSITAFSISYDISPLAGLRTASKDSS
                     TPPTTSEVKVSMNLCGGEGLGKEDGVADEDQCPENTRVCLKLINHKPSSSDPDRVTAV
                     VSFWTVDTPDSDITATPLGKKGEQGLEISVKGQEYAGVPQHLQLTLLCDTSSDSPNPT
                     LVSYTAGLLSLEWATPDACPRSGDSSSPSGSSGGGGGFFSFVKTLFWLIIIGLILYFA
                     IGIFYNHQQYSARGWDLIPHRDFWREVPTLGQDLISHVVANVRGSGSGGRGGYSSLG"
     STS             420485..420964
                     /standard_name="ha2098"
                     /db_xref="UniSTS:515485"
     gene            421001..422774
                     /locus_tag="CNI01430"
                     /db_xref="GeneID:3259578"
     mRNA            join(421001..421243,421324..421550,421600..421792,
                     421849..422270,422325..422774)
                     /locus_tag="CNI01430"
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /transcript_id="XM_572786.2"
                     /db_xref="GeneID:3259578"
     CDS             join(421049..421243,421324..421550,421600..421792,
                     421849..422270,422325..422631)
                     /locus_tag="CNI01430"
                     /codon_start=1
                     /product="cyclin-dependent protein kinase regulator,
                     putative"
                     /protein_id="XP_572786.1"
                     /db_xref="GeneID:3259578"
                     /translation="MALSGQATPSEAGPSKSSLIPGPSAYHESSQFRHWRFSPSTLNR
                     IRSELNTKSVEVARRNTELEKEAQKSLGHDIADPPPAATYLTVNDELLLLRFYCSQVS
                     RICREGFGLPEVVESTAISYVKRFYLKNSVMEWHPKIIMPTCLYLAAKTTNFPIPADQ
                     FVSKIPKLTPEDVLEKEFLVAQSLSFEFWVRGADKALRGWTLDMQDQQNPPLEAIQKA
                     IAPAFTHLSTSYLSDAEFIFTPSQISLACLRMADRKLVEGFLEERYAAHAAAIASKSM
                     NGVEESENGTPVQGPAPLYGMEKVRLLEILDQIEAIIRAVAVELDVKKVKEVDKRLRQ
                     CTNPEKIPGTALYVKRKQEKEAADAAAKATKTLKSQSSAADSDMFFGGSLPLANGQSK
                     SRVPLSPRVNLNSNQKAGGAEMEISDTGMGIQGESGGLLMGGKGLKDVGLPLSKD"
     gene            complement(422642..425805)
                     /locus_tag="CNI01440"
                     /db_xref="GeneID:3259456"
     mRNA            complement(join(422642..422871,422926..422938,
                     422992..423091,423138..423270,423318..423457,
                     423513..423588,423641..423674,423731..423847,
                     423900..423908,423968..424212,424264..424595,
                     424644..424908,424965..425142,425194..425266,
                     425315..425430,425487..425520,425570..425719,
                     425755..425805))
                     /locus_tag="CNI01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657800.1"
                     /db_xref="GeneID:3259456"
     CDS             complement(join(422786..422871,422926..422938,
                     422992..423091,423138..423270,423318..423457,
                     423513..423588,423641..423674,423731..423847,
                     423900..423908,423968..424212,424264..424595,
                     424644..424908,424965..425142,425194..425266,
                     425315..425430,425487..425520,425570..425715))
                     /locus_tag="CNI01440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513475.1"
                     /db_xref="GeneID:3259456"
                     /translation="MATLGPRNKKITRKQLAAVDLARTCDLIAEPPEPMALRLSGALL
                     VGVARVYNQSFDMFYSDVNAFHSNLRRSIATDFNTANGGTTGGLALELPGEGRSRPEQ
                     ITLGGVEFDWETDWTKELGYIDWNNPLGATRKRRASSVISSSQATPMSKRHHDDGERH
                     EENDSEDEGYESEVARQAKRKKYSASAAATTLHRTPLHPHAPSNSLYTGPDLNFNEEV
                     DLGLNLDFEAPAGANDSFSGPSGRDFDIPFAQPDDYDIGLNFEGFGEARPDEDADMGP
                     PVAYDDELGEKYAPYQAQTLQRSPNRQSSIETVEQNLEAKKKREKKLKTVTFDRALEI
                     DEEEERHAKKTYAERMEKEKRDAELKQVEKQIATIVGRMVDGGGGLEFFDLEMDDWFS
                     HLTHVPKFKWEQDLTRSKKGKYGAFKAHAKDIDVQEPVDGRPDVYDNLPPMAEPDDYV
                     YDVFGNIDLGQYDDNGPIQYDDYDMPVRDRNVGRGSEALDLEYARRENAQSGNLPWEA
                     GMMENYSPGFPDMPDTSFTPGSLKLSIMTPQEVRLRAHSRSGSLGGPLNQRRRIRSSS
                     LMSDRPDDDPLMLAPGNDSDLDVLPDELDLANIISSETQEARLADLPEAFRPEMLATL
                     EKQCRDFFTYVEKRMLTLDKQEVEFNELVPEKSSKHVAAVAFYDCLTLATKKILSINQ
                     PEPWEDINIHFAVKNP"
     gene            426163..428059
                     /locus_tag="CNI01450"
                     /db_xref="GeneID:3259647"
     mRNA            join(426163..426245,426297..426645,426704..426894,
                     426942..427062,427107..427150,427261..428059)
                     /locus_tag="CNI01450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572960.2"
                     /db_xref="GeneID:3259647"
     CDS             join(426194..426245,426297..426645,426704..426894,
                     426942..427062,427107..427150,427261..427955)
                     /locus_tag="CNI01450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572960.1"
                     /db_xref="GeneID:3259647"
                     /translation="MSDAEKKRIQLEIARLSGAIHRHTHNASYHPYKSAYPPARGHPR
                     GRSRGTASSRGRGRGGRGAYSLDLRAQNQAASASGSQASTPTGAGSSAQAGPNTEKEE
                     GEIDPEPPAQPAASWVKTARSGHQSLMTAEKRAQLQANSVYKTSKSLASMKPPGKGRQ
                     PRLKIKAVPVPDGTPRVFIDGVTYEFNPGGKGLKRTSDYKQPNTLQWYIDSPKPRLVS
                     VLGIKYRFQPNGDLTLPKSNVPRRGQLCPYFSKTGRCRKGHICKAIHDPDRVAACPNF
                     LRGRCELGPICPLSHRTTAHNTPSCTRFQALSYCTRPNCPYPHVKVSNDAPICEDFAF
                     TGWCDTAEGECPNLHSYDCPEFWSTGKCPRGAKCKLRHTLRAEKGRVAKPESTKEEEK
                     KSKKTEVPPGSFEEQTEFIVFDDEGSPGLALSESEEDDEEENDDDEEENDEGDEDEDE
                     DEDEEDEDEDGHGKQEASADEKDESDEDVKILF"
     gene            complement(428038..429087)
                     /locus_tag="CNI01460"
                     /db_xref="GeneID:3259494"
     mRNA            complement(join(428038..428298,428367..428603,
                     428663..428803,428901..428978,429030..429087))
                     /locus_tag="CNI01460"
                     /product="splicing factor, putative"
                     /transcript_id="XM_572679.2"
                     /db_xref="GeneID:3259494"
     CDS             complement(join(428109..428298,428367..428603,
                     428663..428803,428901..428978,429030..429055))
                     /locus_tag="CNI01460"
                     /codon_start=1
                     /product="splicing factor, putative"
                     /protein_id="XP_572679.1"
                     /db_xref="GeneID:3259494"
                     /translation="MASHLANIFGTEQDRVNCSFYLKIGACRHGDRCSRKHIKPQFSQ
                     TILLPNVYNNPGHTPEGQNMSAEELQADFDRFYEDFFIELAKYGNLQEMIVCDNVGDH
                     LLGNVYARFEYEAEAARAVQALNDRWYAMRPLHAELSPVTDFRESCCRQNELGECKRE
                     GFCNFMHLCHPTRSLVSALQASQRVSRRRAHKGAEVDSGDMGWTPAVAAGGEGDLGWM
                     PERRY"
     gene            429257..430548
                     /locus_tag="CNI01470"
                     /db_xref="GeneID:3259435"
     mRNA            join(429257..429401,429457..429515,429589..429683,
                     429743..429923,429980..430154,430208..430548)
                     /locus_tag="CNI01470"
                     /product="vesicular-fusion protein, putative"
                     /transcript_id="XM_572788.2"
                     /db_xref="GeneID:3259435"
     CDS             join(429285..429401,429457..429515,429589..429683,
                     429743..429923,429980..430154,430208..430447)
                     /locus_tag="CNI01470"
                     /codon_start=1
                     /product="vesicular-fusion protein, putative"
                     /protein_id="XP_572788.1"
                     /db_xref="GeneID:3259435"
                     /translation="MPSRAEDLIAKAEKKASSSVGWFGSSSSKWEEAADLFSQAAIAF
                     KIDNKWQESGQAYEREAACRLRLNENNDAMNAFHNAAKSYKKSNPEAAVTALHQAIKL
                     LIESGLFRQAADREKEIANIYAQDGIDPAKARDSFVRAGDWYKQEDANATANQCYQQA
                     AEISADLGDFQKSMELYQTVADWSLTSALTKYSVKEYWLRAALCSMAMGDLVTTHKLL
                     TEFAQKDLTFPSTREAKFAKDLMDACEEADLEKFTGTVYQYDQVTKLDNWKTGVLLKI
                     KKALEEDEGGLT"
     gene            complement(430503..431431)
                     /locus_tag="CNI01480"
                     /db_xref="GeneID:3259785"
     mRNA            complement(join(430503..431222,431273..431431))
                     /locus_tag="CNI01480"
                     /product="mitochondrial ribosomal protein, putative"
                     /transcript_id="XM_572818.2"
                     /db_xref="GeneID:3259785"
     CDS             complement(join(430553..431222,431273..431370))
                     /locus_tag="CNI01480"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein, putative"
                     /protein_id="XP_572818.1"
                     /db_xref="GeneID:3259785"
                     /translation="MALPAARSALSARAFIRPAAALNAAASSSRYLSTTTPRHDAPVA
                     TTPGNSETALPVPLPGIKFLSMPPVTPHPPTHGIHVATLHLQAHHPYNLDLVSQFAVH
                     SAHSLNIPTSLPAFLPREKSLYTVLKSPFVKKKAQENFERRTHKRAIKVYDADREAID
                     LWLRYLRQNALPGVGMKAYIHEWVELGFGRKEAEGQNEIEMEVEEKRIQDAAAELVKA
                     LSEGEGEDQAEGVQKIVDAAREEKPAEKLKEEEAKSS"
     gene            431580..432670
                     /locus_tag="CNI01490"
                     /db_xref="GeneID:3259421"
     mRNA            join(431580..431757,431816..431935,431988..432054,
                     432115..432670)
                     /locus_tag="CNI01490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572790.2"
                     /db_xref="GeneID:3259421"
     CDS             join(431584..431757,431816..431935,431988..432054,
                     432115..432596)
                     /locus_tag="CNI01490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572790.2"
                     /db_xref="GeneID:3259421"
                     /translation="MLRLVHRTAAATTRTVRSYARMAAPISVEYTQDRASDLRENIAA
                     VQQDIDNAAGTGAKPRLVAVSKLKPASDIKALYDAGYRHFGENYIQEMVDKAAALPDD
                     IKWHFIGSLQSNKSKLAASVPNLFILETLSSTKVADLLQKSLPPSRQSKLNVYLQVNT
                     SGEDSKSGLSPLPSNSAELVDLAMHVIEKCPGLKLLGIMTIGSWDASHDPTKPNPDFE
                     CLKRTRTELAKALAENGVQGAPKEDELELSMGMSADFVQAIKEGSSSVRVGTRIFGER
                     PKKK"
     gene            complement(432699..436265)
                     /locus_tag="CNI01500"
                     /db_xref="GeneID:3259419"
     mRNA            complement(join(432699..432802,432890..433580,
                     433633..433961,434016..434172,434245..434511,
                     434569..434590,434645..435101,435167..435976,
                     436036..436072,436158..436265))
                     /locus_tag="CNI01500"
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572987.2"
                     /db_xref="GeneID:3259419"
     CDS             complement(join(432776..432802,432890..433580,
                     433633..433961,434016..434172,434245..434511,
                     434569..434590,434645..435101,435167..435976,
                     436036..436072,436158..436213))
                     /locus_tag="CNI01500"
                     /codon_start=1
                     /product="specific RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572987.1"
                     /db_xref="GeneID:3259419"
                     /translation="MNDLSAASREKIRRGYRACLHCRSRKAKCDLGDIDAPSSPPCSR
                     CKRESRECVFAPSRRGGNNKKRARTDSEDISREDEDPPRPLGRSTAEVTSGEEHSSQT
                     FPYPQPPPQPRHPSVHNLLGHSPPPARYRQHFGHTSSSSQSSPQTSFSADHATPQTRP
                     TLSNVQSHTATGYPDSPPSPRRRRTANPPLHAADPSSIVVADMRNESDALQILALASG
                     QAANRDGEEERSDRHDGHSVPGTVDSTGMGGHQQQMRGAPSSPEKEMQLAKLAQFPLV
                     KLGILSVEQTTRLVDMFFRCHHHFFPIIPSDGIPRTLEQLSVFAQNEKYLLATIIIIS
                     SRVENTPEMREIHERSWAVMRRWISKVQCLGEPPTIGLVESLLLLAENLPRTSREMMS
                     DDSTETDAIEEPHGVENRQAWQMIGLAVRSAYEMGLDKLGLQLIPETERTLELERAKL
                     VWVYCYLFDRHVSMRLGKGFWTRGGAVCFQGYSSSAQTGPAAALVNFPFLREIRPGDP
                     HSDHPQDDLGSLVQAYLELTMMMSNAHDVLYPNAARTRSLVVYGEYFKYIDEMARSLD
                     GFKILWRRKKWTLFPLTDTVWVMFYYIQLYICAFSFQAHVERATIRGEEEYKLLEQRH
                     KEQGGTTKLAKPSLSLFPRGAAQSPDARYIFQMCDAARELIHICVDNLYPGGALPYLP
                     SRFLLWFTYGAIVLLKAIYSGAMLRADHKRTLDLIDRLCTCFAQCSTDEEYPAVRYGK
                     QLEALRNKLAGLSDVKSTQSPNGSQTVRLPRTQNRAPEVRVSPSQTSTSPNTVPPPQQ
                     FDPRPSTFQPARPHAMPNEHAVNTPTWQLPVLQQYTQPVTFPYPTTPVSFTTGPSTEM
                     SAPYVAPPHQQPFMEFGVAQSSDGLNLGMNDHHNLGFTTLDDWFGFGTAGTAGGAGQG
                     GNGVDDPMGLANVGLDLQDFWMNVGPGEAQGGFPFR"
     gene            436387..438097
                     /locus_tag="CNI01510"
                     /db_xref="GeneID:3259386"
     mRNA            join(436387..436499,436541..436716,436779..437360,
                     437429..438097)
                     /locus_tag="CNI01510"
                     /product="expressed protein"
                     /transcript_id="XM_572792.2"
                     /db_xref="GeneID:3259386"
     CDS             join(436471..436499,436541..436716,436779..437360,
                     437429..438066)
                     /locus_tag="CNI01510"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572792.1"
                     /db_xref="GeneID:3259386"
                     /translation="MADNAAAPAPLYLPAILQNPANRAARQVHAHNAQQREKAAARRE
                     RDTRSNAAPEYNGKGKRVIRRLDNAAFASNPHIVRPTKTDYAPPVPLQARPSRPSFPA
                     GAIPRSTPVPPALVPERDPFSPDSRQGSFSTSLKGTRAMLRKRGKRAEGLVTKADAEI
                     RKWLGGEWGDLNAQEDGQWRVIDERLVDYASEAGAASTSSAARRLPTHRGLDILPDLP
                     IENGQIPAILEISRSPAHLTWCLSESFDRLVIHLLSRYYELASWSQDLATTSGQILRV
                     THVVVPSIAQPNRHPIAGHSLATPETSEVSGQSSSESNYHSSYHSLSEGESNESSGFT
                     ESDSDTATEMGDAEIVSYSVEGDTTITPIPEMSDLSLSENENELIRTFSTTSSRYASS
                     EGGSDFGTLGDSLTIPRTSGHESEDSMAGGWVDMDDESDFGDIPGFSRLRIDAMYGRI
                     NPGVRVSARGWESKPTFFEYLYGV"
     gene            complement(438062..438948)
                     /locus_tag="CNI01520"
                     /db_xref="GeneID:3259561"
     mRNA            complement(join(438062..438308,438368..438450,
                     438524..438755,438829..438948))
                     /locus_tag="CNI01520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572816.2"
                     /db_xref="GeneID:3259561"
     CDS             complement(join(438271..438308,438368..438450,
                     438524..438755,438829..438877))
                     /locus_tag="CNI01520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572816.1"
                     /db_xref="GeneID:3259561"
                     /translation="MFFHLSALSVFLVVAFLLIYYRARLFPLAARFLPDTVVNRLSHY
                     TPLESYSFADQAEAGMSSGNFDLEANNGEGSGEGRLGLDEAGVEEVRRIMAIERCTFD
                     QARLIRHNRILAKNGIAPDGTPLDRKAITHL"
     gene            439095..440800
                     /locus_tag="CNI01530"
                     /db_xref="GeneID:3259490"
     mRNA            join(439095..439668,439719..440023,440073..440238,
                     440293..440468,440522..440800)
                     /locus_tag="CNI01530"
                     /product="transport-related protein, putative"
                     /transcript_id="XM_572677.2"
                     /db_xref="GeneID:3259490"
     CDS             join(439129..439668,439719..440023,440073..440238,
                     440293..440468,440522..440726)
                     /locus_tag="CNI01530"
                     /codon_start=1
                     /product="transport-related protein, putative"
                     /protein_id="XP_572677.1"
                     /db_xref="GeneID:3259490"
                     /translation="MSGLSLAQQLKQLHSNNVSVPDPESAYSNLDSHDIQRKGDEGRE
                     HYVDVGPSRLRMELGGTGGGTLTGPKYEGVKTGRMKIFDDDDDDDDDREGNGSEEGSD
                     GEGDEDEDGDEDDEDEEDEDEDEEESDEDEQGEDEDEDEEEQPQPRANGSKQALDPVA
                     SLRNSRLKDVEKGQAIRKQKALFESLITLRITFQKALTASNTVPPTLPEDPENELAYK
                     KASILKSLGELNERLFTLRESISLPGELGEDVSLGKRKRAEGDDAQGQAYWIKAAKES
                     LGIADRSHPQLLPILNKWSSKIQAASLQLGSKQAGGSKFLQQMKNGAGGVVEAIESGI
                     NSKREAEKTLMESEETGYRALLREVIESRSGSGPAADLTHLRREKKKKREAERGGSKG
                     RKLRYTVHEKAQNFVVPIPLSHGWHEEQVDELFSSLFGGVGMKGATAEKTVGLDVGTA
                     DEGLAELGGLRVF"
     gene            complement(441062..444513)
                     /locus_tag="CNI01540"
                     /db_xref="GeneID:3259601"
     mRNA            complement(join(441062..441358,441418..441900,
                     441953..441975,442036..442721,442816..443482,
                     443538..443697,443759..444022,444088..444205,
                     444331..444362,444436..444513))
                     /locus_tag="CNI01540"
                     /product="expressed protein"
                     /transcript_id="XM_024657801.1"
                     /db_xref="GeneID:3259601"
     mRNA            complement(join(441062..441358,441418..441900,
                     441953..441975,442036..442721,442816..443482,
                     443538..443826))
                     /locus_tag="CNI01540"
                     /product="expressed protein"
                     /transcript_id="XM_572968.1"
                     /db_xref="GeneID:3259601"
     CDS             complement(join(441232..441358,441418..441900,
                     441953..441975,442036..442721,442816..443101))
                     /locus_tag="CNI01540"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513563.1"
                     /db_xref="GeneID:3259601"
                     /translation="MRIPLDVAHSVVRALHTIRSDSAQSGNVTQTSVQIPSNQPAWAE
                     PLSPNLAAFSIEMDRWPDWAGQKVGEPNKYVNQVLTNLGERTGVMPYLRVGANSEDRA
                     TIDLSYEVMNATFPAATEEVPVPEADSISIGRDFYALSGNLPDGTPFQWGVNLASLNR
                     TETIAQAKLIADTFQGDRAHLTANVHLDGLEIGNEPDFYSSGKGLGAAWTPANYSQTW
                     LDYAQGVSEVIQLGGDGPYLTPGAMTGFEAPAWTPEASLEAGILDDDDIRSVVKQFNQ
                     HVYSGAFADGYPLSPTGSLMDKGTVRANLTTRTYGLKAVKSEGLQYVFAEGNSYANHG
                     QPGTSNTAEAAIWAIDWMLQLASMGVERMHFHHGVGFRYNFFQPVATDADHDDGTNMT
                     SRAHILPAYHAALIVNEAIGTNGNSYVAEISTPNDNVVAYGIWEDGDLVRMVVTSTEV
                     YTTDDEDAQEGRNKFELNLVGVEGRNATVKRLFVPQTTAMHGLTWAGQFFDTEDGKPT
                     GEVSEETLDNGVLQIDASSAVLICFK"
     CDS             complement(join(441232..441358,441418..441900,
                     441953..441975,442036..442721,442816..443101))
                     /locus_tag="CNI01540"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572968.1"
                     /db_xref="GeneID:3259601"
                     /translation="MRIPLDVAHSVVRALHTIRSDSAQSGNVTQTSVQIPSNQPAWAE
                     PLSPNLAAFSIEMDRWPDWAGQKVGEPNKYVNQVLTNLGERTGVMPYLRVGANSEDRA
                     TIDLSYEVMNATFPAATEEVPVPEADSISIGRDFYALSGNLPDGTPFQWGVNLASLNR
                     TETIAQAKLIADTFQGDRAHLTANVHLDGLEIGNEPDFYSSGKGLGAAWTPANYSQTW
                     LDYAQGVSEVIQLGGDGPYLTPGAMTGFEAPAWTPEASLEAGILDDDDIRSVVKQFNQ
                     HVYSGAFADGYPLSPTGSLMDKGTVRANLTTRTYGLKAVKSEGLQYVFAEGNSYANHG
                     QPGTSNTAEAAIWAIDWMLQLASMGVERMHFHHGVGFRYNFFQPVATDADHDDGTNMT
                     SRAHILPAYHAALIVNEAIGTNGNSYVAEISTPNDNVVAYGIWEDGDLVRMVVTSTEV
                     YTTDDEDAQEGRNKFELNLVGVEGRNATVKRLFVPQTTAMHGLTWAGQFFDTEDGKPT
                     GEVSEETLDNGVLQIDASSAVLICFK"
     gene            444678..451284
                     /locus_tag="CNI01550"
                     /db_xref="GeneID:3259712"
     mRNA            join(444678..444945,445002..445187,445244..445427,
                     445481..445687,445752..445871,445924..446031,
                     446079..446157,446208..446221,446277..446693,
                     446748..446830,446883..447021,447071..447361,
                     447417..447653,447708..447724,447776..447879,
                     447931..447960,448018..448212,448268..448332,
                     448387..448470,448531..448641,448690..449531,
                     449584..451284)
                     /locus_tag="CNI01550"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_024657802.1"
                     /db_xref="GeneID:3259712"
     CDS             join(444848..444945,445002..445187,445244..445427,
                     445481..445687,445752..445871,445924..446031,
                     446079..446157,446208..446221,446277..446693,
                     446748..446830,446883..447021,447071..447361,
                     447417..447653,447708..447724,447776..447879,
                     447931..447960,448018..448212,448268..448332,
                     448387..448470,448531..448641,448690..449531,
                     449584..451240)
                     /locus_tag="CNI01550"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_024513516.1"
                     /db_xref="GeneID:3259712"
                     /translation="MSVQHYLGTLFQPQPPTFEDSWKAVISSWGPSQFRAQAIDDFEP
                     VLETSPWPSVLNYLTETGLPSVTLEPPPIESTPAPESSSSTKADLVDRLRQHIPATFG
                     SLVNLLSTPRSNDDIQSELIEVMGFEGDALSLVEELLKPGARQDVIDSCLRSTPNAQD
                     KKETRPVQMDKPAYLPNARMTVKGKVKDRKKIIDISDIVGSAEDINKRLQEQIEGPKA
                     MFSEDGPKMVEQEILPHVYTATGNKFVPLSHGGKFALPEGTKREYTDTYEEVIIPPAN
                     PIPPKKTERPVKIAELSPIARGCFPKYIQLNRMQSIVQPTAMNTNENMLICAPTGAGK
                     TDVAIMSIIRVLSQHVIDGPTSHPSGFNINRNAFKVIYVAPMKALAAEIVSKFAKRLA
                     WLSIKVRELTGDMQLTKQEIEETQIIVTTPEKWDVVTRKPTGEGELASKVKLLIIDEV
                     HLLAEDRGAVIETIVARTLRQVESSQSLIRIVGLSATLPNYVDVGDFLRVNRYQGLFY
                     FDASFRPVPLEQHFIGVSGKPRSAVSARNMDRVVFEKVSELVEAGHQVMVFVHARRDT
                     VKTAQTLKEMALEEGVSTFFQTDGHAKFSQYRAELSKSKNKEMKELFDAGFGIHHAGM
                     LRTDRNMMEKMFEDGCINVLCCTSTLAWGVNLPAHAVIIKGTQVYDTGKGSFMDLSVL
                     DVLQIFGRAGRPGYATSGVGFICTTHDKVDHYVTSVMSQTPIESKFIPGMTDALNAEV
                     ALGTITNVQEAMQWLSYTYLFVRMKKNPWVYAMAHDVTKDDPQLGNKRNELIVQAARL
                     LQKARMVRYDDLANTFGITDLGRIAAKYYLRFSTIETFNSKFNPRMSNADLFQMLCEA
                     TEFEQIQLRDSEVEELEAIIGSGVIPLEVAGGAINKRNKVNILLQAHISNVYINDFAL
                     VSDAAFVAQNAGRIIRALLEIALSRNWANCSYLLVELSKCIERRQWVYDHGLAQLKVL
                     QRETIHKLTQYTPDSMTISDFRDMTAQENGEFIHMNEKHGQAVLDAAMMFPTVNLTHT
                     LRPITHDLLQITVKVTPQFKWHNKISGSSEPFYVWVQDEEGLNIYQWRSVRVTPSTTV
                     IDIDFFLPFDDVPPDSISIISISDKWLWSYEQLVIQLGDLIMPPPPKESTQILGIPFL
                     RRSCFNDPQLEQRYAQTLDTLNTIQSHAFWMLYNTSMNAVVSSPVGSGKTLLAEGAIW
                     NAFRHNKESVVLIMVPERYAVHETVARLRNLCPPKRRVIIRPLFNVSDFDQLLSGGPA
                     IGVTTPFAVLSNEKIDNFLSTQRLGLYVFEDLHLLDEVYELAVSKILTFARTARTRIV
                     GTTSSLSDPSDLAEWLGVDPGPLDQWGKPVASQPPALFSFAPSDRGNHISVSIKSFTI
                     PHGPTLLRSMIKPTYDILKSVTGGAIIFVPSVQACATVAADLVTQSGTEMNVDGFLSR
                     PRDEVEPFAERLKDEKLFEPVLHGIGYITRDMAPTDIAIVLELFASGIIRAIIAPRQS
                     CWTLPVRGESVIIMGTQYVRMEARPEGKGPKAKPEKHLVSYSAKELVKMQGFAVVSAA
                     PTAPGGRMFIMCQAEQQVMISRVLKEGLPLESKILDLLSRRSTPSSSIDPRAIQALNN
                     FFKGRRPPPRPTVDRPRRPDGRKADMMDIVNWSFLSVRVKSNPSYYQLVKGSEAEGIS
                     RVIDGWFDAMDGIKVETVEEQRRLTVEDAEAQEDRKDDVEKADLNSDQEGGVANVEEN
                     GNLDESEQKGTASEKSGQSVGLCNTLEVN"
     gene            complement(451250..452568)
                     /locus_tag="CNI01560"
                     /db_xref="GeneID:3259648"
     mRNA            complement(join(451250..451549,451605..451628,
                     451710..451721,451783..451862,451922..451945,
                     452003..452055,452105..452163,452220..452279,
                     452333..452350,452417..452568))
                     /locus_tag="CNI01560"
                     /product="sterol-binding protein"
                     /transcript_id="XM_024657803.1"
                     /db_xref="GeneID:3259648"
     CDS             complement(join(451529..451549,451605..451628,
                     451710..451721,451783..451862,451922..451945,
                     452003..452055,452105..452163,452220..452279,
                     452333..452350,452417..452446))
                     /locus_tag="CNI01560"
                     /codon_start=1
                     /product="sterol-binding protein"
                     /protein_id="XP_024513518.1"
                     /db_xref="GeneID:3259648"
                     /translation="MSDLTEPGFKTSDVLLSLASVFEKMPDDEKKSQIKKTNGVFQLN
                     VKNSQGKEAVWAIDLKNEGKVTKGPAKRPDVSIALSDDTFIGLADGKVNAQKAFMTGG
                     LKVKGNIMLATKLDGVLKNAKAKL"
     gene            452922..456871
                     /locus_tag="CNI01570"
                     /db_xref="GeneID:3259550"
     mRNA            join(452922..454306,454355..454537,454603..454733,
                     454796..455078,455134..455353,455408..455425,
                     455476..455549,455608..455704,455752..456107,
                     456171..456258,456310..456363,456417..456427,
                     456474..456582,456642..456702,456755..456871)
                     /locus_tag="CNI01570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657804.1"
                     /db_xref="GeneID:3259550"
     CDS             join(453107..454306,454355..454537,454603..454733,
                     454796..455078,455134..455353,455408..455425,
                     455476..455549,455608..455704,455752..456107,
                     456171..456258,456310..456363,456417..456427,
                     456474..456582,456642..456702,456755..456779)
                     /locus_tag="CNI01570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513471.1"
                     /db_xref="GeneID:3259550"
                     /translation="MPPAIKRKTFSAKFWKIFDDLDDSGLLEETDEERREYDEAVRNE
                     IGWKIQPISKSEVPTRVDHATDALMDDNHFIEYDTCSIPVPSTDASINVAPAARAFPF
                     TESQPPPSFHPSLMGKMSTPRAHRRIRQESIESVSDEICQSEQDQSSKCPVICAEEGG
                     IGHLSSSEGPPKSKNEARMDFELPNHNDFRNNSAPLAPIITSVPVTTSSTTPLPSFRQ
                     SQFGEVSTPHAANVTFPNVPTPNFDEYTPAGPSTRPVAINNCKHTPKTASPRRRAHTI
                     DTPEYIPSPVDTPDTSRPVIGAFGRSPRDDPATPGPLKLLPLKGETNKRFQNVSKHFQ
                     VFVAKKDNGPVGGKKGGKEKGKKKQPMAKSKSLSGLGLGGGVLRGLRICLPPGDKPMS
                     IQQEAWDHIIELGGTVVLYPDKATTHVIYDSDNRTKAKLAKLLRLQSLDELPVGTECV
                     IWEWISESKLNGVLLPVENFRSFRVDSLFSRVMSTGSLDQRNPRLAGMANQRLTRRAV
                     ESETESEESLPKKIRLQASVARFYSNNPLRSAAVLPTAGPSILRDSVPHHAVETEHTA
                     SKGSGWKKGEEDQRDALDEMIEGVKDGSLPEDELLDDDQTADPPSDDRAMENEANSTA
                     RFSKGGQEKSRKSEKGPNEWLAEKFDQLHDLYEGQVGKNPHSIRQYRNAAAAMRRTTF
                     PITSGAQAREINGIGEALAERINEFISGVPGRTFYEDNEHARCVALFKDIYGVGRQYA
                     NELYRMGARTITDLRTGRFPLSTGQQIGLALYEDLRSRIPREECKQIYELIKLEAKTV
                     DEKLWVEIMGSYRRGSETSGDVDILITRDDADGKSHKGAIKKLVDKLKAKGVITHELS
                     APHDWNALEAKWMGVGRVGQSAMYRRIDILCVPYESWGASLIYFTGNELFNRSLRLYA
                     RRLGYNLNQRGLYRNVVRARDGTKVLEGDRVASRTEEGIFQELGLRWRHPHHRRP"
     gene            complement(456844..457892)
                     /locus_tag="CNI01580"
                     /db_xref="GeneID:3259602"
     mRNA            complement(join(456844..457200,457254..457325,
                     457391..457892))
                     /locus_tag="CNI01580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572673.2"
                     /db_xref="GeneID:3259602"
     CDS             complement(join(456903..457200,457254..457325,
                     457391..457617))
                     /locus_tag="CNI01580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572673.1"
                     /db_xref="GeneID:3259602"
                     /translation="MSDQYSAASASSLSLTQKLTDLRSLLSTQKTVMLVTHAPNGRLH
                     GRVMAIAEITKDWKFFFIYDRESYKEQEVDNDFHVNISVDAMAYNKGWASIAGKAKRN
                     DSPEVIQRLYNPTVKAWFADKGDGVHDGSANDPRVAVLEVSIEEVRHYHQEKTVIGTV
                     IDVVASAVKGETATPGDIRQISGEEISSAWARGELKEP"
     gene            458086..459442
                     /locus_tag="CNI01585"
                     /db_xref="GeneID:36393035"
     mRNA            join(458086..458428,458483..458590,458646..459442)
                     /locus_tag="CNI01585"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658734.1"
                     /db_xref="GeneID:36393035"
     CDS             join(458180..458428,458483..458590,458646..459410)
                     /locus_tag="CNI01585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514405.1"
                     /db_xref="GeneID:36393035"
                     /translation="MLLPPQLPPPSLPRAKLYRLFLQHLRFLPDPQVWTTSVPRFRKL
                     LETPGPSPSGSNPSDNDESHKVVEIREWRREKALKKAHKELNKLRAAVACHPHALARL
                     LEESYGQRGSLRWQRLQEISAPYGSILSQTSLPPPLMPLRPPPPPPDDSQPRARKRMP
                     TCRLRKQAQRLVQRDWKGVQPPLYLPTSSELKDNDVDKKGRTMVDNLRIFAGLSEEPT
                     SPLTSAAALDLSPLPSNLSRIFPTNPRKTRSLPLPPYPPPRPKHTRSNPHTWSLPRKL
                     CSRLVRRIYKRLWDKLIWVRPVKGDKWKKCGYRELQNWEQGLIKESLVETDPASNKGK
                     KSKKEKAIERTPKNIDSSKWSCATPEDRQWLLFGKMQTS"
     gene            complement(459414..460531)
                     /locus_tag="CNI01590"
                     /db_xref="GeneID:3259583"
     mRNA            complement(join(459414..459604,459658..459697,
                     459753..459981,460044..460053,460112..460290,
                     460345..460531))
                     /locus_tag="CNI01590"
                     /product="manganese superoxide dismutase, putative"
                     /transcript_id="XM_572672.1"
                     /db_xref="GeneID:3259583"
     CDS             complement(join(459502..459604,459658..459697,
                     459753..459981,460044..460053,460112..460290,
                     460345..460461))
                     /locus_tag="CNI01590"
                     /codon_start=1
                     /product="manganese superoxide dismutase, putative"
                     /protein_id="XP_572672.1"
                     /db_xref="GeneID:3259583"
                     /translation="MITAITRTALPRATLRTSLATMSTIRAKHTLPPLPYAYDALEPS
                     ISAEIMNLHHTKHHQTYVNGLNAAEESLQKASAAGDFKAAIALQPALKFNGGGHINHS
                     LFWKNLAPTGSAQVKVPTSGVFYDQVQADFGGFENLKKEMNAKTAAIQGSGWGWLGYN
                     KATKKLEIVTTPNQDPLLSHVPIIGIDIWEHAFYLQYKNVKPDYLNAIWNVINYEEAE
                     SRLKAAQ"
     gene            460712..462433
                     /locus_tag="CNI01600"
                     /db_xref="GeneID:3259706"
     mRNA            join(460712..460829,460877..461037,461090..461165,
                     461221..461268,461324..461351,461411..461480,
                     461530..462433)
                     /locus_tag="CNI01600"
                     /product="pre-mRNA splicing factor, putative"
                     /transcript_id="XM_572796.2"
                     /db_xref="GeneID:3259706"
     CDS             join(460810..460829,460877..461037,461090..461165,
                     461221..461268,461324..461351,461411..461480,
                     461530..461555)
                     /locus_tag="CNI01600"
                     /codon_start=1
                     /product="pre-mRNA splicing factor, putative"
                     /protein_id="XP_572796.1"
                     /db_xref="GeneID:3259706"
                     /translation="MSYFMTHLHSGWHVDQAILVEEDRVVCIRFGHDHDEECMAMDET
                     LYGVSEKVQNFAVLYLVDITEVPDFNKMYELYDNCTLMFFYRNKHIMIDLGTGNNNKI
                     NWAITDKQELIDIIETVYRGASKGRGLVVSPKDYSTRHKY"
     gene            complement(461637..463349)
                     /locus_tag="CNI01610"
                     /db_xref="GeneID:3259751"
     mRNA            complement(join(461637..462466,462532..462657,
                     462707..462785,463009..463113,463181..463349))
                     /locus_tag="CNI01610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657805.1"
                     /db_xref="GeneID:3259751"
     CDS             complement(join(462104..462466,462532..462657,
                     462707..462785,463009..463113,463181..463251))
                     /locus_tag="CNI01610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513564.1"
                     /db_xref="GeneID:3259751"
                     /translation="MSSILSAIWPFLSSYRPNAARDRQAEREKQPLRFGAFEATYKPP
                     GFGIRGPRNDKEAQRLYNHIRTVAFWLDAAPLLADLGLPFRAGLDDIISLVPIYGDIL
                     SGILQLYQVWLCFIFGVPRTLLGYMLFNVLIDCVVGIVPLIGDFLDNLFKSNLRNLAL
                     LEDWLLTSPTATRSYHILLMPNTTDFMPKPKTSKFSSSWFGGGHGKSDGDEERERERT
                     TGKVRQTRRMGRDEGEVPHAQTDVPPPTL"
     gene            463517..465312
                     /locus_tag="CNI01620"
                     /db_xref="GeneID:3259697"
     mRNA            join(463517..463847,463910..465079,465139..465312)
                     /locus_tag="CNI01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657806.1"
                     /db_xref="GeneID:3259697"
     CDS             join(463648..463847,463910..465032)
                     /locus_tag="CNI01620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513470.1"
                     /db_xref="GeneID:3259697"
                     /translation="MKEKQVPVTSKSEGREEAERSSALGVDDEKKQSSDHQQFSGESG
                     NVQTLQKKKSFFGSVNLKKKVKRFASQIMKGKPASPTAFPTPPTELHPPLPSPQPKSR
                     RMPRPSLNKTSQTFQNTLRWANKSTASQVSFPKKPRKTASWPPPTMSSNHLPVIKQSN
                     NLHRRPSSVYIKNLRKAIKMDTGHMLNVPSLRAAANTRPNSYGTLQRQLARLQLCDEA
                     LTNRVQRRSQDKIRGNKDEATVPKNTIMPSFSKQYSCVSLDQEKDQSLPAISLFCPDG
                     NPSGLSTPSLTNESSQTSLFELKRVSSLPTAIQGEKSNNNDVLVEISTRIFNRSPDSS
                     VSDLQQHLQEPKHHIKKRSEKRKDTARETSASQSACGYQSEKPRQHHPNTAYTKQISK
                     DKLNVGPVYPNQRRRPSEVGRAKTLRGPVTTPNQIPDFESMLSIYAHF"
     gene            complement(465303..466270)
                     /locus_tag="CNI01630"
                     /db_xref="GeneID:3259683"
     mRNA            complement(join(465303..465425,465476..465526,
                     465581..465682,465736..465761,465811..466172,
                     466222..466270))
                     /locus_tag="CNI01630"
                     /product="aminoacyl-tRNA hydrolase, putative"
                     /transcript_id="XM_572812.2"
                     /db_xref="GeneID:3259683"
     CDS             complement(join(465374..465425,465476..465526,
                     465581..465682,465736..465761,465811..466172,
                     466222..466243))
                     /locus_tag="CNI01630"
                     /codon_start=1
                     /product="aminoacyl-tRNA hydrolase, putative"
                     /protein_id="XP_572812.1"
                     /db_xref="GeneID:3259683"
                     /translation="MSTIRMEGIFPSIIFSILAFTLGYQAHSLLSRSTSAVAAPKSPK
                     GTRSPRKFQQQDDYESASDTESDASDNAAALATDLSNIKYSSFEEMKLVLVVNDELKM
                     TKGKIAAQAGHATLACAMTLKEANPKLFKAWQMQGQPKIALRGANTEEIETLAAQARS
                     VNLCARTIRDAGRTQVAPGSKTIVGIGPGPAKLINTITGKLKLL"
     gene            466416..467520
                     /locus_tag="CNI01640"
                     /db_xref="GeneID:3259523"
     mRNA            join(466416..466631,466695..466800,466881..466980,
                     467035..467277,467334..467520)
                     /locus_tag="CNI01640"
                     /product="acetyltransferase, putative"
                     /transcript_id="XM_572798.2"
                     /db_xref="GeneID:3259523"
     CDS             join(466476..466631,466695..466800,466881..466980,
                     467035..467277,467334..467442)
                     /locus_tag="CNI01640"
                     /codon_start=1
                     /product="acetyltransferase, putative"
                     /protein_id="XP_572798.1"
                     /db_xref="GeneID:3259523"
                     /translation="MTATYSTTGTVSNPLDLSQIQGEHTSVNLSSSNKKNVKPNVKVT
                     LTSLTPNNSGTLRKINSVVIPIVYSEKFYKDVLDPLLDDVNKLIYYADIPVGAICCKY
                     ENLSKGSKEPPTLVILTLAILAPYRSLSLGTSLLRSAMHAAIHPTTPPPPIPSDKQTN
                     TRAQLTVAAPRVKVNRALAHVQVGNDEAKRFYERLGFKEVGIEENYYSKMEPRGAILM
                     VCDDLAIALGEKTEANGSV"
     gene            complement(467486..469750)
                     /locus_tag="CNI01650"
                     /db_xref="GeneID:3259502"
     mRNA            complement(join(467486..468440,468496..468963,
                     469003..469116,469164..469583,469643..469750))
                     /locus_tag="CNI01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_572670.2"
                     /db_xref="GeneID:3259502"
     CDS             complement(join(467820..468440,468496..468963,
                     469003..469116,469164..469400))
                     /locus_tag="CNI01650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572670.1"
                     /db_xref="GeneID:3259502"
                     /translation="MSTPSNEPFFPKDRKRSAHWSDSDTDILVDVLLRERDTGRTVDN
                     GFKPEVWKEAARLLENSNFVGGPKTPEACRSRWQRLQRDYRLVKEMEVLPGFSWDHNT
                     HRLSASPEAWMNAEKEMDAYKYRKIHLPHYDSLAILCANDSCRRAPRNTKTRHTSISS
                     SSSLMNLSTPNPNTSTPAQMAQVPQPITMAQVGHLSRQHSHSSLPTNGQMTPMSSSQH
                     HPHGHPGMHDPVNGNGLVQLGATSMQTDHNVFSWESGEQGGGEGDFDGSFGLSNGSQA
                     FLPQKRTMPFDPSLLNGSSQQHHMIPQGSPPKKPRTSSRPMITHQLSGMHQNGPFGYS
                     MQNTGNPAHLDTGNPGRGPNAGSGNQGDQQSPEFSTSTPAMLDHTLLQTPPGLRIKPY
                     TPPTPGSAPNLTLQAPEMAVAGLTEAQRRTEALLQLQLQESEMRDEDMVEVMAEFEMN
                     VAAADTYLAIKREPLRKMWLANLVKRRNL"
     gene            469843..471866
                     /locus_tag="CNI01660"
                     /db_xref="GeneID:3259758"
     mRNA            join(469843..470149,470203..470321,470374..470478,
                     470537..470665,470727..471365,471440..471542,
                     471608..471866)
                     /locus_tag="CNI01660"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572800.2"
                     /db_xref="GeneID:3259758"
     mRNA            join(469843..470149,470203..470321,470374..470478,
                     470537..470661,470723..471365,471440..471542,
                     471608..471866)
                     /locus_tag="CNI01660"
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /transcript_id="XM_572801.2"
                     /db_xref="GeneID:3259758"
     CDS             join(470012..470149,470203..470321,470374..470478,
                     470537..470665,470727..471365,471440..471542,
                     471608..471757)
                     /locus_tag="CNI01660"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572800.1"
                     /db_xref="GeneID:3259758"
                     /translation="MPLDLNYAPGSEDEEEDNIDDEDFPGPSSRRQARGAAGKGKGKN
                     KDTGRQAWEGEYQKSWDIVQEDESGSLESAVETLLARGRRKRALMSDTPVRRSIIRHV
                     FIIIDLSESMLDKDYRPTRFEVILGYLRTYVVEWFDQNPLGQIGVIAMRDRLSEVLIP
                     MGGNPEEIVRALSDKRKLEPSGEPSLQNGLVMAKGGMAHLPSTSSLEILVIFSAISTA
                     DPDGPITIHNVLDTLATGHIRTSILSLSGEIKICKQIAERTGGKFGVALDQEHLKDLL
                     WETIPPPATTIAPVTANVRSALAAGGRGPNQTGERAPAGDLMVMGFPIRLPLGGETMC
                     ACHGLLRKGGYLCPRCGSKLCDVPTDCEVCGLMVVSSPHLARSFWFLFPVANYGPLSI
                     EDVVESSETCFGCDSEFSDATAINAGVAQVEDGVSPTGRYRCAKCKHDFCADCDLYIH
                     DTLHTCPGCS"
     CDS             join(470012..470149,470203..470321,470374..470478,
                     470537..470661,470723..471365,471440..471542,
                     471608..471757)
                     /locus_tag="CNI01660"
                     /codon_start=1
                     /product="RNA polymerase II transcription factor,
                     putative"
                     /protein_id="XP_572801.1"
                     /db_xref="GeneID:3259758"
                     /translation="MPLDLNYAPGSEDEEEDNIDDEDFPGPSSRRQARGAAGKGKGKN
                     KDTGRQAWEGEYQKSWDIVQEDESGSLESAVETLLARGRRKRALMSDTPVRRSIIRHV
                     FIIIDLSESMLDKDYRPTRFEVILGYLRTYVVEWFDQNPLGQIGVIAMRDRLSEVLIP
                     MGGSPEEIVRALSDKRKLEPSGEPSLQNGLVMAKGGMAHLPSTSSLEILVIFSAISTA
                     DPDGPITIHNVLDTLATGHIRTSILSLSGEIKICKQIAERTGGKFGVALDQEHLKDLL
                     WETIPPPATTIAPVTANVRSALAAGGRGPNQTGERAPAGDLMVMGFPIRLPLGGETMC
                     ACHGLLRKGGYLCPRCGSKLCDVPTDCEVCGLMVVSSPHLARSFWFLFPVANYGPLSI
                     EDVVESSETCFGCDSEFSDATAINAGVAQVEDGVSPTGRYRCAKCKHDFCADCDLYIH
                     DTLHTCPGCS"
     gene            complement(471836..474691)
                     /locus_tag="CNI01670"
                     /db_xref="GeneID:3259608"
     mRNA            complement(join(471836..472490,472571..472729,
                     472794..474023,474085..474691))
                     /locus_tag="CNI01670"
                     /product="peptidase, putative"
                     /transcript_id="XM_572810.2"
                     /db_xref="GeneID:3259608"
     CDS             complement(join(471995..472490,472571..472729,
                     472794..474023,474085..474452))
                     /locus_tag="CNI01670"
                     /codon_start=1
                     /product="peptidase, putative"
                     /protein_id="XP_572810.1"
                     /db_xref="GeneID:3259608"
                     /translation="MVKPHILTVLSILPLSFATVATVATLDNTDSHNGLSPESVHHAA
                     TRQAVDMPERAITRDRGHGEQLIRKASARKRSVERRRRSTPPPFVGVGGVELDLVGRE
                     DRGMVKRSDNGTLLPLGTSQNTFVVPVSIGSPPTTYPLQLDLASSDILLASTLCGSHC
                     PTSLGTTTNPYYDVSKHSAGFESIDSNQTVWNTSYADGTVASGFLATETIILGDSVLQ
                     GQVFGMINATNLTLSSQKSSGILGLGFPRLSTLTHVLFEKHEQANTIASTSSSSLANE
                     TSVSTVSNATGTASASTASASRPAYFPTLLENLVRTPHLPYPVFALALSAPIKSSSTS
                     TSSSSSAAASASSRYRPSIGSLTLGGLSSYYVDDTEGSGRTVGDIEWHDVVPFGQPVS
                     ANDTATEEQALTASTGTLSASSTSENSEAASTSDAQRKRSDESQLDAFPSTVSELSQE
                     EYLYWALDLESVTVNGTDVGINSSYASIGLGSVALLDAGFNGIAGPQQDVVKLFRLIT
                     DAREVSEGQWAVPCNTRMTLGFSFGGRYIQLQPSDWIYAGIAQSSMCLAWPIAQPATG
                     DGIDWQLGTPFLKNVYTIFSYGINGKQAPLVGFLPLESTSVASNSTDDYNSITTSTAD
                     GNSPTPTSIAALSLTTTLQTALPNAVLPDPTFPTPTYVYSATPALLQPGAPQYLGLAN
                     SSAYEVMDVPVISVDNSAVSSIAVGNNGGGSNVSDDGSSSAAPRRMGAETVVGMGVMV
                     IGMIMGGLLV"
     gene            complement(474826..475689)
                     /locus_tag="CNI01680"
                     /db_xref="GeneID:3259372"
     mRNA            complement(join(474826..475056,475166..475293,
                     475393..475485,475654..475689))
                     /locus_tag="CNI01680"
                     /product="trafficking-related protein, putative"
                     /transcript_id="XM_572808.1"
                     /db_xref="GeneID:3259372"
     CDS             complement(join(474904..475056,475166..475293,
                     475393..475485,475654..475672))
                     /locus_tag="CNI01680"
                     /codon_start=1
                     /product="trafficking-related protein, putative"
                     /protein_id="XP_572808.1"
                     /db_xref="GeneID:3259372"
                     /translation="MTAGLKTVILLSFILAAGFLLVILSCALWANWLPLLVALTFILA
                     PFPNWICSRCASADDLSPEFNSAYIDFGRFLTGMLVMTGLSLPLLLTHSALIQPAACW
                     MSIAGGMLVYGTILVYAGWFGGGNEEEF"
     gene            complement(475980..476649)
                     /locus_tag="CNI01690"
                     /db_xref="GeneID:3259740"
     mRNA            complement(join(475980..476168,476221..476362,
                     476420..476569,476615..476649))
                     /locus_tag="CNI01690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572805.1"
                     /db_xref="GeneID:3259740"
     CDS             complement(join(476109..476168,476221..476362,
                     476420..476569,476615..476634))
                     /locus_tag="CNI01690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572805.1"
                     /db_xref="GeneID:3259740"
                     /translation="MSHGFRQDMPPPGGYETLRYKRNLPLKGPSGAVLFGGVFAICTL
                     GFYRLGQGNVEKRELKREKAWSRINVVPLLLAEQDRDAYRRQQAALAREKEIMKDYPG
                     WEAGKRTYNSSRYTPNTIVVL"
     gene            476743..480999
                     /locus_tag="CNI01700"
                     /db_xref="GeneID:3259564"
     mRNA            join(476743..477246,477293..477481,477542..478017,
                     478064..478641,478699..480058,480117..480436,
                     480490..480572,480645..480999)
                     /locus_tag="CNI01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657807.1"
                     /db_xref="GeneID:3259564"
     CDS             join(477126..477246,477293..477481,477542..478017,
                     478064..478641,478699..480058,480117..480436,
                     480490..480572,480645..480907)
                     /locus_tag="CNI01700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513469.1"
                     /db_xref="GeneID:3259564"
                     /translation="MAAAATTARRGWGMSSATGTTRMNRMADGPDGKYAVGGGQFLRV
                     FQVSDPCSGSSTPIIQEDPKERTLLARGQGGATISEVVNLWKSNWPVGKGVNDVNWGV
                     AAWDHKLVTAAPNGNFMLFDVEKGRLENEISSGSFRPLNCAQFCHQPSYCHMVLIGGA
                     DGNIKLLDLRTGDPPSRRPLRHSSAITSLCFSPTDASSFVIGLDDGTIKRYDWRMAGK
                     HLGTVYGAHGSKAVMDLKWKLGDDSIGGAGAGWLASAGANKIVQIWDMNQSWEKAPTA
                     THSLHTAHPVRRIAWRPDHPTELLVIPLTQPLSSSNSLDPALPAPPPPTPPPPPHSLS
                     VSSASTNKFNISTTTPDETTMDDDSARLEIWHVRRHYIAKYAIPSQDGVAVDASWRGS
                     AGLVVTFQNGGFAQLDIPRKLNSGLLPLPLDQIPRQIAGWSAKGDLYFAIDKFRAGEV
                     PFDDLKPEYANHYERLGRPTHSLSDPPYIPLQTIGSLALPDTDPSEFAFLASWYRLEG
                     SIPADLCAWNRDVAKWCGREDDARLWGFVKGLFEEFMPLQEGMEATFVNDVWGRAGKA
                     LAATTTTTMTMTPPNVSPRGRHARLPPDDEREKRAHRILPTYAGIPLERITPPASPTS
                     NPSEISERTPDSDSGSDDEIYSDEQSESVKPRRSKFVSFIEPGTSSLGLDLSSAANRR
                     RSSFSSQEGSPVFEKTTKKKQQQQGETSPIAITNTNTNPSAGTISHPNSASKKSTLSK
                     IAFTPRQHSHPHPHQHQHHQHQLVSSSDWPDPYGIIPDQVLTSGTMTSTTATSGTSRA
                     STTTQSSPLPAFARNGTKNSPRAGTTGLAGHEIGSGVVEAPLAGRGSAEVGVGAVVPN
                     GNGPGGIASRVGSGQGKEMRGREEKFEKTEWEEYRKKRVATLMTWWDGCVENGEMQLA
                     TTIALIASPLVTFPPFQVERLAHAYVQLLEQHRLFMFAAYIRRFSGIPSLEITPQDEG
                     LTHTFFCERCGKSTGNLEDIEVKGKIFWWCKKCRTGAKSCAICRKIIKGLWMGCRQCG
                     HGGHQACMRLYHSQAPLIPVPSTNGSNPSHTPHALLNTSSSTYNQSAGSNFTTLSTTD
                     GANADPVEKVDGVEADGRFALCPTGCGCRCRRIGTANTAHD"
     gene            complement(480933..483533)
                     /locus_tag="CNI01730"
                     /db_xref="GeneID:3259729"
     mRNA            complement(join(480933..481973,482025..482571,
                     482619..483070,483119..483399,483447..483533))
                     /locus_tag="CNI01730"
                     /product="ribosome biogenesis-related protein, putative"
                     /transcript_id="XM_572803.2"
                     /db_xref="GeneID:3259729"
     CDS             complement(join(481029..481973,482025..482571,
                     482619..483070,483119..483399,483447..483453))
                     /locus_tag="CNI01730"
                     /codon_start=1
                     /product="ribosome biogenesis-related protein, putative"
                     /protein_id="XP_572803.1"
                     /db_xref="GeneID:3259729"
                     /translation="MQAQVPKSDKSSSSSGSEEDYSSDYSSSSEDVTEDEEGNELTPA
                     LDAAILRTLSKIKKKEGVYGGENVLQEELRKAQEIAEQRGLKSNIVKKVAEKPYLLAD
                     YHRSKLLAGEDQDEDSESAEPLTHVESQRRLRQEAVSAFKTLAEESDDESDEEFIQKR
                     EMDAQEVDEDDEEYKKFLLEFGGGEEEVRKILGMGDQPAILKVLESEGGEDEEEKAAV
                     SKIEKEELERQKQEKEAKKAKDDDDFLMNYILNRGWIDRSEKHVPTYDEVVGPSTEVA
                     EEAAAQTKSTKPKSSHPWGELDEESDFEDRAEEFETEYNFRFEEPGSSTIATHPRDIP
                     SLVRRADDTRKSKRARRAERKAAEKAAKEEEIKREKGKKRREMEKRMNILKHDLEKEG
                     FKDLEWGKLEKVLDGEWDENVWEKIVGGMLSKGDEQEDGDDNEKPTWDDELGDAEYDE
                     EEGEGDFQYEFAEGEGEGEDMDVDEDEGPINMDADFIDEEPSKKSKKKDKKKKNKNKE
                     HSPSPLPEDEENQLSIPEKAHALKEAVESYNALAHEDIIEDMPTRFKYTPSAPASFGL
                     TPVEILLATDDELNKLVTMKGIAPYRKGGIGIQGKGLGKRVRELKDKLRERRWGEEPS
                     QTKSREEKKEKKRKRDDGEERGQDERRGKKSEGEATEKSEKVRNGKRLGKKERMRLQK
                     AAEAAGAAPAAAGEPESAPAEKKRTVESGEMPADAPAANGEDGGDKKKRRKKKKSKAD
                     GEA"
     gene            483657..485287
                     /locus_tag="CNI01740"
                     /db_xref="GeneID:3259709"
     mRNA            join(483657..484821,484872..485287)
                     /locus_tag="CNI01740"
                     /product="trans-hexaprenyltranstransferase, putative"
                     /transcript_id="XM_572668.1"
                     /db_xref="GeneID:3259709"
     CDS             join(483709..484821,484872..485210)
                     /locus_tag="CNI01740"
                     /codon_start=1
                     /product="trans-hexaprenyltranstransferase, putative"
                     /protein_id="XP_572668.1"
                     /db_xref="GeneID:3259709"
                     /translation="MLRRPALPTRAFPKHRISSTFSFSTSQRRSSVSSSPAKQPESTW
                     AAATTEAHRVLTPPPATSASTVTSLDDPLSAINSEIGNLKSSLWRMLGSSNSALDTVA
                     KYYFQAEGKHLRPLLVLLMSQATNGLGGKGWDGAKREAIRRKVDDSLTAEGGVLNDWN
                     PEVSGPEPSSGLGSMVFASPFRIPEAGAPAIPEPEPLPSQFDELLGEGNGQPVILPTQ
                     RRLASITEMIHVASLLHDDVIDSSSLRRGTPSAPSTFGNKLSILSGDFLLGRASVALA
                     RLGSREVVELLATVIANLVEGEMMQLRATSEPEKAPTAKGFEDYMRKTYLKTASLMAK
                     SARAAVILGGCGSVSEEGAWVKDVAYGYGRNLGIAFQLIDDALDFLPPDSSLGKPSLG
                     ADLRLGLATAPALFAWETHPSMGPLILRKFTEPGDVEAARDLVARSDGLQRTIELARE
                     FAGEARRLVEMLPESGARDALVQLTVKVVERVK"
     gene            486184..489425
                     /locus_tag="CNI01750"
                     /db_xref="GeneID:3259737"
     mRNA            join(486184..486265,486360..487692,487785..488470,
                     488532..488554,488607..489089,489149..489425)
                     /locus_tag="CNI01750"
                     /product="expressed protein"
                     /transcript_id="XM_024657808.1"
                     /db_xref="GeneID:3259737"
     CDS             join(487407..487692,487785..488470,488532..488554,
                     488607..489089,489149..489275)
                     /locus_tag="CNI01750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513562.1"
                     /db_xref="GeneID:3259737"
                     /translation="MRIPLDVAHSVVRALHTIRSDSAQSGNVTQTSVQIPSNQPAWAE
                     PLSPNLAAFSIEMDRWPDWAGEKVGEPNKYVNQVLTNLGERTGVMPYLRVGANSEDRA
                     TIDLSYEVMNATFPAATEEVPVPEADHIFIGRDFYALSGNLPDGTPFQWGVNLGSLNR
                     TETIAQAKLIADTFQGDRANLTANVRLDGLEIGNEPDFYGTGKGLGAAWTPANYSQTW
                     LDYAQGVSEVIQLGGDGPYLTPGAMTGFSAPVWTPQASFEAGILDDDDIRSVVKQYNQ
                     HVYSGAFGYGYPLTPVGGLMDKVTARTNLTARANEIKSVKSEGLQYVFAEGNSYANHG
                     QPGTSNTAEAAIWAIDWMLQLASMGVERMHFHHGVGFRYNLFQPVATDADHDDGTNMT
                     SRAHILPAYHAALIVNEAIGTNGNSYVAEISTPNDNVVAYGIWEDGNLVRMVVTSTEV
                     YTTDDEDAQEGRNKFELNLVGVEGRNATVKRLFVPQTTAMHGLTWAGQSFDTEDGKPT
                     GEVSEETLDNGVLQIDASSAVLICFK"
     gene            490299..492510
                     /locus_tag="CNI01760"
                     /db_xref="GeneID:3259520"
     mRNA            join(490299..491353,491403..491822,491873..492069,
                     492124..492510)
                     /locus_tag="CNI01760"
                     /product="expressed protein"
                     /transcript_id="XM_572667.1"
                     /db_xref="GeneID:3259520"
     CDS             join(490558..491353,491403..491822,491873..492069,
                     492124..492204)
                     /locus_tag="CNI01760"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572667.1"
                     /db_xref="GeneID:3259520"
                     /translation="MLASIIAALPLLAFLPLSSAHAVSDGVALESRLWYERAAAALSS
                     EAEAAGVPSGFRSRAHTSGLRRRASRHHSEAGQKLVRRKKETTQKRDGEKKKKKRSCK
                     AKTTGLGAAATASSSSVSEEVSSSAATVSNSLGAVANAATAGISSQAESSAVSSSSSN
                     AAHVTNYAPTTTSSAAGSTITDSASAVADAWSPEISIGLSANASIDILTTYTVPDSAT
                     TAPTIAPSASASTTSSAANSSTSELSSELLPWGHGISSWTTSGGLLSYDAALKPLTAG
                     KLPDTGNAPDGTSALCANFPAGSYGLTNSGFSFYSSGAHSGVEVDSAREVALSYAVYF
                     EEGFGFNKGGKMPGLYGGTSLSEAKSCSGGRTTDRGSCFSARLMWRTDGAGEIYDYLP
                     VSYTGTDDGYGESIDRGAFTWATGRWQTVAMRVKLNDVGQANGEQELFVDGQSVINIS
                     GVTFATEEDTAIFGIMAQTFFGGHTSEWASPKDQNLYFKDWTLTVLA"
     gene            complement(492721..493804)
                     /locus_tag="CNI01770"
                     /db_xref="GeneID:3259407"
     mRNA            complement(join(492721..492870,492928..493040,
                     493106..493239,493322..493388,493561..493804))
                     /locus_tag="CNI01770"
                     /product="DNA-directed RNA polymerases I, II, and III
                     polypeptide, putative"
                     /transcript_id="XM_572666.2"
                     /db_xref="GeneID:3259407"
     CDS             complement(join(492821..492870,492928..493040,
                     493106..493239,493322..493388,493561..493643))
                     /locus_tag="CNI01770"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     polypeptide, putative"
                     /protein_id="XP_572666.1"
                     /db_xref="GeneID:3259407"
                     /translation="MSDDERMDTGDFEGGDYEQDYVDPDTLNYENEENAEEEAANGEV
                     DETMIIESGAPEGDRPRTGKAAKPNEIRVTTPYMTKYERARVLGTRALQISMNAPVLV
                     PVEGESDPLEIAIKELAAKKIPLVIRRYLPDNSFEDWKVEELIVQE"
     gene            493950..496107
                     /locus_tag="CNI01780"
                     /db_xref="GeneID:3259535"
     mRNA            join(493950..494225,494324..494474,494538..494728,
                     494778..495222,495274..496107)
                     /locus_tag="CNI01780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572822.2"
                     /db_xref="GeneID:3259535"
     CDS             join(494075..494225,494324..494474,494538..494728,
                     494778..495222,495274..495988)
                     /locus_tag="CNI01780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572822.1"
                     /db_xref="GeneID:3259535"
                     /translation="MQLGRYSVSTLLPPPIHSITFSPDGRFFAVAAEKGYEIWKTWPL
                     GLVRRRVLPGTLALAVILPHAPLLVLQAGGTAPLYAPNKIVIYNDKLGEVVAEVEFGE
                     RIRGVVARRGMICVALLRKVVGFEYGLGSDDAGKGKSKMMDSNSNGFWIKKIGEWETA
                     KNEQGLMAMATAPGSTLLTLPGRQPGHVQLVPLPPCPSSSSPGSPTRTSVTSQTTFRS
                     PIILAHTHPLSTLGISPSGSHIVTTSERGTLLRIWDTSRGRLERELRRGVDPAEMWGA
                     TFERDGKGARVAGWSDKGTIHVWESEENKTGQNGTRPATPSNASLTNILSRNLPLPKY
                     FSSITSTAQYRLPRKNPHAFSAALGAAGVPSMAMKEAVDLEGERGERFIVGWIEVDVA
                     VEDHKVDDKDRAKEDPKAQYRPSSNVSTMGSFPIGTREERMSFGSEGTSRTATPFQRV
                     ETPTPGGTKLGRGRGRMSGGPHVRLKGHSAQRTSSNTPSQKRTEKQMQLIAITYSGDW
                     YRLKIPEGAGRGEGSSGGEEGKTSAKCELVEYRRLAVGGGGW"
     gene            complement(496049..502788)
                     /locus_tag="CNI01790"
                     /db_xref="GeneID:3259411"
     mRNA            complement(join(496049..497370,497420..498004,
                     498064..498321,498375..498517,498571..499009,
                     499060..499321,499376..499852,499911..500699,
                     500758..501850,501906..502320,502366..502788))
                     /locus_tag="CNI01790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572847.2"
                     /db_xref="GeneID:3259411"
     CDS             complement(join(496137..497370,497420..498004,
                     498064..498321,498375..498517,498571..499009,
                     499060..499321,499376..499852,499911..500699,
                     500758..501850,501906..502320,502366..502736))
                     /locus_tag="CNI01790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572847.1"
                     /db_xref="GeneID:3259411"
                     /translation="MSSLAQQLQSIASLDAARLTSAYGAPSGKSYLFPPDVASSHDID
                     SIFDLAQSGFDELLSLDPEMEEFEEELFSESAKRTDRMVLSKEENDNLDRTLGRCLRR
                     LGKWIRLMAGGKCIEWMVRRFRVHEMNVDEVLRSFLPYHESPNFPRILAIVTIPKTSP
                     YYATFAPLVKNAQPIPRSYIVTSISPAKDKSLVLLGDIASMVQQAVKEGVVHHALLTF
                     WTATMVDLLEGARHGKGANEGVVKQLVESFVTLLETPKAGEDVNAAVYPPLVLLTRTV
                     PLADEPFLAIVSSLLTPGTGSNPSQRMLTLLVILNDRHTWSLGLGEHATENLAKVSQL
                     GEILVAAMDKYRFEKALNIVVKSMLEKPDLHAKALATVLEHESLPTSVTELASTNLLQ
                     LGSSTDSQEVKAACKSLLTNLRERHPSIVDTAFLQASASLEIDTHPVDHGLVQKPSGE
                     VAFLDVYAADISSRVTGVKSVIDMAKKGEEIESSITALEARLSDVDENVVNALYEEPK
                     SLLEILPVEKYIAGVKPVFWAVSPISHIIGLHLDFISQHLLVSHPEAGKQIYESLLFP
                     IFLSTEKRQPLTKSQALKLLNGGFKKLDKLSTIGPEIGKAREEGMKGAQKGNLVIAKA
                     LAGATLSSSTFEDDISFLIAQLDSTTSSARLLAYLILHSLVLTLRGPRQLSTSLSILK
                     YLSPRLTGHSLRDLKHADENVNTEYMESVYKKPEETRTTLRAIVSILAAMGKVIKPIG
                     QIVWLSGESKAKDASYKTFAQQIYLWANIAILPANVAHFLLRSLLTQLGEEALLFFSS
                     IWTSSTSPVPLRISALKHALAFIHAYATLPTSPAAQGQPVDFQVVLPQILIALQDSDK
                     DVRRVAVDVLRSVEGGEGMGDVYALDTIYGDRSEMTQLLKSVDRKKYIETLLEVAEEF
                     VIDRLRLKAFHTEVLNMQSGKNRKESAHRRAIIGFLMSHVASYRAIDPRLVLLSLLSD
                     VHDTSILRSAIPLLASLFDDKSEESLWLSSLPDGQQALYVQALMGSLRVQSVSVLGEA
                     GGEGWEFLLNLLDASKSSRFIARLRILSFKAMVGGVFSALEAHQQIEYIIALIQCIHA
                     LPTDDALDAVKVLEKLDIQPRVLIELIEHLSDPLETSVNRKRQRQDAADEDRPTQAVH
                     ELITFVDSRNWPSIPASAPLVASLMSILSALLAKRLIVKEGIDYLEQEVFGAILALVE
                     RITDAQEIQRAHVGIEVVIKVIRASTNPRTAQRALLVASELARLIPDAVLHNVMPIFT
                     FMGASDFQRDDAYTFGVVEKTVSRIVPVMTQSLKEKAQNSLELYTKSLTFLSIFTDMA
                     GRLPRHRTLPFFVHLVKSLGASDYLAPVCMLLVDRATTKAGRNKESVSTALELPANLV
                     AAFDVSVKTQVLGEIVQELARLIGDLSKADKEAFLSQTISENDATDRPLRQVTYLLSF
                     LSSILGQLRGKACSQALVQSAVRQLIVLAASTSQPVMATTDIPSNLHKTLASTMLLLS
                     ADNFLGVTAELLSDGSEQDIIMSLGVFAERLPLIKSEVRLRCTKVIAEILKRIGDLLA
                     ASGATVNAALEAVKSVTKTAIAQEDGALASVLPTVVGCIGKVKDSAVIVAALSLVELL
                     VRRLAARTIPFIQSILDTSLNLIKSTKLAATATNQAFVTLSSVIETIPTFISSKQLNA
                     ILITTIDYRRVEETNSASLFTTLAKKIRTKSLFPVLIEAWKTVQEKGGDNEMKGFFEM
                     LRLTLKNAAREDLPSMLKPVFAFFLDVFDLRHRLQLKGVDTRVVNDVEESAIGSFLEL
                     VTKLNEPTFKPLFIRLYDWAVIDLAEGKNADDGRLTERKIVLLHVMMGLLTKFKNLLS
                     PYMGILFPHIQELLPAFASGSVRSEPLWTLLLNVLGKSFEVDSGAFWTDALEIELLPQ
                     LVAQVPLFLPIAPSPQSPRPISSCLANLAGSTTAENVLRRLNTAVCLATRSDDPKVRL
                     AALDALSAIWDAQAEEMVGLVPETVSEFLAELLEDESKDVEIAARGVLAKIEKVTGSL
                     KEYLE"
     gene            complement(502875..505035)
                     /locus_tag="CNI01810"
                     /db_xref="GeneID:3259514"
     mRNA            complement(join(502875..503009,503098..503202,
                     503251..503701,503752..504020,504074..505035))
                     /locus_tag="CNI01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657810.1"
                     /db_xref="GeneID:3259514"
     gene            502955..503540
                     /locus_tag="CNI01800"
                     /db_xref="GeneID:3259478"
     mRNA            join(502955..503083,503134..503161,503217..503340,
                     503392..503540)
                     /locus_tag="CNI01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657809.1"
                     /db_xref="GeneID:3259478"
     CDS             join(502985..503083,503134..503161,503217..503340,
                     503392..503503)
                     /locus_tag="CNI01800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513468.1"
                     /db_xref="GeneID:3259478"
                     /translation="MSEGTITNSVEGEETKPQEEPGFVSLLVKSVFEPGVNPAVVMAM
                     NGCFFLLILTLFALAFLTQWNKHVLLLLAVTLLLWGSMAWFVLELTRVQSRPNNMPPP
                     IDLDSLKDSPADESKKEQ"
     CDS             complement(join(503559..503701,503752..504020,
                     504074..504960))
                     /locus_tag="CNI01810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513467.1"
                     /db_xref="GeneID:3259514"
                     /translation="MSKRAAPSSMPDQKRTRFATSHTTHSISPSGTPASLEEDDAYLN
                     DDFESNAAATRQKARRGLRDAGGYASDSSGDEEGVVPSRRPGARGDDEDDVDMFADDV
                     DESKGKDKEKPKEKEFMSLEDIEGQEFDKPSQAKDYSDSETEEVKTGLDGDMGIDITP
                     FNMKDELAEGRFTAGGETYVANEEDPNDKYDVWLSDVDKEEIKKARRAHREQQRLEEE
                     RQAKEAGGGEEKEKKEKELLQAALRLMERGETVLEALQRLGKQVEDERKKREAGSKKK
                     SWAERQKERKVLMAAQEEQTDSIHTSNPFTNLSNIVSGLTTIGHLDVYSLSRESIQRM
                     LPAPADGAHNPPRAAPPPQPISDNRQFQYRFSMAYVKNLPEGQRPVEREVFGPFSLLQ
                     LRGWRSTGFFGPSSENVELRLVPDGGEPGQWGSWTEVIGQ"
     gene            505207..506550
                     /locus_tag="CNI01820"
                     /db_xref="GeneID:3259370"
     mRNA            join(505207..505795,505844..506550)
                     /locus_tag="CNI01820"
                     /product="expressed protein"
                     /transcript_id="XM_572824.2"
                     /db_xref="GeneID:3259370"
     CDS             join(505264..505795,505844..506436)
                     /locus_tag="CNI01820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572824.1"
                     /db_xref="GeneID:3259370"
                     /translation="MPKLKAALASQQHSVAKLAARKRAQAAEDAKRASIKASVDGVKK
                     GKKRAKAAASKMANEAKSEGLEQITKSKAKKKPPTIPFDKQDTILLLGEANFSFSLSL
                     LREPHNLPAHQILATVYDSERTTLEKYPDAAENIRLLKEEGVRVEFGVDAGALEKCKA
                     VGKGRRWSRVIFNFPHVGAGITDQDRNILTNQHMLLKFFRSVEPLLTEGPTHIPIPQS
                     SSSKSNSKDKQKRKQKKPSSDDEAAPEPEDEEEDFFFNDDPTFTNPKIVVPKEFTPPK
                     RAGTVLITILSCPPYTLWCLPQLAARPPPICPGTNLPQPRYTLLRSFEFRPEIYEGYA
                     HRRTIGWKEGLSKSENEEILGRKGMPRTYEFVRTTNTKGD"
     gene            complement(506551..507251)
                     /locus_tag="CNI01825"
                     /db_xref="GeneID:36393036"
     mRNA            complement(join(506551..506777,506828..506967,
                     507066..507113,507160..507251))
                     /locus_tag="CNI01825"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658735.1"
                     /db_xref="GeneID:36393036"
     CDS             complement(join(506736..506777,506828..506967,
                     507066..507113,507160..507199))
                     /locus_tag="CNI01825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514406.1"
                     /db_xref="GeneID:36393036"
                     /translation="MPVNIRPVVSQGLASCCTVFSVFGIIILVALGSLFSRRVEVLTG
                     SVNDPVDPDLVASTCYAAAVIYAIFVAFCGVQMAVHKRYPRGVQL"
     gene            507400..511240
                     /locus_tag="CNI01830"
                     /db_xref="GeneID:3259569"
     mRNA            join(507400..507672,507728..508063,508122..508525,
                     508574..508811,508857..509780,509831..510037,
                     510086..510628,510679..511240)
                     /locus_tag="CNI01830"
                     /product="ribosome biogenesis protein, putative"
                     /transcript_id="XM_572826.2"
                     /db_xref="GeneID:3259569"
     CDS             join(507448..507672,507728..508063,508122..508525,
                     508574..508811,508857..509780,509831..510037,
                     510086..510628,510679..511173)
                     /locus_tag="CNI01830"
                     /codon_start=1
                     /product="ribosome biogenesis protein, putative"
                     /protein_id="XP_572826.1"
                     /db_xref="GeneID:3259569"
                     /translation="MPKRGSKSTKLQKGLVNKQAALPEEQLKERKNISDALRQAVIDL
                     GGDEEDLDLIDGVDDDDEAPTQKKAEKSTDDKTLKKELGDFMKGLDFGSVEVAAVESS
                     EEVDEESDEEDEDSGGSGEEEGASEEDEEGEEEAEKDDDDEEESEGEVILKAGVPAKE
                     NAPSNPTKETSKTDSTASKDVDKSSGTNVPASTSWPSLVPPLPPVASLPKLHPHDLNN
                     LRQKASNLLANLPPLSRASSSSDQAFISQILQSGTHQDKLSALVLIVRESPVHAIKEL
                     DKLRGMAGWKEDGVGGGGNKDQRVAVMKALADWWVGGGGKEQGKLKYFTDQPLLAHPQ
                     LTDRHLLMYAFEDYLKKWFFNMLQVLEVLSHDTLPFIRTQALHIIFRLLAGNAEQEQN
                     LLRLGVNKLGDIDRPVASKASHHILTLLQAHPAMKAVVAREVSALVLRPSGAVGSAAP
                     STHIKFDNDKGKKAAHAGKAEAVGHGRYYGLITLNQMTLTRKDQDVAGRLVDLYFEVF
                     REILGDPNGLEEEEGQAENNEEVGEDKVQKVAGKVEKWRGRRKGAKPKGGRKSALEEE
                     ELIETTKAKLVAAILTGINRALPFAKLDETMFSSYMDTLFKITHAGTFNTSIQALLLI
                     FKVSTTESDFRQTVSDRFYRALYDSLFDNRLVTSSKQAMYLNLLFRAMKADDSIQRTM
                     AFVKRLLQMLGMHQPPFICGALYLLGELFSTTPGLKRMLIEPEDDGEEHFVDADADEQ
                     ENGGSAEKPARTVIGKDYDGKKRDPRYSNADSSCLWELTPFLNHFHPSVSLQANQLLH
                     SQNLTGSPDISLNTLISFLDRFVYRNPKKTIQPKGASIMQPAAASDKSGMVVKGEGEA
                     GVMVNSEAFWRKKIEDVPVEMMFFHQYFAEKLKRKEKRGKDKEKSTKGSDFGESESEG
                     EEEEDEEMEDSNEDNSGSENEDEDADPDVAEDDEDSDPEEAEIWKAMKATMPRANDDM
                     GLSEDEDDDISISGSSDDHEESDEDEEEEDEAEGASGGDEEDEESDQEPAPAATKSKK
                     RAARSPSPASSASSFPDFADEDEDVISLSDVDMPDIVLDGKASDVEDEAEIGDKRKKR
                     GEERKERRKKRRELPTFGSYEDYKALIEQAGSEED"
     gene            511851..511947
                     /locus_tag="CNI01840"
                     /db_xref="GeneID:3259798"
     tRNA            511851..511947
                     /locus_tag="CNI01840"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:3259798"
     gene            complement(512247..515406)
                     /locus_tag="CNI01850"
                     /db_xref="GeneID:3259592"
     mRNA            complement(join(512247..512478,512537..512625,
                     512676..512723,512777..513725,513775..514149,
                     514197..514450,514505..514741,514789..514806,
                     514865..515406))
                     /locus_tag="CNI01850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657811.1"
                     /db_xref="GeneID:3259592"
     CDS             complement(join(512306..512478,512537..512625,
                     512676..512723,512777..513725,513775..514149,
                     514197..514450,514505..514741,514789..514806,
                     514865..515187))
                     /locus_tag="CNI01850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513526.1"
                     /db_xref="GeneID:3259592"
                     /translation="MAPKPAKTSSKTAKLPTPAATPTRQPSVDTLSKPAVVDTPPTPA
                     SPAQVSAPVPPKKFAYPIPSRLSPSTINNTESLLRFIILALICGAAIGSRLFAVIRFE
                     SVIHEFDPWFNYRASKVLVNKGFYEFWNWFDPSAWYPLGRTVGTTLYPGLMVTSGLIW
                     HALRAINMPVDIRNVCVLLAPGFSGLTAWATYLFTTEMSTPSAGLLAAAFIGIVPGYI
                     SRSVAGSYDNEAIAIFLLMSSFYSWIKAVKTGSSFWGMITALFYGWMVAAWGGYVFIT
                     NMIPLHAFVLIVMGRFNNRLYTAYSSWYVIGTIASMQVPFVEFLPIRTSEHMAALGVF
                     GLVQLIGFVEVVRRLVPGKQFQLLLKAFVVAVFCLSFAALVTLTFSGWIAPFAGRFYS
                     LWDTGYAKVHMPIIASVSEHQPTAWPSFYFDLEMLIFFFPAGVFWCFKELRDEQIFII
                     IYAVLSAYFAGVMVRLMLVITPVVCVSSAIAFSKLLEAYIDPVIPESDEEAGESQTQV
                     VSKSKAKKMAAANANKSGFSFTGILSGKSVSGIFGLDTRFAVVSILSVFLFIFVLHCT
                     YVTSTAYSSPSVVLASRNPDGSQNIIDDFREAYYWIRQNTAEDSVIMSWWDYGYQIAG
                     MADRPTLVDNNTWNNTHIATVGKAMASNEDVAYPILRKHDVDYVLVIFGGLLGYSGDD
                     INKFLWMVRISQGEWPDEVQEVNYFTQRGEYAVDDRATPTMKNSLMYKMSYYRFPELY
                     GGHPAQDRVRGQIIPPNSVTLDTLDEAFTSENWIVRIYKVKKEDPIGRDHKAVTAWNG
                     GKKLKKSPSASEGVKRGSGRPSM"
     gene            complement(515708..515804)
                     /locus_tag="CNI01860"
                     /db_xref="GeneID:3259799"
     tRNA            complement(515708..515804)
                     /locus_tag="CNI01860"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:3259799"
     gene            complement(516100..519254)
                     /locus_tag="CNI01870"
                     /db_xref="GeneID:3259382"
     mRNA            complement(join(516100..516702,516754..517015,
                     517075..517651,517713..519254))
                     /locus_tag="CNI01870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573000.2"
                     /db_xref="GeneID:3259382"
     CDS             complement(join(516210..516702,516754..517015,
                     517075..517651,517713..518903))
                     /locus_tag="CNI01870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_573000.1"
                     /db_xref="GeneID:3259382"
                     /translation="MAPRDSSRFSFKSRFSLLSLLPARHPPLFVDPPRMPPTHPGPRH
                     ETIISDTVSPVHSEYPDLGTPFPPCRKKSYDRSPLGWGHGEEGEPVEEKKRRAKRPPP
                     LNLERTHMMYPPSSVDVVIDPGTPFNLDSPPPQKQVPSLPKKIKPRKKRQLVEDPFEV
                     AEVEIGHRYPSWKDGKADIRPGQVIPPGLMPSLVDLDVKPKPNRRGTAVDTPDNYESV
                     LHNVLLTPTYIVPSPQVNSTPTPSPYDPSEFIEKYDRPRTLLDRATDTISNAAKRTSK
                     WMPGKSILRNGSSGDDGATNKSLRALKERELQEMARFRQNARPGVRLAVPGEAAYSSG
                     SSPAREMSNIYSRKSPGWLGSRERIIGYDGDGKYPVVVGSSNNGWRAGKRDEEHAKRN
                     KRIWKITIIVAILFLTALTIGLCTSLLRKSSSSSLDTSSSSDAASADNSSGSATVTSS
                     AASASSTSSQTLSTCLNLFTSSAPTSPASYPCSDCVQVLQSTTNDFSEPMVNGNSTGV
                     GSALQFCAMMDIYSQIENTSQLSKWGEDASPCGWDGIGCDSRGRITSLSLQYPNVPTA
                     LPDTLGNVYALKALHLLGNSSVPTGDFPSSLLSLPYFQTLDLEYTAITGRIDTAPFNS
                     ATGLVTLMLVSNSQLGTSMPDLSSNTKLVTAAVTGQGLTDAEADKLPSSLTYLDLSYN
                     SLSGQVPSFSQLASLKTLYLQNNDFTSAPDSIPSSLTTMSFTSNYRLSGTMPSSVCSS
                     TVLTSCDLRSTNLTAGTTSSSSRSSSSTSLSFVAASSTITSIASTSSSSVKVSGSSMS
                     SASSSSGSNSAARDTNVTSSTMIGVSARASTEEGTCGVCQFN"
     gene            complement(519496..521881)
                     /locus_tag="CNI01880"
                     /db_xref="GeneID:3259615"
     mRNA            complement(join(519496..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521523,521675..521881))
                     /locus_tag="CNI01880"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_572663.1"
                     /db_xref="GeneID:3259615"
     mRNA            complement(join(519496..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521845))
                     /locus_tag="CNI01880"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_572662.1"
                     /db_xref="GeneID:3259615"
     CDS             complement(join(519542..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521689))
                     /locus_tag="CNI01880"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_572662.1"
                     /db_xref="GeneID:3259615"
                     /translation="MKNKNVRIPNLLDLVKICSFLTDISFIGCPVVALPPILPLHPTP
                     VIFIYNLRTKTEEQNMSNQNDGWGETATETSAPAPPPASAPVSSSNNDGWGEPAPSAP
                     ADNGWADAGASNGGSGANNNDGWFDAPVPPSSQPPKKEASDIQLQDDTEGLITNTFQV
                     EVKLADLQGDPNSPLYSVQSFKELNLHEDLMKGIIAAGFQKPSKIQEKALPLLLSNPP
                     RNLIGQSQSGTGKTAAFTLNMLSRVDPTIPTPQAICIAPSRELARQIQEVIDQIGQFT
                     QVGTFLAIPGSWSRNSRIDKQILIGTPGTLVDMLMRGSRILDPRMIRVLVLDEADELI
                     AQQGLGEQTFRIKQLLPPNVQNVLFSATFNDDVQEFADRFAPEANKIFLRKEDITVDA
                     IRQLYLECDSEDQKYEALSALYDCLVIGQSIVFCKRKVTADHIAERLISEGHAVASLH
                     GDKLSQERDAILDGFRNGETKVLITTNVIARGIDIPAVNMVVNYDVPDLGPGGNGPDI
                     ETYIHRIGRTGRFGRKGCSVIFTHDYRSKSDVERIMNTLGKPMKKIDARSTTDIEQLE
                     KALKLAMKGPA"
     CDS             complement(join(519542..519729,519784..520048,
                     520096..520333,520385..520674,520733..520835,
                     520885..520977,521032..521105,521156..521442,
                     521494..521512))
                     /locus_tag="CNI01880"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_572663.2"
                     /db_xref="GeneID:3259615"
                     /translation="MSNQNDGWGETATETSAPAPPPASAPVSSSNNDGWGEPAPSAPA
                     DNGWADAGASNGGSGANNNDGWFDAPVPPSSQPPKKEASDIQLQDDTEGLITNTFQVE
                     VKLADLQGDPNSPLYSVQSFKELNLHEDLMKGIIAAGFQKPSKIQEKALPLLLSNPPR
                     NLIGQSQSGTGKTAAFTLNMLSRVDPTIPTPQAICIAPSRELARQIQEVIDQIGQFTQ
                     VGTFLAIPGSWSRNSRIDKQILIGTPGTLVDMLMRGSRILDPRMIRVLVLDEADELIA
                     QQGLGEQTFRIKQLLPPNVQNVLFSATFNDDVQEFADRFAPEANKIFLRKEDITVDAI
                     RQLYLECDSEDQKYEALSALYDCLVIGQSIVFCKRKVTADHIAERLISEGHAVASLHG
                     DKLSQERDAILDGFRNGETKVLITTNVIARGIDIPAVNMVVNYDVPDLGPGGNGPDIE
                     TYIHRIGRTGRFGRKGCSVIFTHDYRSKSDVERIMNTLGKPMKKIDARSTTDIEQLEK
                     ALKLAMKGPA"
     gene            522165..525607
                     /locus_tag="CNI01890"
                     /db_xref="GeneID:3259536"
     mRNA            join(522165..522420,522481..523157,523205..525607)
                     /locus_tag="CNI01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_572973.2"
                     /db_xref="GeneID:3259536"
     CDS             join(522356..522420,522481..523157,523205..525456)
                     /locus_tag="CNI01890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572973.1"
                     /db_xref="GeneID:3259536"
                     /translation="MDVLRPGHAHRSSSDRLLNNYLDSQKSLSTSLFTLLSHSHSSTS
                     SLLAYVTSSPGVLLSVRRAVRHAAFEGPLSSSMTERGDHFPEHDSEGGWAAYISSLEQ
                     FRKDLKQIHLLEEELSRVKRDREILVGRLIKATKGRPTKSDLSALASTYSSHALHDAP
                     QSSRASVLSDNSSVTSKEGKRAGKLADAQAELLGCEEHLRGLEVRIENERNRVMSRGL
                     EERFRSMEVVGRMWVQQAKRGLEDLDKMHDLPPDAFELDSNGSLAPSQSASQIIPYDD
                     RPPSRSDVPYPRHMQHEVAGSITGSIAEEDEDGSSSEEDPNQFVVHENRPGSQLSPRL
                     PPKGRATPGPKSPSLGVPSVNSRARPLSNVESPGRGGRRAASDIGTGAYRPPSSRALR
                     RTISHDEPSPRRAGSDTSSIREHRPKKKGFFASIGRLFKSKKHGSDRSSSPPYGSSRG
                     GWQTRTDSNVKRANAFGGARGGDESSSDEDNGNLVSVSNNRNSTWTVDPTRSSGSHIK
                     RSSTMPVANGLIPPKPTRSTSQSTITAKSKPKTTGASNVSRSNTVKSSVSEATTVKSG
                     GTVKKKTRPNGSIARAKSPTSVNGHGQGAGVAGRNIMTLVDTSNPPVMPEVPKAPKSQ
                     VNPEMEGIKAPGSSIVTADTPLPPIKHTPSAATSVGAPALGRSVSSKSAKKKEQVKPK
                     SSPPYRPTTPLPPSRTLSPPVKSAMRPTSPQPSSPLAPKLDLPTTPMYTISAPAPISL
                     EEVKKEQEREKEEQERERERKREQEKEEQKSRDAKRSSFVSLQSDGASIYESAMEDGD
                     EGYGPETDSSDDEEDAANYKMVKNDKVIRRGEMATGDPNYMKDDEEDEGSQVTIGARS
                     EPTAIAAAPPTLGAPASAIPRRRKSVRMAVPDSPSTESHPQVHVPQAPRPIAVSTEER
                     PRSRTPSPEPERVEQAWSTRIGRMREDTSEDEDEQDDYVRARKGLIKTNKWDAVNAAK
                     EKTKGLKKKGSVKSKGSVKSKASRA"
     gene            525886..527970
                     /locus_tag="CNI01900"
                     /db_xref="GeneID:3259675"
     mRNA            join(525886..526275,526324..526535,526592..526734,
                     526789..526899,526948..527184,527236..527709,
                     527756..527970)
                     /locus_tag="CNI01900"
                     /product="tRNA (guanine) methyltransferase, putative"
                     /transcript_id="XM_572991.2"
                     /db_xref="GeneID:3259675"
     CDS             join(525968..526275,526324..526535,526592..526734,
                     526789..526899,526948..527184,527236..527709,
                     527756..527902)
                     /locus_tag="CNI01900"
                     /codon_start=1
                     /product="tRNA (guanine) methyltransferase, putative"
                     /protein_id="XP_572991.1"
                     /db_xref="GeneID:3259675"
                     /translation="MLKSLCFVIRPAIVSRPQFRLPTIARLSLRQFQNQPQSVGFFTM
                     APLETRALALSPSATICPPSRIGTTELDRSAFDLDVQILSAVVEPGMIGKLRSHPSLK
                     DLVLDLPKTKPIVECPAGLAPVAARDVKGLKLLRFHLSKESELPEEAKEVLKGAKALV
                     KEVVRLGYDNWNASEILGACLPTTKSEDIPSSFTTTGHIGHMNLREEWLPFRYLIGQV
                     VLDKNPGLRTIVNKLDTIHAQFRYFDMEVIAGDNDYIATVNESGCSFTFNFSNVYWNS
                     RLHHEHERLISLFPPGCVIADVMAGVGPFAIPAAKKGCYVLGNDLNPESVKWMRENRL
                     RNKVEPTLRVSEIDGFEFIRIAPLEVWTRPFDPAPPPKVSNRQRDREAKEARRKREQA
                     KAAGQPVTETAPMSIPSQEVAIKPHPPQPPKLISHFIMNLPDSAITFLPSYVSCYTPL
                     LAERSFIDEYGGEEEAKRKVEMPMVHCYCFTKEIEIGKAEIDILQRASTNLSFNLTPQ
                     VENYNLHHVRSVAPNKDMYCLSFRLPREVAFRHNG"
     gene            complement(527940..531994)
                     /locus_tag="CNI01910"
                     /db_xref="GeneID:3259444"
     mRNA            complement(join(527940..528244,528296..529095,
                     529148..529237,529293..529452,529503..529569,
                     529619..530178,530233..530314,530363..531137,
                     531206..531275,531324..531335,531383..531994))
                     /locus_tag="CNI01910"
                     /product="prib protein, putative"
                     /transcript_id="XM_024657812.1"
                     /db_xref="GeneID:3259444"
     CDS             complement(join(528163..528244,528296..529095,
                     529148..529237,529293..529452,529503..529569,
                     529619..530178,530233..530314,530363..531137,
                     531206..531275,531324..531335,531383..531843))
                     /locus_tag="CNI01910"
                     /codon_start=1
                     /product="prib protein, putative"
                     /protein_id="XP_024513565.1"
                     /db_xref="GeneID:3259444"
                     /translation="MKRAWDGSSSNSFPNGDSAQQSTNSEQVWVQMPSHPYAAAYSSM
                     ANPFTPSPLHSSTTFDAQTLNSASVNASGSGRQEKRPRTAGSDGKKNSPQGQTKDGDS
                     EGEGDDDDDDDDDENDDESGGNKSASNKKNNNMKMVKGPDGKPKTKLTRGSRACVACR
                     KIKMRCIPDDSAAGQGNGICKRCKAGGHECIFEESNRGKRSSRKNEAMAAKLSKMEAA
                     LKNIGVALSNIDQSSLESFSSALHSSTDDPDVIGLITSHAPVTPNLAVAMNRGSFSSS
                     FGDRAHDMSHEGGHTAQPPLSPRLHSLPDNVLSPLGLLAEASLQNDASKRNFTKGFGT
                     ANGLGKSLARPFSGDRLPEHRNGNVSMNGAATFRMATSDVRGGQVEDDEHFDVDHGLG
                     VSGQNYFKPGASVAFLPPMPADHRVPELLTILTRDEIGELFDIFFDHMSFHVPLVYKE
                     FHTPDLVLQRSQFLCTVICAIAARFYHKKPELHHSLSAYAKRLAFEVPSRGYKSVEVV
                     QAYLLLSLWTLGPEKTFEQDRTWLMLGMAIRMATDLNLHRKSIMSNLDTEEGRARDLE
                     IINRERCWLHCFVLDRSLSAQMGKPYSLREDYIIRNACESVWHQQKFSLPSDAALSAY
                     VMLQQIMSRAIDSIYSSTSTVSGLRHDCDYMLIVRSAHEELRRWLGDAKNNKLSTSEA
                     SREFDSRANFYFAYSSLVLYSFGLENALERAKMDISFFLTNVYEAATKVCMVVKEEFL
                     PKGWLPYLPDTNFVMCSYALLSLLKLLKPELRPYHDSEESIFNLVTEVADILEDCAAD
                     PSHQPAIYAAFIREIVRKTKDMRHGGTTTAPASPGSHTIAGHMHGIVPGEAATLGMVG
                     SARAASDASAASARTDTETNTSAANATVDGAQGAQNGVYDPSLMGQNATNWHPDVLPH
                     ETQFTFIPQGGDMLILPSQAGPSIAPSPTSAFLANPSGTNINAGNASGAAGTSGSHFG
                     TPSGSNGWAEYLPTFMSSDGFDGWDGSMLLPGFGKGQITLSGGLLHSQYGSGIITPLH
                     QTPIQSRMGSRAGSRTQSPHPH"
     gene            532189..534994
                     /locus_tag="CNI01920"
                     /db_xref="GeneID:3259732"
     mRNA            join(532189..532258,532324..532977,533031..533217,
                     533265..533523,533571..533745,533798..534587,
                     534638..534994)
                     /locus_tag="CNI01920"
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /transcript_id="XM_024657813.1"
                     /db_xref="GeneID:3259732"
     CDS             join(532404..532977,533031..533217,533265..533523,
                     533571..533745,533798..534587,534638..534857)
                     /locus_tag="CNI01920"
                     /codon_start=1
                     /product="ATP-binding cassette (ABC) transporter,
                     putative"
                     /protein_id="XP_024513466.1"
                     /db_xref="GeneID:3259732"
                     /translation="MSFGSCSRHALFTPGALPGSFRTMTTSCVKRVYTAQIRGGDALG
                     KRLPSVSSFPGQLPRHGSHFQSLAFFSTSRRRQTPPPPSPPTTSQSPTVPSKASTTPP
                     TSLNTSKPVATESQDKTDWSIIAKLAGNIWPKNNPNVKFRVIGALTLLVAGKVLNVQV
                     PFFFKTIVDSLNVPITESTTVWVLAGASIAGYGAARVLTTLFGELRNAVFASVAQNAI
                     RKVARETFEHLLNMDMKFHLERQTGGLTRAIDRGTKGISFILSSIVFHVIPTALEISM
                     VCGILSWKFGWDFAAVTAITMLLYTWFTIKTTAWRTTFRKQANAADNKGATVAVDSLI
                     NYEAVKSFNNEKYEVAQYDTTLKAYEKASVKIATSLAALNSGQNFIFSSALTMMMLLG
                     AQGIVKGTMTVGDLVLVNQLVFQLSLPLNFLGTVYRELRQSLIDMDVMFNLQSLDSAT
                     KDSPTAKPLHLKGGEIEFRNVAFAYHPERPIFRDLSFKIPAGQKVAIVGPSGCGKSTV
                     FRLLFRFYDSSSGQILIDGQDIKTVTLDSLRRSIGVVPQDTPLFHADILHNIRYGNLE
                     ATDEQVYEAARKAHVEGTIQRLPEKYATKVGERGLMISGGEKQRLAVARVLLKDPPVL
                     FFDEATSALDVYTETELMRNINSILTGQGKTSVFIAHRLRTISDADLIIVLQDGYVAE
                     QGTHEQLLAMPGGVYHGLWQAQLTESTQPTEEEIERQREELEVVDEKKKQQT"
     gene            complement(534872..536097)
                     /locus_tag="CNI01930"
                     /db_xref="GeneID:3259453"
     mRNA            complement(join(534872..535123,535176..535266,
                     535403..535626,535722..536097))
                     /locus_tag="CNI01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_572998.2"
                     /db_xref="GeneID:3259453"
     CDS             complement(join(535025..535123,535176..535266,
                     535403..535626,535722..535844))
                     /locus_tag="CNI01930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572998.1"
                     /db_xref="GeneID:3259453"
                     /translation="MAARSILALSLAAAVAQAIQITAPSNSSGWDTHGSQLIKWTSVS
                     TDPQNFTIAISKPNSSSRTDVVTTAVNTTDDSYIYMPSSDLKPGDGYRISFTSSDGGI
                     LAQSDEFSITDGTSTVSATASANSSTRTSSGVTVSLVDVSHTSKAASATQSSGAEQLT
                     TVTSGLLMLAGGALAMLA"
     gene            complement(536252..539196)
                     /locus_tag="CNI01940"
                     /db_xref="GeneID:3259746"
     mRNA            complement(join(536252..536395,536444..537114,
                     537165..539196))
                     /locus_tag="CNI01940"
                     /product="karyogamy-related protein, putative"
                     /transcript_id="XM_024657814.1"
                     /db_xref="GeneID:3259746"
     CDS             complement(join(536329..536395,536444..537114,
                     537165..539117))
                     /locus_tag="CNI01940"
                     /codon_start=1
                     /product="karyogamy-related protein, putative"
                     /protein_id="XP_024513465.1"
                     /db_xref="GeneID:3259746"
                     /translation="MADPTQWSLLRGGPIPADIQATSPRIKELATRLAEADFKFVLLS
                     SESRAALSSASNLFDGLDVAGPSSESSTNVDPIIKLITAIALLHSFVQINWTGPDLPF
                     TPLDVLDASSSSIEDLNAASLPFLTLHGEPAYHLSQHSVFFLLARRLFLSLEADSSAL
                     PTLPLWLLRLHLVHLSLLDEPVSQPETLLDSIKTLLDNPVVQSDQDLIAQIHLELGLL
                     HYSLGTDKHANQEFLTAAKAGGLEFELTGALGKKTKYQVAAHSQLVLLAESRKRDGED
                     DKVEKESAAEEKAALPESLLLNDDTLLEETEFTKVTRDTSSTSRLAHLDPSDQPALHP
                     LDQSLLISFCLAQSNNTPSSGLTAQQMMPFLSRVISHPRNWSVHTTALLLRSRLEATR
                     SRTVERSTLQLQALIEQMPTSDSEPKERLRYFHQLPLPSKWEMERELAKRFMSVGVIR
                     SALEIFTRLEMWEDAIMCMQKMDKEEEAIGIVKDLLAGKKVESDLVPTLGRANVSESR
                     KQKLTAAREGKLWCLLGDLCLGTEAAQRDPSSARETAVEHYEKGWEVSEHTSSRAMRS
                     LGSLYMGTQEYEKAIPCFHSALEINPLYARVWFTLGVACLRLEKWKDARDAFRKQVGV
                     DEDDAEGWNNLAAVYLRLEEEGLPKDQLPPPVSYENKILAFRALRQGLRYAYTNWRMW
                     QNYMIVAVDVGELSEAARAMTRVVEELANRDPEHAIDVDVLDKLVDSVTRDDFSLSKD
                     ESTKIVPKTSNEGFGLLPIVERLFDVVILPRISDSPRVWRTHARLLRWKEDWEGAMED
                     YLRAWRFGPVQDETVERDLGKWKDAVGELENLVAVLSVLGPKAKAAQEEQGEKKKKGD
                     WKFQARGLVRTFMGRTKESFEGEKDWQRLQDLMEELKRSD"
     gene            539339..541018
                     /locus_tag="CNI01950"
                     /db_xref="GeneID:3259698"
     mRNA            join(539339..539584,539636..539791,539849..539997,
                     540063..540125,540179..540554,540622..541018)
                     /locus_tag="CNI01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657815.1"
                     /db_xref="GeneID:3259698"
     CDS             join(539417..539584,539636..539791,539849..539997,
                     540063..540125,540179..540554,540622..540954)
                     /locus_tag="CNI01950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513569.1"
                     /db_xref="GeneID:3259698"
                     /translation="MVNILEQKVDEVRLEGKLREGEDSAGESETEDIPAPDGEPSIKN
                     KKKKKKKKGKSKASSGANPLLGSIPDEEPAPPPETPEEKAKWDKELKKGCRTFSLPSW
                     YVLDDRTRPILNTFLTPSCKKFALQTPRLRLRQVEVGDTTGIRRIKMEPTVQRTQLYG
                     SPSISDIKESFQNRYIRSSIPRASTSTDTKYREEYVFAITALDPSSLAIKPAGNVRIT
                     NRLTSAEGYIGNIALSLLFTDSCPSLLPQKGQVYTQPTFEQFKKMGLVGKMFYEVHPQ
                     LWGQGIMSEAFVEVLRFAMEEVGCTLVQSDPTVNNDASIRLCTKNGMHFVEKRDNEWD
                     KPQLIHEISSKTWWEKNRPGKVVMDRWGGKEVCRWCLNFRLATPTIQCQHCDWAKYCS
                     RECQRADWVRTNGHQSECDLKP"
     gene            complement(540063..542635)
                     /locus_tag="CNI01960"
                     /db_xref="GeneID:3259745"
     mRNA            complement(join(540063..541030,541087..542213,
                     542258..542635))
                     /locus_tag="CNI01960"
                     /product="exopolyphosphatase, putative"
                     /transcript_id="XM_572843.2"
                     /db_xref="GeneID:3259745"
     CDS             complement(join(541004..541030,541087..542213,
                     542258..542612))
                     /locus_tag="CNI01960"
                     /codon_start=1
                     /product="exopolyphosphatase, putative"
                     /protein_id="XP_572843.1"
                     /db_xref="GeneID:3259745"
                     /translation="MRLPRHSSLICLLFAFVTIPPVIFILLFLGYLDSSMRVCLPFSL
                     ARLSTTAHNTLSCQARPVSSIIMDNATIQSGSDNATVPEGKLAGFLSSQRDLFLQDLK
                     DGKGRGWSVVMGNQAGDLDSLASSVAFSQLSATLLASRVVPLILTPPKSMRLRPENLI
                     ALRNTSIPLTSLLHASQLPVSTTELASQGITFALVDHNKLLPEFAQGKVDAIIDHHED
                     ENAHTDASIREITIPTGSCASLVVKHFQPQWEASISRGSPVPPELATLLLSAIVIDTG
                     GLKPGGKATSVDYEAAAFLYSISTIAQGQAGSFSVTGEGGLPPSLKLLSDTLQDAKSD
                     VSNLTTYELLMRDYKEYEWPTQSPNFPTLKVGLSTVPLGLKTWIAKEPEGWETLMSGT
                     EQYMRERTLDIEGILTTYRSEKKGKHKRQLALIIRPGGVIRDPQEARSVFDRLAAGLE
                     ASEMLQLEEWKKEEKVKRQDDERLVKVWVQGNAKATRKQVAPLLKNLVSELQ"
     gene            542970..545738
                     /locus_tag="CNI01970"
                     /db_xref="GeneID:3259591"
     mRNA            join(542970..543094,543200..545224,545283..545470,
                     545530..545738)
                     /locus_tag="CNI01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_572974.2"
                     /db_xref="GeneID:3259591"
     CDS             join(543242..545224,545283..545470,545530..545572)
                     /locus_tag="CNI01970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572974.1"
                     /db_xref="GeneID:3259591"
                     /translation="MVSTKALPSSAIPAKQLRSPRSPHSPKSPRTKHTDAFAPLSEVL
                     TDSPSDVAMEPDASAGVGVSPAEPYLLRRVLSGGSNASTLPSNAGSPGMKSAPLSPSS
                     QGARTPKAGKAQQLASDMDGLNVRSPVSNDGSLPPPAGAPDIPEPMNSRKGPKSIDDT
                     KNGGSSDGVEQGPISGDTNGHHTKQRSYTGSTDSSNSQHPVPSPHLGSSYGPEGFPIL
                     HHSPEASPMAYSPYLAGAGASYFGGNGNFDPELAARQAALLAKADEAVRQLNNTATVF
                     QGPMPPGPAYPETFGQVPRNYANFVTPHQNPTVTRQSSTSSSLTDAASTSSEESDWCI
                     PTVEWVPANQWQHSTYLNSPGTVFNRQEKDRVPSNSRMPPPLGTRPTSSRHPSTGPAE
                     HPPLQHQNPLPFRSSAATPPLNTSHPSWATAPASESPDEDDDNQTVGHARDRSPSTSS
                     QSAQSGLDLLWRAAHGIKQPNMPRDVSFDHKGKRKAGAEAVDKWRASGIPTGPPPPVG
                     ASQDEVKPPTTSPPRKRRRSEVEMEEMEMDNAANVEAEEDEEAIAEDPTSDYRSPSTS
                     EGPVSDHDSEYGSGARRGRPIARGRGRGRAGTSARGRGGTANTALSSAPGGITKQGTI
                     KKVRKVGDSPNGTAKGGRKPAAVPPGGVQCDYVNPLPPYNRCTDVFTRKYDLPRHMAR
                     HARREGELVMEGKLSEDKAILWKTIKDKPKVVCDTCGESFTRMDALKRHQAKQHH"
     gene            545879..547540
                     /locus_tag="CNI01980"
                     /db_xref="GeneID:3259391"
     mRNA            join(545879..546365,546422..546559,546618..547540)
                     /locus_tag="CNI01980"
                     /product="zinc-finger protein, putative"
                     /transcript_id="XM_572828.2"
                     /db_xref="GeneID:3259391"
     CDS             join(545948..546365,546422..546559,546618..547450)
                     /locus_tag="CNI01980"
                     /codon_start=1
                     /product="zinc-finger protein, putative"
                     /protein_id="XP_572828.1"
                     /db_xref="GeneID:3259391"
                     /translation="MASATSSLPPTSPPASTHTMEPSQPQSSPLKAPSIIVSPSKNPV
                     MERVASQQLNSSPGPQWATENNPHPKAGGSYTGVSPAPSVDGHVDVDEEIDELLGDDD
                     VQEGAEEKNGEPEKQKCQWGECQGDFDSKQEFYGHVKDHINASKEYACEWRTCSRVGH
                     KQGRSLLLTHIRGHTGERPYSCTIPGCNKAFARTDALNKHKRTVHADVTNPNGAKPSK
                     GGKGKTKATPGTGKGKGKTKGVAPVPSDIPTPTPAITSKPKSKSLPPPLILSPSPPIP
                     PVSAPDEDLILDPELAELIPRLRSRWPIIPEGNDEIEALREARRRFPRHRLFPNYTKE
                     EDVEEKGSRVGLEELVADPLDDPVARPLRRNGEDEIEYRERVREYLTDTSRPPDADLP
                     MEELDYTLPPLVPEIAHTTEDPEDPEGEVVDVLGRSRWQVRYIMAKARLLLLEEENML
                     RRRYLQELAETR"
     gene            complement(547623..550029)
                     /locus_tag="CNI01990"
                     /db_xref="GeneID:3259695"
     mRNA            complement(join(547623..547748,547800..548046,
                     548098..548181,548229..548405,548463..548559,
                     548616..548696,548746..548816,548874..548978,
                     549031..549133,549183..549466,549515..549648,
                     549712..550029))
                     /locus_tag="CNI01990"
                     /product="methylmalonate-semialdehyde dehydrogenase,
                     putative"
                     /transcript_id="XM_024657816.1"
                     /db_xref="GeneID:3259695"
     CDS             complement(join(547719..547748,547800..548046,
                     548098..548181,548229..548405,548463..548559,
                     548616..548696,548746..548816,548874..548978,
                     549031..549133,549183..549466,549515..549648,
                     549712..549936))
                     /locus_tag="CNI01990"
                     /codon_start=1
                     /product="methylmalonate-semialdehyde dehydrogenase,
                     putative"
                     /protein_id="XP_024513524.1"
                     /db_xref="GeneID:3259695"
                     /translation="MLPLIRRPLQLRAYTSAAFASTPSSSKLSPLALKAAEDVSSKWK
                     GTTANGGKTKIYIGGEFLDSKTDKWLEVRDPASQTLVNTVPETTPDEFRAAVDAASQA
                     FKTWSKTSIMRRQRAMFELQHLIRQHAPEIANSIVLEQGKTYADALGDVGRGLQVVEN
                     ATAITSTLLGDKLEVANDMDTYVRRLPLGVAAAISPFNFPAMIVLWSAALATVTGNTL
                     IVKPSERDPGATMIIAELCERAGLPPGVINVVHGTVPTVNRICDDPAIKAISFVGSDK
                     AGEHIYNRAIVQGKRVQANLGAKNHAIIMPDANKNLALNSVAGAAFGAAGQRCMALSV
                     AIFVGTAREMIPELIERAKGLKVTGGFEEGADLGPVISPQAKKRIEDYIGSVEEEGGK
                     ILLDGRGYNVSEYPDGSFVGPTIVEAVTTMKVYRNEVFGPVLTIVEADTLDDAIAIIN
                     ANKYGNGASIFTNSGSTARKFEIEAEPGQIGINVAVPVPLPMFGWSGNKASAKGDIPF
                     YGKSGLDFYTYKKTTTSLWPAADAVGNRASVHMPQIH"
     gene            complement(550246..552951)
                     /locus_tag="CNI02000"
                     /db_xref="GeneID:3259447"
     mRNA            complement(join(550246..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552308,552373..552662,
                     552741..552951))
                     /locus_tag="CNI02000"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /transcript_id="XM_024657817.1"
                     /db_xref="GeneID:3259447"
     mRNA            complement(join(550246..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552308,552373..552634,
                     552741..552926))
                     /locus_tag="CNI02000"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /transcript_id="XM_024658736.1"
                     /db_xref="GeneID:3259447"
     mRNA            complement(join(550246..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552308,552373..552926))
                     /locus_tag="CNI02000"
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /transcript_id="XM_572837.1"
                     /db_xref="GeneID:3259447"
     CDS             complement(join(550296..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552248))
                     /locus_tag="CNI02000"
                     /codon_start=1
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /protein_id="XP_024513523.1"
                     /db_xref="GeneID:3259447"
                     /translation="MTSISNGQPAPLAIRQPKDIECWGHRGASAHLPENTLASFRAAI
                     AEGCDGIESDVHATSDGVILMFHDPTLDRTTTGTGLIKDQPWKGVIEHVRTTKEPVQP
                     VPLFEQLISLLMEPQNRHVSLNIDCKMQNDPERLFPEMAKIIGQYENYETELSPRVIL
                     GLWHPLFIRPALKYLPTCRRFHIGFSIPVVKTFFWDVCDGFSMCFPLLMGSEGQAFLK
                     ECREKGKEVTVWTVNDETEMRVAMSWGVKAVLTDRVGAFVNLRKKVVENPEKLALQGM
                     EKYTFPWSHWRYYSVAHNWILRTQLDVMRTVCYQPGPLTMPDLGEFSMVEQGNQAKEE
                     TQNIPSLPRVPVAAQ"
     CDS             complement(join(550296..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552248))
                     /locus_tag="CNI02000"
                     /codon_start=1
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /protein_id="XP_024514407.1"
                     /db_xref="GeneID:3259447"
                     /translation="MTSISNGQPAPLAIRQPKDIECWGHRGASAHLPENTLASFRAAI
                     AEGCDGIESDVHATSDGVILMFHDPTLDRTTTGTGLIKDQPWKGVIEHVRTTKEPVQP
                     VPLFEQLISLLMEPQNRHVSLNIDCKMQNDPERLFPEMAKIIGQYENYETELSPRVIL
                     GLWHPLFIRPALKYLPTCRRFHIGFSIPVVKTFFWDVCDGFSMCFPLLMGSEGQAFLK
                     ECREKGKEVTVWTVNDETEMRVAMSWGVKAVLTDRVGAFVNLRKKVVENPEKLALQGM
                     EKYTFPWSHWRYYSVAHNWILRTQLDVMRTVCYQPGPLTMPDLGEFSMVEQGNQAKEE
                     TQNIPSLPRVPVAAQ"
     CDS             complement(join(550296..550466,550716..550805,
                     550849..551203,551256..551278,551329..551367,
                     551416..551442,551491..551563,551615..551726,
                     551782..551834,552142..552248))
                     /locus_tag="CNI02000"
                     /codon_start=1
                     /product="glycerophosphodiester phosphodiesterase,
                     putative"
                     /protein_id="XP_572837.1"
                     /db_xref="GeneID:3259447"
                     /translation="MTSISNGQPAPLAIRQPKDIECWGHRGASAHLPENTLASFRAAI
                     AEGCDGIESDVHATSDGVILMFHDPTLDRTTTGTGLIKDQPWKGVIEHVRTTKEPVQP
                     VPLFEQLISLLMEPQNRHVSLNIDCKMQNDPERLFPEMAKIIGQYENYETELSPRVIL
                     GLWHPLFIRPALKYLPTCRRFHIGFSIPVVKTFFWDVCDGFSMCFPLLMGSEGQAFLK
                     ECREKGKEVTVWTVNDETEMRVAMSWGVKAVLTDRVGAFVNLRKKVVENPEKLALQGM
                     EKYTFPWSHWRYYSVAHNWILRTQLDVMRTVCYQPGPLTMPDLGEFSMVEQGNQAKEE
                     TQNIPSLPRVPVAAQ"
     gene            complement(553641..556130)
                     /locus_tag="CNI02010"
                     /db_xref="GeneID:3259378"
     mRNA            complement(join(553641..554292,554340..554828,
                     554889..554981,555034..555174,555232..555460,
                     555510..555563,555627..555690,555748..555798,
                     555851..555881,555944..556130))
                     /locus_tag="CNI02010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572983.2"
                     /db_xref="GeneID:3259378"
     CDS             complement(join(553791..554292,554340..554828,
                     554889..554981,555034..555174,555232..555460,
                     555510..555563,555627..555690,555748..555798,
                     555851..555881,555944..556065))
                     /locus_tag="CNI02010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572983.1"
                     /db_xref="GeneID:3259378"
                     /translation="MPFGFTHKPLVALANSAICSFFREIEVYGAENVPTEGPIIFACT
                     HANMAVDPALLSNTVPHGHLMHYWVKDSLFKNPAVGWLLHNAGNIAVDRTTRNNQMLF
                     RGTFEALALGECIGVFPEGTSHTEPHIIPLKDGTSWAALEYVRYLQGTEENKGAKKGK
                     KAVVVPVGIAYVDKAKYRSRVVVHYRKPITMEQFESQFLSDEPGANKVAVKNLTKAIT
                     LEFRKMTVNCPDWDTAFAAQMARELLWERESDLSLADYVQVSQTLVDLFCTPNSKIEN
                     LKTLLATYQRLLTSSRLSNAALVGLKLPRQLNPDSVTSLPSRFSTLWLLIKDSIACLI
                     RLPFFIVPMLLHIPVYIVGILGARLVEDELETQAQMKITFGLLLSFLTYPVLFFSLWA
                     VFRNWTLGTVMAAGAVWLLGRYHSALIDENYDAMKRLVAAWRLVVGVWLPRDFEMPLP
                     NFVAQYSLFAPDPPKVAGLPPATPPEKYQKPKRLSSRVLVKHILRVRAQAARELAELL
                     LELENGEEVVAQTWLAEEFGGKVLQQSQQDGAEEQLTGRWVKQGGTRSGREVLQYLKS
                     KGARLGFTAEEVGAVNASGVDTEME"
     gene            556377..557943
                     /locus_tag="CNI02020"
                     /db_xref="GeneID:3259716"
     mRNA            join(556377..556623,556670..556770,556827..557698,
                     557753..557943)
                     /locus_tag="CNI02020"
                     /product="chaperone, putative"
                     /transcript_id="XM_572659.2"
                     /db_xref="GeneID:3259716"
     CDS             join(556442..556623,556670..556770,556827..557698,
                     557753..557809)
                     /locus_tag="CNI02020"
                     /codon_start=1
                     /product="chaperone, putative"
                     /protein_id="XP_572659.1"
                     /db_xref="GeneID:3259716"
                     /translation="MPTKPSTELDAAVLAYLVKRGYTKAVKSLEKEAGVKLLPGQEDK
                     LENAWAATDVAAVAATSDEAEDSSSSESESEDSDSDSDSDSDDEKSTKAVDPATVPLP
                     ESSSSESGSDSGSDSDSSSSSSGSSSSSSTLKSSGKTSGFLDIEAEVSSDEEVSSDEE
                     SEDESESGSESDSSSSSSSSSSSSSSSGSSSSSGSSSSSGSSSSSSSSSSSDSSSSSS
                     KSKSEFKEEQEARPVIGKRKARSPSTSSSSSSSSSSSSSASESLPKSPAVTVVTTKKR
                     KLEDGTETITSTATITPAPKANSSRETSTPASAVGTPVGGKGKRVQGQRFERIKADSV
                     TFHDPGLMDNSFEARERTGANANDYGAKASRDLIVTRGAGFRKEKNKKKRGSYVGGEI
                     TLQTHSIKFDD"
     gene            complement(557712..560284)
                     /locus_tag="CNI02030"
                     /db_xref="GeneID:3259412"
     mRNA            complement(join(557712..558133,558200..558434,
                     558485..559038,559105..559294,559346..559441,
                     559492..560014,560067..560284))
                     /locus_tag="CNI02030"
                     /product="aspartate kinase, putative"
                     /transcript_id="XM_572658.2"
                     /db_xref="GeneID:3259412"
     CDS             complement(join(558027..558133,558200..558434,
                     558485..559038,559105..559294,559346..559441,
                     559492..560014,560067..560209))
                     /locus_tag="CNI02030"
                     /codon_start=1
                     /product="aspartate kinase, putative"
                     /protein_id="XP_572658.2"
                     /db_xref="GeneID:3259412"
                     /translation="MSSASTPTAPYLEDLVRNSLDQTLPWVVQKYGGTSVGKSLDNIT
                     KIVGSYIDNGSKVAIVCSARSTQTKSLGTTNLLLQASREALQPALSSSGDGRSGSMSG
                     TATPFYPKRVGSGFFGKDQSTSMVSSVSSLSQLEPQLGRSGSPSPFQSSSSRSPPRSP
                     ATPSQDSSVSQEPAFHATVDLIKKGHLEAARASLKEGPLRDELEEEIERDCESLRSFL
                     YAAQIIDEISPRSQDSIVGTGERLACKIVAAALRDRGVDSELVVLDNIVDASMSAASE
                     AISVDAGDQGVAQLGQEFYDQLSFRLGERLRECGQRVPVVTGYFGPVPGSLLAQIGRG
                     YTDLCAALCAVGLKASELQVWKEVDGIFTADPRKVPSARLVPIITPDEAAELTYYGSE
                     VIHPFTMEQVIRARIPIRIKNVENPSGAGTVIYPDLGFPRGLDTEPPKAERIVEGVDE
                     RMPTAVTIKDEIIVLNIHSNRKTLSHGFLARIFGTLDRAGVVVDLISTSEVHVSMAMQ
                     DFLNRKRLERLVKDLEKIGEVTVSKDMAILSLVGRNMRNAIGSAGLMFASLARAMINI
                     EMISQGASEINISCVIENKDAIKALNVIHESCLSYPRSPATEMAGLQLQ"
     gene            complement(561603..563240)
                     /locus_tag="CNI02040"
                     /db_xref="GeneID:3259764"
     mRNA            complement(join(561603..561827,561878..562219,
                     562282..562360,562412..562700,562755..562994,
                     563049..563240))
                     /locus_tag="CNI02040"
                     /product="dihydrodipicolinate synthase, putative"
                     /transcript_id="XM_572656.2"
                     /db_xref="GeneID:3259764"
     CDS             complement(join(561690..561827,561878..562219,
                     562282..562360,562412..562700,562755..562935))
                     /locus_tag="CNI02040"
                     /codon_start=1
                     /product="dihydrodipicolinate synthase, putative"
                     /protein_id="XP_572656.1"
                     /db_xref="GeneID:3259764"
                     /translation="MTTNNTSSGAPSRVWAGGPSVPLVTAMNDDESINYEALAKQTVR
                     LAKAGLGIVLLGTNGEASHLSPEERKQCTVVVRKALDDAGFVNEPLLVGTGAGSAQTT
                     IQVTKEAAEAGASHSIVITPGYFSFAMGRDRKAIKDFFRKVFDESPIPVMIYNFPGAA
                     AGIDLTSDEIIELSNHPNCFGVKLTCAMIGKGHRIAAYTQSPEYLAKHGSFLKSCTAT
                     GQFQVLPGFSESTLPALVSRHTGCITGTGNTIPKTIRRLWDKSVAGLQGDSKALAEAM
                     ELQDRVAEADWTIVKAGIQGTKYFLDHYVEKGMGGAVRLPLGTISDDVKKLIEVDLKG
                     AWEFEQSL"
     gene            563636..567329
                     /locus_tag="CNI02050"
                     /db_xref="GeneID:3259691"
     mRNA            join(563636..564035,564127..564160,564210..564289,
                     564349..565119,565168..565561,565612..565713,
                     565765..566061,566115..566205,566265..566383,
                     566436..566637,566685..566817,566870..567329)
                     /locus_tag="CNI02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657818.1"
                     /db_xref="GeneID:3259691"
     CDS             join(563757..564035,564127..564160,564210..564289,
                     564349..565119,565168..565561,565612..565713,
                     565765..566061,566115..566205,566265..566383,
                     566436..566637,566685..566817,566870..567220)
                     /locus_tag="CNI02050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513463.1"
                     /db_xref="GeneID:3259691"
                     /translation="MLNPSVAATFAGGNNYHRGNSAAPLNMLSHPPSRLSPPPGADIY
                     GVTASSSSQQLPVAGSSATYPTQLPQTAAPLTDTKKQGQNLPKRGYRACTNCRLRKAR
                     CDLGDVNSPSEPPCSRCRREQRDCVFLPSKRRRRTSVADPALREESLDLPQTEIYPVQ
                     AAARPSSANAHSGGAQGAPSVSQSLSQQGPPLASASSVNSSFPQLPKPAANKDDSSSR
                     MPFTQTGIWNETVQQPTSTEDQGKQQVFPSSATYPTMHSVGSTQHHTDTTTPGSLGGS
                     SAASTTALSPQYRTKKRKTEPSNRKIVNANLSNEMDALEILANAATDGDDEGEDGKRK
                     QPHDPKKVTWNVGEQYKAPMRELSDFHLIKAGILDEHGLHAMVDNFFRYYHPALPIFQ
                     TARIPRCREQLLDLAHNDSFLLTCIVAVASRHPSDNRYKDVHDKTWAVIRDAMSDYSF
                     TGLPGSVGFVEGVLLLAEHLPRERGTPPRGTSVDMLAGPGTESAGVHGTDNRRSWSLI
                     GLAIRAAYLLGLDQISLEIDESSRTPDVERARSVWTWCYLYDRTIGLRTGLAFWSRGP
                     ALCFVGYSHISQTGEVAARLNFPLQLSPGAELDGRAHDDSASLMQSLVELTQVMTNAH
                     DILYPSKLRTEVLVKQGEYFLFLDHFRRALDSYRTIWKPKQWSNRTLEELSWMTFHYV
                     RLYISSFGYSAHIKRAQWRGDKEASTGRDGSRQAVQIFPRGSATSPDALYIYDSIAAA
                     NEILHISLRLAQMGSLRYLPSRYLINISYAAVFALKSSYSGAVEEKDMHRIRELVDHV
                     CTGLVLSCPDKDHPAVRYGQMLRMLAKRLEELHDASAVPSRYPSPEPVETTSNSNASP
                     QASQDQPSVFPWPAPPNASTEHSAPTPAFQLPPFPDMSFLTNSQVNPDYLGENNTSNS
                     EKQAAMFDYEDTKFDFDLKGFWDDFSLGEGSGFPFR"
     STS             563997..564772
                     /locus_tag="CNI02050"
                     /standard_name="Hind7"
                     /db_xref="UniSTS:470713"
     gene            complement(567758..569847)
                     /locus_tag="CNI02060"
                     /db_xref="GeneID:3259548"
     mRNA            complement(join(567758..568196,568249..568379,
                     568435..568585,568636..568732,568783..568862,
                     568913..569119,569168..569847))
                     /locus_tag="CNI02060"
                     /product="mandelate racemase/muconate lactonizing enzyme,
                     putative"
                     /transcript_id="XM_572835.2"
                     /db_xref="GeneID:3259548"
     CDS             complement(join(567866..568196,568249..568379,
                     568435..568585,568636..568732,568783..568862,
                     568913..569119,569168..569487))
                     /locus_tag="CNI02060"
                     /codon_start=1
                     /product="mandelate racemase/muconate lactonizing enzyme,
                     putative"
                     /protein_id="XP_572835.1"
                     /db_xref="GeneID:3259548"
                     /translation="MSANPPQPVNVTTDSSVKADREAVYLPPSDLALKYNKGLQCSLA
                     VQPHPSAGQAGSTKIKKIETFYVRPRWLFVRIETEGGVVGWGEGTLEGHTEAVQGSMK
                     DIARRLIGWDAMNIEEIYTYLYRHRFYRGGEVLMSAMSGVDIALWDIKGKVLGVPVWE
                     LLGGKVRERCDVYGWVGGDRPSDVAEQAKARKEQGFRFVKMNATESIGWLDSPHALDD
                     TVKRLAEVKAVGIDAGLDFHGRVHKGMAKQLAAGLEPHRPFFIEEPLLPGHVNELKDL
                     YNKTNIPIALGERLFTRLDVRPYLESGCIDLIQPDIAHAGGISETKKIAIMAEAYDVG
                     LAPHCPLGPLAFAASLHVGFSTPNFVICEMSLKMHYNVGKDLLSYMLNPEVFDIENGS
                     IGLLTAPGLGIELNEDMIRKEAAEAAELEPWINPLFRGEDGAMREW"
     gene            570569..573047
                     /locus_tag="CNI02070"
                     /db_xref="GeneID:3259658"
     mRNA            join(570569..570642,570723..571333,571391..571563,
                     571619..571918,571974..572237,572292..572604,
                     572657..573047)
                     /locus_tag="CNI02070"
                     /product="nicotinamide mononucleotide permease, putative"
                     /transcript_id="XM_024657819.1"
                     /db_xref="GeneID:3259658"
     CDS             join(571122..571333,571391..571563,571619..571918,
                     571974..572237,572292..572604,572657..572894)
                     /locus_tag="CNI02070"
                     /codon_start=1
                     /product="nicotinamide mononucleotide permease, putative"
                     /protein_id="XP_024513522.1"
                     /db_xref="GeneID:3259658"
                     /translation="MSLEEKLSQEHLDRVISEKDKLDDGVDRHLAVKIPESLVGLSPE
                     EVNAIDRKATLKLDLLLMPVLMALYILNYLDRQNISSAKIAGIMDDLGLTTTQYNTCV
                     AVLFAGYVSLQIFSNIFASKINYPGVYICVMCAIWGVISGCTGAVQSYAGLAVCRVVL
                     GFAESAFFPGAVYLNSCFYTKKQMALRTAILYSGSQIGNAFGGLFALAILNLDGAHGL
                     EGWRWLFIVEGVLTVGLAIIFATFIPNKPGTMKWLSQQERDRLTYRLEVDRSSKDATD
                     EVTVWTAFKMASCDPKTWLLCAVLYCNYIAASVTNFFPVVVSGLGFNRTVTLAITCPP
                     YVLCCFSILIIGWHSDKKNERTLHIICPFFITIIANILAISTTKIAPRYVAMCLLPSS
                     FYGATCCVLSWISSSITGPAVKRAIAIAIINAVCNTPNIWTSYLYYDAPRYVAAFGVD
                     LAASVLTIAFAALTYLYLRRQNSKIERGEPLPVSGPSVVQLEAGFRYQL"
     gene            573390..575763
                     /locus_tag="CNI02080"
                     /db_xref="GeneID:3259487"
     mRNA            join(573390..573480,573592..574625,574678..574928,
                     574978..575085,575135..575341,575389..575763)
                     /locus_tag="CNI02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_572646.1"
                     /db_xref="GeneID:3259487"
     CDS             join(573689..574625,574678..574928,574978..575085,
                     575135..575341,575389..575511)
                     /locus_tag="CNI02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572646.1"
                     /db_xref="GeneID:3259487"
                     /translation="MSPSFLPLISSVFAIHILFFAFTSFTQTHAYPHNRRQGVALTRE
                     GSEPSHEAAQSILTNSGSELGQSSTAWNQPDSTSAAVSRIASVTSGPTTNELTSNAMS
                     TLSPTTVASDSSLTETLTSSTPVTTSFTPVSGLAFPSVTPSPSITASSYKTLTSFIPY
                     ILSNANSIAVHSWELGAFTETLLEVYYPQLTPFGWDCRAFDGEDIPWSVLKIAKDAIS
                     HYNWTGAPGQDFGKNLPDYLFPDTTPHAHVSQALVGGDGALGDPVSLVPAVWLLARFA
                     RQDDVRDKLGLRCPEDYAWAVGNQLDYLFNGPASDNGTISQREAGFEVWSDMGYMIPP
                     SLAYLGLDISDDSLLKKALEQFSLESSAMLDTDQLIYQHIPATDARLWATGNGWMTYG
                     LMRDLASVKMSSFAEDLSSLKSDAEQTIAGVFKALFDQLGEDSLLPDYMLQGNSTLAL
                     GDTAGTALSVAAYYRFLEIAPHLTSQDLTAKAEKAFDGVVAKIDDDGWVTHCVDPMGT
                     YGWVVYPEDHSLHSPEGQAFAAKMWKARTDAGY"
     gene            complement(575571..579503)
                     /locus_tag="CNI02090"
                     /db_xref="GeneID:3259643"
     mRNA            complement(join(575571..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..579038,579105..579503))
                     /locus_tag="CNI02090"
                     /product="f-box protein pof6, putative"
                     /transcript_id="XM_572981.2"
                     /db_xref="GeneID:3259643"
     mRNA            complement(join(575571..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..579061,579105..579503))
                     /locus_tag="CNI02090"
                     /product="f-box protein pof6, putative"
                     /transcript_id="XM_572980.2"
                     /db_xref="GeneID:3259643"
     CDS             complement(join(575794..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..579061,579105..579399))
                     /locus_tag="CNI02090"
                     /codon_start=1
                     /product="f-box protein pof6, putative"
                     /protein_id="XP_572980.1"
                     /db_xref="GeneID:3259643"
                     /translation="MDKWAPIAPSRPQFQSASHLSNRFASVLKPSKHGPRSGAPAQFI
                     GRWPEDVILRIIELLPIPDLPNAARVNRAFAHLVKDERGWEWRCTLLGIEHESIAPFT
                     ANLKDNELKPPVSTQRKPSFPAQQASVLEDDFGDFTGQDKDVFEDVDFGDFETAKPTV
                     PQGKFGTNTQQWGTSKEQNLLDFEDLPLPSRPTGSSSSHGRTTGFFALTPTMPLPSAS
                     FSSHSPGPYYLAYKTHHLSLLPFCKHLRSSPSPSSTLSLLFPPSPTTALPPSLSHQSS
                     VLLSLIRFLSPQLQPLRDWGFLRQALLAAADRFDSTCLVAFEVSDGKKDEEGMKEAAE
                     SSWKVWEAGGGDREKWECGRVWVEKREVFYDTSRWDSLENIIKVQTQSGATIRQLDFT
                     PMDAFMSHVLEAFRIDAEIAHSVFPSKAKVVLSFCDRLSNEVIGEYIHPLLSQARAVS
                     QDLFLRAAAATFVQAWKLVDVAMEVLGDEQNVIKKEQVEDSVFHMFEEHLDDYLDDET
                     ERVKHHLEDICRIWEQQLGTSDSEQLSKSHTPTFLISANPDQVKRNVLASFKDALLLP
                     VTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQKWTGKGGVVKEVKDGEEVVFEVTDVD
                     EKTAEDMTNDDIMEGVRVTENVENVKEALEPSHASSSNDSHARSAAGSLESSHPSTPS
                     PKNNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFVKYPGKVGTKVREAIEEIFIFL
                     LKAVGDRHIAPGFKIATNQMSTYKPAEHEETTSVAPLLQFFELVHIGDTIQSMVQVYF
                     DKELSPYVDKTDFLNAVMREKKRFESVLDDAVAAGLNAGIEVLMNQVEHIILVKTGPR
                     EYYPVEGTPMELGPTQGCKEAIMCLEMHCNLLKGSTSKEVLEVFYQEVGIRLEAIIQR
                     HIKRQIISLEGGFQVIADLNAYYDFVSSLKQQRITDDFSDLKMLGNVYIVSDAKDLAQ
                     IVRDVSRYGGAFTPEDIYEFIQRRSDWKKIEKTVDKAMYALSVREDCVVM"
     CDS             complement(join(575794..575838,575886..575946,
                     575997..576230,576297..576493,576554..576821,
                     576867..577555,577603..577702,577767..577939,
                     577996..578170,578230..578723))
                     /locus_tag="CNI02090"
                     /codon_start=1
                     /product="f-box protein pof6, putative"
                     /protein_id="XP_572981.1"
                     /db_xref="GeneID:3259643"
                     /translation="MPLPSASFSSHSPGPYYLAYKTHHLSLLPFCKHLRSSPSPSSTL
                     SLLFPPSPTTALPPSLSHQSSVLLSLIRFLSPQLQPLRDWGFLRQALLAAADRFDSTC
                     LVAFEVSDGKKDEEGMKEAAESSWKVWEAGGGDREKWECGRVWVEKREVFYDTSRWDS
                     LENIIKVQTQSGATIRQLDFTPMDAFMSHVLEAFRIDAEIAHSVFPSKAKVVLSFCDR
                     LSNEVIGEYIHPLLSQARAVSQDLFLRAAAATFVQAWKLVDVAMEVLGDEQNVIKKEQ
                     VEDSVFHMFEEHLDDYLDDETERVKHHLEDICRIWEQQLGTSDSEQLSKSHTPTFLIS
                     ANPDQVKRNVLASFKDALLLPVTIVPRTVTFGVNAIVSGGTQAVSGLAMLNPQKWTGK
                     GGVVKEVKDGEEVVFEVTDVDEKTAEDMTNDDIMEGVRVTENVENVKEALEPSHASSS
                     NDSHARSAAGSLESSHPSTPSPKNNKSFDRLQLLVSLDTALELIQVDRDSLKRAETFV
                     KYPGKVGTKVREAIEEIFIFLLKAVGDRHIAPGFKIATNQMSTYKPAEHEETTSVAPL
                     LQFFELVHIGDTIQSMVQVYFDKELSPYVDKTDFLNAVMREKKRFESVLDDAVAAGLN
                     AGIEVLMNQVEHIILVKTGPREYYPVEGTPMELGPTQGCKEAIMCLEMHCNLLKGSTS
                     KEVLEVFYQEVGIRLEAIIQRHIKRQIISLEGGFQVIADLNAYYDFVSSLKQQRITDD
                     FSDLKMLGNVYIVSDAKDLAQIVRDVSRYGGAFTPEDIYEFIQRRSDWKKIEKTVDKA
                     MYALSVREDCVVM"
     gene            complement(579766..581911)
                     /locus_tag="CNI02100"
                     /db_xref="GeneID:3259692"
     mRNA            complement(join(579766..581059,581118..581424,
                     581487..581652,581712..581911))
                     /locus_tag="CNI02100"
                     /product="expressed protein"
                     /transcript_id="XM_572832.2"
                     /db_xref="GeneID:3259692"
     CDS             complement(join(580891..581059,581118..581424,
                     581487..581652,581712..581885))
                     /locus_tag="CNI02100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572832.1"
                     /db_xref="GeneID:3259692"
                     /translation="MAYPRYNNYEQGVPPVQPAAYYSTPSTSALPSREPLSREPHRVL
                     FAGLPPDITASDLRDLLLSEPLHLSPLTTSVTSLHSENGDFQGVMLVYVETAEDAERI
                     RAQYSGQPIDGSLVLQVHHVLPSHVSLPLTNSVAPARPANQQSKTIPTGPKASSGPTQ
                     TNQQAQRHSAQRNSMSGKKAAGAMHAQAESAPPGLALLKRIGKAGQEDDRRKQQGGAN
                     KQKANVKSHSAGADLLSRLNPSPGDHSKNNKKNKNTKASNGSAKVNRAKGKAA"
     gene            complement(582225..585229)
                     /locus_tag="CNI02110"
                     /db_xref="GeneID:3259505"
     mRNA            complement(join(582225..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584456,584508..584924,
                     584976..585229))
                     /locus_tag="CNI02110"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_572977.1"
                     /db_xref="GeneID:3259505"
     CDS             complement(join(582706..582810,582867..582997,
                     583048..583410,583457..583619,583665..583846,
                     583895..584257,584305..584456,584508..584924,
                     584976..585127))
                     /locus_tag="CNI02110"
                     /codon_start=1
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /protein_id="XP_572977.1"
                     /db_xref="GeneID:3259505"
                     /translation="MASLRRPSTAIPRGPASVQFDRGARPPLPNDNKQKRMSKVGEKI
                     KKRLSMRYGGNESFSVPPPLPGASDFLTADPYGGLDIETPGEDLAASPFGLYGASDLK
                     ESSIQSSQPLDTQEHLVDESIGRRGAADATLEEEWNLEELSNEKVDAQAYVKKVLTGA
                     DEEEKRRFVAALMREKQANKKELQRTVFKHYAEFVAISKEISTLENDMLELKELLGQW
                     KDLPQLMGMEDTLAPTLDRNGNLERRRTQRKSVFDLQNLYRNQLTQLWSIVEGSQKYL
                     PVVAGRHLVFELHGVVELNPATYKPKQNVSIFLLNDVLLIAGKRRNKGGSTTSVGDEK
                     DRDRGRMVAERCWNLIELGIVDVKDGGELVNVIKVHRGKEHCVYRTQKSDDKRALINA
                     FRQISREANEKKRKDSEKEQERRKTMWLGDKNGNGTGNSGHPLSTIGPSMADSKDLRW
                     IDEYGDELTMAIAIRDWEESVKLVEKGQALSKSIESNSSAHSLLVSRLEQLVPSLVSQ
                     ISHDLSSSNLRKSSSARLISLLVRLDLADHARDSFLESRRELMFKRVRSIKCDGDVSI
                     YINELAVVIFTIIRHTSDWYMNAFKENNMASGFVTWAKQQIETFADLFRRQMDAPNIS
                     ESTVNECLHVTATQNRKLLRDVGLDFTFLLSSLLQPSSNPSDYPHSVFTSV"
     gene            585405..587504
                     /locus_tag="CNI02120"
                     /db_xref="GeneID:3259754"
     mRNA            join(585405..585688,585759..586003,586058..586060,
                     586123..586221,586273,586337..586479,586540..586636,
                     586695..586746,586807..586873,586925..587205,
                     587268..587372,587441..587504)
                     /locus_tag="CNI02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658737.1"
                     /db_xref="GeneID:3259754"
     CDS             join(585516..585688,585759..586003,586058..586060,
                     586123..586221,586273,586337..586479,586540..586636,
                     586695..586746,586807..586873,586925..587205,
                     587268..587288)
                     /locus_tag="CNI02120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514408.1"
                     /db_xref="GeneID:3259754"
                     /translation="MSVTAITTEVVDANPACPRDDLELVAISSVVGREAGEKDPYSLR
                     KKMIGEDEIKDLRQRKTGGDKLASFYESQNERINDLLKPMSAHSAEAAQEAKDNALKV
                     KIAINASFIANIALAILQLYAAISSMSLALFASCIDAVFDPFANLILWLAHRRSDRAN
                     ENKWPVRGSRFETIGNIIYGSIMGGVNVILVVESIQEFVTHTGDDLNEFHLASIIAVA
                     VAFGVKFCLFLYCLAIRKSSSQVQVLWEDHRNDLLTNGFSILTAAGGAKLRWWIDPMG
                     ATIIALVIIIVWTRTVYEQFTFLAGITAPPDFINLVTYKAMTFSPSITSVDTVRAYHS
                     GPQYFVEVDIVLPPEMPLWEAHDIAQDLQDQIEKLKDVDRCFVHVDHEISHEPEHRKK
                     V"
     gene            complement(588643..589772)
                     /locus_tag="CNI02130"
                     /db_xref="GeneID:3259626"
     mRNA            complement(join(588643..589095,589147..589247,
                     589296..589373,589428..589772))
                     /locus_tag="CNI02130"
                     /product="single-stranded nucleic acid binding protein,
                     putative"
                     /transcript_id="XM_024657820.1"
                     /db_xref="GeneID:3259626"
     CDS             complement(join(588702..589095,589147..589247,
                     589296..589373,589428..589652))
                     /locus_tag="CNI02130"
                     /codon_start=1
                     /product="single-stranded nucleic acid binding protein,
                     putative"
                     /protein_id="XP_024513571.1"
                     /db_xref="GeneID:3259626"
                     /translation="MQSTQPVASSSSTPVGPNADRLYVGNLSPTVDEFTLIQIFSKYG
                     KITKLDFMFHKTGILKGKPRGFAFIQFLDKADALKAMVKLHDRLLRGRKLVVTYASTA
                     PPDNSMLPTKGRRAEPTKTTTLSLLKSQRKPQSTAAQIAAMEAKLASMQQRKPPDENW
                     IPGSGVGSPAEASNSASPIPNLPAEELLGDIEGEKAAAELEREMQSELVGQRSDAAQK
                     DEVTAEPSSKSPVLSDSSLPSVAQHKSLVQAQPVKKGFASLPKKPVF"
     gene            589898..597444
                     /locus_tag="CNI02140"
                     /db_xref="GeneID:3259524"
     mRNA            join(589898..589984,590029..590206,590259..590610,
                     590664..591292,591343..591491,591540..591690,
                     591745..592005,592060..592758,592810..593037,
                     593090..593347,593397..593673,593723..593842,
                     593894..594072,594132..594331,594384..594602,
                     594652..594801,594855..595170,595221..595427,
                     595475..595756,595808..595981,596036..596419,
                     596468..596714,596765..596796,596855..597192,
                     597241..597444)
                     /locus_tag="CNI02140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657821.1"
                     /db_xref="GeneID:3259524"
     CDS             join(589977..589984,590029..590206,590259..590610,
                     590664..591292,591343..591491,591540..591690,
                     591745..592005,592060..592758,592810..593037,
                     593090..593347,593397..593673,593723..593842,
                     593894..594072,594132..594331,594384..594602,
                     594652..594801,594855..595170,595221..595427,
                     595475..595756,595808..595981,596036..596419,
                     596468..596714,596765..596796,596855..597192,
                     597241..597256)
                     /locus_tag="CNI02140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513460.1"
                     /db_xref="GeneID:3259524"
                     /translation="MDSLDEPLHLHILTSLASSYAAHPSNSDEQPIHALTRGLPQTAL
                     STSAGQGLPGSDEEDDEWTELEINHAISYAHYVYSLPITSLNLAASVEKLKKLLWGLI
                     RQGTIVVDPIASPASSSSARADVGLAGSVGQAQLCQDLIKAMIWAGWSSEEARSDVGE
                     TLVRLGQQIADLCSSNAQTTFPLVLLNSIHSVITHCPLPPFPTSIVARLVSAFLPISS
                     PKFLVKLVRQSSSAASTPHFRLPKNSPFLAQYPSSPVAVVMLVTEAITALLGNSLFSQ
                     PDINEVQKAFVKHSDQMNSPFLPNSEPSGSRPVLEHQINQLVSFPVEGHGLSSTPEGR
                     AVLAEADRMSLRWWSDLMGSTYVDAERELPGRRGNLFAHGRNEPEEEVDLTVAVLHLM
                     NMIVLRQPDGDKTQLARLKMLLSESSTITDARVLEAAFTCTTILVRNNPSLGTPMTHH
                     IRRLLMTPLPAFEGEIAGLGGDVPPAVVAAGKCLSVCIEMSANDDLTSSTLYSLLNTL
                     SHGQGNSGSAGVNSIRSLPLHYQGGEADTYTLKTTLTGGKGSEEQRRLVAAAAVQVVS
                     RLALELGKDDILHLSLAMLLQRLRGVDIATEATIVANLVPLALASSNADLIEVYRAFS
                     QIARSSHPEDPRRSSNAILAALTTLAKGMYKRLDCADGYLVELLTLFADKGTQTQMIS
                     MAAHAFDSKDREQLAQLRTEGNTRVADMKSWLSALLIPISTLLSHPHYHPDQAASPEL
                     VTHFRNLWFTLVVFGLSGSVGKNNLNEHEWEALGVIAEKTPVLVLESSNDFVESELEY
                     NSTLRKDFAASIQHRQSTALNEYLPQQRQSYDTRNLSTPQITFLMAVHDLEEMRTLRH
                     RPSVVLQYFCNVSLNTSSLIGCLDAIVQKVSKSFLRQLYHQAITHSLPPIISKEVCKI
                     LVACTHRMSKVREKALAYAHLILETFSALLCDKEVVFTLLEILTLMRRSCETQYTDEY
                     SPVYEFSSDRMDLTLHLTDDYAVRNEIVTQLHTVTCTWLTLAISRAPIEVQSILQSYL
                     NEARDVLLIDSVEMGAGLALHFSKAISKLDRQETIMPNIGGWPSDSSNLVASQFASKN
                     YHTGELSGARLVLSQGLSDLQKGSPTESSQAELAAFKFQMAQSVSNIRINSKSLDVPE
                     IRRLLLRGVSVLVASRRMDRDILHYLVELPMVAFTPLAIAAGVDAWTWLLRQRPEAEV
                     AIVGAITAGWMQTIIEKKGFFNNSMNYQDPFERPVEYSPSDKKITDLELAKARRLLRP
                     HTLLVQVLSSQFHAIKYRERAMTIALIRLMMRSLEAHREMSTHPLAREVRFSFLLFGF
                     QILSSSRMEALLELRLRDNLYNAAFSWFSVRPQWSYGSDRIQVGAEIKLLQDFLSAVA
                     NDGIRAEHYTSSMADRTPAFLIPGASSIQEYLVQHKDRVRLLQLLVENEISRLAVWSN
                     PVNEHGRTSAPAVGSLERSTSATDWTRLLQTAWKLNPAMAVQMGERFKISSLQAEISH
                     LVKSDPKAVQDVAEALHFLLGDKLEQDAKAALKWLPLWAAVPPVTAIVYFQPRYGNHP
                     LILQYAMRVLEQHPVELTFFFVPQVVQALRADGLGYVERFIFETSKISQLFCHQIIWN
                     MKANTYRDDDASQPDPMKPLLDRMIDMIVHGLSGKSKAFYDLEFDFFDEVTSISGKLK
                     PFIKKSKPEKKAKIDEEMAKIKLSVGVYLPSNPDGVVVDLDRKSGRPLQSHAKAPFMA
                     TFKVQKEKLDLPSNQSIENPDEAKMVKTTYDVWQAAIFKVGDDCRQDVLALQIIAMFK
                     NVFTSIGLTLYLYPYRVTATAPGCGVIDVVPNATSRDEMGRAKINDLFSYFVDKYGGV
                     DTASFQKARLNFIQSMAAYSVACYILQIKDRHNGNIMIDGEGHIVHIDFGFLFDIGPG
                     GMKFEPSSFKLNHEMVALMGGRDSQGYKMFTELTVKAFLAIRPHADQIIDAVHLMLGT
                     ALPSFKGEGTIIRLRNRFQLQLGERQAAEFMMGVIRNAHENMRSNVYDGFQKMQNGIP
                     Y"
     gene            597570..598913
                     /locus_tag="CNI02150"
                     /db_xref="GeneID:3259537"
     mRNA            join(597570..598509,598563..598913)
                     /locus_tag="CNI02150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657822.1"
                     /db_xref="GeneID:3259537"
     CDS             597610..598506
                     /locus_tag="CNI02150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513527.1"
                     /db_xref="GeneID:3259537"
                     /translation="MSYIFRPALVISRASRTASLPWAGAAGMVANFASSSRVRLDTTP
                     SSFSRVNTTSASTTTFVGEEMPEPLPSLEAEGEAERSVSAHQSPSTSNPNPDPIPNHQ
                     IPPQKASPIPQPSPLGSLSSPSSSLPRPSHIPQFTTSRQVARSPYAGLRWTPETIDFS
                     YPISNSDLTPTHTLHIRSTRNNVLLTLTDGLGPLFGTVTGGTDRTFKNAQRSTYEAAA
                     QAAIKMFERVAEWSRETKTSKKHEPKLRISYNGLFGSAREAVTTTLAGPQGSDIRRLI
                     VRVEDRTKVKIGGVRARKPRRL"
     gene            complement(598873..601749)
                     /locus_tag="CNI02160"
                     /db_xref="GeneID:3259628"
     mRNA            complement(join(598873..599482,599535..600251,
                     600304..600649,600707..601749))
                     /locus_tag="CNI02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657823.1"
                     /db_xref="GeneID:3259628"
     CDS             complement(join(599180..599482,599535..600251,
                     600304..600649,600707..601497))
                     /locus_tag="CNI02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513459.1"
                     /db_xref="GeneID:3259628"
                     /translation="MGHDGNFSGSNGTDDGDSQSQPRQQSHANSQPLGGKSLEARAYR
                     STPSVSSAISGSAVIPEDTFGTIKKHVQSLFPPSDLRPKASDGTSIAGDDSNSSRPSR
                     RPLADISATANRTPTSAGIASEFSTPAELSFGPQSLPFMLRKRELVNEGTPSKPTSTA
                     TVTNLSKDPNGPSTGTQFSGRQQLILDHHNESHETHKSSVNHDTNLHQSSVDHSNKPL
                     FEKKLTSWRRDQIKKAKQPELILASTPKPIPTFYGPLSLPYARNPSGVDATVADDSAY
                     ISPVFGLRPASGGVSSMIGTESVRSISSATQSSGVQSFRSASGSSVLYSTGKKNLGTK
                     LASEDSISIGETYKAMPLVLRDTYQNNGIKADNSILALGSKVAHDSIPRKFDPTSPNS
                     SSETAETTQEATDTYSRSAIFPNPQGKKRVVSDTELLERKLGTSVIGPSKSHANLRQL
                     ISLSPIPGSPADYQRKSDITAIRNACKARVRSTSMSRVKPTPTQSEEEDYTSSYATPI
                     RIPAFLPVFFNPSSMTCEINVSPDRAIAQTPVPGHQTIYVKSGSSLPSKADVSHNWRH
                     KPRSQVFRSKQALQPSRALAQTPSARPLHTDAARHAGQIMTIDKLFEKFSPQVEETQA
                     LFKSPVMGELSSSDSTSLAGPNLSPVPSKVIQDPDGEIYVDKVNSGASDAFKTANTPL
                     KPHSDDVYVAPPAPYLSKATPGAGRLLNNARQSGRK"
     gene            602095..602768
                     /locus_tag="CNI02170"
                     /db_xref="GeneID:3259416"
     mRNA            join(602095..602253,602299..602528,602564..602637,
                     602689..602768)
                     /locus_tag="CNI02170"
                     /product="60s ribosomal protein l31, mitochondrial
                     precursor (yml31), putative"
                     /transcript_id="XM_572851.2"
                     /db_xref="GeneID:3259416"
     CDS             join(602204..602253,602299..602528,602564..602637,
                     602689..602721)
                     /locus_tag="CNI02170"
                     /codon_start=1
                     /product="60s ribosomal protein l31, mitochondrial
                     precursor (yml31), putative"
                     /protein_id="XP_572851.1"
                     /db_xref="GeneID:3259416"
                     /translation="MFGAFRPTSFVSGGLLWKNPWRLSPTRKANQRKRLKRVDDVISM
                     VAESGVTTRSLVKALALPTEAEMSPRGKLKCLRLRLARCMQVVYGQRREYKYTTFSKR
                     DPGYRKSQHKVPKWTRLTLRENPKGF"
     gene            complement(602739..607466)
                     /locus_tag="CNI02180"
                     /db_xref="GeneID:3259755"
     mRNA            complement(join(602739..603352,603403..603510,
                     603572..603649,603699..604034,604087..604189,
                     604253..604310,604369..606247,606533..607466))
                     /locus_tag="CNI02180"
                     /product="expressed protein"
                     /transcript_id="XM_024657824.1"
                     /db_xref="GeneID:3259755"
     CDS             complement(join(602909..603352,603403..603510,
                     603572..603649,603699..604034,604087..604189,
                     604253..604310,604369..605599))
                     /locus_tag="CNI02180"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513570.1"
                     /db_xref="GeneID:3259755"
                     /translation="MTHGRNSSLYSIKGHSSTPSTDHLMVPVRADTATERHRRESIDT
                     ISRERMQLQHAPMNAHQHLESPQERHNRRRKLSSTETVYPSSDAAKKALQSQRAANPN
                     HRRVPTPHTSRRSRSHERMIQKMSSDRSIRSRVSFDSTRSRGTRSNLEYESDDGYSTG
                     IDDSSLGIINGIGPTGEPVEVIGLGKKKPKHRVFQANMLKPALRSSTKLASRSTVNET
                     NSGTSWGERSDKPLPSRPVSYVGPVMGSLSSLRDDTRNNTGSRSRHPSHEANPINYHS
                     ERRSDPPTKTHNPRALTHARSSSQPTGLGLRSLFSNISLTNQSPSTFTLLSSRHSFIT
                     PAENLLDYLRLAKIPSWDRWPGRGAKNGFWIIGTRKGWGEMSWEWHRRLEETERARNT
                     RVLVSWEQKTEWQRDIIDFQAENVPAYPIDMTNRWGAQIFALSADGYDTLEFFDQSVH
                     ESEDNGLLSWLTGALLQTAVSTLHMLRYSSQNFTFHLIPSPRPPHLPPMSTSRSKHFL
                     WDGFGSMVLVNKNDDRDRSMLIEVRPPSVLDLSAIKEFEKTRGGEGWCPYDKETWIGD
                     AGQANLLQAQVYDSCVQNQVYFFAVTNLRYWVFGQFNAGYTSCTVGPAIDRKSREPSL
                     MQCLTAWVIRSVDERPKAQHSERRPTTPTTSHPSRTPRFHQSLRPMDTHAPPYTEGSR
                     RRKKRLQSLPINNCYDDFSPGNPPNYFVGSMQQGMNMMPGYYDQPLGLGQVANVPYPQ
                     PSSAPSMTYSTGWGQRPFSPNVGVQMPYNSGLSWYGGGISWPGMG"
     gene            607608..609818
                     /locus_tag="CNI02190"
                     /db_xref="GeneID:36393037"
     mRNA            join(607608..608116,608170..609637,609700..609818)
                     /locus_tag="CNI02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657825.1"
                     /db_xref="GeneID:36393037"
     CDS             join(607956..608116,608170..609637,609700..609804)
                     /locus_tag="CNI02190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513492.1"
                     /db_xref="GeneID:36393037"
                     /translation="MSDVASQAVSARPLHHLYISPSHECVRSVEDKILHDYSHPSILI
                     SHIHLNPTSRYTTMSSTLVPSPPSEQALRTILPLPSPQDGIYSEPRIPLEVNVVPITW
                     SSDGKHYPAPSLTENRTLLTIISNSRQYTSAFGKEYCRHAKDIVLLMFASFHPCFGRI
                     ITSTEFAYYHLQFLHQQPNMARLLSEILDAVVYNITLVTFKLDEIIACVKWQPSVVRE
                     MDYHAGLEGLHIENNDDEKEKNSASKQGTLHAFNPDHGWSGCIRVPSSATQPIQLFRL
                     KTASELAKGLKHGDSDALIEVKDWILTLTEETEEFECSYRLRSVETEGKSKSRQKGKH
                     SLLAYSGNSNDSNDSDDSDDVDTGRKKRCRSSTIRDGQRNIHIIEPRKTGRIDKSKAG
                     QEAESYSDEADAEDEDDHVGSGMDSPIDIDMTLESGTEDSDPASDIDVYQPTTEDEDS
                     EGEDEEDDEDEDEYVPASRGRGRSSARASSSKLPYRKQAKKHIQVRRRTSKASSSFNS
                     DPNAKPRFSNTHVTHASPINRARHACDECRRRRVKCDETQPACTRCWRLNKNCVWGKP
                     PQYGKMGKKSN"
     gene            complement(609888..611658)
                     /locus_tag="CNI02200"
                     /db_xref="GeneID:3259669"
     mRNA            complement(join(609888..610031,610094..610393,
                     610448..610479,610531..610940,610996..611257,
                     611303..611658))
                     /locus_tag="CNI02200"
                     /product="expressed protein"
                     /transcript_id="XM_572994.2"
                     /db_xref="GeneID:3259669"
     CDS             complement(join(609969..610031,610094..610393,
                     610448..610479,610531..610940,610996..611257,
                     611303..611609))
                     /locus_tag="CNI02200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572994.1"
                     /db_xref="GeneID:3259669"
                     /translation="MGVHALIPAAIQNSGHVEAFHDSVPASHHPHTDTASALYESYPS
                     YASTVQQGSNHDNSQSGPSRVTLDSMRTASSHSLHPKDAQDIEQGDYEAEEEYGPIIT
                     VTWKTMSRLYLLVPIITLAWLVLLVLLATYAWPPTKKEREAGQQYPHPLLPYPFIIGI
                     FASCTVQTMRVPIFVVVEWFRFSPTAIGFTSRILHSTLHEAFRLLTLPLIIPSPASGF
                     HSSYYLGLGWGVAEVTWGIVQGWEQLSLYQEIMPSSDKIYLPDEEDHIDGENEQERAK
                     REGMLSAVEERDEEESNGEIEEEEDEEEDELDESELEKKVEILERMRARRDLEQVIGV
                     PFPNIPFPFHLLWRLDTLLLNLGLTLILSAFYFNPTLIYRHSHPSPLSDGAAVEAEFV
                     LETKPDRDASKYLWLAWVIVVLVHVGVNLAWKVVGRLGVGAVTWGALIIALGSVFAGL
                     GCWGGLV"
     gene            611840..612853
                     /locus_tag="CNI02210"
                     /db_xref="GeneID:3259756"
     mRNA            join(611840..611886,611925..611987,612107..612190,
                     612242..612290,612346..612369,612431..612620,
                     612688..612853)
                     /locus_tag="CNI02210"
                     /product="ubiquitin-conjugating enzyme e2-18 kda,
                     putative"
                     /transcript_id="XM_572712.2"
                     /db_xref="GeneID:3259756"
     CDS             join(611884..611886,611925..611987,612107..612190,
                     612242..612290,612346..612369,612431..612620,
                     612688..612751)
                     /locus_tag="CNI02210"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme e2-18 kda,
                     putative"
                     /protein_id="XP_572712.1"
                     /db_xref="GeneID:3259756"
                     /translation="MSNLAQARLHEERKQWRKDHPFGFYARPTKAADGTLNIMSWEVG
                     IPGKAGTDWEGGMYVVKMNFPDEFPTKPPKCKFDPPLFHPNVYPSGTICLSILDEEKS
                     WKPSITVKQICLGIQDLLEHANVNDPAQVEAYHMFKNDRTSYDKRIRQQAVERRPK"
     gene            613060..617556
                     /locus_tag="CNI02220"
                     /db_xref="GeneID:3259736"
     mRNA            join(613060..613197,613233..615413,615463..616029,
                     616081..616181,616230..616581,616637..617060,
                     617129..617183,617238..617323,617383..617556)
                     /locus_tag="CNI02220"
                     /product="SCP160 protein, putative"
                     /transcript_id="XM_572710.1"
                     /db_xref="GeneID:3259736"
     CDS             join(613168..613197,613233..615413,615463..616029,
                     616081..616181,616230..616581,616637..617060,
                     617129..617183,617238..617323,617383..617456)
                     /locus_tag="CNI02220"
                     /codon_start=1
                     /product="SCP160 protein, putative"
                     /protein_id="XP_572710.1"
                     /db_xref="GeneID:3259736"
                     /translation="MAFSAADLQKQHQELEGAPDPFPALAHAPTPVAKKVQSAPAPLD
                     TSSEDAFPSLAAPSAPSSKGNAKPAISMWASKSSAVKTGATRPMAPGGLGRTGTPTAG
                     SHPFAETFSIPANELVQGKAASDVVKKVQDQTGAIVESSTQMRTGLKTFHVKAADQKK
                     LAQAKRMIEGGLRKPVTVQVEVPITTLGTIIGPKGATLKGITDATGAKVDVPRRETLP
                     SYIPKDNGSDAGSDDEDGEPQVSITISGPATGCADAKDRILSLISHKVSQTSASIKTI
                     PSAFYTIISTQVSELEQGPGEGKVTVKIPTPAVWKALERQAQADAEGEKVVVDGEAPI
                     KVKGDRENVKAVVDEITKSYDSLVQSFNLKKVSIPKRQHRFLIGSAAEDILAQTGCVV
                     ELPPVDDPSDRVVIRGPQAKLVAAQSLVFEKANAVSVEPLDLVSVFRRTTSDPVTHAT
                     NILRYLRASKLKGVSSAHPNVQIFPPFPSTVANTGAVIIEIVGEDGEEVSKVVDEITS
                     LAKGVLPSAVSIVQVDHLAHSLLVGKKGTRIAQFEKAHNLTVVFPPASEESSNVLLVY
                     TGPAGKDVKLEEVFEGASKDLTELAKEVADIKTEILEVEKKWHKYIIGQSGSVLNAII
                     GEDALVSVKVGASPTKFPSTGSEDSVTIRGPRNEVDRVTKQIKQVVEDAKNDDIVNGY
                     TVKFDVEKKYVPHLVGQAGAAINKLRETLGVKVNFEDAPEKETKKGPKKVLVNCSIVG
                     RKEPVEEAKKRLIAQIEKLEDETTEVLSIKRAIQPALIGAGGKYAIRLEEKYGVKLSF
                     PRDSKDKESGANPDQVTIRGGRKGVAAAKAELLEAAAFETESRQEATFKVPSKAVAQI
                     VGKGGATINAIKNDTGAQIDIEREGGEDKQTTITVRGDKQAIAAAKEAVLNVVKEIGD
                     EITVELTIEQKYHRNLIGQGGQNLRDLIASAGGPSEGYKQAGLVTFPKNGDETTDKVR
                     LRGDSKVVKKIQAELEKQVAVLKETIVIGVVVPAAQHATKIGRGGMALQDLQRKTGAV
                     IHFPGSRQYSSVGEIENLDELEGVSEGDIVKVIGTKEVTQKAAELLQITSERGQRNDS
                     RQGRATPDLVSCPVSIPNKYYHAIAETPNLIRQIRAIGGYLNIPQPAPAKPSPKRPEP
                     KSGDDLAAKTARIDLEGDEDVPDVQGEWSLVKNFEGADDEKSEWIVRAKEEDLERAVK
                     VLEQALEKAKKATHVGYLTGLPRSAFPRIIGSKGATISRMRLETGADIQVGKEDDLIT
                     IVGDEESVLQAKDAILSIVSRPGRERY"
     gene            617847..620572
                     /locus_tag="CNI02230"
                     /db_xref="GeneID:3259588"
     mRNA            join(617847..618088,618144..618241,618289..618494,
                     618546..618655,618704..618779,618842..618952,
                     619005..619042,619099..619114,619161..619196,
                     619254..619295,619350..619670,619721..619797,
                     619849..619966,620016..620572)
                     /locus_tag="CNI02230"
                     /product="nad-dependent malic enzyme, putative"
                     /transcript_id="XM_024657826.1"
                     /db_xref="GeneID:3259588"
     CDS             join(617910..618088,618144..618241,618289..618494,
                     618546..618655,618704..618779,618842..618952,
                     619005..619042,619099..619114,619161..619196,
                     619254..619295,619350..619670,619721..619797,
                     619849..619966,620016..620351)
                     /locus_tag="CNI02230"
                     /codon_start=1
                     /product="nad-dependent malic enzyme, putative"
                     /protein_id="XP_024513530.1"
                     /db_xref="GeneID:3259588"
                     /translation="MPSATLIRLSKSLSMSSSNSTVRVALRGGAILNNPRFNKGSAFT
                     HQERSEFALRGRLPYAVDSLEIQVKRAYEQYKSRETNILKNSFLQSMKAQNWTLFYAL
                     LQAHLVEMFPIVYTPTEADAIADYSHLFRRSEGLYLTPPGEKNMEEDFLDACEGRELE
                     LIVVSDGEAILGIGDQGSGGIGISGAKAVIYSLIAGVDPAKCLAITLDVGTNNQDLLN
                     DPLYIGYREKRLRDDRYDQFVDKFVGLVKKHQPECLLHFEDFGVTNAERLLRRYRDQH
                     SIFNDDIQGTGAVTLAAVQAAISVTKSSLKDQRIVIYGSGSAGLGIARQLRDAIALDS
                     SGSPSEAAKQFWLIDKHGLIKKSLGKDKIRSEIEDEFIRDEGDWGEGETGLKEVVKKI
                     KPTILVGTSTQAGAFTEEVVKEMSKHVDRPIIFPLSNPTRLCEAQPKDVSEWSKGKAL
                     MSTGSPFDPVDISDSGEKYIVAECNNALIYPGLGLGSILAKSSKMTDKMIIAGAQRLG
                     QLAPALVKKNANKSLLPDFGDAQKVNFEVALAVLEQAMEDGVARAKDIPEDKDERRKW
                     AENNRWSPGYPNFKYDPEGLK"
     gene            complement(620004..621718)
                     /locus_tag="CNI02240"
                     /db_xref="GeneID:3259560"
     mRNA            complement(join(620004..620721,620770..620946,
                     620999..621178,621233..621380,621437..621718))
                     /locus_tag="CNI02240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572881.2"
                     /db_xref="GeneID:3259560"
     CDS             complement(join(620438..620721,620770..620946,
                     620999..621178,621233..621380,621437..621643))
                     /locus_tag="CNI02240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572881.1"
                     /db_xref="GeneID:3259560"
                     /translation="MSRWSLALWAITIFFAIIAIQTFQARIASYTLKGVQSAIKNNAF
                     REQSFSTMSEANTSKVGDVYFLSHGGPPTIEQYDSAPYEGWRKFGKILQANPPKGIVV
                     VSAHWENQEAFRSGVIVNNNSSNPLIYDFYGFPKHFYELTFRSRAEPELQNKVVEALK
                     ESGITVSRANRGLDHGVWVPFRAALGDETNFPLVQVSLPASSDPRESVKVGKALASLR
                     QEGYAIIGTGQVVHNLRDLFTGGDLSYTSPFLSAVSIAVSEPDLVASTLKLTTHPLYR
                     RAHPTDEHFFPLLVASGAVQPGEKVEEIYKGVVDMGGRNVKNDGLGWGMWRWTAA"
     gene            complement(622407..625620)
                     /locus_tag="CNI02250"
                     /db_xref="GeneID:3259750"
     mRNA            complement(join(622407..622986,623050..623088,
                     623140..623169,623220..623330,623384..623447,
                     623503..623538,623596..623650,623713..623718,
                     623790..623829,623898..623961,624020..624104,
                     624155..624348,624411..624557,624633..624807,
                     624844..624978,625042..625078,625208..625620))
                     /locus_tag="CNI02250"
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /transcript_id="XM_024657827.1"
                     /db_xref="GeneID:3259750"
     CDS             complement(join(622651..622986,623050..623088,
                     623140..623169,623220..623330,623384..623447,
                     623503..623538,623596..623650,623713..623718,
                     623790..623829,623898..623961,624020..624104,
                     624155..624348,624411..624557,624633..624807,
                     624844..624978,625042..625078,625208..625372))
                     /locus_tag="CNI02250"
                     /codon_start=1
                     /product="protein-vacuolar targeting-related protein,
                     putative"
                     /protein_id="XP_024513488.1"
                     /db_xref="GeneID:3259750"
                     /translation="MDGSNASDRLTTQEMEEGHLQPVQDDSALTDEATLFASPLPIVG
                     ERKTTTRKEVWSWYIYYVGNSGLGPFNFAISAWQNLLYLAGWDPAYPTGTVPCGDGAC
                     NLIAFGSERSVNSIVLITNGLSFAFQAVLFLIMGSFADYGIIRPHITTAFTVLAWAVS
                     FAWLGVEDPSKWQAGTALYILGLIGYQGALTFWTAAFPGLARDLPEIKDSEEKLARGD
                     TDRKSHDRLDMLARNRLANVSFLVCSLGELVVLAILAGILEGVINDDADSNTKALSIV
                     CAYSAGVWIICATPWLLFEQYRPGHQLPPHTTYFTVGIKQIYHAFRLCLRLKQTFIYL
                     AAYFFLGDCLNTLVTVIATLQNEVVSYDTKMLNYLLIDGIAAQALGIGLFWAVQKRYT
                     IPTKTMLLFNAFWILLLAAWGCVGITQTRFGFHNAWEFWAYQAFYGIAVCPWYAISQA
                     MISEVIPRGKEFLFFALFSIIGKTSSFIGPFVSSAIIDDSGNTNMPFTFLLGLGVVSV
                     GILACVDVEKSRKECRKYLEDEAIRVYGMDLADVVVISGQSIEMNKAGRTGASVEETE
                     KGDLIA"
     gene            625886..629649
                     /locus_tag="CNI02260"
                     /db_xref="GeneID:3259534"
     mRNA            join(625886..625978,626025..626372,626421..627625,
                     627672..627704,627751..628021,628076..628291,
                     628338..628385,628435..628520,628571..628746,
                     628806..628951,629005..629054,629113..629314,
                     629378..629649)
                     /locus_tag="CNI02260"
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /transcript_id="XM_024657828.1"
                     /db_xref="GeneID:3259534"
     CDS             join(626148..626372,626421..627625,627672..627704,
                     627751..628021,628076..628291,628338..628385,
                     628435..628520,628571..628746,628806..628951,
                     629005..629054,629113..629314,629378..629467)
                     /locus_tag="CNI02260"
                     /codon_start=1
                     /product="conjugation with cellular fusion-related
                     protein, putative"
                     /protein_id="XP_024513572.1"
                     /db_xref="GeneID:3259534"
                     /translation="MPTRRRPSQHEERDPSDEVAQQQGMDVELLTPHSSPSTSRPDSL
                     LHNSPRDSPHPTSRLPSFETSTSIPRSNGQEDATYGSRPNLKVRWRSKLGEDYRTDTR
                     SFHSPRPSTAPSEEEIAAVRRSVTSIFRRPQGYSPRQSRSDLESGPPGSRSSVLSFES
                     DSFVQPRPMKRRASSRRSSAGSWASSDNDSDYDAQVGTGGILSALLGLYGNEASYKKR
                     KALRSLLRRSDKDNEDSHRGRARKRWSTESLFALPSRNSSRSASRSVSRGATSAPDGP
                     EVARRMRDEREKVHRNRRHQRLPHRSQDLNQPYIPSARYSNPLQPAPNVTAAQRFRTF
                     MTGRSAPATLLGAPDAVDHSKSQEESRYRTMAALLITTNSLMSIGSPILAHVAPASGQ
                     EGESSGGHRKISWYESVAEKERAEQEREQKEEHDLGLIDGEEDNIRAMEEGMCGGKRK
                     RKRTRGKRIQREMAVTKHVSNLIQRKKFIEELAKAVVNYGAPAHSVEAWLASTADILS
                     VEASFVYLPTVLLVAFRDTDVHSTDVLFIRPSGGLELYRLSLVHEVYRRVTHDKISAS
                     QGRRALKRIGRETLPYSRLTLILTAAVASAISARVAFSGSFIDILMSGALGALFTLVQ
                     FTVSKENRVFSNIFEIGMAGILSFVARGLASSKYFCYESLASASIVLILPGWHICLGA
                     LELGSKNIIAGGIRLVWAVVYTLFLSLGLGIGSEIWDSFGPPQPGNDSNSSDATEVQC
                     YRDPNWDYWWYTEPSDWWLFLLVPVFAFSLAVWFRADWRSKDIVVMVLVACAGYVVNY
                     FLSGQISQINVTSAVSAFAVGVLGNLYSRLGRGSAFPSMVCGILLLVPNAIAAAGGLA
                     TNSIDQSDSTNSNNEQEINTAVIVSIRMILVGVGLAVGLFASTVAIYPFGKTRRYIFS
                     Y"
     gene            complement(629688..630413)
                     /locus_tag="CNI02270"
                     /db_xref="GeneID:3259807"
     mRNA            complement(join(629688..630024,630081..630216,
                     630279..630413))
                     /locus_tag="CNI02270"
                     /product="expressed protein"
                     /transcript_id="XM_572879.1"
                     /db_xref="GeneID:3259807"
     CDS             complement(join(629907..630024,630081..630216,
                     630279..630366))
                     /locus_tag="CNI02270"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572879.1"
                     /db_xref="GeneID:3259807"
                     /translation="MSANEQIRQNEQAINSYAAKAGAGRQSDSTVDSGVNEQVTAQFP
                     GSTVQVGGTKRGENPPIPDEEGGGINPGTGHQTKAQDFEGPGGPEEKQARTAYQRPGD
                     QNVPNFLEQGQ"
     STS             630308..630501
                     /standard_name="CT16"
                     /db_xref="UniSTS:470712"
     STS             630310..630505
                     /standard_name="AG2"
                     /db_xref="UniSTS:470716"
     gene            complement(631035..633712)
                     /locus_tag="CNI02280"
                     /db_xref="GeneID:3259598"
     mRNA            complement(join(631035..632128,632178..632549,
                     632599..632865,632913..632972,633023..633447,
                     633495..633529,633577..633712))
                     /locus_tag="CNI02280"
                     /product="cell wall chitin catabolism-related protein,
                     putative"
                     /transcript_id="XM_572877.2"
                     /db_xref="GeneID:3259598"
     CDS             complement(join(631117..632128,632178..632549,
                     632599..632865,632913..632972,633023..633447,
                     633495..633529,633577..633655))
                     /locus_tag="CNI02280"
                     /codon_start=1
                     /product="cell wall chitin catabolism-related protein,
                     putative"
                     /protein_id="XP_572877.1"
                     /db_xref="GeneID:3259598"
                     /translation="MPSPTAVAHAKRLSIASNSPKGKMEQFTFTLGKLDAGMAILLGP
                     NAHLLEFPSLLLPTPSPDAPPLGPGSILTITVSRDLAAEYAAQKAFKELQDSILNAFS
                     IPPKVPVVRLRNVTQTNVTVEWDRIDVGSAEFRGLEMHRNGQRWGRVGGEYGGGIQEK
                     TEWKTGGLQSGEEYTFQLVLKTTAGTYPSNIIRVRTHTMDNLTGLLICFGPMHPPQLV
                     DQLRHCLRQIGARESPQVALDTTHFVCTTPMVGSDEHGRGGGVDPEYQEALRMNLPVV
                     GPGWLFAVADQRKLFPISNYILPSLPSNASLDTAPPPPFRRPSPLKRASLPIPSAPQS
                     PIRDDDDAPRSPSPETIARMSMVPASPTLPSHAPGDFSEQRRESLGAGEVPRVKSPRP
                     EAQDAPRSRSPKPEADGKLDRGFKFPLSSPASAASSSSQSSPLSGSQFTSPTAGEAQV
                     PATDPASTLVSTPGDAQATYDYADIPLQTVSPPAEIEEEVKGISTEPIVVEEPRGATE
                     QLPIKTELPVQINGQQEREGGKAQTIDEAVKEFENVVSGGASNLHAESIASPIPIENV
                     ETATHPDAEYHAADLPQTEPSKNPEPLEHRAAPSEEALSEESTAKKAEANVLPEVVES
                     VQLIPVEDGTAGKDMDLESRPAEDIVKANSSHSPAKKEEDTPSNIEQPKEAIIAESEP
                     QSDIIPENATPTASTPARSSQSTPVSKSQKKKNKKKKKAQASAAAAAPREESEANGNG
                     EGLEDVDLN"
     gene            634506..636783
                     /locus_tag="CNI02290"
                     /db_xref="GeneID:3259705"
     mRNA            join(634506..634827,634879..634900,634965..635110,
                     635160..636019,636078..636187,636236..636309,
                     636360..636783)
                     /locus_tag="CNI02290"
                     /product="polysaccharide synthase, putative"
                     /transcript_id="XM_572855.2"
                     /db_xref="GeneID:3259705"
     CDS             join(634794..634827,634879..634900,634965..635110,
                     635160..636019,636078..636187,636236..636309,
                     636360..636463)
                     /locus_tag="CNI02290"
                     /codon_start=1
                     /product="polysaccharide synthase, putative"
                     /protein_id="XP_572855.1"
                     /db_xref="GeneID:3259705"
                     /translation="MLYLTADKFPVFVPFGVIGFYRYLWYIIRLLARATYRPIPLPEN
                     PTYVAHEDVTIIVPTIDAGEEFKDAAKSWLAGNPKEIIIVTEAKMEGPLQDLANQVDP
                     ERIRVLTVPAANKRLQMSHGIRNTTTDIIVFADDDAIWPETLLPYVLACFEDQQIGGV
                     GTSQRVKAVNSRMTVWEVLAAFRLTIRNIEIASSTHIDGGIPCLSGRTAAYRTIILKD
                     PDFLHGFTNDFWLGKYHLNSGDDKFLTRWMVSHGWNTYVQVCKEAELLSTMKPNWRFL
                     LQVLRWTRNTWRSDFRSIFTERYVWTKHPYVAYTMIDKFINPLTLLVGPCLVIYLIVK
                     STKDVLDGGYHLAAWDIVVSYLVWLMCTRTLKLLPHLWNNPKHIIYVPAFIAFGYYFA
                     IMKLYALFTLHETGWGTRAGIGNITEATMAAEKENEASNFARQQQPDFQYPAARRKA"
     gene            complement(636723..637495)
                     /locus_tag="CNI02300"
                     /db_xref="GeneID:3259767"
     mRNA            complement(join(636723..637179,637232..637495))
                     /locus_tag="CNI02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657829.1"
                     /db_xref="GeneID:3259767"
     CDS             complement(join(636799..637179,637232..637420))
                     /locus_tag="CNI02300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513575.1"
                     /db_xref="GeneID:3259767"
                     /translation="MSSLLEDSYTALPLSTTKSQPSPPIQSYQLRQSICEVETELLIQ
                     TFDDRILAIVTQNGKVGCLTQASLPQQIPLPPPTVPLQSNGHPSNLHILSILPPPPHS
                     ACLTPLLGSPPQQTLHELYVSQIATLVWWALQTSGQMRRHVVVGLSLKQNGRRARDED
                     DAKEEALVESERERYAGIMDMVSRWPGPE"
     gene            637682..641468
                     /locus_tag="CNI02310"
                     /db_xref="GeneID:3259597"
     mRNA            join(637682..638355,638409..638479,638531..639106,
                     639158..640021,640074..640203,640261..641468)
                     /locus_tag="CNI02310"
                     /product="telomeric DNA binding protein, putative"
                     /transcript_id="XM_573004.2"
                     /db_xref="GeneID:3259597"
     CDS             join(637718..638355,638409..638479,638531..639106,
                     639158..640021,640074..640203,640261..641305)
                     /locus_tag="CNI02310"
                     /codon_start=1
                     /product="telomeric DNA binding protein, putative"
                     /protein_id="XP_573004.1"
                     /db_xref="GeneID:3259597"
                     /translation="MAFEDTLKQLRDFLRLPTPSLEDLTFRISSTLSTLHIHPTSLPP
                     SSIPLTDLKALARYLPAVQNLLLQDVLPHFVSILDDRNQELVRELFVPQKKVEGLEIR
                     RNIALVSYFTLPSYLNAPKQNYPTLPKPMRSFFISLLDTLSTEFGLDDLYCTVFPNKE
                     GITKEGKDGVKILQWEDALRSIIGIPAKTGNAIGRWELEEAVKIDVPVTLLSRPYFDR
                     LVRHLENLLYEMSQRPSPDVTPLRLVIEKLSNIGLLTSQSPNTSSRSPSLLFPLLPPL
                     LSHLHPPSSSPSLPYPPTFLPSVFLPLPSSILSAFINALTTHLSFYLIDPANPLQPHK
                     PDERVKRAVQVFQSIIGNAEVGNEAWQAVVQSVVAKKGKSRMRLGEWREQARNRLIVG
                     WIAQGGDVAVKAFIEIVVDTWTDPKYVKFSMFSEQFSLTHVLLLSLSLLPTYSPWLIQ
                     LSHRSRFILAFQSYLSHPDPSIRRLGMVVGEIMSELTIPDTEVDQSEKKKQEDEIEEL
                     RKGLEVDEDNEDTKPKTTATRSGSVRLKFKGMWDGNGDGREESRWLRGNVGIKDANAL
                     TGDDDEQWLLGWKDIPSSPTVEPQPVPESSLGRRATRPANTKPASPKPREKKPKVVML
                     DPDQQDDPLSGYASSSPSSSRAPSPTPEYLDEIAADPSLGLDEANKKKVTRPVYIPQL
                     VALLKERDKPENVEMGLSWGEGLVRAKREFGTELAENAVGVTLMVLGLNDSFDIENFE
                     EKKQGLLNALVACAPKQVAPFLCEQYFNSQFSLQHKASILTALAMGARELAGLSVPQT
                     PRTTRSIDFPSKTLPPTLHSKYISSADVPSNPLLGYGPDDQLDQAIDGVRNLILSKGA
                     SKGEETVPELAREKRLRVGEIRRPKVAPVNSLASSQMGQLARPPPVVAFKDIAAEIFI
                     LPLINRFWQHFQDSSIREERAVMLGARYRAAGAGLVLFPMAMEKFMMALALMLDAARY
                     SPLWLSVICPEALELAMTIGIRHPPRPLLSGEEGIDPSRAEAQVLSAALELTLVCLDV
                     SVDLDGGRTLAMDKSALVMAVGEWASGVFKVESEGGEVSVGQGGRIEGKIKAEAAGVV
                     VKVGEIGEKWGRMGMDMGF"
     gene            complement(641316..642998)
                     /locus_tag="CNI02320"
                     /db_xref="GeneID:3259711"
     mRNA            complement(join(641316..641650,641714..641966,
                     642047..642138,642194..642998))
                     /locus_tag="CNI02320"
                     /product="expressed protein"
                     /transcript_id="XM_572992.2"
                     /db_xref="GeneID:3259711"
     CDS             complement(join(641419..641650,641714..641966,
                     642047..642138,642194..642945))
                     /locus_tag="CNI02320"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572992.1"
                     /db_xref="GeneID:3259711"
                     /translation="MTASKNPSAGSSRPSSDKERPQRPKSDYSDISTEIDSDKEIAVC
                     NFGNVEKEKPAPNPLQYPLRTTGAKKTVNLEEHDKRTSERREIKPSSGINANRMEDDT
                     DSDVSDDDYSTDITAVESDTKVESWENRSKSSSSRKPNYSPSSKSNTKKRSRLTQEDY
                     LSRSQKLHNSYIQRPPAWASCCGDCSRCWKGTWSWWGWKWLVRKLPFLLALAMLLCGA
                     VCAVTGPQTGIWALEAGGYKFGGLGWCDSQESNCQEGILYTDVTASSQWPAMTVPILL
                     LCFGFLAIIQLTFLLFTFLFVRHIFLSCCSDPESQSQNVRSQKQNPRRVKSLIWFERI
                     MTFCGIAYSVVAVILAIWVSQTNAEGDVGYKLSTFLLVSPLVWFFLSISYRSRWAYNS
                     DAFLSSASLRQKRGGKYEETSYEDPDEDEVIVSRDGIDPVGRPKRKLRKY"
     gene            complement(643193..646955)
                     /locus_tag="CNI02330"
                     /db_xref="GeneID:3259374"
     mRNA            complement(join(643193..643332,643392..643911,
                     643968..644283,644337..644603,644650..645077,
                     645131..645171,645226..645671,645724..646584,
                     646659..646955))
                     /locus_tag="CNI02330"
                     /product="NAD+ kinase, putative"
                     /transcript_id="XM_024657830.1"
                     /db_xref="GeneID:3259374"
     CDS             complement(join(643294..643332,643392..643911,
                     643968..644283,644337..644603,644650..645077,
                     645131..645171,645226..645671,645724..646447))
                     /locus_tag="CNI02330"
                     /codon_start=1
                     /product="NAD+ kinase, putative"
                     /protein_id="XP_024513574.1"
                     /db_xref="GeneID:3259374"
                     /translation="MPDTRPSTPPPSSSARGSRAPQPSPYLNVPTTARMRHPAAPSPL
                     SKCDPTLENPRSISAMSSPDQKSLAAPSTSALAIPEASPCFIHSHLDRHGSLQDWLKN
                     KSVNNRTHFVPDSPTSSKARSSHGQHHHNNTTEPVLQSDVPFPSHNNQENISSPPSAS
                     QPSSPRDNASHVTLSRKGPLFNGYESDQSSVNEYGTRTPNLLAASGLLGDGLLEGDEE
                     GNGSLTKQLAETAQGVREMSKELGRTKVRSRIQNVLIVTKARDNRLIKLTRELALYLM
                     QKRPTASPDGSSSRHGNGTRGRGLVVYVDAQLQTSKRFDAAGLQREYPHLFVPMARQR
                     SSSSASVNTLSHISAFSSTTSMGEAAKQATNGEGQLRYWTSELCSATPHLFDFVITLG
                     GDGTVLFTSWLFQRIVPPVLPFALGSLGFLTNFDFYGYKETIDKVVDEGIRVNLRMRF
                     TCTVYRAVASGDITVSKGKKRKAIKKRGGEILMSRVDKGGWESLEGPTPAASPSDFEG
                     EDKEIMCYSTRPVEQFEVLNDLVVDRGPSPYVSLLELFGDEHHLTTVQADGLTVSTPT
                     GSTAYSLSAGGSLAHPQIPAILITPICPHTLSFRPMLLPDSMELRVCVPYNSRSTAWA
                     SFDGRGRVELKQGDHIKVTASKYPFPTVCADKASTDWFSSISRTLRWNEREKQKSFVV
                     VEEASDPPERSRDRKEDAKAGLFEEGRAKQKFEKDANARGDLVESEDEEDDEEIFDID
                     DKSGPSSPPVQQQQQPTKNEMFPHQLHYLLSSHQNGLETPNRFVTPYSAPPALSQRHL
                     VEAIHKAKIDEKENEKGQRDSTRESPSALRVDRSRHLSQLGRTVSQSTEETEAEGVER
                     EEEKSRKEEETPKHGQQQRHHHHHHHHHHHGHKPKRTPSNLAEKVADCKAKAFAFFGQ
                     DDSASDCSGSEE"
     gene            complement(647219..650103)
                     /locus_tag="CNI02340"
                     /db_xref="GeneID:3259398"
     mRNA            complement(join(647219..647379,647433..647730,
                     647784..647937,647997..648078,648131..648140,
                     648194..648300,648351..648364,648433..648463,
                     648515..648580,648628..648682,648737..648761,
                     648812..648956,649011..649242,649296..649516,
                     649574..649677,649727..649765,649816..649840,
                     649981..650103))
                     /locus_tag="CNI02340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657831.1"
                     /db_xref="GeneID:3259398"
     CDS             complement(join(647345..647379,647433..647730,
                     647784..647937,647997..648078,648131..648140,
                     648194..648300,648351..648364,648433..648463,
                     648515..648580,648628..648682,648737..648761,
                     648812..648956,649011..649242,649296..649516,
                     649574..649677,649727..649765,649816..649840,
                     649981..650020))
                     /locus_tag="CNI02340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513568.1"
                     /db_xref="GeneID:3259398"
                     /translation="MANESVEGSNWGRVLICGGTDWATNGRKERSSGKVPTDLMEPHI
                     LRSLCNVKASKIITGPSANYAIILDIHGAAYLFGRPPAMVQSNGVISENTPLKISPSS
                     VGSPKGTKWVNGAAGRSHFLLVDSNGDVWGCGNNVVGQIGVPVAMVVEKLTKVAGPWV
                     RDPEAKVVQVTAGHTFSLFLTFTGQVYASGSSEFGQLGNGKTGERLVKAGKIAYDIEV
                     PPRLVQGLENVKITEIASGNQHSLALDDNGYVYSWGFAGYSRLGLQDQKDRLLPTIVP
                     SFAGNNELTRARSIACGPTSSTVVDRQNMILIAGKWKLSGDGSTGQPYTRFKHIQDVM
                     ACKVIKTSSGGCTHFITTPDPEGGVMTVGFGQGVLYGELGLGSDSAKSATKPQKIIPL
                     SGVDMIDVVGGAFFTLFLARPNSALSDLDRYPLHINSASLCLVCNTDHEQDAPLECER
                     CDQPYHIGCLSPPLSAVPEGEWFCPECALEADAGPDEPFKPALGITIPKLANGKKGAK
                     QDVVESRGNPEAAVSATNGALTPSKSVKGGKRSWDEERSAQGSGKKARNSKN"
     gene            650347..652357
                     /locus_tag="CNI02350"
                     /db_xref="GeneID:3259760"
     mRNA            join(650347..650670,650729..651165,651218..651258,
                     651304..651731,651790..652056,652118..652357)
                     /locus_tag="CNI02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_572857.2"
                     /db_xref="GeneID:3259760"
     CDS             join(650376..650670,650729..651165,651218..651258,
                     651304..651731,651790..652056,652118..652287)
                     /locus_tag="CNI02350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572857.1"
                     /db_xref="GeneID:3259760"
                     /translation="MSPISSDKASESFRPMREQASSVAPTTSSPHPDKISQCFVHSLF
                     KKRCLAALLSNESQSEKTPENQTPYYEDEDEEDESLTKQLAETAQSVREMNKELGRRI
                     VRSRIQHVLIVTKVNDNQLVSLTRELTLHLMQKSPSIPRGTNNRYGTASLGRGMVVYV
                     DSEFEASKAFDVPGLQRDHPELFEPMISNRSSSSLSSMNTPNESSTDEGPVTSGSSTP
                     VGEGQLRYWTYKLCSNSPHLFDLVITLGGDGTVLYTSWLFQRIVPPVLPFALGSLGFL
                     TKFDFKDYKEIIDKVIRDGIRVSLRMRFCCTVYRTSTPGDIDGPKAKKRRIIKDGSAT
                     ALKKRVHKSGWESLEDEEMDSHLSDAGSEEDVIMRHSTKPEEQFEVLNELVVDRGPNS
                     SMSSLELFGDDYHLTTVQADGLTVSTPTGSTAYSLSAGGSLTSPQTSNILITPICPHT
                     LSFRPVVLEDSIDIRVCVPFDSRTTAWTSFDGRSRLELKQGDHIKVTASKYPFPIILY
                     ADKSFPDWASSLSRKLRWNERERQKPYVLVEEARQQK"
     gene            complement(652870..>654495)
                     /locus_tag="CNI02360"
                     /db_xref="GeneID:3259776"
     mRNA            complement(join(652874..653016,653075..653171,
                     653230..653665,653727..653967,654024..654120,
                     654178..654246,654307..>654469))
                     /locus_tag="CNI02360"
                     /product="NADPH dehydrogenase 2, putative"
                     /transcript_id="XM_572706.1"
                     /db_xref="GeneID:3259776"
     CDS             complement(join(652938..653016,653075..653171,
                     653230..653665,653727..653967,654024..654120,
                     654178..654246,654307..654469))
                     /locus_tag="CNI02360"
                     /codon_start=1
                     /product="NADPH dehydrogenase 2, putative"
                     /protein_id="XP_572706.1"
                     /db_xref="GeneID:3259776"
                     /translation="MTVIQSPKLFTPIQVGEYELKHRIVMAPLTRLRAETKTAIPSEW
                     AETYYSQRASDGGLIVSEGTFIAEELRGYENVPGIYTPEQIAVWKKITSGVHSKGGRI
                     FCQLWVLGRVADPNVIPVIYSVGTIRDDSPSYIAAPEPEGQRKPLTPVTEADMDRFIG
                     HYIQASKNAIEAGFDGVEIHGANGYFIDQFLQTNSNDRTDQYGGSLENRMRFPLRVLN
                     AVCDAIGPKRVGIRMSPFSEFQSMRMEDPLATFVPWAQAIVEAQPELAFIHAVEGRGI
                     LTPENEWYIQDNLNPIREVILNKGKSVRFIPAGGYMPDTAFEHAEKYPEDLIAFGRYF
                     ISNPDLPNRVRNGWPLHKYDRTTFYSQSSVGYNDYKDYKPETEALAQDEAAPKEGTTK
                     A"
     gene            complement(654945..656668)
                     /locus_tag="CNI02370"
                     /db_xref="GeneID:3259465"
     mRNA            complement(join(654945..655484,655539..656039,
                     656096..656342,656392..656668))
                     /locus_tag="CNI02370"
                     /product="mannose-6-phosphate isomerase"
                     /transcript_id="XM_572705.1"
                     /db_xref="GeneID:3259465"
     CDS             complement(join(655069..655484,655539..656039,
                     656096..656342,656392..656532))
                     /locus_tag="CNI02370"
                     /codon_start=1
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="XP_572705.1"
                     /db_xref="GeneID:3259465"
                     /translation="MSPSVFKISPGINSYDWGKKGSASLAAQLATTSIPDFSIDEDKA
                     YAELWMGTHPNNPSRLSDNTLLSEHLKSHPELIGSSVSSKFEDCKDGSLPFLFKVLSI
                     GTALSIQAHPDKPLAKKLFDEKPDVYKDPNHKPEMAIALTPFLAFLNFLPLSVLLLHL
                     LTVPELQEFVDSSLTESLASSLGLPTSQPPDTSLFKPTESPATAEQKDILKQIFAALM
                     SADKKLVEEAISKLIKRYQAKRDIKENEKSLVDLALRLNDQYPGDVGVLCVFLLNVVE
                     LKRGEAAFLGANEPHAYIEGDIIECMATSDNVVRAGLTPKLRDVDTLVSMLTYEAAPG
                     NKQLLQPTPFQKGDDTTKLYDPPIAEFSVLRTELSKGMKTSHRPVEGPSLCVITEGEG
                     VVRNGNDRSEFVRGDVIFVGAGKEVEWEAIKGLEMFRAYVEA"
     gene            complement(657109..659024)
                     /locus_tag="CNI02380"
                     /db_xref="GeneID:3259610"
     mRNA            complement(join(657109..657665,657722..657890,
                     657950..658086,658133..658363,658415..658648,
                     658700..659024))
                     /locus_tag="CNI02380"
                     /product="expressed protein"
                     /transcript_id="XM_572704.1"
                     /db_xref="GeneID:3259610"
     CDS             complement(join(657174..657665,657722..657890,
                     657950..658086,658133..658363,658415..658648,
                     658700..658993))
                     /locus_tag="CNI02380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572704.1"
                     /db_xref="GeneID:3259610"
                     /translation="MNDQTLPPFLRVNPSPVPPPSHARLQALYASTSAQRTANPTGYA
                     ANAQWWAGVLEETLRTGWLNGEGGDRLVLKVDNGVLGRLEDEKGSRPRGLGGVVETLA
                     TTTPPTLHALTHFMTSATPLHVPASLTSRFVGRPLWWAFSQLNPFGGSEKVVKEEALW
                     AKYGQGKEYVHMPLLEQSAAAFTAHMLKSPILSYTSSLYDLDTFLAEYGEACFPTGPT
                     AKELPKGKHGLSKRDAEVLVKWLSRDCQLVVTDGSVIKVLDADQIAENHPISEADRGA
                     VSVLNALRRVEKQIVGIEEQISQSHEKAKKYLASKQKNIALSYLRSKKHLEDLLAKRV
                     ASSEQLRAVIRSIDQAKGDVEIMAAYETSTSTLTQVLAHPLLSPERIAATTDALAEAM
                     ADQEEIDQAVRIGGEVAMGGKRVEIDEDELAKELEALVEEEKEAEQEKTEKKTPVEAE
                     KKPDMTTELPRTPLSAPASGKEEKEEGPVADEERLWQQRYEEAQARKQAEKERFETER
                     LRKEEKIVAE"
     gene            659222..661673
                     /locus_tag="CNI02390"
                     /db_xref="GeneID:3259513"
     mRNA            join(659222..659470,659517..660251,660306..660369,
                     660414..660982,661032..661673)
                     /locus_tag="CNI02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_572703.2"
                     /db_xref="GeneID:3259513"
     CDS             join(659273..659470,659517..660251,660306..660369,
                     660414..660982,661032..661097)
                     /locus_tag="CNI02390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572703.1"
                     /db_xref="GeneID:3259513"
                     /translation="MPPSSLPLVRLPPKAVVHRFGAPTSAPPSSALLRFPVQGWTINR
                     ESAKPEGWAIVGDADGRKVAVETLLSRHRIQPFSPPPGPFPYITSLISSSTDSWSSTT
                     EAPSKPIRHLAFARPPTTGEFTDFTARYGALLEEDRLSYRENLQNLHPRPSDEDIERV
                     AKLMRIGHLLDLPTVSFSSGQTRRGRIASALLTRPVLLLLEDPMAGLDVPSRKEVSNL
                     LGELNASETIKIVLILRGKGGEEMPTWITDVAEVRNGEVWIGKRDEYEQKHAEEQVRN
                     QAKVEQVAEKSDEVPGEPVIKLDGVSVSYGEGTRQVLKDIKWTVKPGEKWHLIGANGS
                     GKTTLLSLILGHHPRSYSLPASSLLLFSKPRRSIPSPTLRTLIGHTSPEIFASFPRGM
                     GLSALEAVGSGFEGIFSRRNLTSEQKERVKYLLGQFKDLLKPSSLSGKPAPDVTVQEI
                     ANRNFAHFTPPQQGLLLFLRAIVRKPKLLILDEPSQGMDEVIWERCKGLLEKEWEDEG
                     KGMAVIVVSHYEDEVPWKKGRGKVLKLDQGVATVQ"
     gene            661907..662961
                     /locus_tag="CNI02400"
                     /db_xref="GeneID:3259783"
     mRNA            661907..662961
                     /locus_tag="CNI02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_572702.2"
                     /db_xref="GeneID:3259783"
     CDS             661941..662822
                     /locus_tag="CNI02400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572702.2"
                     /db_xref="GeneID:3259783"
                     /translation="MSLSSSPAPTSTMTFEPTINHILSLPNLLQPISPPHAALHLARL
                     RLLYSIPADGQSVSETSSSSSSSSGTRSKLTLGGWCNHCGGLRKGMGGAQRGGRGQNK
                     DKEKEEKTKAIRERARKRVRELSNLTENEKEEKKMARKLEIAGAVQKRRQPAECTTCG
                     AVYTRPKPDKKTLAAFPSSRKTRKQVAEAKAEEEAKSLALKAEVEAAGKIEREAQPPQ
                     TLLSHPAFSHIPSSPPNLPTHPPPLPMKNYAGSTSATTDVAKKKTKTKKSGLSKLLAE
                     NKERNESAKGAGMWGLG"
     gene            complement(662849..664624)
                     /locus_tag="CNI02410"
                     /db_xref="GeneID:3259805"
     mRNA            complement(join(662849..662969,663019..663164,
                     663221..663251,663308..663315,663386..663466,
                     663522..663674,663724..663758,663811..663894,
                     663945..664043,664092..664208,664265..664299,
                     664352..664624))
                     /locus_tag="CNI02410"
                     /product="Short chain 3-hydroxyacyl-CoA dehydrogenase,
                     putative"
                     /transcript_id="XM_024657832.1"
                     /db_xref="GeneID:3259805"
     CDS             complement(join(662952..662969,663019..663164,
                     663221..663251,663308..663315,663386..663466,
                     663522..663674,663724..663758,663811..663894,
                     663945..664043,664092..664208,664265..664299,
                     664352..664534))
                     /locus_tag="CNI02410"
                     /codon_start=1
                     /product="Short chain 3-hydroxyacyl-CoA dehydrogenase,
                     putative"
                     /protein_id="XP_024513534.1"
                     /db_xref="GeneID:3259805"
                     /translation="MITPVLRSAMSSQRAATYRLSTVQRHLSTTSATRKVEELTVFGA
                     GLMGAGIAQVGAQNGLKVVLADVTDKALENGINIISKSLARVAKKKSPDDIEGFTNNV
                     LKNISTTTDSSQAVENADLVVEAIIESIKVKRDLFGFLDGKAKSDCIFATNTSSLSVT
                     EIAEACSPERQAKFAGLHFFNPVPAMKLVEIIRTPQTSQETYETLREVTLQMGKSPVT
                     CNDTPGFIVNRLLVPYLLEAIRMIERGDATAEDIDTAMELGAGYPMGPFKLLDFVGLD
                     TTSYIAEGWREKAASGAISKELVSPIPLLDKLVKEGKLGRKSGHGFYKYEGKK"
     gene            664886..666676
                     /locus_tag="CNI02420"
                     /db_xref="GeneID:3259765"
     mRNA            join(664886..665111,665164..665238,665295..665366,
                     665434..665451,665516..665652,665705..665840,
                     665895..665957,666010..666286,666342..666676)
                     /locus_tag="CNI02420"
                     /product="uricase (Urate oxidase), putative"
                     /transcript_id="XM_572701.2"
                     /db_xref="GeneID:3259765"
     CDS             join(665075..665111,665164..665238,665295..665366,
                     665434..665451,665516..665652,665705..665840,
                     665895..665957,666010..666286,666342..666462)
                     /locus_tag="CNI02420"
                     /codon_start=1
                     /product="uricase (Urate oxidase), putative"
                     /protein_id="XP_572701.1"
                     /db_xref="GeneID:3259765"
                     /translation="MSHPGYLSAARYGKDLVKVARVVRDGEQHHIVEYTLRVLLEGEI
                     ETSYTEADNSCVVATDTVKNTCNIFAKTSPYVLDAPVFALHLGLHFVTKYKHIHKCFV
                     DIIGLKWSRISVDGKPHKWSFIRDGDEKAIVECVVDGTAGPDAATANVKIGIKDLLVL
                     KTSGSAFENFHRDENTTLADVADRIFSTSVSLQCSISLPPNTPLTIDNLGSIAKELDF
                     PKMKELILKDVLDTFATDESASVQATLYLTLQKILASCPAVKDASMQLPNKHYIPVNL
                     SAFGLDNKLGYEGGAEVFYPAADPSGYITATVTRK"
     gene            666869..666977
                     /locus_tag="CNI02430"
                     /db_xref="GeneID:3259585"
     tRNA            666869..666977
                     /locus_tag="CNI02430"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3259585"
     gene            667098..668198
                     /locus_tag="CNI02440"
                     /db_xref="GeneID:3259623"
     mRNA            join(667098..667261,667441..667478,667529..667592,
                     667640..667714,667764..668008,668078..668198)
                     /locus_tag="CNI02440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657833.1"
                     /db_xref="GeneID:3259623"
     CDS             join(667240..667261,667441..667478,667529..667592,
                     667640..667714,667764..668008,668078..668104)
                     /locus_tag="CNI02440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513487.1"
                     /db_xref="GeneID:3259623"
                     /translation="MSSRKWYNLEAQTDDAIFGGNESAFSALGLTRTQRLGGFAACFV
                     GGLAISLLGAILLFLGATGAFATLFAVGGIISLIGTGFLIGFKTQLEKMFKPVRIVAT
                     VLMLASIIMTFVSAFVLPTILCIIFVIIQYLAYLWYSLSYIPYARTMVKNMVGW"
     gene            complement(667831..669734)
                     /locus_tag="CNI02450"
                     /db_xref="GeneID:3259773"
     mRNA            complement(join(667831..667925,667983..668548,
                     668600..669476,669521..669734))
                     /locus_tag="CNI02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657834.1"
                     /db_xref="GeneID:3259773"
     CDS             complement(join(668231..668548,668600..669476,
                     669521..669711))
                     /locus_tag="CNI02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513566.1"
                     /db_xref="GeneID:3259773"
                     /translation="MSLNSVVNRLVRAAAGISQDISDVELDAHVAQLLAEEAKAKELK
                     WSELGLTGLLGNSMAAGRDSPDPSLPKPNKRFLASVIRTVDGHNNALLRSQAEAAKQA
                     RNERMPGPSRVNTIGSSRRTTGGAANRLFGGAVKDMARNDSARTRGREREHRGDERTV
                     KRQDEERREGKVRSSRYNDDLRGEKRHRKNNDRRPMNVDKDSPDNTRESRSDDYDRFD
                     RRHERRRDRSHERQGYGSDEDQSPGKFWRGDADDDNERNRERRRRRHGRDSCSPSPPK
                     RRHSSIKLSPAPKPPREPIPPAPPQDLFGSPSPPPISKMDKYFESSYDPRLDLPAVPA
                     QGLVAEVGWDNMLAILKERGKKKQRNSPSLLDDESAPPPGILPRKRAYSPDTLARKAE
                     RKERKAGREERRKRRGDSDSEDEKDRVKRRERRKDKEKEKANGEQQGGGLLGGYEYTK
                     KGSVREWDMGK"
     gene            669898..672657
                     /locus_tag="CNI02460"
                     /db_xref="GeneID:3259493"
     mRNA            join(669898..670012,670069..670111,670163..670221,
                     670279..670314,670371..670556,670609..671222,
                     671281..671844,671899..671958,672013..672657)
                     /locus_tag="CNI02460"
                     /product="t-complex protein 1, zeta subunit (tcp-1-zeta),
                     putative"
                     /transcript_id="XM_572859.2"
                     /db_xref="GeneID:3259493"
     CDS             join(669941..670012,670069..670111,670163..670221,
                     670279..670314,670371..670556,670609..671222,
                     671281..671844,671899..671958,672013..672037)
                     /locus_tag="CNI02460"
                     /codon_start=1
                     /product="t-complex protein 1, zeta subunit (tcp-1-zeta),
                     putative"
                     /protein_id="XP_572859.1"
                     /db_xref="GeneID:3259493"
                     /translation="MSSIELINPKAESLRRTQALQVNTAGAVGLANVVKSNLGPRGTI
                     KMLVDGSGQIKMTKDGKVLLSEMQIQNPTAAMIARTAVAQDEQCGDGTTSVVLLVGEL
                     LKQADRYIQEGVHPRVIGDGFDIAKKEALNFLDTFKQTPKLDRANLISVAHTSLATKL
                     HAKLAQKLSADVVDAVLAIQPPEVTEPGAYREPIDLHMIEVMKMQHKTDTDTQLIRGL
                     VMDHGARHPDMPKRVENAYILTLNVSLEYEKTEVNSGFFYSSAEQREKLVESERRFVD
                     SKLKKIVELKNAVCDVVVGSNEKPKNFVVINQKGIDPMSLDVLAKNGILALRRAKRRN
                     MERLQFACGGVAQNSVEDLTPDVLGWAGLVYEHTLGEEKYTFVEDVKEPKSVTMLIKG
                     PNAHTMTQIQDALRDGFRSIKNAIEDNSVIPGAGAFELACSAHLNSSLKTLAKGRAKL
                     GVQAFAEAMLVIPKTLAANGGYDVQDAIVGLQQELEEAGEDGVVGLDLKSGEPMDPVV
                     EGVWDNYRVKRQMLHGAATIAVNLLNVDEVLRAGRSSLKEGPGP"
     gene            complement(672228..675557)
                     /locus_tag="CNI02470"
                     /db_xref="GeneID:3259443"
     mRNA            complement(join(672228..672629,672682..672748,
                     672801..673130,673178..673327,673384..674259,
                     674307..674875,674928..674997,675050..675193,
                     675319..675557))
                     /locus_tag="CNI02470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572872.2"
                     /db_xref="GeneID:3259443"
     CDS             complement(join(672520..672629,672682..672748,
                     672801..673130,673178..673327,673384..674259,
                     674307..674875,674928..674997,675050..675193,
                     675319..675465))
                     /locus_tag="CNI02470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572872.1"
                     /db_xref="GeneID:3259443"
                     /translation="MNADLKRVRENTLDDSPSPSAKRRLNSNASSPIQPSDDEGMAEW
                     MKIVEVKRKEAIYRQMLEYRRISEHETKRANDLEAQRRVLEASFHAVELCWTQIVAAV
                     RDLAGAENLQLKEEEVLEPLLDPSTPVPELEKALRSRLPTTRQLVTRFVDLVAHNATR
                     PASEADLQARCLKLEAEASALRSNSKLLESEISALKGSRDEAQRDLQRIRKALDRERM
                     EHGKAQEEWKEERTRGGQATPNLRANGSGHSTPNGKVEADKKFYSGAGPSMAGVLQDT
                     SELEQLAASRLKQLEQLRFEQTQLQQEVDRLKILANHPSEAALRESPFFQVYLHQLST
                     SINRAESLQTRFTATESKLDQLRDSNGEFREAVLAEARGQTETLRAQMAKKDSDIARL
                     RGQRDELNSEIMERRAKEVEKCKYTEQIENLANSRQERISFLTSEVRRLKGKLAAAHS
                     SDGYLSFLKESGIDGDYVKDLEAKVVTSQDQINALTSQLERVSSDTAAAKSETEVRTE
                     LESAKRLLARYERILGPNPEAAEDVRYLSQQLEKKEKERASLEMKLEEAEAATNALYS
                     EVEGLSKLWEALDQTVKSKVLELRDGEQKITRLATEKAKADNKYFAAMRAKEAVDMEA
                     KAAQRSVEKQLRLLERAQEVETSLRSQITANEKGLTALKNNALDLQNQLATVVAEKTQ
                     LELRLQQSQNALVEAQQIMHQRVAEAIAEKEARAKLQDEADGQMKIIKKLKERQDAVA
                     AASQTGMSDHEWAITQERDKLLKLLKCSCCEQNFKQQVIVKCMHTFCKQCLEQRIASR
                     QRKCPACGLAFAKEDIQTLYWQ"
     gene            675730..678296
                     /locus_tag="CNI02480"
                     /db_xref="GeneID:3259703"
     mRNA            join(675730..675909,675961..676049,676106..676233,
                     676284..676432,676483..676619,676668..678296)
                     /locus_tag="CNI02480"
                     /product="ER to Golgi transport-related protein, putative"
                     /transcript_id="XM_572861.2"
                     /db_xref="GeneID:3259703"
     CDS             join(675803..675909,675961..676049,676106..676233,
                     676284..676432,676483..676619,676668..678139)
                     /locus_tag="CNI02480"
                     /codon_start=1
                     /product="ER to Golgi transport-related protein, putative"
                     /protein_id="XP_572861.1"
                     /db_xref="GeneID:3259703"
                     /translation="MSAGHPVLDLPPTMPSASVHTMPSSSPMVDDEDDITFDSPEEEI
                     AHYREKYRQALDMLTDTRAELEEFQQSSKELEDEMEQELAANDKQQADLREKIKRLDA
                     EKEEWRTKHIALQKMHSSTTSAMQREMDNLRSERDKTLVALRDLEMGNDELERNERVA
                     ISSLLDLESKYNRAIEEKTLLEQDLAQKDELETETQRLKDELREANEEISILKDQLAR
                     AIATPPSSVSTSSPIHDAACDLSRIHLSDDINASPLPPPVPSKNKSITPEGHSPRRGL
                     SRSGTMSSIPVASPSTKRFSQQIPHSPSFSTLSRSTTSRNLAAAAGTPGSPALARSRS
                     GIPQASPARGIVLASHQQTKSRGFKLLHDLQARLKATDDKLGGAKVPRRNVSNPASVF
                     GVGKRVTSTTSTTSSTTTAPAPHARVTALAKDHNTTPTAQSQQFPGSGIMSPGWVLVG
                     EGEGEDTPTGPWSMTLPAEPNSPLDPTFRSSSTTSNRSLPSRPGIPSPLASGSARSTT
                     SGTAQRQAGQRPSSRLGLKASRRDSEARPLSPSMIPVPSFSSRPMSPDVYQPLRSATP
                     TSGFSSFSASASTSNPPRPNSRTGKRNPIGRGPPPLSSSTRLHHQRSRQSLSGAGPTP
                     TTGADKVERAKRGPRRSSLSNMDKPSLMSASSGSRTPSGRPTSVHVFRETPPPVPRIP
                     SAILKESKVKK"
     gene            complement(678211..680616)
                     /locus_tag="CNI02490"
                     /db_xref="GeneID:3259479"
     mRNA            complement(join(678211..678358,678411..678541,
                     678590..678724,678786..678921,678978..680018,
                     680067..680616))
                     /locus_tag="CNI02490"
                     /product="expressed protein"
                     /transcript_id="XM_024657835.1"
                     /db_xref="GeneID:3259479"
     CDS             complement(join(678319..678358,678411..678541,
                     678590..678724,678786..678921,678978..680018,
                     680067..680602))
                     /locus_tag="CNI02490"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513486.1"
                     /db_xref="GeneID:3259479"
                     /translation="MDTAKRNRLLTRTQTDTERASRWWAEGIKASASASCDLSSVLNS
                     PSKRNRAMEEEIKRLNEELVATRKGYERQMEEEAKLSMSLRDRIGRLEGKFRKEKAKV
                     ELAQIKESEMKVSLELLEDQLKREREDWSKYVHDLKATLAKERDEKRTLQEEIDNLKK
                     ETSRPAEVSAVPPSDLFMSPRALQPINVNIPTSLASTAPSTPSRKIAAHPSSPSALRK
                     SYAHLESQHKALKAAYDSLQEQHERDMKYLKTYAAVVADREERRRKKRAEKRAERSAR
                     KNSTATETFNHEGNASAIVHQKDNVGPAMPSAMAGNETDPFGAIEASDTEMDTGNVAL
                     NSTTENGQPTPFGTPILTNTALRQVSGPTSPGTPSLAQPKSQNRASLWLGTLQTPAPP
                     TSLKRKENDLNLDLFSPPDKDSVITTPSAFSRNLVRDRLGESSLRKTVISRALGTGMP
                     NPLTLRSETSSTSTPGPSSAKGDSSGAKRKAIDLEGLSPAEKAAQRRLINKLPASEKR
                     ELYKEYKKGGRYIVPEALEQRATEEFEIDPAQNEGAAFAFHDVKRKKTERMQMHGGDC
                     ECCKGYYEAVGVMPKFHRAPTWKDQEQIEEENGEQAVREHLNKVSRHREDWVKPPTPP
                     GYWKIGFPTTQEVEEQNRKADEMARERDEKIRKEAMQKDGKWRKKSNV"
     gene            680767..681853
                     /locus_tag="CNI02500"
                     /db_xref="GeneID:3259539"
     mRNA            join(680767..681004,681063..681138,681200..681388,
                     681428..681525,681584..681853)
                     /locus_tag="CNI02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657836.1"
                     /db_xref="GeneID:3259539"
     CDS             join(680822..681004,681063..681138,681200..681388,
                     681428..681525,681584..681658)
                     /locus_tag="CNI02500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513485.1"
                     /db_xref="GeneID:3259539"
                     /translation="MAELPLSRIVIDSEPDWLRVKKNVSDAMMEVMETRLSTMPGGKD
                     GDAAKTMRRELQARLAQIQERMFEMSKYNLQVNGQNYEDFVQATEGFDEVLDRKIWGL
                     HTEKVDHETRIAERRKKMPESINRLEVDLEMRRTEAEWLPDELEEENDVKQVEEIPKP
                     LRHDEVRETFQTVASNLSEVVKSAPLQLQRAQRAQAVRDEITSMPL"
     gene            682460..685385
                     /locus_tag="CNI02510"
                     /db_xref="GeneID:3259542"
     mRNA            join(682460..682831,682882..683623,683672..683954,
                     684005..685385)
                     /locus_tag="CNI02510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572864.2"
                     /db_xref="GeneID:3259542"
     CDS             join(682509..682831,682882..683623,683672..683954,
                     684005..685341)
                     /locus_tag="CNI02510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572864.1"
                     /db_xref="GeneID:3259542"
                     /translation="MGKPGAKALGKRKAPASKPPAPKKAKAASAEDNTQVNGRPKRKP
                     DQPKKVKLRDQKTIPVPKSVYATGSGDEDDGMGSDMLGNLGEEEGLGLENAAFLAGID
                     TTALSRSVKETKRLHELAKTREIIPQSKKQKSKTSVRQPGSDESDGFDSDPEFDSDLQ
                     SDMGSDVDLGSEDDQSLESDDEDEFSGSEDDVDVTAAFDDFSSDEEKDEPERRKRKKK
                     EEEAEYELAGRSRWAAKPEEPEEDSVEVGRLPIKLPTGEIQMVQGSTRIAVPQPKKPV
                     TKAESEDEETDEVDEEEENSDDGAQAMRMASQKGKFGRMGIAEIVGRKGWKNVQRLEA
                     AKEQVAQLGSEILAGGELVDIGPVLTRLSSFGLPTVPALEEGQPPLSVPASIRGLVFL
                     SQLAVYKDLIPGYRIRELTALEEAEKVRDEVKRLREGEKMLVKSYKGYLKMLEAEIKS
                     KTNLATISLRCMCELLTSVTHFNFSENIMGVLVGRLGRRSWDGDSDLVLQTFIRVFRD
                     DISGQHSQTLVRLIARMIKERHFQVHPNVLFCLLHLRLKDELDQMRRGKNAKGSNKEK
                     GGKDEIKGKKFKSEKRKKWATKNQKKREREMKEVQKEMAEAEAEVDKEERARVQTETL
                     KNLFVLYFSILKNPKRTPLLPAALEGISTYSHFINIDFFRDLLVVLRKIIADQQLSDA
                     TNKQEEESEDESSQQLDVVGASQRIRNRLLAIATAFDLLSGQGEALNIDLSDFINQLF
                     SLLRPLCLDTGIEDPPFLPASTKSSSGAVHTLSTSALLFRCLNASFFSRHSRSPANRS
                     AAFAKRLTECALHFPPRTGKQAIAFARSLLSKEPKIEGLLDTEERMADGAYRPELDDP
                     QLVNPFTTSWWEAGVLGSKHWDREVRLEMSKLRDGKVV"
     gene            complement(685370..686742)
                     /locus_tag="CNI02520"
                     /db_xref="GeneID:3259641"
     mRNA            complement(join(685370..685542,685600..685785,
                     685835..686028,686083..686139,686190..686344,
                     686391..686462,686512..686520,686579..686742))
                     /locus_tag="CNI02520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657837.1"
                     /db_xref="GeneID:3259641"
     CDS             complement(join(685431..685542,685600..685785,
                     685835..686028,686083..686139,686190..686344,
                     686391..686462,686512..686520,686579..686720))
                     /locus_tag="CNI02520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513533.1"
                     /db_xref="GeneID:3259641"
                     /translation="MSTPIDPVNLDPVPPLSDSYVFHSSLPAAEQTPGEGWIMGIDEA
                     GRGPVLGPMVYAAAYCPLSFKPILESIGFDDSKALSAETRQTLWESFGVHPPLCYSSS
                     TLSPQDISSNMLRKVPINLNRQAEDATVGLIQAALNRGINVTECYVDALGPAPQWQAR
                     LTAIFPTIKFTVCPKADSLFKIVGAASIVAKVTRDRYVHGWVDPEDVIHSATHIKSQD
                     EEEVIRGSGYPSDPKTQAYLKGSIDPVFGYKGIVRFSWATVKVLLDKQGVESKWIDDT
                     TQRSAANWFAADADNERPKVWRDLGISSVGEL"
     gene            686914..688235
                     /locus_tag="CNI02530"
                     /db_xref="GeneID:3259466"
     mRNA            join(686914..687073,687131..688235)
                     /locus_tag="CNI02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657838.1"
                     /db_xref="GeneID:3259466"
     CDS             687153..688100
                     /locus_tag="CNI02530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513484.1"
                     /db_xref="GeneID:3259466"
                     /translation="MSATVPTLAAAEEPVIDPALMDENEAVVDQAVTLSVEKESDNGS
                     NGQGPSTLQAAITASDPVPQESTHVVDSSAVEALADIASPSPTAEASNNAVAGPSSLV
                     HAASASAEPPCSVLVQASSYTLPDAEATLVAPSPPHGPWLSREEAEEAIRAYALANNF
                     DVTITHSDVYRHVITMACVKGGKYRCTRGPTHDEVRQRGKRTGKTGCNWRVTIRDENY
                     KPHRYHDEKQKWDYVPMSDLVNTHNHPPILPKDNPKVRHKTITPQVKELIYKEVNKGT
                     PTRKVLEKIQKEFPDCLANMVDVKNLIGRRKKELPTMGL"
     gene            688440..690335
                     /locus_tag="CNI02540"
                     /db_xref="GeneID:3259417"
     mRNA            join(688440..688580,688697..688753,688815..688927,
                     688981..689290,689364..689636,689708..689844,
                     689928..690335)
                     /locus_tag="CNI02540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657839.1"
                     /db_xref="GeneID:3259417"
     CDS             join(688512..688580,688697..688753,688815..688927,
                     688981..689290,689364..689636,689708..689844,
                     689928..689964)
                     /locus_tag="CNI02540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513531.1"
                     /db_xref="GeneID:3259417"
                     /translation="MEAVHRNLSHAMRDNYNEHGVDEYYRKVAATYRNPFYPGIKKAV
                     WALMNRWWEAEGRDMFSQEEKRGRKNLKVLDMAAGSGEGTLCLLEWARTGSTNASAEA
                     TSSASQPSLSVPDPLALLRSTAPSTSARQAFVPPNVRRPVVPPPKPTASAKVSSSGNQ
                     VFGSMIPARLPEGFEIDVIATDPYTSPAYTERTSRPCHSLSFTDLAQGLLPPTSAMTS
                     PRSEDPNNNSEPIWDIIICSFALHLVTNPSELFALLFELSGKARWLIVVAPHKKPEIK
                     ETWGWARWDIASWTAAGEARLYGGGKPKGDGDDGETELEIVRDKVKLRLYRSNAF"
     STS             689431..690224
                     /locus_tag="CNI02540"
                     /standard_name="Hind20"
                     /db_xref="UniSTS:470714"
     gene            690336..691287
                     /locus_tag="CNI02545"
                     /db_xref="GeneID:36393038"
     mRNA            690336..691287
                     /locus_tag="CNI02545"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658738.1"
                     /db_xref="GeneID:36393038"
     CDS             690595..691038
                     /locus_tag="CNI02545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514409.1"
                     /db_xref="GeneID:36393038"
                     /translation="MTDASTQHLLPTVIITPSTPISDSSEDIALLPSATLFYPSSSSE
                     RPQSKPKRQRYHTGSSYSTEYLLPPTRLPSPQTGHRPLRSSFISLALLLVGLTLIASS
                     VLCTGSGANAWLEMKHTGLQKLEGMGRGVSAKLGWDNSSATSGNV"
     gene            complement(691260..695236)
                     /locus_tag="CNI02550"
                     /db_xref="GeneID:3259612"
     mRNA            complement(join(691260..691609,691659..691971,
                     692025..692144,692199..692276,692327..692437,
                     692495..692777,692836..692963,693010..693102,
                     693157..693260,693314..693995,694045..694301,
                     694357..694498,694551..694641,694692..695236))
                     /locus_tag="CNI02550"
                     /product="vacuolar protein sorting 41, putative"
                     /transcript_id="XM_572694.2"
                     /db_xref="GeneID:3259612"
     CDS             complement(join(691311..691609,691659..691971,
                     692025..692144,692199..692276,692327..692437,
                     692495..692777,692836..692963,693010..693102,
                     693157..693260,693314..693995,694045..694301,
                     694357..694498,694551..694641,694692..695107))
                     /locus_tag="CNI02550"
                     /codon_start=1
                     /product="vacuolar protein sorting 41, putative"
                     /protein_id="XP_572694.1"
                     /db_xref="GeneID:3259612"
                     /translation="MSSSSHSSLSPPSKPAFVHDTPEAGPSVQSLRSRTSSLSSTSSS
                     VSRKGKERARVPNGDDLDSELSETESGDENSEEEEEEDDDEEKEGSQSSERSGHESEN
                     KDGPSTKEKSIEDDEEQIEDDDEEDSEESSDEEEEEPALKYSRLKGRIPEILAKDSAS
                     TISVSPRSVALGTHNGMVHILSYEGVKINSFRPHAASVTCLRMDESDDFVATSSVEGR
                     VVIHSLSTPESYAFDYKRPMRAVALEPDFAKKKSRAFVCGGMAGNLILQEKGWMGYKE
                     QILHSGEGPIWAIEWRRNLIAWANDLGVKIYDTNTGQRIGYIDRGASAPRAELFKCTL
                     QWKDDQTLLIGWADHIKSVRVRSRPSSQASGNLPPLTVEMTAIYQVDCMISGIAPFGG
                     SYVILAYIAPDRYENEATDDPIEQRRKAANRPELRIIDKGEETNADALSLANYHMYGC
                     NDYSLVKSQKPGEEAFLVISPADVIVVRPRDEADHIEWLVEKERFQEALEAAEEMQKK
                     HGSALDMKGIGLKYMRHLVSKEQFEQAAELAPKILEQDVAAWEKWIDIFVQHQQLPVI
                     IPYIPTQKPRLGRRVYEMVFTHLLINDKQALLKVITSWPTEIYDLTTLVDAIQGELQA
                     SHDDPVLLECLGELYLINRLPAKALPYFLRIRKPYVFDLIREHNLFTAVRDQALQLVT
                     FDQERKKAQGKRENQRGEKTDDAEMGSVEGDKSKHGAAIQLLVDHVHSIPIERVVHQL
                     ETKPHYLYMYLDALLDKDPQYSLPYSDRMVELYAAYDVDRLMPFLRTSNFYDLEKAYA
                     VCKERDYVPEMVFLLGRMGNNKRALMLLIERLGDVERAIEFAKEQADEDLWEDLLAYS
                     ESRPDFIRALLEHVGAEINPIRLISRIRNGMEIPGLKPALVKILQASNLQVSLLEGCQ
                     HILNGDCAGLMGQLQKGQTNGLKASFTSTCAVCSKPAFTNSPSLVLIYLCRHLVHAEC
                     VLPEGVDLPVRQENASVAYLLADEGRMGGRRGAAWKARNLGARLGYAAAVRVRVKQCP
                     VCESKQGH"
     gene            complement(696037..697246)
                     /locus_tag="CNI02560"
                     /db_xref="GeneID:3259477"
     mRNA            complement(join(696037..696446,696496..696668,
                     696735..697246))
                     /locus_tag="CNI02560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572692.2"
                     /db_xref="GeneID:3259477"
     CDS             complement(join(696081..696446,696496..696668,
                     696735..697194))
                     /locus_tag="CNI02560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572692.1"
                     /db_xref="GeneID:3259477"
                     /translation="MSRLPRLSTLTRAFRRMHTDGRQIDHNGPSTPPPHHHPPADPSA
                     HAPLPQPIITDAPPLATPEPRSTKKGKPIFTRAARQVTVHLPSGYPEPTKYPPPPEYY
                     EGLEEKRKEPHPLWQFFHVPVKSQGRPTDVYPSQGFGSLESLAPEDANLHSGRAWTAA
                     ELRQKSFKELHTLWYVLLRERNVLATQREERRRLGIGSRVDGVLNAKRGFRCRKSMAR
                     IKYVLNERRLGLIAAAGPHLPIDAPHIPWSSSPTTDPAGATAAIRGERPDSKRIAEFE
                     GAGFGGGSRQSESFIEDEDVAEEEVEARDEGFGGGKEAEKFVDEVEVKDGKVEKKE"
     gene            complement(697808..699568)
                     /locus_tag="CNI02570"
                     /pseudo
                     /db_xref="GeneID:3259557"
     mRNA            complement(join(697808..698336,698400..698555,
                     698616..698700,698754..698816,698910..698944,
                     699001..699123,699176..699249,699304..699568))
                     /locus_tag="CNI02570"
                     /pseudo
                     /db_xref="GeneID:3259557"
     gene            697914..699593
                     /locus_tag="CNI02580"
                     /pseudo
                     /db_xref="GeneID:3259373"
     gene            complement(699810..700424)
                     /locus_tag="CNI02590"
                     /db_xref="GeneID:3259517"
     mRNA            complement(join(699810..700238,700289..700374,
                     700411..700424))
                     /locus_tag="CNI02590"
                     /product="expressed protein"
                     /transcript_id="XM_572688.2"
                     /db_xref="GeneID:3259517"
     CDS             complement(join(700106..700238,700289..700374))
                     /locus_tag="CNI02590"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572688.1"
                     /db_xref="GeneID:3259517"
                     /translation="MPGPLYRDPWAAREAWRKSPIFSNKAMFRSMFPGLGTAIVAFTA
                     YVIYDDFFAAKSSHGHAHGKEHPKTLAM"
     gene            700561..703601
                     /locus_tag="CNI02600"
                     /db_xref="GeneID:3259748"
     mRNA            join(700561..700781,700831..701358,701410..703601)
                     /locus_tag="CNI02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_572997.2"
                     /db_xref="GeneID:3259748"
     CDS             join(700607..700781,700831..701358,701410..703433)
                     /locus_tag="CNI02600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572997.1"
                     /db_xref="GeneID:3259748"
                     /translation="MSLRSLSERTRDAVLALLGQQIRPPDTDQQWTHLLQPTSQTNRS
                     IILWLLVFVFLLIGAVVTNPSETCFRSHLTELSFRSAMADFRRSEDEANDEHGNKQGS
                     LPVTGADTPTLQPISPLRFANRVAISLRTPTLYYRSFFLLSIAITPPLQSPAYLSDSR
                     QTKKNASIKERHLLWVGTWGSWSEVMLIPLYLEWVWRVVTRGAKEKSRKRASVDKPGV
                     FEIRSVALKEEPVTPNPKASLSPATAKHLRRSDSSTNIPDVLPLHSRPPSPTSRPPSI
                     VNLVPPSSPAPEIASPLINSLKAELAAAQNVVQELQNQLSTHDQSVHEAHAHLQSTLD
                     DLRNRRKEDDAERQELKARTKNLEEQKRQAESARREAEKKLRAVEIMRDGLENKIKGA
                     EGSVKGTREQIGGSQQSVKVLQQEGDRHAVGARQEVERKQQELRNVEAAIGMVEAKNE
                     ELESRVKEAEEKLKGVIEAGEAARKIGPEEEMMMMAAAYEVAAQEGYLHGYQHAHGGN
                     SHWATQAAAYMAEAGMPHLGYDYTARPTSHISTTGFGHLSKGTFASSSSRDLKELRYT
                     DVSGFEDFGPGSASVSRRVSGVDAGKKQESTASDSESDVYGHDPGSPNGGISSSFSAN
                     LLPQGLFSSLEGETPYVGAGDESSTFDDPLKLDLGEQDVHADNFSNSSASSPEQPALS
                     HHSSFSNPTTAHVEPIKRPSGSASHSLLPYPSSTSPSLGPNGLAPPAHSTTPPLIPGL
                     PTLPGSRRWFSGTLSNDSLPNKSTSSFSTSGFPSGVTKLGYQHPTTTTSNDSLHMGIG
                     NSGAGGYESPFAPTEGEKKALAMAQGKWGGLSKRWTGGGEGWPSGLGWGRRDVGMVEG
                     RASSEGHRIEISQVVGQSQGEMRQGEEGDKPGLKSKFSFLRKSQNQLSESRS"
     gene            complement(703546..704614)
                     /locus_tag="CNI02610"
                     /db_xref="GeneID:3259388"
     mRNA            complement(join(703546..703830,703917..704058,
                     704118..704614))
                     /locus_tag="CNI02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657840.1"
                     /db_xref="GeneID:3259388"
     CDS             complement(join(703691..703830,703917..704058,
                     704118..704588))
                     /locus_tag="CNI02610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513478.1"
                     /db_xref="GeneID:3259388"
                     /translation="MVLRVQPRPFLRPFSLPRLAATRFAHSAPQAPTRTCPSCSRPVP
                     LPLSPCPSCSSILPLPSNLSHHSMLYLSAPISSSGSPAGPFDIPQELAHLPCNGYTVD
                     KADLRSNWVRRQRELHPDKYSTRGDGVVDLARELSGRVNEAYAVLGDDLRRAEYILSV
                     NAQGTEETDKIDDPMLLAEILEAREELEDAQTPEEIDRIRQANKEHVKGIIGSLEQAF
                     SGTPPDLAEAKLLAVQLRYWMNLEKAAKEKSV"
     gene            complement(704752..706047)
                     /locus_tag="CNI02620"
                     /db_xref="GeneID:3259409"
     mRNA            complement(join(704752..704955,705029..705082,
                     705134..705196,705302..705488,705621..705720,
                     705793..706047))
                     /locus_tag="CNI02620"
                     /product="mitochondrial import inner membrane translocase
                     subunit tim17, putative"
                     /transcript_id="XM_572685.2"
                     /db_xref="GeneID:3259409"
     CDS             complement(join(704906..704955,705029..705082,
                     705134..705196,705302..705488,705621..705720,
                     705793..705824))
                     /locus_tag="CNI02620"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit tim17, putative"
                     /protein_id="XP_572685.1"
                     /db_xref="GeneID:3259409"
                     /translation="MSAADHGRDPCPYVILNDFGGAFSMGAIGGGIWHGIKGARNSPR
                     GERLVGSLSAIKARAPVLGGNFGVWGGLFSTFDCAVKGYRQKEDPWNAIISGFLTGGS
                     LALRSGPKSAFGSAVGCAILLGVFEGVGVVANRMMAQPIPQMQLPEQAPPPVAPAVAT
                     A"
     gene            706165..706984
                     /locus_tag="CNI02630"
                     /db_xref="GeneID:3259437"
     mRNA            join(706165..706262,706319..706352,706415..706680,
                     706731..706771,706820..706984)
                     /locus_tag="CNI02630"
                     /product="DNA-directed RNA polymerases i, ii, and iii 17.1
                     kda polypeptide, putative"
                     /transcript_id="XM_024657841.1"
                     /db_xref="GeneID:3259437"
     CDS             join(706215..706262,706319..706352,706415..706680,
                     706731..706771,706820..706928)
                     /locus_tag="CNI02630"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases i, ii, and iii 17.1
                     kda polypeptide, putative"
                     /protein_id="XP_024513535.1"
                     /db_xref="GeneID:3259437"
                     /translation="MAESSNIIFDDRFTVDTVDKDGKKFDRVSRITATSHSLSMSLTL
                     DIANELYPLEQSETFTLTLARSLVPSELETLDSRADGDEGEEGSEVRRVKRELWRSHE
                     QGLAEDYDYVMYGKIYKFDDSAQGEAQTTAYFSFGGLLMALRGSYRHLAGVVVGENVY
                     LLMRK"
     gene            complement(706945..>707858)
                     /locus_tag="CNI02640"
                     /db_xref="GeneID:3259558"
     mRNA            complement(join(706945..707360,707409..707610,
                     707655..>707858))
                     /locus_tag="CNI02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_572684.1"
                     /db_xref="GeneID:3259558"
     CDS             complement(join(707011..707360,707409..707610,
                     707655..707858))
                     /locus_tag="CNI02640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572684.1"
                     /db_xref="GeneID:3259558"
                     /translation="MRPPRPLALLALALPAAAFRDTSPLLIWLPHAPHAPLAPPLADA
                     AAVYSQLHTLGCDWHSAVAVHVDDLHSSCTADYAIPPDAHVHIPYLSRPDRRALDDSL
                     EAWARTCGAVVDDAVDAAVGGKRLVRLSVANGEPIPPLPPSSILLITGSPSGSRPHKR
                     QEERPFPTHSSLTTRPTASPPKHNATVPADGPLFDRVQILTTPIITALLVTFGIFIPL
                     AAFGVSALASIQVPPRMMEIGKGLVVGKERKDQ"
     gene            708047..710131
                     /locus_tag="CNI02650"
                     /db_xref="GeneID:3259576"
     mRNA            join(708047..708203,708254..708261,708311..708408,
                     708460..708836,708886..708980,709033..709123,
                     709173..709258,709311..710131)
                     /locus_tag="CNI02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_572999.1"
                     /db_xref="GeneID:3259576"
     CDS             join(708053..708203,708254..708261,708311..708408,
                     708460..708836,708886..708980,709033..709123,
                     709173..709258,709311..709751)
                     /locus_tag="CNI02650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572999.1"
                     /db_xref="GeneID:3259576"
                     /translation="MSSSPARDDKPAPAKKPAPRPRAAAAKPPADHKFDIGDIVLARL
                     RGYPPWPARIANPETLPRNVLKTRPGKNPNLYCCQFFPAGDFSWLQNKDIKALSASDI
                     SSFLAQPHRKSSGGLREAYQTAQDPTEWDAQQEEIHKQQEEAEANVDELEDEDEAEVV
                     VKAGKRKREEPKRKKAAKKEEEPKPKKAKAVSKAVSKAGDKKAVSKTEVDEDPLASDP
                     ECVKVKDWRHKLQKAFLGESMPAEPEMSHWNEVFESIESYDSMTIEALQYSKIGKVMK
                     KIMGLTTIPLNDKYDFTRRAGKLMHQWQEFIDAANRGRVTNGQKKSARPPSAPSAAAT
                     AAEEETPAKEDKPADETPAEEKKEESAEPVAEKKEESAEPVTEKKEESAELVTEGKME
                     LDEKEKEAAAEEPAAAEKTEEVGAGAGEEAEAAEAPEPEAAEKPEANGEDKMQVDA"
     gene            710792..714216
                     /locus_tag="CNI02660"
                     /db_xref="GeneID:3259656"
     mRNA            join(710792..711262,711334..711763,711821..712710,
                     712763..714216)
                     /locus_tag="CNI02660"
                     /product="integral to membrane protein, putative"
                     /transcript_id="XM_573001.2"
                     /db_xref="GeneID:3259656"
     CDS             join(711430..711763,711821..712710,712763..713845)
                     /locus_tag="CNI02660"
                     /codon_start=1
                     /product="integral to membrane protein, putative"
                     /protein_id="XP_573001.1"
                     /db_xref="GeneID:3259656"
                     /translation="MRIPLFILTFLFSLFSLATTPVAADSGVLYTDAVTYCAEAKAVI
                     VDEFDITYHRSNGSVTFSFSLASVESNLNTSVNLYINAYGIQIINQTLELCELLQGVI
                     CPLPQVNFTGYGTYPIPEEYLSKIPSIAYTVPNIEAYARVQLIRVENNEVAACLQATL
                     ANGKTAHQKGVIWASAMFTLVAFLVAIWHTASGTSTSPIQYRWFDILFIFQAAAASGL
                     LHLNYPLVYTNFVQNFHWALGLFYSSNMQSSIKKMREKTGGSMDSTAYSDVQYINRKL
                     SPYNVYMSNDGILSSPESLAAFFKENALSKRSLEHFAKRATIPSVLPQNVTTDINTGL
                     PVYTNTLKIPEANAYDTIWFVFLALIGIFVAFHVLLFGIVFLFDRMGRNRSHLGWAAR
                     LRRMWWPFCIGNSLRLCLIGFFPIWIFAFWQFHIGDSGLSIFWAVFGILLTLVPLATA
                     FVLSLLRARRISSTSPEINSLYTSFRYFHSIGVLYRQYRQKFHYFWFAPFILAMIARA
                     GFIAFGPTSAWAQVIGNLVVEFIILVALLACRPHKDKKGDWLGAFLSLCRLIAIGLLI
                     AFIPDMNVTPIPRAVIAFVIIVFYGVPVVLLFIGFLWNIGYGYLWCKHSTRIEDGLEV
                     ERFSPTSSNSSVPPPMMKNIDAATFVSSDGAAASRGSLSMGGAGATGAGAGFGGGAAA
                     AGAGLGRRSSLMEPVGDNVYEASGSSADGALSSPPVTTYNPYGKEEIGYPYDPQNSQL
                     AYEQAAMGRGGVNGAGSPIDEKQWSRRY"
     gene            complement(714325..717642)
                     /locus_tag="CNI02670"
                     /db_xref="GeneID:3259686"
     mRNA            complement(join(714325..715416,715487..715565,
                     715615..715696,715752..715821,715876..715941,
                     715999..716257,716314..716329,716382..716663,
                     716716..717642))
                     /locus_tag="CNI02670"
                     /product="MAP kinase, putative"
                     /transcript_id="XM_024657842.1"
                     /db_xref="GeneID:3259686"
     CDS             complement(join(714398..715416,715487..715565,
                     715615..715696,715752..715821,715876..715941,
                     715999..716257,716314..716329,716382..716663,
                     716716..717266))
                     /locus_tag="CNI02670"
                     /codon_start=1
                     /product="MAP kinase, putative"
                     /protein_id="XP_024513542.1"
                     /db_xref="GeneID:3259686"
                     /translation="MTSPSAQPMIPRSQPPRPSHTQSSPAINSTGIKPNGPPSVIRRA
                     PSVPVNPSTAAASGSLSSLLKSENTAQAVSRSSPPTEPNDLPRPIEPTPMLPITGLPN
                     SSSSSSNARHGSSSSISRGPSVTGTLTPATTALGAPIEPTPPQTGASKMAAAAKRGLD
                     GSAGNNVKVYEEGHPLNEETLKQRGYQTLNILNHPFHLPDRWKLLRPLGQGAYGLVIQ
                     VQDAETEIPIAVKCVTRVFDKVILARRALREITLLRHFGEHDNLTGLVDMDNVWDGYN
                     EIYLYMEPMEADLHQIIRSGQPLGNAHIQFFIYQLLRGMKYIHSANVIHRDLKPGNLL
                     VNSGCELKICDFGLARGFNPVKGEEPQGEEGKLTEYVATRWYRAPEIMLSNRRYTTAI
                     DVWSIGCILAELLGLKPVFKGKDYIEQMTLILETLGTPDEETMARVASEKALTFLKTL
                     PTYEKKDLGSIFPDADPLAVDLTDKLLEFDPTRRIDVPSALTHAYVERYHDPEDEPSC
                     DKIFDKWEEVESLSTIEELKEAITREIQGFREEVRMAAEEDDEDEEWAEGEYLDDENV
                     FHDSPGPALASTLEKFTYPDHIAPSSSILPSAARLAPIIHQSPKGSKSPHVKSAHLPS
                     VPSSANSSKPSSTAGSAPRTREHSPTTTFITSAEDYFTAQHGFGGPNGRASRRSSSHS
                     TSGRRPASFLFSPFGAGMTQIVPTPNAYPRSHAQASPELTTAEKTPRDRRSSGLWRTR
                     SRAQSQSGNLVLERLSSLEINDHKDGEKNRIDALHAVVGLGGDGEVPPMTVSPSDAPP
                     SEVPKSFGY"
     gene            complement(717775..719496)
                     /locus_tag="CNI02680"
                     /db_xref="GeneID:3259389"
     mRNA            complement(join(717775..718379,718437..718659,
                     718711..718774,718832..718853,718903..718968,
                     719105..719496))
                     /locus_tag="CNI02680"
                     /product="expressed protein"
                     /transcript_id="XM_572910.1"
                     /db_xref="GeneID:3259389"
     CDS             complement(join(717970..718379,718437..718659,
                     718711..718774,718832..718853,718903..718968,
                     719105..719210))
                     /locus_tag="CNI02680"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572910.1"
                     /db_xref="GeneID:3259389"
                     /translation="MAYNHKLPKKISLKPKKHHGFQVFLWLLGLLLPPLAVAVRFGIG
                     VDFFVNVFLCICGYIPCHFHNFYIQNIRNNSNRARTPKWAIKYGLVDNSDRERRARKN
                     QWSKRFDERNNHSTLAEQELEEGEEGPNYDPSIVNPEEVERRRNEGLWTADDEEYYND
                     DQAPNQRKWHYPANFEGAVGDGRSYKRNASSGGDRWQRAARRSSGASNTYPPVAATDD
                     DVPEWGKDYGSKRRSSKKKLNKKQDHTHDWARNPEYGNEDESGARGAGGSGRPREGSR
                     GSGRENGGTANGDPNWDHEF"
     gene            719802..722008
                     /locus_tag="CNI02690"
                     /db_xref="GeneID:3259510"
     mRNA            join(719802..720137,720191..720249,720310..720380,
                     720442..720496,720549..720659,720716..720884,
                     720939..721015,721065..721108,721170..721250,
                     721301..721351,721414..721869,721929..722008)
                     /locus_tag="CNI02690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657843.1"
                     /db_xref="GeneID:3259510"
     CDS             join(719888..720137,720191..720249,720310..720380,
                     720442..720496,720549..720659,720716..720884,
                     720939..721015,721065..721108,721170..721250,
                     721301..721351,721414..721699)
                     /locus_tag="CNI02690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513576.1"
                     /db_xref="GeneID:3259510"
                     /translation="MTQSFFLYHRLVLQLAHTQNLCVLLTIMTDYYPYVLPYESTSQA
                     QPFIPRVSDGISRQSHTMEEARPRYHALPTKVEKLYMSIAAAEAVIVFALAAAVFGLV
                     EVNVKDAGLKIKTVPVYLAIFLLSQVFSLLYVFDALRARNIVQLFLHIWLNLMLLLYA
                     ILQIPQTKIALEDVTGSCGDFDRCTGPGSLFNVIQGILIVPPIIFGLALISFGFLSRQ
                     LYFQFGWDVFRLVGASPELKRIHRAYQTLLSLLKLLLFFAMAFCLAYLILVTAWSTNR
                     GEFILTVVALPLVIVFILLCGWALRTENKTVMVCLLVIMVAGLAYFIYKLVTLWLPRT
                     SSLYINTKITMAILSIFSIIILLVTFIFGCMCMSNFGKGLVEAHQNPENRTSLWSLPA
                     NKGWSRKYNGNEGESGQMVPQMVIE"
     gene            complement(722627..725208)
                     /locus_tag="CNI02700"
                     /db_xref="GeneID:3259806"
     mRNA            complement(join(722627..723999,724048..724418,
                     724473..725208))
                     /locus_tag="CNI02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_572909.2"
                     /db_xref="GeneID:3259806"
     CDS             complement(join(723022..723999,724048..724418,
                     724473..724872))
                     /locus_tag="CNI02700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572909.1"
                     /db_xref="GeneID:3259806"
                     /translation="MDPQQQADNDALASAVAASAHQLGLGPLHGHDHSDDGHHQPHHF
                     HHALQQPDFSQGHHHKDGEGHHDQGMDVHALDIPTVDESHHHVMEHHQSELDLGLGSI
                     GTPGEMQGFDTGEMDQTPAEVYSGRPPSIRKACDLCHAAKQKCSGDRPSCTRCAAGGW
                     PCNYAPRQRRRTVPKEQKHQQHHASHHTHHALDMHHHHAHAMQLQSGAKKRKLAREAL
                     AGFGSEAIDMKMAMGMAMDMGLTGEEEGEEMQNMSDEQMLESIAIDGYLSDLPLASFV
                     HNLPFTSTPAQEPVFNADDFPSSSDNPFPSADMDQHTTSALRDAIFSLNESGNAGQEA
                     EGGGEHGDGEGGEEGQMDPHLALLDLSNMNNEADGEGSDPTGGLNLGDFTHPHTPTQS
                     QGCNHRQLVPHILALLASHTLDPKPGSNTPLTLAVFAPLARSLRLFHSLTTCQSCMSS
                     PRETLPQLALLSRTTTILTFPFPPINSSSVGSSAQITIHGARISGTGLSEAIEQHIVG
                     VVWDSWRASVREVFAAMDKKAQEVITASGLAAAAAGNQEGGPVPQVSSLEKQRAGLVF
                     QAVSRLVTAMDEVEGN"
     gene            complement(726962..732828)
                     /locus_tag="CNI02710"
                     /db_xref="GeneID:3259768"
     mRNA            complement(join(726962..727649,727717..727881,
                     727934..727953,728005..728173,728228..728695,
                     728749..728976,729038..729168,729209..729338,
                     729394..729579,729636..729998,730048..730115,
                     730172..730267,730313..730914,730961..731067,
                     731118..731222,731272..731404,731459..731604,
                     731657..731689,731730..731825,731876..732072,
                     732122..732465,732527..732828))
                     /locus_tag="CNI02710"
                     /product="translation repressor, putative"
                     /transcript_id="XM_024657844.1"
                     /db_xref="GeneID:3259768"
     CDS             complement(join(727873..727881,727934..727953,
                     728005..728173,728228..728695,728749..728976,
                     729038..729168,729209..729338,729394..729579,
                     729636..729998,730048..730115,730172..730267,
                     730313..730914,730961..731067,731118..731222,
                     731272..731404,731459..731604,731657..731689,
                     731730..731825,731876..732072,732122..732465,
                     732527..732744))
                     /locus_tag="CNI02710"
                     /codon_start=1
                     /product="translation repressor, putative"
                     /protein_id="XP_024513476.1"
                     /db_xref="GeneID:3259768"
                     /translation="MEQTTDIEDSVFLELLNTAANPTSVDAIPSDELATSLGIDGPLS
                     REQALELLENEVLSPVHKFQGHELGQWQVQPPISLPIPPLTLSPLHQTHTVTPSFRGI
                     NGEFTHWREALAPKPPAHPTLSSSTTRAPGSMQNFVRGKGSYAPFLPGGLEAAAKVEE
                     DEDEDEDEEVGWKTRAPGMKKGAKLDGADKFLAEMLGQQSLTAKAKRRRRDGEFASPQ
                     LTVSRLGDKDEDVDGIDLKPVQSSDKNIDDLLPIGRLPAPPSSKKQFKAVAKKEWAHV
                     VDVNQKLENFNELVPEMAKDYPFELDNFQKEAVYRLEMGDSVFVAAHTSAGKTVVAEY
                     AIALAAKHMTKTIYTSPIKALSNQKFRDFKTTFEPSTVGILTGDVQINAEGSCLIMTT
                     EILRSMLYKGADLIRDVEFVVFDEVHYVNDAERGVVWEEVIIMLPEHVNIILLSATVP
                     NTKEFADWVGRTKKKDIYVISTPMRPVPLEHFLWAGRETHKIVSSQSKFLMEGYSSAS
                     DALRRKQDKEREANGLPPVQRTGGRGGAAIRAKDLPTGKSAPFTRIGAGRNHTNRGGG
                     NGPPQAAFGGGRGGRGGGRGGFGGSSRPSHVLDQNIWTHLISYLKKNMLLPVVNFVFS
                     KKRCEEYAQTLSLDLCTAKEKSEVHITWERALTRLKGEDKTLPQILRMRELLSRGIGV
                     HHGGLLPLVKEVVEILFARGLVKVLFATETFAMGVNMPAKSVVFSGIRKHDGTSFRNL
                     LPGEYTQMAGRAGRRGLDTTGTVIILSGDELPSVEELNEMMLGVPNRLSSQFRLTYNM
                     ILNLLRVEALKVEEMIKRSFSENATQKMAPEQQRVIAQTEKELAKLPKLECDVCSADI
                     DAFYNLSTEASRLNAQFLKRASWSNQSGKLFVPGRVIVLRNAHFPGNLAVILGNHPNL
                     GPDGQRSDVKAFRVLVLVTPGQKSGKGDLSVEELTPRWPPILPKGSFPSPTAERTVVD
                     TSSISFVINHILKYDFHRLNSRESPSDVQRALDDLTKLHEELSLLPELPEADWSRLRD
                     IDIQSLLKERTNAAGRLSKLGCQLCEDFADHYATVHERKQVEQRIQKLKLQLSDQNLE
                     LLPDYESRVEVLKRLSFIDENATVLLKGRVACEINSAPELILTELILENILADYTPEE
                     VVALLSIFVFVEKTESQPIIPTKLQDGLDVIYNIAEQVEREQDYCQVQHDEFATKYKP
                     GLVEVVYEWARGMPFNEITNLTDVPEGTIVRVITRLDETCREVRDAARVIGDADLFKK
                     MEEAQGLIRRDIVFAASLYL"
     gene            732969..735117
                     /locus_tag="CNI02720"
                     /db_xref="GeneID:3259504"
     mRNA            join(732969..733109,733159..733210,733264..733380,
                     733440..733480,733534..733731,733785..733905,
                     733966..734387,734434..735117)
                     /locus_tag="CNI02720"
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /transcript_id="XM_024657845.1"
                     /db_xref="GeneID:3259504"
     CDS             join(732998..733109,733159..733210,733264..733380,
                     733440..733480,733534..733731,733785..733905,
                     733966..734353)
                     /locus_tag="CNI02720"
                     /codon_start=1
                     /product="nuclear mRNA splicing, via spliceosome-related
                     protein, putative"
                     /protein_id="XP_024513474.1"
                     /db_xref="GeneID:3259504"
                     /translation="MSSDNTVAPKRKLKPARKQVASDEVDKSQGYQAGREYNIWYNKW
                     AGGDREDALASKVHSQTRCIISRDAGYTRADATGNKYCCLFFARGCCPYGYECQYLHR
                     LPLPSHQLPDNSRDCFGREKHADYRDDMGGVGSFNRQNRTLYIGKIQESPDKKQMTET
                     LLRHFGEWGKIVKYNILFGRGVAFVTYETDHQASFAKEAMANQSMDGDEILNVRWATE
                     DPNPGEKVAEEKRIEEIGQKAIAGMLDENLVEATQAVRALEDGDVEDFYHIETSKPEE
                     EEENRPAKKGKSEGGFFNADALDNIKFYAELAKKQAEEEKEKARKVPAKQVGMSLLGG
                     YGSGDESD"
     gene            735422..737198
                     /locus_tag="CNI02730"
                     /db_xref="GeneID:3259661"
     mRNA            join(735422..736893,736951..737198)
                     /locus_tag="CNI02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657846.1"
                     /db_xref="GeneID:3259661"
     CDS             735543..736883
                     /locus_tag="CNI02730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513473.1"
                     /db_xref="GeneID:3259661"
                     /translation="MPPTLLSCGSNAGSHLAINHPNDVSVLTPTAYHPSLPPISPSTR
                     ILQVVSASAHSLLLLSSPNPVALNNGQGKGCRNVLLGAGTNTFGQLGPRCAFWDDVRP
                     GGQWKMLNLCREYGLEASWEPVKVAATWTTSFVVYQQVQEASSEGGASEDPKESKIRQ
                     VIISCGSNDFGELGSSTPLTLSGTPSPIHVSQASQKPTLVDAGLKPGERVQMIKGGQR
                     HVVVVVGGLKGQRIVGWGASRKGELSAATLSSVNAAGPSNKAKGKSKANLYSPTSPPT
                     LIDLPLQPGQHVIDIALGASHTLALLSDGSVLGWGSNLKGQITGVHELGNVKAIAATW
                     GGSYFLTSDGVYSQGSNTHSQLLRGQASSERGKINIPGGWQAKKIVAGTEHLLVLARK
                     DGQEDVLFSGGWNEHGNLAMGDERDRDALERVELKGKVLGLWGGCASTWVWVEA"
     gene            737213..742097
                     /locus_tag="CNI02740"
                     /db_xref="GeneID:3259448"
     mRNA            join(737213..737478,737537..738734,738784..738897,
                     738946..739626,739693..740401,740458..741626,
                     741686..742097)
                     /locus_tag="CNI02740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657847.1"
                     /db_xref="GeneID:3259448"
     CDS             join(737733..738734,738784..738897,738946..739626,
                     739693..740401,740458..741626,741686..741937)
                     /locus_tag="CNI02740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513577.1"
                     /db_xref="GeneID:3259448"
                     /translation="MSTQVAPQAPAQVPIPFTPPQDPSPKAREYSEGSMYDELNPEDL
                     KAWHGRYAAYKQWRHEIPPKNVKPFGHTSGSRSTQSFGLQVGVGSADWNWRRGYQLSD
                     TGTVPTTIMEGQWEQRDRELEKNAQAPVASAVPPHPNVHSVKSKPSFALPAHTQPPNT
                     TKPSPNLSRQPSIHQPIQPILAQPISQSSQAKWPPTASRYPVPAQPSKRVSPPPGTLL
                     VPYPTHSATHAERESYLASVINLPIEMLIETRDGVATSKKVDTHISRSRSDRDRAKGR
                     SASNMSAGSSTTLTSTEEKAKEVRALGSGGSSRNRLGRSVTDVVKAKSSSSIRMESRH
                     SVDRSLGSAGSRLERSITDGAKTRSSTSQKPLREHHYQASDHLPVPCIASHEPHPTET
                     TINRAARLPLPPSYASTGHQSKSTAGSTVGSVRSRETTIIPQYQPSSSEVIISRAARE
                     PLPPSTIAETIKLPISAKTAASGSAALPVRVPTDATIIQAGTTPLPASTIHAHTSYTA
                     PIQPTPSQVPLLPSMKPHTDLPYLASPLPSPGPLPDPTLTHRQQMPLPRPALTPRPSN
                     DALDVNLMDVKSNRGEGSLMTKFESANGPDNGVKTVRMPKAEIVEIKMKAPSKKEAII
                     APQPSITRQTSQHSVGTRSEHASVPLSTAPPPNTPTAHQAPSHISQAHPMTLDVHAAL
                     TSHQRQPSTRDLRRQPVDSPVSTLQYLNVPGSLRSCHGNGSGSGKDHSMGSANGSPHP
                     TFIFSPQTNSQRSGTYRSNEDQVSFEVPQGSRRRLRVTLKWLKDGSRRESSTNDGTSQ
                     REGNVRSEKPPAVPPKELPRQKESYKSKVSRQTSHRDGQASQAEHPIPADRLPSPNLP
                     PINMDFPFEHQTERENKPMHENRKQYLNPTNPAFNPILNPYYAGAPLPPYNPTQVYNV
                     RMPFAYPLPQPPGMWGCRPLDHGQSSEKNPKQSSELPGKESVDPPSEKMSLMMADGGM
                     PSIRGLGMRLGTGVGAAAVGAYPQPQGQREQYSWQQRSNVFQCMFNRDPYQPNHHRNV
                     NHEDEELPSEDIHAWRHKIPSDLGQAHTAAPTNRPSANLRPAIANTFGPGTAYDFVPP
                     GRAPNTWWKRLRPRRQIDVQSTKNKPRLPDLARLSPSHNIQQNLPRTHGDIPPQNAPY
                     VRDRFREKEEKRRQRAAKRHKRQRRMTEQTKSAGLSSEALARTDARDWPKGMGNDQLR
                     GRSRTMIKDWVTKVRGSGKIQPPPKSGPATEYVPWRSRLIIKDPGVARLHRQSSQARR
                     ADGSPQQQRMQNSSNVPLNALKMGLSLGGRNQNVQNGQENGQRMRK"
     gene            742234..743856
                     /locus_tag="CNI02750"
                     /db_xref="GeneID:3259659"
     mRNA            join(742234..742445,742501..742972,743020..743170,
                     743222..743423,743478..743650,743716..743856)
                     /locus_tag="CNI02750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572885.1"
                     /db_xref="GeneID:3259659"
     CDS             join(742339..742445,742501..742972,743020..743170,
                     743222..743423,743478..743650,743716..743792)
                     /locus_tag="CNI02750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572885.1"
                     /db_xref="GeneID:3259659"
                     /translation="MVAAAPSNKERLPDMMTSIRLDQSGRVEIIDQLLLPHSVVWMPV
                     STPEEAFDAIKTMRIRGAPAIASLAALTLRSYLSSSSSPVSSSSSSSDVISWVGQTID
                     YLQSSRPTAVNLGEAMDRIRAALKDSEAQNQTAGDIIQRVKKICGDVHDEDLERNMKM
                     GRLGAEWLWKKRGGGKKGLKVMTVCNTGSLATSGYGTAIGVITALFQEDHLDTAYYAQ
                     TTPYHQGSRLTSLELTTLQIPACMICDTMLGSLFQHEDIDGVIVGADRVVKNGDTANK
                     IGTYQAAVLAQRHNVPFMVVAPVTTIDLSLPTGAEIHIEHRPAAEATQVRGLDTETGK
                     LSVVRITPEGVGEGDKPWQRVYNPSFDVTPAELISAVVTEKGVAERKEGEKSIDVASI
                     C"
     gene            complement(743827..747632)
                     /locus_tag="CNI02760"
                     /db_xref="GeneID:3259704"
     mRNA            complement(join(743827..745909,745968..746502,
                     746556..747632))
                     /locus_tag="CNI02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_573011.2"
                     /db_xref="GeneID:3259704"
     CDS             complement(join(743927..745909,745968..746502,
                     746556..747568))
                     /locus_tag="CNI02760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573011.1"
                     /db_xref="GeneID:3259704"
                     /translation="MSHPARLSLRAPPHLPFVQGFPGIPADLSRQRETPSVQGTLEVR
                     IGSIPVKARWVRVELRKFESLPPGFPTQATEETWELVGSIQTLWQPKDGKEWDTVQTA
                     DFKFILPLPLSLPPSIDLPKGAGVRYELVAALCYRQKGGVFKKESAPIIKVTEPIQIF
                     KHDLHSAWPIYNIPEKRTIKVANDQMELTVSRPCTAFSAGDKVRISTSLKSSRPKPFT
                     LRGFEYTLSEVITYIPLPPGPSSKSKKHKISTAPVTKARPIQTVRAPLNENIVSGGVK
                     SATIEMEVGNVLVTVKGAKTLEVEYDLEVKAIMEGVAEKVEMRGIRSVIGLFSRDHAQ
                     RAVKDIGHYEPLCPDIPGAEKPLPPRTSSIQSQPRTNGIPPSSYIRPNQQSMIQGFTP
                     RNHRRQSSLTSVTTDTTTTATTATHELGAGVGGSNSQRPFHTMPSIQRRTDVVAFPDP
                     HPARPRSTEPKWPVESLMPERHAMSEAGHGADDCSRYSSGTAATFGRWDLGLQTSIMS
                     VHNRTNSDLTQKTPPTPTNPSSSRPPARTSSSSYTYLSAEQEKRRQQELYDNARARAT
                     EVQKASGASLDRIGLGPGGGSPGMLIKSSAEGGVGDEELDDIPPPEYAPPRPPAQGEY
                     VAPIRPISAYTSRPSEHAITSISTPQSSSTAPPSSPSAFDKVYLTIGQEKEAQRRRYE
                     EATSKVVGSSSAAPSTPSKRQAVDAGPIHSPTSPPPFVTSTSSPASSTSLPAAGIASS
                     LSEKEQMKRYYEAQDRVARAAAQKQNGEGGVDGQAGSSGSGLARNEGAGNSIAAIGAI
                     DEKEQMRRYYEAQEKVAAASGSASGSGSNSNSASGGGRVPGIVSGVPSTLNEKEQMRR
                     YYEAQGRVAAAAASASGSENRPSSVPAPATRSVSTPVGVMDEKEQMRRYYEAQDRVAA
                     AATGASGSGNGASHTPSRHSTLSSVPTTAHADIVDEKEQMRRYYEAEDRVAKAAERRA
                     GSASAFASGSSEDDVPPPPFEAYTSSSINGGNGADASHLSAEEEKALMRERYELAQSA
                     VRKNMSSNPIGSTNSQCTLPSRSRSNFDPGSKPFVLPTSSSSVPPTSTPTGRPFSNVT
                     AATMSTPPDSPNLRDPLVKAGKARVTRTGNSDEGHVSGYAGGNGSGNDNGDSSGSRGE
                     SNANLPAGPPPPLPTKPPREYIHLLSPVGE"
     gene            complement(748194..752230)
                     /locus_tag="CNI02770"
                     /db_xref="GeneID:3259759"
     mRNA            complement(join(748194..749424,749482..750119,
                     750175..750501,750561..750777,750866..751714,
                     751804..751848,751953..752230))
                     /locus_tag="CNI02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657848.1"
                     /db_xref="GeneID:3259759"
     CDS             complement(join(748324..749424,749482..750119,
                     750175..750501,750561..750777,750866..751261))
                     /locus_tag="CNI02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513472.1"
                     /db_xref="GeneID:3259759"
                     /translation="MKVFKTTCLPLVLLYVVFSFPIANASSASDVVQKLCDQLGTVAA
                     CRATIKIPTARVRYGTITLFRINSCKTKKKAFGVSICIPGTEAQQVRTPVGLDIVLTS
                     VDICKFATKTIPGLPDLVKKSTAVCRCIPDAWAMIDTDTFKAVAKSKSVSESTGAILA
                     KTTKFYACAIDAGLNVQDNKQGLTQGTGALVTNGNVRVFKAAELDLDRYSAFALALAP
                     CFTPAGCQPTTIEGFFQNYLKDSEALILDQVKATFTPWSTSLDGVANSFSSLSANTKS
                     IADMTTSIQAASTKIVNDFCPDANVCASNTLTEFKKQVESTLDISKQVGEVYDLAKGT
                     VQDAKDLSDLISSTVSFFENLNDLQIETIVVNFITSGGKSLDELAKSLKVAQRLPNIL
                     NSLEAKLPNLQKTIASIVVKGPQFVDSLQGIFTRNWLSDYQGDAATASKIGDQVFAVQ
                     KLFEQLIPQATELYSSVTFLANSLGSVEKTGQIGKVDVAVASYQRWTKGSFAMPCLTT
                     GKITFSILSFKTVVDYPKFYRCVQEYNIPFPNQHIPYVRLTLPQDSTLAKLGQDTKGA
                     TTSITWSGAKPSANGQANSSVASAASSSFSSSASVVSSSAGISPSEAASSATVTSSAD
                     ISPSETSASTTVTSSADTSPLEAAPSAAISSSSDSSSSDATPSVVVSSSTATPEDISS
                     SLTTASTFNSPPAIDTTRRRAARRRAIPYDRRQEGAEDEDDPVPVDIDITLAAPALSG
                     YATDSTMLSVPTTSVAYSEVVEGDTTRSVEIPVPTNIQITAIETAAEPGPTSITLASE
                     TYNIYSDVTETELETVMSSWSALGTVSVDMATPTEEIDSGGQSAIASSSSASAFATAT
                     ASNAAGKSKGGAWGEAGVSLVVMGTIGGIAFEAIWL"
     gene            756043..756572
                     /locus_tag="CNI02780"
                     /db_xref="GeneID:3259468"
     mRNA            join(756043..756201,756261..756572)
                     /locus_tag="CNI02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_572674.2"
                     /db_xref="GeneID:3259468"
     CDS             join(756081..756201,756261..756505)
                     /locus_tag="CNI02780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572674.2"
                     /db_xref="GeneID:3259468"
                     /translation="MEGCEHTYLANMSDVSTAITTITSSTGTDDISDDFGKKWVWLMV
                     AAVIFIIVFGLVFAICRKYHKRGRMTVWGRNSHCRNCGEKMAGEAGTAQNLEKLWCWK
                     VKTYYCDVCVRNERKNGIV"
     gene            757069..759317
                     /locus_tag="CNI02790"
                     /db_xref="GeneID:3259753"
     mRNA            join(757069..757907,757957..758179,758242..758526,
                     758579..758857,758912..759012,759079..759317)
                     /locus_tag="CNI02790"
                     /product="vacuole protein, putative"
                     /transcript_id="XM_572887.1"
                     /db_xref="GeneID:3259753"
     CDS             join(757110..757907,757957..758179,758242..758526,
                     758579..758857,758912..759012,759079..759168)
                     /locus_tag="CNI02790"
                     /codon_start=1
                     /product="vacuole protein, putative"
                     /protein_id="XP_572887.1"
                     /db_xref="GeneID:3259753"
                     /translation="MSSDESKRPAKPAEIPRRALSSSRLSFRAFFPLLGLLMVLVYQN
                     YPDISSAIITRLSRNASLAERPTTEQLAIVEQDVPLPDSARCPIQPEPLNVGEDWNPL
                     EDSVYADLAVKRLSKAIQIDTVAYDDMPMDTSDPAFDKHLVFARFIEHEYPKLISNLK
                     HEVVNNHGHLFTWEGSNSNLKPIMLMAHIDTVPVPPETLGQWKYLPFEGAITQDGTPD
                     TPGTWIWGRGSSDCKNSLLGIYGAVERLISEGYKPKRTVIISNGFDEEVGGARGAATM
                     ANVLEERYGKHGIAFLVDEGVTGILEYYGASVALFGMAEKGSVNVKVKVESLGGHSSV
                     PPRHTGIGVISRILTKLEDNPFPPILTPETPFFKFLACMSEYAPLVPEFIKTKIKHPK
                     EWPMLAHGLAARDRILNSFLATTQAIDLISGGVKYNALPEYTEATINHRIAFTSSINE
                     TLQHIVDLVLPVAQFLNFTISPFDGSPKASDFHISLEAPYSLEPAPITPSDSKSFELM
                     AGTTKHVFGKGTIVSPSGMFANTDTKRMWNVTKNIYRFSPALVTESVGMHTVNERISL
                     NAHLTTTRFFYKLIRNSEGWVNDDE"
     gene            complement(759327..761523)
                     /locus_tag="CNI02800"
                     /db_xref="GeneID:3259717"
     mRNA            complement(join(759327..759761,759817..759947,
                     760004..760076,760134..760449,760505..760655,
                     760710..760884,760940..760983,761036..761133,
                     761193..761523))
                     /locus_tag="CNI02800"
                     /product="tartrate transporter, putative"
                     /transcript_id="XM_572657.2"
                     /db_xref="GeneID:3259717"
     CDS             complement(join(759410..759761,759817..759947,
                     760004..760076,760134..760449,760505..760655,
                     760710..760884,760940..760983,761036..761133,
                     761193..761445))
                     /locus_tag="CNI02800"
                     /codon_start=1
                     /product="tartrate transporter, putative"
                     /protein_id="XP_572657.1"
                     /db_xref="GeneID:3259717"
                     /translation="MGVTKASPLVPFISLAKRLPFFTDKKMSAQGDHIKHTESVVSDV
                     QKPEDTEAAEMDVERRKTIEKSLVRKLDLRCSLFILLYIMNYLDRNNISAARLKGLQS
                     DLNMTDTEYSTCLSILYVGYILMQIPSNMIMNRISRPSWYIGGAMIIWGMISTCSGVT
                     TSFGGMVATRFMLGFVEAAFLPGALLILSKWYTRKELTLRNAILFGGNLISNAFASLV
                     AAGVLSNMEGTLGHAAWRWMFFIEGAATMFFACLCPLILPDLPTNTRGFTEEELEVAQ
                     LRLLEDVGEADQDSENDGVFAGLIMAVKDVKIYLMMITLTAYVVGLSFNAFFPTLTGT
                     LGFGYVPTLLMSAPPWVFATLVSFAVSWHADRTQEKFWHITIPILFGMVGFIISMATL
                     NTAGRYVALFLQAQAYAGFIVFYSWISSSFPRPPAKRAVAIAMVNAFSQLGNIAGSYV
                     WNLSENGYRKSYGIVLAMFGISIAGCFVFRMILVNLNKKLEAGEAAWEAKEDVTDKSQ
                     KLEHFEQEDEALKMRKGFRYLV"
     gene            complement(<763066..764440)
                     /locus_tag="CNI02805"
                     /db_xref="GeneID:36393039"
     mRNA            complement(join(<763066..763155,763210..763718,
                     763764..763840,763886..764440))
                     /locus_tag="CNI02805"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658739.1"
                     /db_xref="GeneID:36393039"
     CDS             complement(join(763066..763155,763210..763718,
                     763764..763840,763886..764397))
                     /locus_tag="CNI02805"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514410.1"
                     /db_xref="GeneID:36393039"
                     /translation="MATATTGKETSLEDLIRLLPDPQAPLPPLSQNIYTVVTWLVYLV
                     YLSIVPIYLPYLILLHILLPRPFPSWTLSQRINTRLSKLQSTLLAWWLPPILFDEWKV
                     EVWKMYTDETETGKLEVEIVSLPPIDEKMVVSSLLDVRPAVRPGFMIIPKDTVYQPVT
                     KARVILHIHGGGYIRGHPLWTSFPVDIARATGMPCLSVCYRKTLESSSAFPAPLYDAL
                     SAYLYLTQTYPGSSVLLLAESAGGHLALLLSRYIRHFSLPQPGYIALLSPWADLSMSY
                     PSYKSNKDYDTLCPRRLRTAVNSAMRYFIPAALKTEWFSPANAESKSWSYLKEERVKV
                     YIQYGGRELFRDEIVSLAERMKGAGVETTLREDVDGLHTAGLSEPRAKNTFQEDLLGM
                     LKA"
     gene            765155..769959
                     /locus_tag="CNI02810"
                     /old_locus_tag="CNI02820"
                     /db_xref="GeneID:3259671"
     mRNA            join(765155..765468,765542..765751,765798..765890,
                     765936..765995,766037..766087,766129..766178,
                     766225..766326,766373..766427,766479..766672,
                     766721..766742,766794..766888,766941..767025,
                     767073..767124,767176..767375,767429..767490,
                     767542..767605,767662..767725,767778..767899,
                     767952..768033,768089..768259,768320..768435,
                     768484..768560,768614..768713,768763..768800,
                     768856..769035,769080..769154,769204..769231,
                     769272..769465,769513..769580,769630..769720,
                     769774..769959)
                     /locus_tag="CNI02810"
                     /old_locus_tag="CNI02820"
                     /product="expressed protein"
                     /transcript_id="XM_024657849.1"
                     /db_xref="GeneID:3259671"
     CDS             join(765438..765468,765542..765751,765798..765890,
                     765936..765995,766037..766087,766129..766178,
                     766225..766326,766373..766427,766479..766672,
                     766721..766742,766794..766888,766941..767025,
                     767073..767124,767176..767375,767429..767490,
                     767542..767605,767662..767725,767778..767899,
                     767952..768033,768089..768259,768320..768435,
                     768484..768560,768614..768713,768763..768800,
                     768856..769035,769080..769154,769204..769231,
                     769272..769465,769513..769580,769630..769720,
                     769774..769803)
                     /locus_tag="CNI02810"
                     /old_locus_tag="CNI02820"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513573.1"
                     /db_xref="GeneID:3259671"
                     /translation="MPKDPFTAIQESLDDARPQLTALISGALNAQQTRVLLKLLDAIQ
                     KAVHNYVKSRKNKKKKDGDGDSRGAEQVKIDWLDTEGVHLWNLASQVNRATPTTPELS
                     KDELSTFSALRLTGFRLVEAATDIRGPTTFVVRLLGLTAKTMTALLEAGKTPMASQLS
                     LQGAEYEQLITSSTTIKEASELKQKVTVLVWYYMARIDFLLREGNDSFAYDLLYKATQ
                     LDETWSMAAQECRLLASKCWTVGNDMLNKRINISGSIDWLKQGILLVEKLINRGVQLD
                     HLKELHIAILKSLSRAQLVKAEEDPHALTSATAALNELGELVDDSDKATLHEMRLLQV
                     HILKTRKAPEGELRIVMEDIMKLTDWTEDSVLEMLSQLASLIGPYPALPSQSVQTYLR
                     LALASSSGHPYVRIIMYEGLLFVKALSPPAAGVSVAAGILDMISKDPDYQLDDKVSAI
                     ACQTLLWNIGVFNESKERITEAAHWYQLAAHAVFKELGGENISRCYRKAALCHIKMAD
                     WAAAVNLISLCPKEEASTHYLAFLTAIRQGREEAAIDAVCSIVECTDFEVQQLVLMTS
                     FANEKGAKHVLIASMRALLNALTDSRVNSDVQIETITVIRCLVRMTVMELAHAEDKDR
                     LIESMIEYLQTAIDILTEDPTRGQGQTKGISWLYKCAYNVAVQGLSTLSSKSLADLFD
                     ISAQLMSIYDVIETSGATDPDLHFIRGSAMFACLCGKIFFCRDLSNGPDKVLLLDQLL
                     DYVPHCREALSSVKSTHPRWPVVTHMRRIIDTSEIELHCESKEWTAIPPVLERMKKAH
                     ANGEISETNQTLEMMANVLFQYEGCPSHITYQLLELILDTCPTVYAKDIKRYSRWMRA
                     ILRILLHRNGAEEEAESLKYAEKALDVLKTSLGKNAYPLDEIQWLVATSWNKGLEWFS
                     SSRVSQAKAWCEIAMTIATGTPELNIDRQKMNEHYEWAL"
     gene            771309..774376
                     /locus_tag="CNI02830"
                     /db_xref="GeneID:3259562"
     mRNA            join(771309..771584,771636..771764,771811..771946,
                     771992..772683,772736..772855,772925..773133,
                     773204..773328,773388..773553,773619..774376)
                     /locus_tag="CNI02830"
                     /product="nuclear pore complex protein, putative"
                     /transcript_id="XM_572655.2"
                     /db_xref="GeneID:3259562"
     CDS             join(771412..771584,771636..771764,771811..771946,
                     771992..772683,772736..772855,772925..773133,
                     773204..773328,773388..773553,773619..774295)
                     /locus_tag="CNI02830"
                     /codon_start=1
                     /product="nuclear pore complex protein, putative"
                     /protein_id="XP_572655.1"
                     /db_xref="GeneID:3259562"
                     /translation="MVAERTPYSSFASLLAAYQEQYSQAGPSTQLDSPISHEAVLDEQ
                     SGLIISLMESLEETIRSKTPTNCSSFEMDGEEQISEDEYKALLSEHRAWQLIRAVYDN
                     RIPRTDPNFVPPSAAQQIIENPYTSPEDLVQTMVIEDPELSLWATLVEHLQTRPLLTS
                     PPPLEARHGYLPSTVRRSKFHSTTDSPSLDPDFTVRDPHSSSLAGEDQTYQLPLLETL
                     YNLVRYGELESAIKVCEQGGEPWRGASLMGVRRWTMGGMSKGTEPTVMTGNRYRALWK
                     KSCRTIAKNHTLLPAERNLYAAMISDLPTLLPACESWEDYLWAHVQHRIEARLEKRWR
                     ELGGFWEGEGGVGKDDVEEVEMAKGGLEEVFASMRNLQNASISITMTEPYHVAQQMIL
                     LDRTEALFHGFADQLLELESGVSPELIAPLLRFFTHLALILRTLSQPVPVSAANAIIQ
                     AYLQILEREGNDKLVAMYAACLREGSGEESYARFLWSMDPSAGRDSRSEALLRAKKHN
                     LDVALIARETVRLCLEEVVADPPKRLLAEPDIVPISIGLTEHDVVLIRSIEWLIILPE
                     TADDALVRSCQLVRYFLSKGQANAAQSLLLSLPSLPTSSSLTNQSHLLELASYNRLFS
                     LFSSHTYFADILFRQPSLTASKLEVHAWKKDLEACVEDVWKGTVGLIKERWLDLPSLS
                     PKVEKDGKGLYEYEGEEERQKQLKLIRHIFIPDLVLRLHNTLIEQSVLFPYFLQRALE
                     LASIVADGRYRVYEGFLPLATIAGGAEMVGGGEKGVSRLEVYMDKIREVALEVLKSGN
                     GNAFKVRRLA"
     gene            complement(774421..777355)
                     /locus_tag="CNI02840"
                     /db_xref="GeneID:3259400"
     mRNA            complement(join(774421..775409,775465..775519,
                     775572..775888,775935..776017,776068..776197,
                     776253..776445,776496..776733,776785..776878,
                     776933..777003,777057..777355))
                     /locus_tag="CNI02840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572908.2"
                     /db_xref="GeneID:3259400"
     CDS             complement(join(774545..775409,775465..775519,
                     775572..775888,775935..776017,776068..776197,
                     776253..776445,776496..776733,776785..776878,
                     776933..777003,777057..777203))
                     /locus_tag="CNI02840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572908.1"
                     /db_xref="GeneID:3259400"
                     /translation="MAAPRRSAGVTSSSGYADVAELEKYKLISNIGKGSFGVISKVQR
                     VSDGKEFALKQLDYSKMTEKDRKQILAEVAILDSLKHRNIVQLIQKIKDPKNERIYIV
                     MEYCTSGDLGTLIRRAQRNNSSLPEDKIWNIFLQIVLALHHCHWPAERPANTGGRQSV
                     VAPSTDGGVARYQVLHRDLKPENVFLSDEFVKLGDFGLSKDMGTASFTSTYVGTPLYM
                     PPEILAENRYDTKSDIWSLGCLVYEMCALHSPFSAAQTQAELITMVKSGKIPPLPARY
                     SPALRSVIKAMLTLHPAKRPSTKDLLEMPEMKLHRKLFTVQNQTSLLFAKRDELKQFE
                     DQIRARAVALDEREKELAGREASLQAREDLCDSREEEAKETQRKLNQAAESLRGQWER
                     FREEKEQWERYRELEEEAKETAFGVTDVPDEKCQPHTGAVGIARPPLEERNTAPASPS
                     VSRFTRCLDTPSKIPLATAAVSPAPLAPLEARFSTSHFQPRPATPLRRAATKSMGNLA
                     GVVRAQTAQEWAGATQSTPAKQFSFPIRQQRISIGSPSELQSVCCEDVSMISAIPSPW
                     VPRPRKSSVAPSIVVAQQECPASGESFSTGNNRLASVAPTQIPAPTFIYREAATPAKW
                     SFDDPDLPSPFIRRPNSMPTQPQAASFPPSSNMVGMRQPLGSINPQATITAPSALGSP
                     VAKKIPSRSGNLHQHVLKVNAARVSGEGVAPSVAPVGVVRGRTGNRIG"
     gene            777533..779279
                     /locus_tag="CNI02850"
                     /db_xref="GeneID:3259789"
     mRNA            join(777533..777957,778006..778213,778262..778756,
                     778809..779279)
                     /locus_tag="CNI02850"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_572889.2"
                     /db_xref="GeneID:3259789"
     CDS             join(777611..777957,778006..778213,778262..778756,
                     778809..779213)
                     /locus_tag="CNI02850"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_572889.1"
                     /db_xref="GeneID:3259789"
                     /translation="MPSPSPEASSSMSQPGPPSRSPSPASSNPDAPEASHNKTFADLG
                     ISPELCRACASMGFKKPSDIQAEAIPHALEGKDIIGLAQTGSGKTAAFSLPILQTLWE
                     NPQPFFALVLAPTRELAYQISQQVTSLGSGIGVRTAVLVGGMDMMSQSIALSKRPHII
                     VATPGRLMDHLENTKGFSLKSLKYLVMDEADRLLDLDFGPIIDKILKVIPKERNTYLF
                     SATMTTKVAKLQRASLNKPVRVEVSSKYSTVSTLLQHYLLLPLKNKDAYLLYLANELS
                     SSSMMIFTRTVADSQRLSIILRRLGFPAIPLHGQMTQSLRLASLNKFKSGGRSILVAT
                     DVASRGLDIPLVDLVINYDMPTNSKDYVHRVGRTARAGRSGKSITLVTQYDVEILQRI
                     ESHIGKKMTSFDVDKEAVALLTDTVAKANREAALEMRESGTGGGGGKRGRDKGKRKTF
                     GDGDDRDRDDDVVEAGVPRKKNKFTPGGKKKARK"
     gene            complement(779268..782488)
                     /locus_tag="CNI02860"
                     /db_xref="GeneID:3259496"
     mRNA            complement(join(779268..779631,779697..779852,
                     779907..780329,780382..781693,781741..781798,
                     781848..782076,782128..782488))
                     /locus_tag="CNI02860"
                     /product="expressed protein"
                     /transcript_id="XM_572933.2"
                     /db_xref="GeneID:3259496"
     CDS             complement(join(779371..779631,779697..779852,
                     779907..780329,780382..781693,781741..781798,
                     781848..782076,782128..782367))
                     /locus_tag="CNI02860"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572933.1"
                     /db_xref="GeneID:3259496"
                     /translation="MEIASAAWKNKEKQFTQKSHQIASLWGVSSVVRPGILDSTLWTV
                     KDGLFMCTCKNKHSEEDYEVEDKIVAALEKGMMAADANLDEVGKALEKQRIPKRMATI
                     AWGMERHSDEFSWDKEGMRVRHISLDQVAECSNMGLEELSTIDTMSLKCPNKHRRFAY
                     ICRVLTKPKVEDGIVFHVEDPDGLSLPVIIKFPTSTPCYSLSIKTILEELYSVGTILA
                     IKEPAVRYGKRGGYVICVDIPTNIVEIHPKDKLASRFAKIPPAVPVQDLEWESVKDLG
                     NKALKNKNPIIAAKYYTSALADPAVKGSPSRQLLLYLNRAQALLDQKLYGTAYRDCLK
                     AEKLVAEPKAKASQPQCAKLYWRMANSAYGLRLWQSAEQLADKCSHYPESSYQLPELR
                     RKLERRRKEWEKGEYDWTSLFHEVHLSNASHLDVADYQGPIHCRIIPGRNTRGLVLSD
                     AVKAGDLLLVSKAIITTHATDVGNAILPCVDNSNEDYIPPSTYTAINRAVHRYIDDPF
                     MGQLFAGLNLGKNGVNIGTNPLPQWTCCNDSRLSELIKPVETINLRMIRQAIAMNKVF
                     GFSVPYKATDNPVKVDEIRQWPLMLFATPTLLNHSCKPTASLTYWGDVAVVRALYDLP
                     KNCELTVERFDINATYAARLDISFSENIRCSCMLCKSDAKTEYDLRCRLVEEVYPKLL
                     EDFTMDTSHPFDAKSERGFCRAKEWIRSWMQLERKVMSTYGDANKWLRTDLAPVRKGL
                     AKAWYLIDMKKGIETEMRLFEGLGCVWSSREQRLKHGRLLERICPTKDNLIIFLLTSA
                     AHYAKLQPLNRAYVSLWVRTALWAHQIIYGGNIELFKKRFAEKLPPDDMIDWEWTDEV
                     KKNGDGIGTLPRPNVALNGIGVNGKDHVRKFFNSTA"
     gene            782646..786306
                     /locus_tag="CNI02870"
                     /db_xref="GeneID:3259371"
     mRNA            join(782646..782901,783017..783111,783169..783561,
                     783618..786306)
                     /locus_tag="CNI02870"
                     /product="expressed protein"
                     /transcript_id="XM_572654.2"
                     /db_xref="GeneID:3259371"
     CDS             join(782853..782901,783017..783111,783169..783561,
                     783618..786197)
                     /locus_tag="CNI02870"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572654.1"
                     /db_xref="GeneID:3259371"
                     /translation="MATHVPDSGPLDVYFRDELEGQKQLSETLGGELEAGTEGQTCLS
                     LRNTQVESQATPTKYRQQPSALSLSGICEQSQAPEDTFAEQFKYRICSSGLLEKDYVP
                     GLSGVSGADAEPIKPDWPGQMRKWMIKWKGRWDVLAAGACLLVGLVMRLGVVKFAGLL
                     LVLALVAGNYVWYLRTPTLSPCLPTNSTESPKDQTLSSLTTFLAQSDSLNATMMSSLE
                     ILQPNSETGDNSHELRLALHRLTDNMTDHIATATSTLLKMTDRNKLGVLGEMYDIPVV
                     GSSFYSRRRANESFSSDGEQADQTVPSPRRTPVRPLSTPSPSRIPQAGSLRRYGHSGR
                     SQHMSIMSMPDPNDRFTQIPERTPRLSKRASQERATSRKSWNPENIHHERRIMEADEK
                     ADNSFVSAQSSEEGDKTLVQALRGSLSPDPNTSPELSMSTPTTPVTPITKRRPISTSF
                     KHIPSPLSRRLSQVSETGLIPLRTAPLAYRSRTNSSSLLPSPFETDFPSSPIRPTEFS
                     ARVLGSSDDDPGRKRRSLQNMPYYPSSENDHLSGADLTRTRSMPISDLQTLRSAQSTG
                     SRPRRSSVNRDLTSAGLGLGLPNIFLPDKRSSFASVSSPLSRTAIKRINSVSPLTTPA
                     LTASSLGIHLKRRRMACCLLGLRFEESNNMYWEEISSTLKELSRKIKEEREVVEDVLR
                     KVRKNMAIKEALDDLVGGHSGFSDMGISTVEATFPFPTILNDQQRDFAPKTSDQQLLV
                     EHIDKMTSSMVKAWGELANLRSTLGREGEGETSERWAKVRKSLGEVIREWERGREVSS
                     RMDERGQEEALGNDEVEEESDEVQEPKMPDFLRAWEDTSTSRSTSLETDRQSFINKVH
                     LAEHLSTSPHHDDSSVVLDQLPPPGKDTVFESVSAPLPRAKAILNGMTREERIKLMRE
                     VREKGVNIEDLLGVAEMRKDEDARKRGGELVSELERVIDVIRKMKEPEFEGEYKKTVK
                     TDAQTEQPSLASSSLISSILAPMTPSPTPSSGPHLSNTHLQFDLGELKRSFRFPAAGE
                     GGNDHVLG"
     gene            complement(786210..790994)
                     /locus_tag="CNI02880"
                     /db_xref="GeneID:3259498"
     mRNA            complement(join(786210..786722,786778..786881,
                     786939..787099,787156..787284,787344..787423,
                     787500..787711,787780..787994,788051..789853,
                     789900..790033,790095..790163,790213..790555,
                     790612..790821,790875..790994))
                     /locus_tag="CNI02880"
                     /product="oxysterol-binding protein, putative"
                     /transcript_id="XM_572653.2"
                     /db_xref="GeneID:3259498"
     CDS             complement(join(786488..786722,786778..786881,
                     786939..787099,787156..787284,787344..787423,
                     787500..787711,787780..787994,788051..789853,
                     789900..790033,790095..790163,790213..790555,
                     790612..790821,790875..790929))
                     /locus_tag="CNI02880"
                     /codon_start=1
                     /product="oxysterol-binding protein, putative"
                     /protein_id="XP_572653.1"
                     /db_xref="GeneID:3259498"
                     /translation="MSAPMPITPRRASPEKTSKLSTSTSSNSNLSLSAPPSALYNFRL
                     LSALRSEDASEVQQFLNQLKAAGGTEEQMEKAGQMLGMAVRVASIPVITLILNSPNVS
                     SPNLPTGTGTPSTPLHVASELGRVDIVQLLLSDPRIDDTIKDDRGRTPLECAASPEVA
                     SVIEESRAQLQSKYMALLSQYVSSPLNSPGESASLAKFLDLPRMGVVNLNALDGRTGT
                     SLLHEAARRRDLRLVELAVKKGADVFVRDKRNKRVLDGEKNADDRIKMFLRQFNNQDS
                     LVEAKSDGRPPDHRGFLSKWVNYRSGWRTRWFVLENGVLSYYRDREDEAVACRGSIAM
                     AVATLHSSSDGTRFELSSKVSSAVPKFIVKSVHRAEIARWIQTIKLNIEYYQNGPGAE
                     GQGTGPPLPRRSASLKVHDNAATAVNSLPPSDQFLSPTLQRTATSLSGASIGSVKPPS
                     ESSNTRITGTHPESLAFEKDDSDHSEDDDQPSTEVIPYENAYELGVLNIKEQIDLTLQ
                     LVDSIVVPPSAPPSSGRDTSTSARQAAVKDALRQSLSTMSSLVLKQNAMSHDRERYFT
                     SRIQREIQARQLWEENMLTIAKQQAEFEQQLNDAAKVNEKKKKALRQAKGVLAGLSGV
                     SVPTSPAELGEPRASIDQGILGPASTTGTGETLSPFSKTTFTSAGPPISSTTPTAPSG
                     ALSPPSIPNIKEAHDAIVAAESGDEDDDTDEFFDAIEQNQLPNLKLYDSIAHPERELP
                     GTPVTPGTPGIDRGVGIVADAGGEAEEGAVQDSKLVRQQSVPAKGTIEEYLARQSLEP
                     YLHVRHKLPIDDDKRPSVSCELFYYTDKYRKGVGLRGAHVIVWSILKSSVGKDLTKIS
                     FPVSFNECTSMLQRMAEDMEYDACLTVAASEKDSLRRIAFVGAFAMSNYSSTIGRIAK
                     PFNPLLSQSFEYAIPNRYRYISEQVSHHPPISACYSEAPKWKYYGEVDAQNKFQGRSF
                     EIRPTGVAHAELIIPQEWINPSLKYPDAGSEYGPGLVKEHYSWKKVTTNVSNFIMGSP
                     IIDHYGDLVVTNHRTGETCTLTFKPRGWRGRDAFEIKGNVKDADENVKWDIAGRWDTQ
                     LIAREASAETLPLESDMNVNQAQKEYILLWRNSEKPKAPFNLTPFAITLNDIPKGLGE
                     YLCPTDCRLRTDQRAFENAEYDRAQGLKTLNEEKQRNTRKLRAEGKLPPHEPRWFNAT
                     VDDDTRERLWEPKRAENGEVAFWSVREKKNWDAAGIEHIFASDEA"
     STS             788831..789656
                     /standard_name="Hind19"
                     /db_xref="UniSTS:470711"
     gene            791307..793178
                     /locus_tag="CNI02890"
                     /db_xref="GeneID:3259770"
     mRNA            join(791307..791535,791594..791931,791985..792106,
                     792165..792270,792325..792415,792478..792744,
                     792834..792888,792964..793178)
                     /locus_tag="CNI02890"
                     /product="structural constituent of ribosome, putative"
                     /transcript_id="XM_572652.1"
                     /db_xref="GeneID:3259770"
     CDS             join(791390..791535,791594..791931,791985..792106,
                     792165..792270,792325..792415,792478..792744,
                     792834..792888,792964..793107)
                     /locus_tag="CNI02890"
                     /codon_start=1
                     /product="structural constituent of ribosome, putative"
                     /protein_id="XP_572652.1"
                     /db_xref="GeneID:3259770"
                     /translation="MSDMFRKSVLNKLPHLPPTRAPWADESEPIEEIDEEDEQLDGIG
                     EFKPATMGPSKHDTQDYSPLSASTFFAQAAEVQPPSTPCTFRVYLTPPNLSIASANAG
                     TPPGPSGLRTQQQTNRHGTYLVCHHGGGASGLGFAPLAREVKAKGNGEMGVLAFDCRG
                     HGKTSTSDPNLELDLSHDTLLSDFMAIIEMMFPDPKESPSLILLGHSMGAAPVVSAAP
                     ELQKKGYTIPGVVVLDVVEGTAVESLPLMKSVLSKRPESFRSVIDAIYWHVTSNSIRN
                     VESARVSVPHIIVPAPSSSSSDPSANPGGKQVWRTNLVGTEPYWEGWYKGLSQRFLRT
                     KCARLLVLAGQERLDRELMVGQMQGKFQLEVMSDVGHYLHEDNPAGLAATLITFWHRN
                     TRVLVLPPKIGAPGPGARGGPVEVKQVGQQ"
     gene            complement(793145..794230)
                     /locus_tag="CNI02900"
                     /db_xref="GeneID:3259532"
     mRNA            complement(join(793145..793498,793590..793926,
                     793997..794230))
                     /locus_tag="CNI02900"
                     /product="expressed protein"
                     /transcript_id="XM_572907.2"
                     /db_xref="GeneID:3259532"
     CDS             complement(join(793226..793498,793590..793926,
                     793997..794157))
                     /locus_tag="CNI02900"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572907.1"
                     /db_xref="GeneID:3259532"
                     /translation="MPHASTSRHTESTQLYNLREPPPCRNDAVTPALFIPVHAVHEGL
                     KRRKVRLIGQILHFNNRKSILIITSHPSARKPTATAAQSPTLLADISIPLLANSPSVR
                     DVTDVLGTAVFSRLSKSFLPPESEEDKRMVRMKGLVGREMVSIRRGEWVNLVGWLEDG
                     KDAVRKIQTFGPYAPPPPLILEVIHISNSRPLPTPIPKLRGEIDGWNGQLTAISPDTP
                     KAAMKGMAKQTAEGCEEKKDESWDEVTPKPKRMRQISS"
     gene            794329..795522
                     /locus_tag="CNI02910"
                     /db_xref="GeneID:3259429"
     mRNA            join(794329..794968,795039..795160,795221..795287,
                     795342..795522)
                     /locus_tag="CNI02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_572891.2"
                     /db_xref="GeneID:3259429"
     CDS             join(794795..794968,795039..795160,795221..795287,
                     795342..795410)
                     /locus_tag="CNI02910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572891.1"
                     /db_xref="GeneID:3259429"
                     /translation="MPSSSSAKDKEEKLKAKRKEYLKKSDPATVEELVDGKTLVKDYF
                     KEGEWKPSWAHLEFNGDACLDNILKKSNEGFYVPAGTILPLGASMQPMTVVRYGGYFP
                     EGTSFPGGVLVPMYARMVNLLPKETTKPASKLSEESLCTIQ"
     gene            complement(795833..796575)
                     /locus_tag="CNI02920"
                     /db_xref="GeneID:3259727"
     mRNA            complement(join(795833..795968,796041..796140,
                     796204..796266,796329..796361,796416..796575))
                     /locus_tag="CNI02920"
                     /product="small nuclear ribonucleoprotein E, putative"
                     /transcript_id="XM_572906.2"
                     /db_xref="GeneID:3259727"
     CDS             complement(join(795913..795968,796041..796140,
                     796204..796266,796329..796361,796416..796442))
                     /locus_tag="CNI02920"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein E, putative"
                     /protein_id="XP_572906.1"
                     /db_xref="GeneID:3259727"
                     /translation="MSGRKVMVQPINIIFSHLQKHNRVAIWLYDNNDFRIEAYIIGFD
                     EFMNVVLDDAEEVYDCGAKPGKEVPPRRELGRILLKGDNITLIQPVTA"
     gene            796716..798403
                     /locus_tag="CNI02930"
                     /db_xref="GeneID:3259413"
     mRNA            join(796716..797478,797529..797648,797705..798403)
                     /locus_tag="CNI02930"
                     /product="homoserine kinase, putative"
                     /transcript_id="XM_572893.2"
                     /db_xref="GeneID:3259413"
     CDS             join(796759..797478,797529..797648,797705..797938)
                     /locus_tag="CNI02930"
                     /codon_start=1
                     /product="homoserine kinase, putative"
                     /protein_id="XP_572893.1"
                     /db_xref="GeneID:3259413"
                     /translation="MAARKHKIHVPCTSANIGPGFDVCGIALSLSLSLVVTIPSASSG
                     AESLPKIIYTGLDSDNVPLSPYKNLLTRVALYVLRANGITTFPPGVTIEAHNEIPFGR
                     GLGSSGAAVIAGVLLGDLLGNLNLPKSRLLDFALMVERHPDNVTAALMGGFVGSYLRE
                     LSPEDMSAASIPLAEVLPEYPPDAGPDWGKSPPQPPHGIGHFVRFGWAKEIKAIAVSP
                     RFELATAKARGVLPESYSRKDMIFNLQRLAVLTTALARSPPDPDLIYDAMGDRVHQPY
                     RMTLIPGLPKILSTLTPTSHPGLLGICLSGAGPTILALATHNFEAIADEIERIFGDEQ
                     VLVDHKVLDIDEKGSWVEDITEA"
     gene            complement(798211..799917)
                     /locus_tag="CNI02940"
                     /db_xref="GeneID:3259415"
     mRNA            complement(join(798211..798827,798882..799002,
                     799058..799168,799219..799335,799409..799549,
                     799617..799917))
                     /locus_tag="CNI02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657850.1"
                     /db_xref="GeneID:3259415"
     CDS             complement(join(798511..798827,798882..799002,
                     799058..799168,799219..799335,799409..799549,
                     799617..799799))
                     /locus_tag="CNI02940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513464.1"
                     /db_xref="GeneID:3259415"
                     /translation="MAPRKSVSSRTGKPPAASSSKTTLDSIPPADIPESLTPGYLYEP
                     TERQPLTQEEQAKLIHELVGFNPKNLGADLTETARLEMYNAVTSIDNWTNTVAKDSKS
                     RAELIHGLHALETLLETHVDKAFDMFTSWLLRNPFEFSPDLEVVLPWQKGLDFSRGEY
                     VATQLGGQDGLQMKLDKLRTEVEQARLVSQRLEIAEKKLDRRIEVLKQRQAQVGFVKE
                     IIDSAGLNPLPTRAAQLQTTLTSLQSALIPLDIIPIPTSTGLPPSSGEHTKAWELGRA
                     AYLNWALGKMLPPGVVGESGDAERLERIEQEIEETGPREGMEVLTGSLRDMSQ"
     STS             799939..800100
                     /standard_name="AGC4"
                     /db_xref="UniSTS:470709"
     gene            800034..803664
                     /locus_tag="CNI02950"
                     /db_xref="GeneID:3259556"
     mRNA            join(800034..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803497,
                     803546..803664)
                     /locus_tag="CNI02950"
                     /product="transcription corepressor, putative"
                     /transcript_id="XM_572649.2"
                     /db_xref="GeneID:3259556"
     mRNA            join(800034..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803279,
                     803330..803497,803546..803664)
                     /locus_tag="CNI02950"
                     /product="transcription corepressor, putative"
                     /transcript_id="XM_572650.2"
                     /db_xref="GeneID:3259556"
     CDS             join(800183..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803279,
                     803330..803495)
                     /locus_tag="CNI02950"
                     /codon_start=1
                     /product="transcription corepressor, putative"
                     /protein_id="XP_572650.1"
                     /db_xref="GeneID:3259556"
                     /translation="MKVTKPNWVEHTVGEKKAKTAIYSISVHPDGTRLATGGLDHKVK
                     IWSTLPILDVEAEKEEENPKLLCTMSSHTGSVLSVRWAHHGRFLATGSDDQVIMIWGL
                     DPDGGGRLWGSDEINVENWKALTRLVGHVADVVDLAWSRDDTMLASVGLDSTVWIWDG
                     LTFERLRKLDLHQGFVKGVCWDPVGNYLATQSDDKTVKIWNTEDWSLAETISKPFETS
                     PQSTFFRRLSWSPDGAFIAASNAMNGPVFVAAVIDREGWASDISFVGHENTIQVAAFN
                     PRLFFPEGEPKGRATASSMLALGANDFSISIWRNTLYKPLVVLKDIFGADLMDLCWSN
                     DGYVLYGSSVDGSVCAIQFEPSEFTDLADFSATELVLREYDYKPKRAHQPLAVHSSAA
                     SITNGFGPSTTTSTHVNVLQPKKGKAKRRVDLSNGNINAGPSAGPSRQALRPPPPVDP
                     FSGPIQGFASPSTAQASTARMFEDAHRAFGPGSGSISGTSPRAGDKRKASGSYEDPTR
                     GVRGRGMPVQQPIQQFEVQIIRAPMVAPSPSDAGPSKAYLPYPQVQSILRAQAIGNES
                     RSIYLEARNTSDPKGENVLCYFADGEQRWMDYLPKAALAVTVTKNFCAAACEDGSLRV
                     YSPAGRLILNMKLSGLVYDLQGEDKMLLIITMDCQVRVINVRNGKAFSPPSSIHHLLF
                     PGSSSFHSFDIISCTVRPNGVPVIITSEPQAFAYDASLHEWSTIASPPIAGIQPLPSG
                     PSGPLSVVDQIVAKSAPVTTTEKSNAPWIEESYVMSQFEMKLRGTVLLDSKEEHKHWL
                     LGYMKYLGDENFAERAGEVMKDLIGPVYHQSKPTGWEPKLLGVDKREIAAEVLDVLSK
                     TLQGKNVASVWYDVLDKMKADEGSW"
     CDS             join(800183..800219,800271..800351,800412..800513,
                     800570..800660,800731..800816,800876..800968,
                     801024..801106,801164..801409,801460..801635,
                     801690..802586,802638..802733,802788..803283)
                     /locus_tag="CNI02950"
                     /codon_start=1
                     /product="transcription corepressor, putative"
                     /protein_id="XP_572649.1"
                     /db_xref="GeneID:3259556"
                     /translation="MKVTKPNWVEHTVGEKKAKTAIYSISVHPDGTRLATGGLDHKVK
                     IWSTLPILDVEAEKEEENPKLLCTMSSHTGSVLSVRWAHHGRFLATGSDDQVIMIWGL
                     DPDGGGRLWGSDEINVENWKALTRLVGHVADVVDLAWSRDDTMLASVGLDSTVWIWDG
                     LTFERLRKLDLHQGFVKGVCWDPVGNYLATQSDDKTVKIWNTEDWSLAETISKPFETS
                     PQSTFFRRLSWSPDGAFIAASNAMNGPVFVAAVIDREGWASDISFVGHENTIQVAAFN
                     PRLFFPEGEPKGRATASSMLALGANDFSISIWRNTLYKPLVVLKDIFGADLMDLCWSN
                     DGYVLYGSSVDGSVCAIQFEPSEFTDLADFSATELVLREYDYKPKRAHQPLAVHSSAA
                     SITNGFGPSTTTSTHVNVLQPKKGKAKRRVDLSNGNINAGPSAGPSRQALRPPPPVDP
                     FSGPIQGFASPSTAQASTARMFEDAHRAFGPGSGSISGTSPRAGDKRKASGSYEDPTR
                     GVRGRGMPVQQPIQQFEVQIIRAPMVAPSPSDAGPSKAYLPYPQVQSILRAQAIGNES
                     RSIYLEARNTSDPKGENVLCYFADGEQRWMDYLPKAALAVTVTKNFCAAACEDGSLRV
                     YSPAGRLILNMKLSGLVYDLQGEDKMLLIITMDCQVRVINVRNGKAFSPPSSIHHLLF
                     PGSSSFHSFDIISCTVRPNGVPVIITSEPQAFAYDASLHEWSTIASPPIAGIQPLPSG
                     PSGPLSVVDQIVAKSAPVTTTEKSNAPWIEESYVMSQFEMKLRGTVLLDSKEEHKHWL
                     LGYMKYLGDENFAERAGEVMKDLIGPVYQ"
     STS             803850..804646
                     /standard_name="Hind18"
                     /db_xref="UniSTS:470710"
     gene            804064..806485
                     /locus_tag="CNI02960"
                     /db_xref="GeneID:3259630"
     mRNA            join(804064..804485,804535..804585,804625..805459,
                     805509..805677,805730..805926,805980..806187,
                     806251..806485)
                     /locus_tag="CNI02960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572912.2"
                     /db_xref="GeneID:3259630"
     CDS             join(804407..804485,804535..804585,804625..805459,
                     805509..805677,805730..805926,805980..806187,
                     806251..806280)
                     /locus_tag="CNI02960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572912.1"
                     /db_xref="GeneID:3259630"
                     /translation="MSSDGENEDLAYEDDYDVFDADDVMDDSASEPDDFDVLSPTIET
                     VPSKKPYDVNYTVYDLKEIIGMQKKMIDEVAALLVIPASTAAALLRHFNWNTEKLQEV
                     FWTEPDATLLAAGLSPPSSPSTSTQPLPGSQSGSFECPICFTDYEGKSAQQDTFAMGC
                     GHRFCKTCWGEYLTGKIKEEGESGRIQCMESGCKRVVKGEMVKELAGDKISDRYYNLL
                     NAAFVSDSPNLRWCPHPDCPYIIGCTQAPQRMLNQLVPTVECECGKDLCFGCGYAASH
                     RPVICKIVRLWEKKCADDSETANWLQANTKECTKCQSTIEKNGGCNHMTCKKCKWEFC
                     WVCMGPWSEHGTNWYQCNRFDEKSGIDARDVQAKSRASLERYLHYFNRWANHEHSAKL
                     DTEFYAKTEKKMEQMQDAGNLSWIEVQFAKQAVDAVIRARITLKWTYCMAFYLKRNNQ
                     TELFEDNQRDLERAVENLSYLLEQNIGEPESIAKLRHDVTNQAAYVQKRHEIMMDDTL
                     RGHLEHRWEFTVDV"
     gene            complement(806743..808487)
                     /locus_tag="CNI02965"
                     /db_xref="GeneID:36393040"
     mRNA            complement(join(806743..807035,807119..807486,
                     807545..807938,807988..808261,808324..808487))
                     /locus_tag="CNI02965"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658740.1"
                     /db_xref="GeneID:36393040"
     mRNA            complement(join(806743..807035,807119..807486,
                     807545..807966))
                     /locus_tag="CNI02965"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658741.1"
                     /db_xref="GeneID:36393040"
     CDS             complement(join(806913..807035,807119..807486,
                     807545..807623))
                     /locus_tag="CNI02965"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514411.1"
                     /db_xref="GeneID:36393040"
                     /translation="MGLVIGGLFGFITAHYQQAGWRGLFRDMIIVILPFGVSALVFIP
                     KTAGDLAENLPSRDKSKRLYIVNCFLMLSSVIFLVLGITQRTLRLKEASFLVPFLLCW
                     PIFVIFYGARLSEGYALTPPPPPPSFWKIPNMTILIVLALGIYPWWLCDPSITSMSLP
                     SLRLFESFLKIFLLSLWLFWFRLSSGRAK"
     CDS             complement(join(806913..807035,807119..807486,
                     807545..807623))
                     /locus_tag="CNI02965"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514412.1"
                     /db_xref="GeneID:36393040"
                     /translation="MGLVIGGLFGFITAHYQQAGWRGLFRDMIIVILPFGVSALVFIP
                     KTAGDLAENLPSRDKSKRLYIVNCFLMLSSVIFLVLGITQRTLRLKEASFLVPFLLCW
                     PIFVIFYGARLSEGYALTPPPPPPSFWKIPNMTILIVLALGIYPWWLCDPSITSMSLP
                     SLRLFESFLKIFLLSLWLFWFRLSSGRAK"
     gene            complement(808709..811170)
                     /locus_tag="CNI02970"
                     /db_xref="GeneID:3259699"
     mRNA            complement(join(808709..808905,808954..809193,
                     809254..809633,809683..809775,809833..810062,
                     810112..810608,810659..810886,810939..811170))
                     /locus_tag="CNI02970"
                     /product="expressed protein"
                     /transcript_id="XM_572937.1"
                     /db_xref="GeneID:3259699"
     CDS             complement(join(808728..808905,808954..809193,
                     809254..809633,809683..809775,809833..810062,
                     810112..810608,810659..810886,810939..811087))
                     /locus_tag="CNI02970"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572937.1"
                     /db_xref="GeneID:3259699"
                     /translation="MNGISEQRSSPKTVFEDLRLSIDPTTIRLALGEKPVKSIDPDGT
                     IAYDETKTPDAKLTEQLERIWNEYPNGLLELTERKLERLPPDEDAVKPQGEGVDEEKK
                     RDPFSMMTYEEMEKLRSEIFLQLNDARNELWFVLELAKTLSSSSSFTTQPPPPPAALH
                     QKKGKAKPAPPAPTTLPSIPGEPPILPPGTFSTTPSDFPIKPPHAQIYELERLLQAKR
                     IALNECQGLIDGAVGELRLMAHAGDRFWKDIRNLKEGEGGRGQWAVVPKPDFGRVGGE
                     GEKAKDVVIPYAIDEAPSGTRARCLAGFDLDPTKKDGLTFGDRHHLRLRATLRDDSGA
                     VISSTPVKVEDQSDVRAMMEAAQMEAFDEDLFNEIRFAAARIPKNETEPQRVSFPVAD
                     KILSFELYDTRSLPSSPTSSICDIIVSSTRLSLLNIHRQRKINLVAPSQNFASPIPSI
                     LLPIIDTLRFRQLCSLVSSTLNGFDRTLRDAGLDSRMEKRMLKDGQDEIKEMRAVLLG
                     KRGAEVLTGEYSLGIDDSYIITINISAPYNTIVYLSSISFPLANPDELSQVVSDDLSV
                     QLLRLASRHLHGKLADEHKKGLYFDSLEEVIRIGETGLLRLSIPASFHTIYGSVESDW
                     ISVQAYDSRQSDITVFAWLDTVTHAIESSLSSNGSTTQVR"
     gene            complement(811379..813999)
                     /locus_tag="CNI02980"
                     /db_xref="GeneID:3259497"
     mRNA            complement(join(811379..811707,811766..812923,
                     812981..813999))
                     /locus_tag="CNI02980"
                     /product="protein serine/threonine kinase, putative"
                     /transcript_id="XM_572865.2"
                     /db_xref="GeneID:3259497"
     CDS             complement(join(811523..811707,811766..812923,
                     812981..813341))
                     /locus_tag="CNI02980"
                     /codon_start=1
                     /product="protein serine/threonine kinase, putative"
                     /protein_id="XP_572865.1"
                     /db_xref="GeneID:3259497"
                     /translation="MDPPRASSTRSSSSSMPTSSSASASANKLKKFKLDPMSMLLPHE
                     RPGYRGSPAAGRSMPPLHPQFQLQSQPGSPAYFAMLQSQQVQQDSGTQRIGIQTRTTA
                     SVGEQGGKRGEGSGSQIPTQVPVGSQHPAQGVPLSPPASMASTPPSGSWEDSASQWSS
                     MEGVVEGTPAPGQRSQPSRHYAPRMTQNTMRLEDWEIVETLGTGTFGRVLLVRQRPSY
                     RPTPYHPIFPHLYRSRHPFSPSPSTTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSE
                     RIILERVRHPFIVELHATYQDQINVYMLLSYIPGGELFSHLRRAGRFSADVTRFYLAS
                     IVLAIEYLHSQNIIYRDLKPENLLLDRHGYLRIADFGFAKVVQDRTFTLCGTPEYLAP
                     EIVLSQGHGKAVDWWALGILGFEMLAGYPPFFDDHPLGIYEKILRGDIAFPSHVDPYA
                     KDLIRGFLTADRSKRLGNLRGGAKDVMGHPWFAGVDWRSLERKEIGAPIVPRVASMGD
                     SQNFQRYPPPRPQDLPGVFGQTYNTSNDPCGELFSDFSFPGGGSERGSASESTEVLSR
                     D"
     gene            815728..819374
                     /locus_tag="CNI02990"
                     /db_xref="GeneID:3259741"
     mRNA            join(815728..816678,816742..816993,817048..817191,
                     817242..817370,817432..817614,817671..817799,
                     817856..819374)
                     /locus_tag="CNI02990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657851.1"
                     /db_xref="GeneID:3259741"
     CDS             join(815787..816678,816742..816993,817048..817191,
                     817242..817370,817432..817614,817671..817799,
                     817856..819189)
                     /locus_tag="CNI02990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513578.1"
                     /db_xref="GeneID:3259741"
                     /translation="MTHPGASNLPTTISSSVTGATAVTGGFVQADDSSAPQSNSVVEP
                     GGGLASSPNVPQPGTSINSQTGKPHTAGLTRAQLEAQKAGEVAFQGGQGFAGPGLGSS
                     PNVPKPGTTINPETGKPHTAGLTRAELSAKRAEEGAEQATTESEPPSTTIPTSVKPIN
                     TEAGEPNTGSLPLGDLEGKKAQAIAAATLYAPVIPVASKPAAEVDPADTTQAGALSAK
                     EVEAFKDKGADLLDSAPQTEQVRRGSVNSVAEENKVRRPSDVNGREQAARQLAGLVPD
                     TIETASAGSSTPGQELPGGWGAIKPTPLPGSGPNAPTSLYEDVTEGLGKMGQAAFSVI
                     PSPIKDAFHGPGSPKGRRSSATGLIDQAKAQASKVAEGLQGTIQNTQRRASANFGPDG
                     TIRKQVMNFVDEAFQSTKDASAAEFGFIHSGPHGRVAIVPRVSHPTDEFVGAQPGEHS
                     DGVGALPGTANETGVAVLPEEKKVDAAKAASSETNQGVRPGEAVGVGALADVPVGAVA
                     ASQAGPSNTLPQAKHTTTHADHVAGVAPRTSLPSDEFTGALPGEHSSGVGALPGTVNE
                     AGVAVLPDEKTLNASAPSSAIIASIATPGSSTAVSAEPSTSGAVAPASITGALANSSS
                     NRDPSSTTVTGTSTSADNSYSLAPPLPATTLGLGAAHGATKLDPDGTPTAPGSTTTTT
                     LSSATTSISPGEKHFASETTHAHERTSSAASMTAIAHGREGKPLDRELAAKESKIAPS
                     PLAESTVAEDRSVVNGKETAAGVTTIGQKSTAPATSHITSLTPGKEDDGVGHPSTHNI
                     PGTSREPGTYPTPDNATNTKAPATIGVAGSKIGQHNVKGPNEPVDGTGTAGEADALIS
                     HDDSAKHSNALKPVKDKITDPHDKTYPSDREVADVPDIKTTGEDNTKATKSPAAPGIE
                     SAAEKLKTERPTTPTKGTETGPTIPVKGHTEAVDKKSTATAAGTGAAAVGGAGAAGAG
                     TSSTIAPTHKSQSSTDNPVSPTTSTGSGTTPKKKTGFMKKLKNKLAQI"
     gene            complement(819529..819632)
                     /locus_tag="CNI03000"
                     /db_xref="GeneID:3259723"
     tRNA            complement(819529..819632)
                     /locus_tag="CNI03000"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:3259723"
     gene            819752..821981
                     /locus_tag="CNI03010"
                     /db_xref="GeneID:3259527"
     mRNA            join(819752..820076,820140..820405,820463..821981)
                     /locus_tag="CNI03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_572913.2"
                     /db_xref="GeneID:3259527"
     CDS             join(819825..820076,820140..820405,820463..821918)
                     /locus_tag="CNI03010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572913.1"
                     /db_xref="GeneID:3259527"
                     /translation="MPDFTPNLHAAHDQIQSLLSHIHSFPTERLMYHAPVLDRIYLPS
                     LDLRSDDKKTGQPRIWRQEDVMGLKKFIEGIEHHEQHIQSMIDSNIPPQEDPLPSVQG
                     LETFWKVVISCKPPVVGVRMPMGRDKGGSWSGAESKGRKVPGNGGHKARKAKEIWVDV
                     LADGGKEWIRIYSKKISHLLAEFREQDSYVNSDFNSDSQTGYHDDNGRQQYNSLLATA
                     RDLRRAASRTPRIPGAPVPKLSLWLTRIPPTPEQLPPEYLDPESTIPEWPDNRIPQTL
                     ATLKEWGVTVHHLSPPPLSQLSGHLVPKTPPPSMKINFDITALLGLCSDVLHYPLPKD
                     SEEAAKRSLRPKNHLIGKGSAVRGRDGTGKGKGKGRREMDAEDEEDEILKGQSQNSRE
                     LYRCILEEMERPWVEEFNAVMTEAWEEHKKLYGMTGDEPQVEFWATKEAAQYTFEALT
                     SGPAHGLGEEQRRMKRMLGYEKGDVFEGSRYEGKEGVLKGFKVKIFDAEALDSGKVER
                     TGFHVSLEAISKAFLDEYYTSLQPPDLAKKSQDKFKSSILPNFLQPKKISAPPVAKIT
                     LPFPVVSLHSLCRGAKEGMTTVMMGTATFKEVWGQSRWKVRGWERAGYNLAPGADREK
                     GSAAVMIFPYRVFGEGKRVRFEKGDYSYPNPSA"
     gene            complement(821911..823141)
                     /locus_tag="CNI03020"
                     /db_xref="GeneID:36393041"
     mRNA            complement(join(821911..822059,822104..822266,
                     822318..823141))
                     /locus_tag="CNI03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657852.1"
                     /db_xref="GeneID:36393041"
     CDS             complement(join(822049..822059,822104..822266,
                     822318..823061))
                     /locus_tag="CNI03020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513462.1"
                     /db_xref="GeneID:36393041"
                     /translation="MSRSTISSLESQLSTATHELELATFLNKGILQTNTEYKLRIAEL
                     ESENNILRKAETRLAGTEDALEDAEKRIKMLEEERDVWEEELETAKENMESAERDKDA
                     AVRERDHERNQRELWEERFWELRGSLEGLMERTNYQIGGSSRTLSQAKSKKGLLPLLK
                     DLTPVAKVKPNASASTGRLSRKPRLQSPTSPPSPPIEPSSPLRRPMREAAKKRKWLAE
                     SESDEEDAFVPKGGRRKALADPLADSNYTETSSQIATPASSRVPFNSKRRGRQSNNTK
                     QQMDITMQVKEEPTSPGYKNPSEDSDDPL"
     gene            823227..824515
                     /locus_tag="CNI03030"
                     /db_xref="GeneID:3259594"
     mRNA            join(823227..823612,823668..823842,823896..823948,
                     824017..824126,824186..824280,824341..824515)
                     /locus_tag="CNI03030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657853.1"
                     /db_xref="GeneID:3259594"
     CDS             join(823286..823612,823668..823842,823896..823948,
                     824017..824126,824186..824280,824341..824402)
                     /locus_tag="CNI03030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513461.1"
                     /db_xref="GeneID:3259594"
                     /translation="MPASPDRRRGDDSRSPRRDRDSSSYHRRRSPNRPNSGRSSRPRD
                     GGWGNRDRVREQEKDGGYGRGSDKGDRGSYRSSSRRDREGSYGQKERESERAKDRKRY
                     DDDVGREDSDQPPVEREKPNFSSSGLLAKETNTVKGVVVKYNEPAEARKPTKNWRLYV
                     FKGTEQIDLIHIYRQSCYLIGRDEVVTDIPVAHPSCSKQHAAIQYRQMTERNEYGDVA
                     TTIKPFIIDLDSTNGTFVNDIEIPKSRYYELRPSDVIKFGTSSREYVLLHEDVSS"
     gene            complement(824474..826346)
                     /locus_tag="CNI03040"
                     /db_xref="GeneID:3259541"
     mRNA            complement(join(824474..825057,825137..825472,
                     825542..825990,826062..826096,826173..826346))
                     /locus_tag="CNI03040"
                     /product="expressed protein"
                     /transcript_id="XM_573014.2"
                     /db_xref="GeneID:3259541"
     CDS             complement(join(824527..825057,825137..825472,
                     825542..825990,826062..826096,826173..826237))
                     /locus_tag="CNI03040"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_573014.1"
                     /db_xref="GeneID:3259541"
                     /translation="MAIPLVWLSQQLIPPLLLTYFFISWKVATFELAPSLSLDVLAWS
                     QPDSGNISTFTNGIKRIIAYNILFSLHILPTLLIGFISALYLRLYFLPRSQSVPPYDP
                     PFEVLDKQVMFACLFPRSASRSRSHLELESEFGDVLLITEQEPIVERCYKGRCGGRWK
                     PARTRHCTQCGVCRAGFDHHCPFFANCLTAPYIPTFLAVLLYTPPTVLILSFPLLSPL
                     LHRFIAAYSQACDSSEIIAYWWNWKWSWVVAGGPVGRFAGGIILGWRELDRQDGGGLY
                     RLAVGLLVAFGFILSGITASLAYSTIRILRDGDFTIDRERSSAHRRILSTIKGLPREQ
                     PIPDKLRQNLARFSDRPAFYLPPRDIDRICPGQGQDRKWDCHGRKNPKGYVVQLNDKA
                     RPYDHGPRMNTQLVLGTPWGEGWSWLLPWRAIRPGIEYDGGERCLFNWPVAEGVRQEI
                     EGAIGSGILNRLSEGDHLNCR"
     gene            827571..829444
                     /locus_tag="CNI03050"
                     /db_xref="GeneID:3259735"
     mRNA            join(827571..827618,827746..827886,828562..828623,
                     828676..828814,828873..829134,829197..829444)
                     /locus_tag="CNI03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_572643.2"
                     /db_xref="GeneID:3259735"
     CDS             join(827812..827886,828562..828623,828676..828814,
                     828873..829134,829197..829243)
                     /locus_tag="CNI03050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572643.1"
                     /db_xref="GeneID:3259735"
                     /translation="MAPTKKTTTAPKKAASHPPFLTMIQEAISSHPTDSKKGVSRVSI
                     KKYLEDKYKLDMSAAGNTSNLNGAIKRAVEKNELALPGGPSGRVKLVAAAKPKAAEKK
                     PAAKKPAAAKPAEKKTTTKAAPKKAASATTKKATTAKPTAAKAKAAAPAKKTAASSTA
                     AKKTAEKKAAAPKKTKAPAAKKAAAPKKAASKKA"
     gene            complement(829442..830115)
                     /locus_tag="CNI03060"
                     /db_xref="GeneID:3259491"
     mRNA            complement(join(829442..829732,829790..830115))
                     /locus_tag="CNI03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_572863.2"
                     /db_xref="GeneID:3259491"
     CDS             complement(join(829483..829732,829790..830049))
                     /locus_tag="CNI03060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572863.1"
                     /db_xref="GeneID:3259491"
                     /translation="MLSGLGIDILSLSRFRDFVIRRGADKVAKRICTPGELKRFEKLA
                     RDSVARRIGPESAHSSNTQLEATSSVLGTEDILDRQVRFLSSRWCIKEAAYKSLSPLL
                     PRPPSFKTFELVHSLTGQPTLDIISEAKDKYTLLSSLSHDAGVVVGVVIAIDRTFNLL
                     RKDDVDFSH"
     gene            830253..832520
                     /locus_tag="CNI03070"
                     /db_xref="GeneID:3259611"
     mRNA            join(830253..830341,830413..830782,830848..831101,
                     831159..831330,831392..831656,831733..832327,
                     832391..832520)
                     /locus_tag="CNI03070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572914.2"
                     /db_xref="GeneID:3259611"
     CDS             join(830322..830341,830413..830782,830848..831101,
                     831159..831330,831392..831656,831733..832327,
                     832391..832502)
                     /locus_tag="CNI03070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572914.1"
                     /db_xref="GeneID:3259611"
                     /translation="MDEETAYELERQKTIAENRALLDSLGLDPAGASSPFGSSPAPTS
                     NKTKPKPKPAPKKRKAAAVIAVDEGPRRRSGRIAGLEADGDAFKAKVEEEEKEREILR
                     VVSRKEREKVMDVGKMVEDTPEDEIKDMEKYLQSIAELSNPRTYPAGTVSAREAYADS
                     DTVPSEVQRLKDAFKDMSLKGNTKVTNERVFSMCVHPEKTKTLVLVGDKYGQLGIWDA
                     LGPPMEKPENEDDTSGLLRAEGEDEYQEGRVWRVQAHAKNSISCMKVDPVNGSGLFST
                     AYDCSLRHLSFSTLQSTELFSFQDEDLLINHFDLLPSAQEAWMVDKNGGISHWDTRES
                     KRESGRRRWVVQEEGRGAKLGGVSVNPLMPHLICTAGNDQHVRIWDTRHLFSISSNLV
                     PSAAAIEEEEEGTSTLSGQSSSLPHDTHPTRESDYSTVTSYLASPRGKGLMRAKWQHG
                     KSCSSAYWDPWGRRILTTSYDDHLRVFNIDPGSSLVDDRAVGSLLQPNGFKPTKVVRH
                     NCQTGRWLTILRAQWSLNMEYMPHFTVGNMKRTLDVVSATGEKIVGLWTDDVTAVPTV
                     TASHPNIVDRVVGGNTSGRIQLWSSGDHI"
     gene            832568..834350
                     /locus_tag="CNI03075"
                     /db_xref="GeneID:36393042"
     mRNA            join(832568..833287,833349..833475,833529..834350)
                     /locus_tag="CNI03075"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658742.1"
                     /db_xref="GeneID:36393042"
     CDS             join(832866..833287,833349..833475,833529..834245)
                     /locus_tag="CNI03075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514413.1"
                     /db_xref="GeneID:36393042"
                     /translation="MPFSFSHPRRPRAALFRPLNRLSRTTPLLLLYLLVRHTSAQYLP
                     PQAYPLRRALPRHEDENWHDERDGDTSRSLYLVSHTDFCLFGPPSPLSNTSTSISQID
                     KDVVSWCTDGRHGNRVVPDGTLNGATYVKANSWVQVSGTGDFTKINIPADDQGAQFDS
                     VDNTPDGAVLYTTDDNQAASSWVTMISSTTYCLRACSDASYCPTSYDEMGCYFFTSNG
                     IGWDGVYQDCVGDDGDRPGVYVDEGQTVTYTQGGGEVPTFSIPAVSECAGGSVSVEAT
                     EAAETAVEATAATETATAAETATATENTWTATSWLPVETCTPCTGAATAGTEQVGVTR
                     VAAIGARDGAASSGECCFTTWTSAVSGGTLSGTLGGTSGILSAGTVASGASTAGTAGT
                     SDSSSSGKRSGRTALVVALVVAALAGCCK"
     gene            834374..835627
                     /locus_tag="CNI03080"
                     /db_xref="GeneID:3259655"
     mRNA            join(834374..834542,834592..834656,834706..835627)
                     /locus_tag="CNI03080"
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /transcript_id="XM_572917.2"
                     /db_xref="GeneID:3259655"
     CDS             join(834396..834542,834592..834656,834706..835252)
                     /locus_tag="CNI03080"
                     /codon_start=1
                     /product="cell wall organization and biogenesis-related
                     protein, putative"
                     /protein_id="XP_572917.1"
                     /db_xref="GeneID:3259655"
                     /translation="MLSSLLAVPLAILALRPSLVAAQGDLSGANNVTDLEGTWSSNSA
                     VSTGGDICIPAEMKFNYPNNSGISYSFTNDGFFEEVQYQYNANASNPACIQAYIYWQH
                     GTYSLNDNGSMTLFPFTSDGRIQVQDPCAATTNIITYYSNQVLFTDWGIVVDSSSGRY
                     TLNLNKYDGSKMARMFLVAKPPNMLPTQILTGVNASGQTSTRKRSFTQSLDFLKRSSA
                     EPRWSGLLFAQGYPTSFTMLGLAGLAVVGVLALV"
     gene            complement(835592..838876)
                     /locus_tag="CNI03090"
                     /db_xref="GeneID:3259507"
     mRNA            complement(join(835592..836005,836077..836184,
                     836281..836426,836496..836684,836769..836825,
                     836881..836982,837053..837206,837257..837546,
                     837620..837721,837780..837904,837967..838876))
                     /locus_tag="CNI03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657854.1"
                     /db_xref="GeneID:3259507"
     CDS             complement(join(835649..836005,836077..836184,
                     836281..836426,836496..836684,836769..836825,
                     836881..836982,837053..837206,837257..837546,
                     837620..837721,837780..837904,837967..838847))
                     /locus_tag="CNI03090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513546.1"
                     /db_xref="GeneID:3259507"
                     /translation="MVSLRQRKPQRQYSDIAPGLHDLSDEENSGQGSSSRPPKDDDDI
                     SISSGESSEFKPGSPEKQAAKGAAIDDDEEMEDDEPLRSIHDTHTSPAKRPIKKARSQ
                     SKGKGKAIAPSSVSVTPTVRSSPVPKPSEGNPLSHIPLEYLRLLGQSAKSIVKPPEPA
                     PDAQRQAFETWLKKKKGNSREESILDSPLPFFTRLLKDPQNGSVRPKVEWSPKVESSL
                     TAKQEKKEKRNQLNNIALGVPWDLWRGEGWWPEMYIGPEGGGDGKRTEWLMREDVRLG
                     LENIGRFKKSELVFLAQGDAKPYLPKPPGKNGEPFITCLFGPYEKETPTKLSIFDSKS
                     LSETNPIVPRPGFTFYAGGPIWGLDWCPIPRSKSAEFENTQYLAVSTLSHLSDQPKMF
                     DKCPPETKGSIQIWSLLPPRQSAQEDKDQDQDQDEEDVAMGGEKGGGMACELVLCVKG
                     GNAMQIRWMPLGVWDEFDVCKMRDEEIEIPKLGIIAAVQLDGSVSFYPVPHPKFLVSE
                     QSIAGQPVYLHLQKPLVRLTIPDANCTTFDWLSGSRLAVGLDTGHVVVWDIYNSLLHP
                     SSEPPLPVIYTPVAMSCIRSLSVLRLPPTPHHLGSDAVYVVTGAYDGSTKILDVRDPL
                     VPIPLDRQRLPIMSTAWSTYFPGPIVGDNQYTAQVVRVADRKGRSRGFVISGHRGVIW
                     DIGTSDYHTMVVTAGADGALIMVNHADGVLRSTGARTITLDRLYEIDYNTLTDTYRLS
                     DDFLPESQPLDIVQYGKPARGAGEGEAGEDANKAYSKIGAWSPEVGIHRCVWNNAGGL
                     GQAGWVASGGASGVGRVEWVEGVWRDVVGGRAKSEKES"
     gene            839005..840786
                     /locus_tag="CNI03100"
                     /db_xref="GeneID:3259426"
     mRNA            join(839005..839225,839274..839519,839576..839814,
                     839882..840042,840119..840452,840509..840786)
                     /locus_tag="CNI03100"
                     /product="expressed protein"
                     /transcript_id="XM_572641.2"
                     /db_xref="GeneID:3259426"
     CDS             join(839045..839225,839274..839519,839576..839814,
                     839882..840042,840119..840452,840509..840730)
                     /locus_tag="CNI03100"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572641.1"
                     /db_xref="GeneID:3259426"
                     /translation="MPPRLTRITPRPRMLVLSRPLARPLSSDTRSPSNKITTAPFRLA
                     PADALNKMYINALLASASIPNIVYAFLLRLFGPSVTPLATEFGLGSKLELRGTMKAAL
                     YPAWRVDSILEGKASVDSAGGVAKRLEPKVWISTSEAYVPGNPFAPLSYLSFAVPPLP
                     NDLPIYNPSKHLRQLEDDGLEIVPVPFTVSPLGLGKLIRSRIGQLTRWENLKIDESKF
                     KETMVACYPLLLPIYLAEFEYDQGEDGKRQFTIVMDAHDDNPKNCRVSWPPPPHLVES
                     GRFDKNYYVNPAPFLPNANLTIYPSPGPQPIPGTMRNKLIEAYQTWMSPAPDLENVEH
                     INPSPMVAVQDEEGGVVDWEDERIMSWSGVEREENGEYLEMALRTQKGLETLETMKLV
                     SRRTPDKDLKGLVINTNGPRPHFERKSLADMETQLQRDIEKMKEELEDLKPGWLKSFE
                     AKQQTEKTSE"
     gene            complement(840760..844863)
                     /locus_tag="CNI03110"
                     /db_xref="GeneID:3259613"
     mRNA            complement(join(840760..841779,841836..842577,
                     842628..842815,842868..843508,843556..843647,
                     843695..844456,844509..844863))
                     /locus_tag="CNI03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657855.1"
                     /db_xref="GeneID:3259613"
     CDS             complement(join(840851..841779,841836..842577,
                     842628..842815,842868..843508,843556..843647,
                     843695..844456,844509..844781))
                     /locus_tag="CNI03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513458.1"
                     /db_xref="GeneID:3259613"
                     /translation="MLMELPPLWAQVEPLLVAQSPSSPFAHQTARANSILWNRLRTTR
                     RWETEGGDNNRVCVAIKWPEDGRLRRGKGKMKGKSTVVWVEEGEEDKRLESIILVHPS
                     LIPSFYPTPLPISLLVHQPINLSLAVLQPAFDNPDDRSSSNTSEDIDFSDIWRDSNYP
                     IIRQGAIISCKSGITTNQYKVLMLEPVYQGILTAETNIIISNTFFFADSYPLIQTPLG
                     DGMSEGSFSKTHLSLANFDADAFLSSSLSLSLKDDLPDGEALEDEELMALSSTTSGSL
                     TPRPPGAGVRPISPVAPVEEVLQHEELEDRGVRFNPVVAEGKAVDGGGDDVCWMGVGG
                     LGRAGIFEGDWVLVKPIGQAQASGRLVKALAWELLDESDDELPANTILLSPSLYRSLI
                     PSSSSSSLPQLTVVPTPFGARSPTLPIANKITLTRIATAEAVDKRYERSWLRGQTTLF
                     VPKNRKRRGDAQEYVSMVRRGDILGIPVWLDKTVTDDERQKSIAAESEDDTDSGSESD
                     SPSPFFSKIPSTPTSIVYFAVTSISYNPLVPIEEDFRSSTTAKARAGELGCWIGDGTE
                     LVYEGLEKARIEQKGWDKRWCGIRSNPPPFSRSAYTKLSDILNSAFFQTSTAFRPQLS
                     IIVKGSRGAGKRSLIECIADDIGFNIVTVDCYDITGDTPEVTSGTLLARLSKSISCSP
                     SLLVLHHVEALSSKSNSPFGRPPSVVKILEEVIDGARQTSDSSSGSSSSWPVIVVGTT
                     ADADAVPSEVLACFKQEIELKAPNEDERLAIMEYKLEDYEVAPDVDTRALARQTAALN
                     AGDINSLVHLAWIAAVKRSTSSCVSFPQAQQAGISITSEDFRHALSKARAAYSDSIGA
                     PKIPNVSWDDVGGLVSVKQDILDTIQLPLERPEMFGEGLKKRSGILLYGPPGTGKTLL
                     AKAVATSFSLNFFSVKGPELLNMYIGESEANVRRIFQRARDAAPCVIFMDELDSIAPK
                     RGNQGDSGGVMDRIVSQLLAELDGMSSSRGGVFVMGATNRPDLLDPALLRPGRFDKML
                     YLSIPTTHTAQASILTALTRKFNLHPDLDIGKIAEQCPFNYTGADLYALCADAMLGAM
                     TRQAEAVDRTIAKLNASASMGEDPSLKTWPGELTSQYYLAKMATKEETEVIVKQKDFE
                     EALIKLVPSVSKEELKHYERVQKEFQGYAIGKKDSANEVKDKGKGKGKEKGKSVVVNG
                     EAGG"
     gene            845124..846746
                     /locus_tag="CNI03120"
                     /db_xref="GeneID:3259719"
     mRNA            join(845124..845413,845467..846339,846406..846746)
                     /locus_tag="CNI03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_572919.2"
                     /db_xref="GeneID:3259719"
     CDS             join(845160..845413,845467..846339,846406..846628)
                     /locus_tag="CNI03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572919.1"
                     /db_xref="GeneID:3259719"
                     /translation="MAKKKSVNAPISIRPASGKRITFDEDNDASFEFGNEGESSGSST
                     KNVKQDHEDENGEDSDDEAPEAVGINVAHEAERAAAQREATEREAKSKAARARAQAIA
                     NVKQGKRMAQDQAQVKNNGKGKAVVSKPEKKGKQQAESEDESEDEDEDEETRRLRKRM
                     EAAMAQASDEESDLDDDDNDEEQDDNSDISSGSEEELGDQQSFHTDSDAVHFSDEGGL
                     EGYQDDGDESDDSEKLEDLPMDSKSKTMWAQMQAMMEATEKRAGVTSDGVDSGKTEKR
                     AKTQEEKSEERKRKAKEQSENEDKEKSDEEEENDDEAQWDLAPGVKPLPKSVLQAAVK
                     AEEEKKAREAEKKASQKVEQGAEQSRRKKRKIAKVETSRKVSDKTTLHLLPQTLSSAG
                     PAALPPIIDARSRPGGTAPAGKATVNKFYKRAMKNSGVVPGRSPLDGRRRAVSHALR"
     gene            complement(846838..851841)
                     /locus_tag="CNI03130"
                     /db_xref="GeneID:3259781"
     mRNA            complement(join(846838..847640,847693..847869,
                     847929..848595,848672..848681,848752..848820,
                     848903..849693,849744..849909,850056..850257,
                     850331..850540,850603..851566,851642..851841))
                     /locus_tag="CNI03130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657856.1"
                     /db_xref="GeneID:3259781"
     CDS             complement(join(847138..847640,847693..847869,
                     847929..848595,848672..848681,848752..848820,
                     848903..849570))
                     /locus_tag="CNI03130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513457.1"
                     /db_xref="GeneID:3259781"
                     /translation="MIERKKSSGTPGKRRLSFHSGSESLDKRVKQEHFDTLDLVSQEV
                     DSNYADCDPPLTASSSRFPQSTSSFSSPSNSVDGDDRDRPQRPPPHPSNSTSDGSNST
                     ARSQHNQQSAYQFGWSNTESGTSSFSTTSQSQPSSKSSSRQRPASNPSAQIAAASQQS
                     SSPITFNVSAGQPLVNPPPKTQAAFVGKLYSMLEDEDIAKTGLIYWSANGTTFTCPNP
                     TEFSKVVLPRYFKHNNWQSFVRQLNMYSFNKVNDIYSTSTDPQAWEFRHSLFRRGEAH
                     LLPSIKRKSSRPSAPDGSNTVTSPTDELPPSTSNPIKPVAGWMRDAVPVPYRMPSPPH
                     IHGQPQRSATYPYSDGFATRKDDGRSPTRGMAWDPLPAVQRMPPPPDNQIPIRYHPDP
                     NRPVLTTQRFYHPGYPESPLYGPAHSPSAETLLNQMSVLEDKVQKLTDVLNNDRIEHV
                     RNNLDFTSYLLQMIGWAAGDQHASPELRALQDTLSRQNADMRHKYEAFMASDALAIMA
                     SGGGRERSDSRDSTRERNARLGFEIPPFPGHPHPSITDLRLPQTAQSSSSAILSQRAA
                     PRTSPRNSTSSDLLLTRPSTSESIREREIYPTYFPPQTSHGIGPASSIPSRGPETITP
                     SLYGGGPSVPPPLYRPAPIVEKHREIEKGEEHKDMNGPSTVELGREERDNEDSRMTMA
                     GEEAESKTGLRNLLN"
     gene            complement(856757..858302)
                     /locus_tag="CNI03140"
                     /db_xref="GeneID:3259720"
     mRNA            complement(join(856757..856983,857050..857403,
                     857459..857661,857723..857811,857865..857943,
                     858002..858052,858109..858302))
                     /locus_tag="CNI03140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024658744.1"
                     /db_xref="GeneID:3259720"
     mRNA            complement(join(856757..856983,857046..857403,
                     857459..857661,857723..857811,857865..857943,
                     858002..858052,858109..858302))
                     /locus_tag="CNI03140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657857.1"
                     /db_xref="GeneID:3259720"
     CDS             complement(join(856908..856983,857050..857403,
                     857459..857661,857723..857811,857865..857943,
                     858002..858052,858109..858207))
                     /locus_tag="CNI03140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024514414.1"
                     /db_xref="GeneID:3259720"
                     /translation="MADQAASLEPFLILARSTKGAAAAKIILDVTAAPGVYVFSELLE
                     MPNIQELSSDASFGGHFQLLQLFAYGTLQDYEENKAIFPLLKEAHINKLRQLTLISLA
                     SQHRSLRYQDITQTLQLKTLRQVEDIVIDTIYAGLLNGKLHHDKKVFHIDWVAGRDVR
                     EEDLAVIQKSLENWCQTAQTLLGALDTEITHLRQEAVNEASKLARYRLHRDEVYETVA
                     NELRNDKAEKSAKRGTEPGAEFDAQQWSAHGRGYEEQVGSATGAGATFGGKAGQNILQ
                     TLAHVGSLGGAFSGRNNLTRNVSGGSDELENYRAFKRSRD"
     CDS             complement(join(856981..856983,857046..857403,
                     857459..857661,857723..857811,857865..857943,
                     858002..858052,858109..858207))
                     /locus_tag="CNI03140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513456.1"
                     /db_xref="GeneID:3259720"
                     /translation="MADQAASLEPFLILARSTKGAAAAKIILDVTAAPGVYVFSELLE
                     MPNIQELSSDASFGGHFQLLQLFAYGTLQDYEENKAIFPLLKEAHINKLRQLTLISLA
                     SQHRSLRYQDITQTLQLKTLRQVEDIVIDTIYAGLLNGKLHHDKKVFHIDWVAGRDVR
                     EEDLAVIQKSLENWCQTAQTLLGALDTEITHLRQEAVNEASKLARYRLHRDEVYETVA
                     NELRNDKAEKSAKRGTEPGAEFDAQQWSAHGRGYEEQVGSATGAGATFGGKAGQNILQ
                     TLAHVGSLGGAFSGRKW"
     gene            858499..860661
                     /locus_tag="CNI03150"
                     /db_xref="GeneID:3259555"
     mRNA            join(858499..859169,859217..859480,859539..859678,
                     859739..860661)
                     /locus_tag="CNI03150"
                     /product="expressed protein"
                     /transcript_id="XM_572637.1"
                     /db_xref="GeneID:3259555"
     CDS             join(858530..859169,859217..859480,859539..859678,
                     859739..860602)
                     /locus_tag="CNI03150"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572637.1"
                     /db_xref="GeneID:3259555"
                     /translation="MDNHQPLHLAAAVNDIPFIHPALDDPQSFFGSPELDQGPSEDTG
                     RNPEEPTQEEIDAVIEQSLLKAEAQSKSEEEHAEAGIGETQDVQSSDGSTPQLSSHGF
                     HTQAAEFIDQIDQVAGPSSVDHLDVGGPGISEQDPIHNPPVCPAPFIRPDRHDGVTPS
                     PIYYVFTDRTTFNAWLEGESSWCHFVQRRSTTPDKRSAERLQTRIAKHNKKLEAMTPE
                     ERALALPLKTRRRNRVSPVAEKVTYTCHHAGHYSSQHSVELPKEKLRMNTKKSVKCAC
                     PSRIVLSEMQTGECRVCYHWKHEGHDPYNETDKDGGRMNKAIDEWMVSQIAAGRTPDE
                     IRRALDIDEEEKKAYLDKVAADPCQLDPNLPPPIALVRASKFKYSEIYNRYRKLKGPI
                     KESRPPKSDSSRSRGESSKKGKRKPSEAEGEEIDGDQDGKKKRRGRPRKATEGQEEGI
                     ENAEQMHVQEQGSVQRHLSDTDIFIDPELQRSMADPSNTADTSVHLVDSSTGHQMEML
                     PDHRDQSIHTDSFHHQPHGQPPPTSNPDNPLPPQTHSEHEHGTSHTMDLSGLSGLPGS
                     AEEGDDHVDTDFASLAATHESLARALLTLPGGSGLRDEEIAGMSLEEAMRRLAGEVQN
                     AHGDGDLNMAL"
     gene            complement(860674..862891)
                     /locus_tag="CNI03160"
                     /db_xref="GeneID:3259530"
     mRNA            complement(join(860674..860931,860986..861305,
                     861354..862268,862316..862483,862534..862663,
                     862716..862891))
                     /locus_tag="CNI03160"
                     /product="lysine-tRNA ligase, putative"
                     /transcript_id="XM_572931.1"
                     /db_xref="GeneID:3259530"
     CDS             complement(join(860739..860931,860986..861305,
                     861354..862268,862316..862483,862534..862663,
                     862716..862882))
                     /locus_tag="CNI03160"
                     /codon_start=1
                     /product="lysine-tRNA ligase, putative"
                     /protein_id="XP_572931.1"
                     /db_xref="GeneID:3259530"
                     /translation="MLRAVIRTATSTRQATTYAPKFKPQIPLRRTFIMSAPAAEANLH
                     KDEVTGEMISKSELKRRQKERQRAAQKAEKAAAAPAAAQPKKQSKADAEAEMDATAFH
                     EMRYKEIAKLRETKQPNPYPHKFNVTHAVPKFVEEWGKEGKLEKGETAQLNEPISLAG
                     RVYTIRESSSKLRFYDLKADGVKVQIMAQAQNAASLEEYLDTHDRIRRGDIIGVTGIP
                     SRTKMGELSLSISSIQLLSPCLHLLPGREGVVDLETRYRKRYLDLIMNPSTRDIFVTR
                     SKVINYIRKYLDAQGFLEVETPMMSMIAGGATAKPFVTHHNDLKLDLFMRIAPELYLK
                     ELVVGGLDRVFEIGRVFRNEQIDMTHNPEFSICEFYMAYADMYDIMDMTEELIEGMVK
                     SLTGGTKLTFHPQGKGEGKKVYEVDFARPWKRFDMIGELEKQLNVKFPPGETLHDDNT
                     NKFLRELCEKHNVDCAEPKTNSRLLDKLVGEYIENQCVNPSFIVGHPQVMSPLAKYDR
                     SRPGLCERFEAFLCTKEICNAYTELNDPFDQRERFMEQVRQKEQGDEEAQGVDETFLD
                     ALEYGLPPTGGWGLGIDRLVMFLTDCSNIKEVLLFPAMRPIVANSVEAVAPSVTATEA
                     AKEAKA"
     gene            863059..864059
                     /locus_tag="CNI03170"
                     /db_xref="GeneID:3259693"
     mRNA            join(863059..863219,863276..863436,863489..863850,
                     863911..864059)
                     /locus_tag="CNI03170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572636.2"
                     /db_xref="GeneID:3259693"
     CDS             join(863082..863219,863276..863436,863489..863850,
                     863911..864014)
                     /locus_tag="CNI03170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572636.1"
                     /db_xref="GeneID:3259693"
                     /translation="MLGNPLKTLLNNTARFLNPASASSSRAISTAVHLGDLTPAKGST
                     KTDTRYGRGPGSQKGGTSGRGHKGQKARNGKGVRLGFEGGQTPLYRKIPKRGFINFTS
                     KTYAPLSIATLQSWIAQSRISPDEPITIGTIVRSNAVHGLSNLSGIKLLGDADPTLPL
                     PPLKLELSRYSKSAAQTIINAGGEVKAVYHNNLSLRKEWYPEKFMDKEIKSAKPTRKN
                     DILYYTNPAKYGYLAEEVKTPARKMTPQEWSEVKSA"
     gene            complement(864041..865629)
                     /locus_tag="CNI03180"
                     /db_xref="GeneID:3259646"
     mRNA            complement(join(864041..864754,864822..864927,
                     865005..865155,865213..865285,865344..865423,
                     865494..865629))
                     /locus_tag="CNI03180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572929.2"
                     /db_xref="GeneID:3259646"
     CDS             complement(join(864048..864754,864822..864927,
                     865005..865155,865213..865285,865344..865423,
                     865494..865498))
                     /locus_tag="CNI03180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572929.1"
                     /db_xref="GeneID:3259646"
                     /translation="MNTIREINRINERELELGVKGSWHDEYKDSAYIYVGGLPFELTE
                     GDLITIFSQWGEIMDVNLVRDKETGKSRGFGFLMYEDQRSTVLAVDNMNGTQVIGRTL
                     KVDHTRNYRQQGKRNENGEYEEPEEPIYNAMPPILSGSESSSSEGEQDDLDEEDPMAA
                     FIRAEKKKGAKNIKGNDDDGKKRKHEGETKEERRARKEAKRAKKAVKEEKKRIKKDVR
                     EGNGSERPKSVKSERDERNGRSKDREDSFWSRGKNAAGRDDWRQGKWELEREEEYREK
                     RDERPRERDGDVVKDLMGNDLDRTRGNGDGGSGRERELEGKPRNRGYRREDDRRWHDD
                     RRKDDRDRDRAYNQRDDRDRDHDRGDYGRRNDRERDMRY"
     gene            complement(866298..867164)
                     /locus_tag="CNI03190"
                     /db_xref="GeneID:3259579"
     mRNA            complement(join(866298..866529,866614..867164))
                     /locus_tag="CNI03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_572635.2"
                     /db_xref="GeneID:3259579"
     CDS             complement(join(866364..866529,866614..867074))
                     /locus_tag="CNI03190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572635.1"
                     /db_xref="GeneID:3259579"
                     /translation="MSFASSSRIVLARSNIPSIGSTRGVLHRARPPRMPVLPSPHNPK
                     QPLPTSGTSHPVPPNLGTPSVLTTVTALPDSGLTFHHSPPPSAPSYTNGAVPDLFRWT
                     AGESVRLSGEEAAMALGERRWYGGKVDWSGELVQKMRDLRGQGLSRREIGESLQIAPE
                     QQRLISRVAPQSREQASAKVEEFAEHKAKWGYRKRLAREVRQKRKEFW"
     gene            867439..871143
                     /locus_tag="CNI03200"
                     /db_xref="GeneID:3259790"
     mRNA            join(867439..868496,868548..871143)
                     /locus_tag="CNI03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_572921.1"
                     /db_xref="GeneID:3259790"
     CDS             join(867768..868496,868548..871022)
                     /locus_tag="CNI03200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572921.1"
                     /db_xref="GeneID:3259790"
                     /translation="MKIQSKAASLLLLPLLVTSSLAAPNVRRHKPLFRKIYGKRDNGT
                     ETAEVINNSTANVTETVTVSATESSSVTPVASSNSTASSNAAFTGSYSSSFASSSTYS
                     SSIPAPSNSTDTSSIPVNTTDNSTNTASGFDTQQANPANLSSNAISSLLQSTVAFATY
                     TYSVYKPETVTQTEYHTQHSTEVVVSTSTSVSGAQPTSSGNDDESEAESYWDQIQAAA
                     KSYAEHMTGSSLPTMTLEVVLEPTQDADGSWEYIIHIGADGTATASPTWVSSTAAATL
                     SPSGSSSGGSADDRYSSTPITTSADLSGASAATSSYSNPYLQSATNIRAPAATSTSSS
                     SESTSTSSSSDESSSSSADASSSDSSSSDSSDSSSSSSSSEDSGSVSSGTTSSSADES
                     VDTSTDGSSTASSSAGAASASATSDPYAVPGHGSSHFGSNSNSDDRGSSSSSGSGSSN
                     NDDPLSSDQSSSSSSAAESTSTSNPYSVPGHSSSSYGGSSSSGSEGSGDSSASSGSES
                     SEGTTSSPDAQATSTDYNGDAGLDEETQATSTSSNVEGQTTASATSVPFPPWYGGVGS
                     DPDDPSTSSNVTLPGNSTIPENSTYPINSTYPDNSTIIANGSLPTNSSNSSIPLPWTN
                     DTNSSVPGNYSNVTVPAEGANATATSLTGWMNATATSLSTNAAETASATLTLVNGSVA
                     MPTATTTESVSAVANANVSAIQSEIAIPSSSAIVSVEEPTSASASATATASETWSVSP
                     DESVSSTQSEAETETMPVTSSFTAFSSSVTTREAEGTISSYESVLPTSTDSSSSSNFA
                     SVASSTETNSSTPTITSAHSSSTPAPTITSASSVAENEDGMETDYVTSWTTVDYTMTR
                     SPNSTAIATATAAASSDANATASQSTDPVIVSSESLASSSSKGAETETASEVEGSTPV
                     SASVSVSATESASVTESAVGNFAHPVVISSSASSTMSVAESQFESSSSTESASSFATS
                     SVISASSEIVATPTSYSSSYESISEPSSASSAESFTATSTASAEGASETSGADEDGEG
                     DDCDEDGEGSDLTERDDEYEEVWVDEDEIEEGWEILV"
     gene            complement(871322..874729)
                     /locus_tag="CNI03210"
                     /db_xref="GeneID:3259533"
     mRNA            complement(join(871322..872612,872660..873236,
                     873291..873448,873500..874729))
                     /locus_tag="CNI03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_572927.2"
                     /db_xref="GeneID:3259533"
     CDS             complement(join(871398..872612,872660..873236,
                     873291..873448,873500..874525))
                     /locus_tag="CNI03210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572927.1"
                     /db_xref="GeneID:3259533"
                     /translation="MSVPYEAHNSPPPPPPKHASSSSSGKKAKQKRPSSSNGTPDQSS
                     ATAVRAFSACRNCRNKKVKCLPGPPLPSSSITLPASPTSLENPGANLGPCQQCLQSGA
                     ECIYPPTRDRAAYSRQYVANLETRVQSLEMVQARLMPLLETFEASTHSGKPMPMPLPP
                     VPARRTETPAQEMNEDVEEGEDEIPEDSAMQPASDSEDAGQITQDDRGNYRWIGSSNT
                     LSLLDSFSGRQLASGRPLPSRTQSSTTQMDAAISRDRTPSNIASTPTRESNPYFGPVA
                     GSGVVKALPPVDEVQYPSAEKSLEMVDAFFQEVHPCLPVLLEHEFRRDFRALMEARAR
                     GNLSWGGGFISVVFAIFALGERVIVTSRAWRREMAKAEGDDDDHETVLPGEAEAGVIW
                     YERAQILHYTTLKDVNIHQVQCLTLLAAFQASVNAMPMSWLLAGQAIRVAQDLGLHRS
                     TARLPLSFAEKQLRSRCWWAIYGLERMMSISLGRPLGVDDLDVDVAYPLEVDDAVLEK
                     MAMENLQALPPEFEKEPEASTMSGFIALTKLCKIAGRVVHLLYRPSNGRSVSDPSWAV
                     QQQNAINKLDKLLRDWLANDVPSKYKDPSETHSVSLLSAILSNSYFTVLVTLHRNFLP
                     SSPDYPRPKPPPSSQSLAHCVDAARSVIHIASQSRTLVPPSHHLAMYCQYLWSSAVIL
                     LLCEIQARDEVVIEAVGSQVEACRKCLQALEPVWPGSKKLKELLNDVASRAKEVMVSK
                     SSDKKRKSSAHKDKDRERQMLHPSQNHQSRPSTDSPIPQHAENQWPSHSVSPPEKRQR
                     VFELSDTRTASNEDEPAQNPQAYYSVYPMTTPITSQASLQFTEPMPTYDMVFDLGGVT
                     FDGLELLQGFSGGASNFWNNFNFGMDGAGNGSASGGSAPVARTGQQFLPSGQLTPNSN
                     GDGSRPSSSSWQGQLSRMVSQNGQQYVQGQGQDGYNGAGSGSGGVGTPNAHRGATFWE
                     QVTGSTFDWQADPNVPFNI"
     gene            complement(875462..876714)
                     /locus_tag="CNI03220"
                     /db_xref="GeneID:3259540"
     mRNA            complement(join(875462..876076,876131..876714))
                     /locus_tag="CNI03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_573013.2"
                     /db_xref="GeneID:3259540"
     CDS             complement(join(875592..876076,876131..876416))
                     /locus_tag="CNI03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_573013.1"
                     /db_xref="GeneID:3259540"
                     /translation="MPIPSRPIPNPRHRQRPTRPGTAVPRKSLSATPQNTADWRAEMA
                     LLPEVGPKSVPMKLSGSMGREAKELSRSVEGKRDVGLERLIMDGRDRRGKRATTATTL
                     GFDFVTNPQVIALSEGEIPNAPDDLVPKPISLLTTTKSASTHPDSTSRALSNTPTTPA
                     LLATRSDSDGEDEDDHGDDDWEHISALSRAEQVEERDENMCSDGEEDVIVLGEMEMEE
                     DMAHLELGPKNKDDKNTKKTVVTKEEKHKSYAAVALGV"
     gene            complement(877010..878187)
                     /locus_tag="CNI03230"
                     /db_xref="GeneID:3259553"
     mRNA            complement(join(877010..877281,877337..877509,
                     877573..877702,877785..878187))
                     /locus_tag="CNI03230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657858.1"
                     /db_xref="GeneID:3259553"
     CDS             complement(join(877162..877281,877337..877509,
                     877573..877702,877785..877970))
                     /locus_tag="CNI03230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513455.1"
                     /db_xref="GeneID:3259553"
                     /translation="MPTATINPALPPEPEQAWIKPTLSNTFGGKTYQPTHPDLFRVEF
                     TASKGLEEDYASRLVAVRDFAPNELITPLTNISLAPEKAYSSVQFGPGPRDHLELNSD
                     LLFMNHSCSPTTEVHLPPLRPNEWAVYATSKGIKKGDSLEFFYPSTEWDMAQGFDCAC
                     GSDICLGKINGAKYASLKELQARGYINEHILALKKAQSKHEE"
     gene            878388..880564
                     /locus_tag="CNI03250"
                     /db_xref="GeneID:3259742"
     mRNA            join(878388..878647,878709..879401,879457..880149,
                     880207..880564)
                     /locus_tag="CNI03250"
                     /product="GPI anchor biosynthesis-related protein,
                     putative"
                     /transcript_id="XM_572632.2"
                     /db_xref="GeneID:3259742"
     CDS             join(878555..878647,878709..879401,879457..880149,
                     880207..880524)
                     /locus_tag="CNI03250"
                     /codon_start=1
                     /product="GPI anchor biosynthesis-related protein,
                     putative"
                     /protein_id="XP_572632.1"
                     /db_xref="GeneID:3259742"
                     /translation="MGDYKLAKEAFVSGNPGASIWSINAVSLVALATYALWIALSPYI
                     RHGLLNNYLICVLPLLLGVTIFSTSPLVFASFLSIISLFFIAKSQKRFNFPRSPEKPK
                     GQWLDESDSDEEPAEPASAAGSAAVSPAKLLPSQVAFASGSLLSTDPTISPMSPSSSS
                     SSGHEDPLGIMGVNRRRSPLEGVSLDVPSHIDSKVRISPVPSLRLKKSRATKVQGVEE
                     KGRLPFLTVYRAHMMLMTVICILAVDFEVFPRWQGKCEDFGTSLMDVGVGSFVFSLGL
                     VSTKSLSPPPPPPTPTSPALNSHIIPLTPSPLSFILISLRKSVPVLVLGFIRLIMVKG
                     SDYPEHVTEYGVHWNFFFTLALVPVLAVGVRPLTQWLRWSVLGVIISLLHQLCLTYYL
                     QPIIFSFGRSGIFLANKEGFSSLPGYLSIFLIGLSIGDHVLRLSLPPRRERVVSETIE
                     EHEQSHFERKKLDLIMELIGYSLGWWALLGGWIWAGGEVSRRLANAPYVFWVAAYNTT
                     FLLGYLLLTHIIPSSISSQTSPSILVPRLLDAMNKNGLAVFLAANLLTGLVNVSMETM
                     YAPAWLSMGVLMLYSLAVSCVGWVLKGRSIKI"
     gene            882467..883788
                     /locus_tag="CNI03260"
                     /db_xref="GeneID:3259797"
     mRNA            join(882467..882892,882954..883203,883268..883788)
                     /locus_tag="CNI03260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657859.1"
                     /db_xref="GeneID:3259797"
     CDS             join(882635..882892,882954..883203,883268..883479)
                     /locus_tag="CNI03260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513543.1"
                     /db_xref="GeneID:3259797"
                     /translation="MFSTTAARTDQPDPNANPIIAPPHIHALLDRLHELSTVQEEAAT
                     AQVIDAEDFDNFMRDKFIALDQDKCWYMYQHCLASGARNVVEAGTSFGVSTIYLALAV
                     AHNAALTGKPGQVIATENEPSKALQARKNWKEAGDAVLQVIDLREGDLLETLKVDIPK
                     EGIDLLLLDIWAPMAFPTLKLVEPHLRPGATILIDNLKGAASRYEELIEYLHDPQNGY
                     TNMVLPFSRGLGMSIYTGRKV"
     gene            complement(884071..887075)
                     /locus_tag="CNI03270"
                     /db_xref="GeneID:3259761"
     mRNA            complement(join(884071..884449,884509..884634,
                     884690..884788,884844..885200,885251..885548,
                     885600..886071,886124..886338,886613..886653,
                     886726..886784,886927..887075))
                     /locus_tag="CNI03270"
                     /product="succinate dehydrogenase flavoprotein subunit
                     precursor, putative"
                     /transcript_id="XM_572631.1"
                     /db_xref="GeneID:3259761"
     CDS             complement(join(884308..884449,884509..884634,
                     884690..884788,884844..885200,885251..885548,
                     885600..886071,886124..886338,886613..886653,
                     886726..886784,886927..887031))
                     /locus_tag="CNI03270"
                     /codon_start=1
                     /product="succinate dehydrogenase flavoprotein subunit
                     precursor, putative"
                     /protein_id="XP_572631.1"
                     /db_xref="GeneID:3259761"
                     /translation="MLALSRTRALARPLRNNFARNYVVASQTARATEAPNFGQKKGYP
                     IIDHEFDAVVVGAGGAGLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNM
                     TEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTKEGKIYQRA
                     FGGQSLKYGKGGQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLLMQDGE
                     CVGVLAINMEDGTLHRFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMAVRAGLPLQ
                     DLEFVQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMERYAPTAKDLASRDVVSRS
                     MTLEIREGRGVGPEKDHIFLQLSHLPAEVLHERLPGISETAAIFAGVDVTKEPIPVLP
                     TVHYNMGGIPTKYTGEVLTIDEQGNDKVVPGLYAAGEAACVSVHGANRLGANSLLDIV
                     VFGRACANHIKETLAPNTPHKPMNPELGKESIEDLDKIRNASGPLPTSQIRLNMQKTM
                     QTDAAVFRTQQSLDEGVAKMREVYKSYDQVGIKDRSMIWNSDLIETLELRNIMQNAMQ
                     TVVSAAARKESRGAHAREDYPERNDEEWMKHTLSFQHDPNSPDVELKYRGVIANTLDE
                     AECKPVPPFKRTY"
     gene            887798..891418
                     /locus_tag="CNI03280"
                     /db_xref="GeneID:3259804"
     mRNA            join(887798..888201,888437..888523,888590..888990,
                     889040..889188,889240..889495,889548..889692,
                     889752..889982,890035..890373,890427..890991,
                     891043..891418)
                     /locus_tag="CNI03280"
                     /product="topoisomerase I"
                     /transcript_id="XM_572925.2"
                     /db_xref="GeneID:3259804"
     CDS             join(887848..888201,888437..888523,888590..888990,
                     889040..889188,889240..889495,889548..889692,
                     889752..889982,890035..890373,890427..890991,
                     891043..891296)
                     /locus_tag="CNI03280"
                     /codon_start=1
                     /product="topoisomerase I"
                     /protein_id="XP_572925.2"
                     /db_xref="GeneID:3259804"
                     /translation="MFRKRILYLSSFSIPLYTVPAHSYSCTFQTNQRPSTLLKRVHSL
                     AMSFPPVQPADNGMAVVAPNLESNPTTVASHAPQIAVKDENDSMSEDEQPLAKSKANG
                     ARKRVENSSDEEEKPLSKKPRANGVNKKRVVASSDEESDVSPPAKRPVSKQSKPATPD
                     SESDDDQPLAKKANGLAASKRQAKKAEELSEESSEEEKPLAKVAKRVSAKKMKSETED
                     SEEDRPLAKKKAPVKRAPAKKSAKKEPSESEEDEKPLAKNARGKAKAATVKEEKGKKT
                     KKEKEEEEEEERYKWWEQDALGDGSSKWTVLEHNAVLFPPPYVPLPKNVKMKYDGVSL
                     TLPPESEEVAGFFGALLETDYAQDAKFRENFFRDFKAIVEKYPPKEDVKVKKLEKCDF
                     RPMFEYFEKEKEKKKALTKEEKKAIKAEKDKLEAPYLYANVDGRKEKVGNFRAEPPGL
                     FKGRGEHPKKGTVKNRLRPEDIIINIGKEAPIPVPNIPGQWKGIQHDNTVTWLAHWKE
                     NVNGNAKYVFLSAGSAWKGQSDRAKFEKARELIKHVDKIRKDYTADLKSKVMADRQRA
                     TALYFIDRLALRAGNEKGEDEADTVGCCSLRYEHVTLSPPNTIIFDFLGKDSMRFHQE
                     VEVDPQVFKNIKLFKADPKKKGDDIFDRLTTTLLNKHLNSMMPGLTAKVFRTYNASWT
                     FQEQLKNTPKNGTVAEKIAAYNTANRDVAILCNHQKSVSKGFEGSFAKAEDKIRALKY
                     QRLKLRLQLFSLNPKIKKKHPELAEDESDVDDEFMERHEAELLEKALENAKKKWDTDN
                     VKLEGDGKKKKTKGELDERLSEIKAEFKELKKERKAKKIDAKRGATEEKLLAQVARID
                     ERIATAKVQLQDRDKLKDVALGTSKINYIDPRLTVAWAKKFDVPLEKLFSKTLREKFP
                     WAEAEAGPDWVF"
     STS             890178..890966
                     /locus_tag="CNI03280"
                     /standard_name="Hind6"
                     /db_xref="UniSTS:470708"
     gene            complement(891651..895523)
                     /locus_tag="CNI03290"
                     /db_xref="GeneID:3259401"
     mRNA            complement(join(891651..892123,892174..892634,
                     892701..893250,893311..893383,893441..893742,
                     893797..893871,893920..894532,894579..894808,
                     894864..895038,895086..895225,895278..895523))
                     /locus_tag="CNI03290"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_572630.2"
                     /db_xref="GeneID:3259401"
     CDS             complement(join(892082..892123,892174..892634,
                     892701..893250,893311..893383,893441..893742,
                     893797..893871,893920..894532,894579..894808,
                     894864..895038,895086..895225,895278..895412))
                     /locus_tag="CNI03290"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_572630.1"
                     /db_xref="GeneID:3259401"
                     /translation="MNYLKSITTSVLQSTGVTFPFSVGERIPGLDSHSSIWEIREGVK
                     RDDGTPLTLFIYDSTLPLFQPGSKDRKVLFQLAKNALKKLRTIRHPDIIKYIDSVETE
                     THIYIATERVRPLEGVLRDWETGGALASGSGRAKGKENWIGWGVRSLSSALAFLNSPP
                     LSQHHSYLLPTSIFVTPSLEWRLAGFELLTGKDDAGILWGLGGVAPGDIGERCAPEVR
                     KDGWSALRETDPAQHDTYLLAILLFTFYNPHSPLPPLSSQPTPSSSGALPKVLFPLWK
                     RMLNPNPRTRLTTISFIDEAEKAGFWASNPLVSLVNGLDNFELQSESDKLSLLRIIKE
                     ANQAGTLPGPFTTYKILPSLLHSLSLPTAPSSAMLPLVLELGKLVPSSDYPKMVLDPV
                     VRLYTSPDRGTRMALLEGLNEYVDKLDNKTVTEKIWPNLITGFADTVPVIREATVRAV
                     YPLASKLSDRILNNDLLRVLAKMQMDTEPSIRTNTCILLGRLAPILGHNTKKKVLVPA
                     FARSLKDPFVHARVAGLMALMASVECFDREDLAGKVVPNMSFTLVDKEKLVRDQAFKA
                     MNMFVSKLTDMVKDMPESALPPDQTSSQGPVTTTSASISSSQGGAVNSAAGAAGALAG
                     WAISSLGKQLKTSEAHSSMNSSGMPGGFGASAPTIKFSTDSSNPAAPASSRVSEEIFR
                     PASASSSLKSASPRSSAVNTFGRTTTSSSLSGTNGRMKLGGAKKAPGKSLADQLAGEW
                     EEEDGGNAWGTDDLIDVNADDDDWSAFESAPVPEVVVPPPQPYYVSAPKPKPTSTNIT
                     TSAAFRSKPTLSTAISTTSSIPTHAPEPVKLASSISTPLIPSSPALSSLSSAKSPVLI
                     SQANTTDAERGQIDSTPVSERSSPQLSVKAGNGTGTPQPSLANMSKEEKEKEMARRRE
                     ERKARIAAMKEQKKSKV"
     gene            895681..900424
                     /locus_tag="CNI03300"
                     /db_xref="GeneID:3259499"
     mRNA            join(895681..895827,895879..899965,900030..900103,
                     900159..900233,900282..900424)
                     /locus_tag="CNI03300"
                     /product="phosphoribosylformylglycinamidine synthase,
                     putative"
                     /transcript_id="XM_024657860.1"
                     /db_xref="GeneID:3259499"
     CDS             895880..899947
                     /locus_tag="CNI03300"
                     /codon_start=1
                     /product="phosphoribosylformylglycinamidine synthase,
                     putative"
                     /protein_id="XP_024513532.1"
                     /db_xref="GeneID:3259499"
                     /translation="MLVLPGSSAITSSRRATLLKLFQSVIPSITSVDAVHLHFVNPTS
                     DEAESLLADTQSAERDILNALLAYGDNEQLNSTKAFVDAGMKGDVFALYVLPRVGTIS
                     PWSSKATDIAKLCRLAGHVSRLERGALYLFTSSESISLLEMRHHLHFIHDRMTQLIHT
                     ALPPSAAVFPPTPPNPSALISVPILGAENPHAVLGEANARLGLALSETEIPYLVESFL
                     AAGRNPTDAELFMFAQVNSEHCRHKIFNAKWTIDGHDQENSLFGMIRNTEKAVHSKGT
                     LSAYEDNAAVMEGYEAPRFAVGGKGDGCYTSQIEKNPILIKVETHNHPTAVSPYPGAA
                     TGSGGEIRDEGATGRGSHPKAGLAGYTTSDLLIPDFIQPWESDIGRPAHIASALDIMI
                     EAPLGAASFNNEFGRPALGGYWRTWLMAVKDAEGKEEWRGYHKPIMIAGGLGNVRPQF
                     ARKDKITPGSKVIVLGGPGMLIGLGGGAASSMASGASSADLDFASVQRENPEMERRCQ
                     QVIDACISRGDGAGNPIESIHDVGAGGLSNALPELVHDSGLGAVFEIRDVLVDDPSMS
                     PMEIWCNESQERYVLAVATENLAAFEEIARRERCPFSVVGTATEEERLVVTDRLLGDN
                     VIDISMSILFGKPPRMHREAQTIHPKRDAFDSSLFTYLPAYAGAPKTSLMAESINRVL
                     RLPSVGSKSFLITIGDRTITGLVTRDQMVGPWQVPVADVAVTRSSYGFDVVVGEAMSM
                     GERTPLALLNAGASARMAIAESLTNLAASSVADISQIKLSANWMSAANHSGEGSKLYE
                     AVQAIGMDLCPKLGVGIPVGKDSMSMSMKWPGEKGEQKQVTAPLSLIVTAFAPVDNVE
                     KTWTPVLRTDKGETVLVFIDLARGKQRLGGSAIAQVFKQLGADAPDVEEAADIRAFFH
                     AVQALKKAETVLAYHDRSDGGLLTTLVEMAFAGRSGIEVTVDAISSSGDAVAALFNEE
                     LGAVMQVKVDELSAFSDAFVKAGFPTQHIHVIGKVLGRENQSVSIIHKSDAIYTGTRG
                     QLQQLWAETSYKIQAMRDEPTGAKEEFDAILDDEDQGLIYNVPFKYLPDVTDANRLAS
                     PPKVAILREQGVNGHIEMAWSFHAAGFEAIDVHMSDIISSKVSLSSFAGIAACGGFSY
                     GDVLGAGNGWAKSVLLNPTARKEFEQFFQREDTFALGVCNGCQFFAQLKEIIPGAEHW
                     PIFKANRSERFEGRVVNVKVSPEAAKSNIFFSDMADAIVPIAVAHGEGRPSFVTGSLA
                     GLNENNLIPLRYVDGNGTIATTYPKNPNGGPEGIAAVSTLNGRVLAVMPHPERVVTRE
                     SFSWFPEEMGKTWEGKGPWFRLFQNAYKFATEGKQ"
     gene            complement(900379..901283)
                     /locus_tag="CNI03310"
                     /db_xref="GeneID:3259574"
     mRNA            complement(join(900379..900802,900875..901283))
                     /locus_tag="CNI03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_572629.2"
                     /db_xref="GeneID:3259574"
     CDS             complement(join(900541..900802,900875..901167))
                     /locus_tag="CNI03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572629.1"
                     /db_xref="GeneID:3259574"
                     /translation="MSSNSYQPIPSQSPPVSRSNSPSTSQTTFPPRPNHPFGDEDEEY
                     QERLRGYQAEFNRPPPAWWKRMFLILAIIAMGWLSIYLGKRGMSKKPQVIYASRYSEE
                     FKYRPAASPVITETLSDGRIRIRGASVGGVGVREEDIPLTPAMKAKRDQERREEAREK
                     AREKMGLKTKSKKRGKKGAKKATA"
     gene            901547..902990
                     /locus_tag="CNI03320"
                     /db_xref="GeneID:3259673"
     mRNA            join(901547..901572,901627..901680,901738..901856,
                     901911..902098,902137..902226,902277..902587,
                     902644..902990)
                     /locus_tag="CNI03320"
                     /product="vesicle budding-related protein, putative"
                     /transcript_id="XM_024657861.1"
                     /db_xref="GeneID:3259673"
     CDS             join(901570..901572,901627..901680,901738..901856,
                     901911..902098,902137..902226,902277..902587,
                     902644..902877)
                     /locus_tag="CNI03320"
                     /codon_start=1
                     /product="vesicle budding-related protein, putative"
                     /protein_id="XP_024513454.1"
                     /db_xref="GeneID:3259673"
                     /translation="MSAQASKPVPVETQHEDMIHDAQLDYYGKRLATCSSDRTIRIFN
                     VIKGEAKGEPVILKGHTAAVWQVSWAHPSFGSILASCSYDGRVFIWKEVGQGQGKGSG
                     GELQDGWERIKEHTLHTASVNSIAWAPYDLGPILACASSDGKVSVLSFQNDGSIEVNI
                     FPAHGTGANAISWAPSVLSTVSGVSRSQQPSNSLAPQKRFVTAGSDNLIRIWGFDEEQ
                     KKWTEEETIKGHEDWVRDVAWAPNIGLPGMYIASASQDRTVLIHSRPSPSSSWTSAPL
                     LPSLPQSQDPHFPDAVWRVSWSLAGNVLAVSCGDGKVSLWKEGVGKGWECVSDFSS"
     gene            903755..905160
                     /locus_tag="CNI03330"
                     /db_xref="GeneID:3259451"
     mRNA            join(903755..904177,904238..904760,904818..904949,
                     905023..905160)
                     /locus_tag="CNI03330"
                     /product="O-methyltransferase, putative"
                     /transcript_id="XM_572625.2"
                     /db_xref="GeneID:3259451"
     CDS             join(903961..904177,904238..904760,904818..904949,
                     905023..905053)
                     /locus_tag="CNI03330"
                     /codon_start=1
                     /product="O-methyltransferase, putative"
                     /protein_id="XP_572625.1"
                     /db_xref="GeneID:3259451"
                     /translation="MIPRRFPALPQKVYRPFESFDHYIPLFSRIHSSTGRQFQRASAQ
                     QTDETPTSWPANKQKLDMPSDSKKGEINPGPSAGDVDKYLNSKILSPSFGGDPIFKRI
                     SARAQQAGLPNIAVSAQQGQLLTILALSIRAERILEVGTLAGYSTACLVKALPNHGQI
                     DTLEVKPEHAKVAQENFIDADLYPFPKIHVGPAIETLKRMETPDEGPYDLVFIDADKS
                     TTLEYFLESMRLLRKGGLIIVDNAVRSGRIASPEEDSNPDVAGMRKLYDWVHGDDGRS
                     VLMNVTQTVGDKFWDGFAIAIKLN"
     gene            906023..907713
                     /locus_tag="CNI03340"
                     /db_xref="GeneID:3259418"
     mRNA            join(906023..906113,906273..906319,906371..906724,
                     906779..907065,907117..907219,907268..907443,
                     907494..907713)
                     /locus_tag="CNI03340"
                     /product="actin binding protein, putative"
                     /transcript_id="XM_572871.2"
                     /db_xref="GeneID:3259418"
     mRNA            join(906023..906113,906273..906315,906371..906724,
                     906779..907065,907117..907219,907268..907443,
                     907494..907713)
                     /locus_tag="CNI03340"
                     /product="actin binding protein, putative"
                     /transcript_id="XM_572870.2"
                     /db_xref="GeneID:3259418"
     CDS             join(906072..906113,906273..906315,906371..906724,
                     906779..907065,907117..907219,907268..907443,
                     907494..907661)
                     /locus_tag="CNI03340"
                     /codon_start=1
                     /product="actin binding protein, putative"
                     /protein_id="XP_572870.1"
                     /db_xref="GeneID:3259418"
                     /translation="MDPSLPLVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEER
                     LGTSQLKDIMIGDEAAENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGK
                     KILLTEPPMNPKANRQKMCEVMFEEYGFGGVYVAIQAVLTLYAQGLQTGVVVDSGDGV
                     THIVPVYDGFALPHLTRRLDVAGRDVTRYLIKLLLMRGYAFERTADFETVRGIKEALC
                     FTSYDLEMDKKLAEETTVMVENYTLPDGRVIKVGSERYEAPECMFQPHLVDVEQPGVA
                     ELLFNTIQQAAVDTRTELYKHIVLSGGSSMYPGFPSRLEKEMKQLYLTRVLGNDTSRL
                     KHFKIRIEDPPRRKHMVFLGGAVLADIMKDKDAFWVTKEEWEEQGIRALDKLGRGD"
     CDS             join(906313..906319,906371..906724,906779..907065,
                     907117..907219,907268..907443,907494..907661)
                     /locus_tag="CNI03340"
                     /codon_start=1
                     /product="actin binding protein, putative"
                     /protein_id="XP_572871.1"
                     /db_xref="GeneID:3259418"
                     /translation="MAIFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYLQVTH
                     PMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKMCEVMFEEY
                     GFGGVYVAIQAVLTLYAQGLQTGVVVDSGDGVTHIVPVYDGFALPHLTRRLDVAGRDV
                     TRYLIKLLLMRGYAFERTADFETVRGIKEALCFTSYDLEMDKKLAEETTVMVENYTLP
                     DGRVIKVGSERYEAPECMFQPHLVDVEQPGVAELLFNTIQQAAVDTRTELYKHIVLSG
                     GSSMYPGFPSRLEKEMKQLYLTRVLGNDTSRLKHFKIRIEDPPRRKHMVFLGGAVLAD
                     IMKDKDAFWVTKEEWEEQGIRALDKLGRGD"
     gene            908089..912410
                     /locus_tag="CNI03350"
                     /db_xref="GeneID:3259622"
     mRNA            join(908089..909296,909337..909690,909739..909998,
                     910044..910286,910342..910577,910636..910769,
                     910828..912410)
                     /locus_tag="CNI03350"
                     /product="yeast yak1, putative"
                     /transcript_id="XM_572873.2"
                     /db_xref="GeneID:3259622"
     CDS             join(908160..909296,909337..909690,909739..909998,
                     910044..910286,910342..910577,910636..910769,
                     910828..912126)
                     /locus_tag="CNI03350"
                     /codon_start=1
                     /product="yeast yak1, putative"
                     /protein_id="XP_572873.2"
                     /db_xref="GeneID:3259622"
                     /translation="MIPADSFPDDPLQLPLFNSNSPYHQPHSQLQMPAANSYLGRSAS
                     LGRKKDPFAYRSDDVESGFGNMDIIDPGQQQPQQPGWGSYGYAQAGYRDSVVSPRSGG
                     YQNMVNQSSMNPLPVPSHNLSRPPPAVPEHPSPTTKAANNAYIPARSSDPGPSVTDRS
                     NSYSHSPGTSAIDPYHPGAAGASQWTEYRRPSIKSRMPSSSSYASRGSDGLSPFISPG
                     TLDTNVGVGSPGHSPLLNPNDIPHAGWSSPSMPHIQPPSPRNYAPQSTATRPQASPVG
                     GRPPPTSSRPLSIAASQTQGQTLYPASQPTTPQSRYDPNMPPPQTIPSRSGAGSAVDR
                     RSSSAVSKREEEFRDIRGLADLRAVVNALPNGRRADPDAPGKYLSPLKCLTSSLPETY
                     TLCNPSFRYVTSDNPRRVLTKPSKPVHNDGADNEDWDYILYVNDVLGGEDGRDRYLIL
                     DVLGQGTFGQVVKCQNMRTHDLVAVKVVKNKPAYLQQSKMEVAILELLNTQHDPQDRH
                     HILRMHDSFTHKHHLCLVFECLSSNLYELIKQNQFKGLSTQLVKVFTQQLLDCLSVLK
                     DARLIHCDLKPENILLKSLQSPQIKVIDFGSACHEMQTVYTYIQSRFYRSPEVLLGLP
                     YSTSIDMWSLGCIVVELFLGLPLFPGTSEYNQISRIVDMLGNPPSHLLEVGKQTHEFF
                     NITPDAYGRNTYKLKPMQQYSMEHRTDEQPSKQYFKQTKLKDVIMEYPYAKKSAKQSD
                     IDKEMATRRSFVDFAEGLLNMDPIKRWSPQQALKHPFITGEKWTGPWQPDATTTAKKL
                     PVSSAESSPSTSTPSKKYGGLVQSPPSSRSQRIYSDAAAYNQQLAQHQSYTAQVQAQQ
                     NAQRAGPFSSGYDIAQAQAPAHTHAAGGGGGGSGYGHQRVVSQQMPSTASHHHHAQQR
                     QPSGQWGQQVAPPSSAGYQQRGPSVNNSGSHASLRQPPSNVPVISNPPPNSYYPASRH
                     RANTINQMDAIPPALARLVHFGAQDPNGSRNSLTPVLNRDDAIREWERRQQGGHSKQS
                     SLHNASYPQLEYLQEQAELAAMQGQNWMMPGPYPPHHGRGHVHRSSLGEQSHGHGHRT
                     NPSGQYQMQPHIGISPSNDYRPRPTSEYDPPSSTSSARGYGLPTYPPLAATTSHPPGG
                     SVSGAVGTGQGVFDAFDGRDGGMGMLYTPLQPNQAYGYQGHAGQHGQGHATRASYSGP
                     YSSSNPFANQPNSPRY"
     gene            912580..912677
                     /locus_tag="CNI03360"
                     /db_xref="GeneID:3259722"
     tRNA            912580..912677
                     /locus_tag="CNI03360"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:3259722"
     gene            complement(913155..917039)
                     /locus_tag="CNI03370"
                     /db_xref="GeneID:3259483"
     mRNA            complement(join(913155..915646,915701..915843,
                     915900..917039))
                     /locus_tag="CNI03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_572945.2"
                     /db_xref="GeneID:3259483"
     CDS             complement(join(913657..915646,915701..915843,
                     915900..916994))
                     /locus_tag="CNI03370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572945.1"
                     /db_xref="GeneID:3259483"
                     /translation="MEDPWATPTWSTPAKPSAKPETTILPSNPWGAPPTPAGPRTATF
                     EDKDKTKSPTGGKALGLSDVVENAWGAESEAATLSLPTLPTSPIRSKVEADPDPGAVW
                     GGDPAPASPVPLPGSPKASSKSAVDLAASNPLPEIPELSASTAAITYTLPRPSLPGEE
                     TAISSRVGPEGDHGAIWGNDPAALLSTPSSEEIAGNLAVNEPTSIISTESSIGPPVSP
                     QASGLQTPISYSPLSKSLGGLGSSSVEELPTPTLPKSPSFGEEFGGFSDFAAPAASSS
                     DPWGSNIKESDNDVWGNDDWDTSLTRSASGVHSIEEVPEERESKVDDEEVAWGAPAVG
                     LGLGTSSATKPKGDDDWEEAQRRIKIQEERAPREKMEELKGLWTKVAESVMAGGVGLE
                     KMTGAEELQYEQTINKVFEDAVESFRSLSTIPPEINTYPPVLSSLVTHERFDYSLQRP
                     NLDPSSSLLSAAARSVRRPKRVDPLSLSLTSNGDASWSSRSRLGEPENQGDGRSEGKE
                     EGNKSRWSLWGRRPASERQLTTSGGGILEVKPMTRTATGDTTQSGPSSDAKPPSIPAS
                     HAASVSVPSRSTSPASSIHQNPITEAQPLPPAKHATAPPPSAVSRFFGRLSRRPSQQP
                     STSTSTPDVDAKDFELSASDFSFLSDIPGVPEQPQGKGVADLLSLEPGANEPIASLEN
                     LLSSKVTDLPKPLAPPPKVSQEPTASTLSGAGRSTSGRFIARMKAPSAPQPNDMDLLG
                     GLDFGSPGGSGSGTPNMLSPTSTGSGLAVRGESDSGLAWDDFAGLMSSGASSGQMGQS
                     ASTNNSPITPSIHSTPAISFSSPPSAAMNVAMSSVPLKFQPQSPAVPKPSTEHISLND
                     DFGDFGDFGSTSNRGVASSAKDNSYDFGDFSSPVSSLAPTSSTKSQSPIQPRLPLGQP
                     SSSSSHSRPPSMSFDHSHTLNLLSGASASKGKRWPAPPSPVPPQLEPPPRASSANGSK
                     GFPFLIPPPPGGSAKRGGDLLGGVEPSTPSLGSSKTTTVAEMGTMGGLNALSPSPTPP
                     LPFTSAPVFSLMGGATLKPSQTPGQGTGSGQGGLSAQDLSFFDSL"
     gene            917132..918609
                     /locus_tag="CNI03380"
                     /db_xref="GeneID:3259632"
     mRNA            join(917132..917783,917837..918057,918148..918609)
                     /locus_tag="CNI03380"
                     /product="expressed protein"
                     /transcript_id="XM_572876.2"
                     /db_xref="GeneID:3259632"
     CDS             917148..917726
                     /locus_tag="CNI03380"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572876.1"
                     /db_xref="GeneID:3259632"
                     /translation="MPFPSPHLERTRSHSSSLSIARSPNVLASAPFLPPISPISPHDL
                     DQPNPIESHHPFAQNWRSNILGRSVSASGNGRLEAIPSVEDLSAPTTADALLDTEDKT
                     GNYAEDDYDGSASTPLLKPHVHSSDAGGSVFERLSMDLNGIERLEGPSFEYTGPFQPP
                     DSKELLGIILSFVGVLVLAVAAGLATIFDWVL"
     gene            complement(918012..922872)
                     /locus_tag="CNI03390"
                     /db_xref="GeneID:3259809"
     mRNA            complement(join(918012..918326,918397..919478,
                     919537..919821,919883..919904,919957..920447,
                     920528..920809,920871..921102,921167..921802,
                     921861..921966,922027..922872))
                     /locus_tag="CNI03390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657862.1"
                     /db_xref="GeneID:3259809"
     CDS             complement(join(918153..918326,918397..919478,
                     919537..919821,919883..919904,919957..920447,
                     920528..920809,920871..921102,921167..921802,
                     921861..921966,922027..922808))
                     /locus_tag="CNI03390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513452.1"
                     /db_xref="GeneID:3259809"
                     /translation="MSQPPRLPPRKPSPLPQAITITPASALTTPPPLPPRPTTAGSVS
                     RESPPPPILIGESVATASEGTPQLSEEVPRVQVAITPASPDEEPNASNVLEQASQRLS
                     NASNGDLTVNGAGNRDAGPKAAAGNDLLNNDPINEGQASSTNASLFSPNKGMPPAAAP
                     SSRNSSHIPLALSLLKKALSSGLKDLPAMSGTERAIFTTILVLLAHCGLPLTWLMVAA
                     FGGYRLLSQLDGSLPPPTHDASIQEQKEKIMQTGDGVEAVSWVNHALYALFPLISTDV
                     LTPFVDLLEDALVEEVPPIVTSVRLTSPALGSQPLVLTSLRPMSDKEWFASLSSSVTK
                     SDQKTGDKTHSSSAEKAPASPGAEPLKRARHSRQTPSTSSSNLINNGKPPPTQSTPEY
                     SGSDPQVQDEVQKRQKRDRLLHKITHRTPSNLSTDHSKTGQSPETNTTQQHQPQTRSG
                     DCLEDKADKFDGPRIHGGWDEEIDEEDPDSGQYVNYQVGFEYKRGAEATRKGRGLHCL
                     AYIGIGVKGLGKAEIPVYIDVLYVKGVVNLRLLLSPTPPFITTGTFTLPSMPEYDISA
                     NPLKKGAFNAMDLPLMKPYVKASFKSVLSSFLHPQSYTMDIDRLLLGAESSNRTEHIG
                     VLHIIFHGARDLPKADTVGSCDPYLEVGFEKAKKPVFSTRTIGRSMNPVWEEECFIMV
                     AADAIEVGESFRICANDSDRFSADDTLGVVLLDLAELIDSCRQGMTHRVDHFAADRAA
                     KNTSGTLEWSVEFCPVWQMSPEETKERLAQMQREREKCEPPKDAAEPWWIRWMKDMVP
                     GQDEWESERIKRRTEAKAWLGGKKDREVWEAEVGASEERLSGILQFHIHQCLDLEVES
                     TAGTYATQPRRPAGGPPALGHVTDRNPNENSDPPSAYCEVHLNDKLVYKTRTKEVTPM
                     PYYNAVSERFVRDWTKGKVVFVVRDARDREHDPILGLVEINLYDILKNTSQITRWFPL
                     TAGLGWGRIRLSLLWKSLEMYIPRGISGYEVGTVQIKSLVFTPMDDRHDDLRVVIRTD
                     SDTRKVRLVSGESGNSSAAPAASPSSSRFPTPPSSTEQYTFPPSTHPALAIMYRHSCA
                     IHMSVQSSKSKRRVLGKMKLLGVGVVRLNDVPDGEGSRRVAVWEGVKGEASDWDLDFD
                     GAADTPLDEDSGELLNTSDLTDVDQSPRLNSHPNSLALARVKTSTSKRSSRSIASSSR
                     SSSGQHRLIGYIDVSWVLAPGISAIHRKLAKHDLRFAKVFEAWESARDEHYIVHELGD
                     EGNESDSENGEGENTGEHEFADLQDDIVEDMSPRKAHSHALHKRHKGLFQLKIARTGK
                     FVKDKLSATMHNATNHGSSSVHEGYGRRRGADLEVEKEGLSKL"
     gene            923267..927031
                     /locus_tag="CNI03400"
                     /db_xref="GeneID:3259674"
     mRNA            join(923267..923658,923709..924724,924776..924863,
                     924912..924993,925045..925363,925417..927031)
                     /locus_tag="CNI03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657863.1"
                     /db_xref="GeneID:3259674"
     CDS             join(923910..924724,924776..924863,924912..924993,
                     925045..925363,925417..926896)
                     /locus_tag="CNI03400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513579.1"
                     /db_xref="GeneID:3259674"
                     /translation="MNTPASSRQTHSFFHPAMIKPQSRKSWFSFARQNPETIKAEKAS
                     AVSPAELLPPAAASDGVPNSSSNRLSVYNSDPQGYLRPIQFEPNRIATLYVSPSEVNL
                     YLAAMSQLDQSPPPLPLWTDPAPELPRLNPTDPLDVPRLPSTYTITRPTFGLDFWTDS
                     LYNPKPLPGGVYDPPSSTGLLVRDEFRSYSVPKSANHAIIALTPPGEIRFTNFPPSAL
                     LALDNVIRDQWPHGIVKRSLGVVELKERDEKDKIVWTVNLEGKVWKRKGNEELHTIRL
                     VLGILKVLGIHGWTLVESIQAGGSKKDTHDLLFSYSLKTIRGPPAFFALSIPLPDRLS
                     LINPPFKSTPALISALRTSIISASPLKLKQSSNGIIDPNSTDAELLKAAEQGKKKGKV
                     NWQGYDPRGVKLEGWVHDGVYRFWVDGMRRWVGGGLRRKTVENIHPMLVINIVNNLTA
                     NHFELAGSVPLLPFTKGRDVLVFQSLPSSGLTAQDSYDTKQYKYNEAAHPGGPTTAGT
                     QGEKARTSTRPPRPPAATAMTRLRRLSDLTLRRHSSNGESPNRCVRAAPSSGAGINTQ
                     EGTPKAKNVLLKKNSTRRKNVLNMPASTADNHVGNGQSKRASAPSFVPSRGHVQGSDD
                     AAGFAQGDAHLRVMNSTSQDRNNWSFVEHPTVLNQEGRAPPIGISRIFPTESLWNAPL
                     ALCHNTNRDPIQFGTTQLFVPRGTGHAPDPNLSQDSGDSMYIDPPVAGEKDRCPSLDN
                     VRIPQANVYSSTTTGIGGFHDFVSSDITQPFRLGHPMGTPSPSIQSRPKISHTIVPAP
                     QFTSLPVNNPNGAATMKDRGSPKRNRPAVVVPDMTGIGRVDSMHGSVGWNGSALSRGS
                     GDHQPHHSSLNNEQSGPGRESQQGSVVMLVNAQGYGGSLQFPGSPTSPTTQAEKVGSA
                     RTKVNVGPRHWET"
     gene            complement(927002..929375)
                     /locus_tag="CNI03410"
                     /db_xref="GeneID:3259452"
     mRNA            complement(join(927002..928294,928348..928866,
                     928919..929058,929113..929205,929257..929375))
                     /locus_tag="CNI03410"
                     /product="iron hydrogenase, putative"
                     /transcript_id="XM_572892.2"
                     /db_xref="GeneID:3259452"
     CDS             complement(join(927115..928294,928348..928866,
                     928919..929058,929113..929205,929257..929277))
                     /locus_tag="CNI03410"
                     /codon_start=1
                     /product="iron hydrogenase, putative"
                     /protein_id="XP_572892.1"
                     /db_xref="GeneID:3259452"
                     /translation="MAFSGALTITDLDDFLTPSQACIIPVRNNKKPAEDEGPTEIHID
                     SNNNYYEVSTYPSVGHDDDIGNSKKALEKAEINLNDCLACSGCITSTESLLITMQSQN
                     EILEFIKTNPTVVDPESPCHKPRLPILSISPQTLASLSAAYATASSRPPIPLLVLLRR
                     IRAFLSQPEKGSWRVWDTTFARHMSLRESVVEFHERKDKKEKGKAAEMPMLASACPGW
                     VCYAEKAQGDMLPLLSAARSSQGIIGALAKSWYGHKLQHKPDEIYHVTAMPCYDKKLE
                     ASRSDFYSSLYSTRDVDCVLTTGELDLLLQELGFDPHVPIANESTPSYSATEDSPFPE
                     LLTHEGSSSGSYLQTIIHDVQRSHPNPTRIITREIRGSTDNIEYLIQDTITGQIVFKG
                     AKVYGFRNLQNLVRKVAKETGIGRSGRGAGAGKLSAAVAARRRKAKTAAPAATSATTS
                     AEGTDVESIASLSLVSGEDKKLDFVEVMACPGGCVNGGGQMKPTVPTPSAPEAMEVDE
                     EGYQRPLPDDGVAVAVNGGSNNVGTGTVAGMEEGMRWSTKEWVAKVEDIYWTGLPTPP
                     ASPPLTASNVNGFAPQVKTNGTTNGQVNNGVDRNLQSDQLAEEIIHEVCGDDASKRWD
                     FMRTRFRKVESDVLSSGGVTHEAVKW"
     gene            929605..930964
                     /locus_tag="CNI03420"
                     /db_xref="GeneID:3259489"
     mRNA            join(929605..930130,930198..930375,930488..930964)
                     /locus_tag="CNI03420"
                     /product="expressed protein"
                     /transcript_id="XM_572878.1"
                     /db_xref="GeneID:3259489"
     CDS             join(929712..930130,930198..930375,930488..930730)
                     /locus_tag="CNI03420"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572878.1"
                     /db_xref="GeneID:3259489"
                     /translation="MNDHLAALNAPPPRYLLESDSSDEEGQGAYPGSSTPKPKVSVET
                     PPVEVLFTRGTGNEEVKDFVLALGQAGKYLKKHLGASGSAIGQEEVGKIVVGGRQAGQ
                     GWKVGEGMVFSVNEADLPHEALWEIADKLFANVKAQSWTIITTYVPAMYISSKTDGSR
                     VRSDPPIRYLSQGEVKVEGAETYETPNYLTGLAGAITSLSAHPSFTIQPTTLILPLPL
                     SALPLAYLSTALAHISPSISDALNRKRSKWTEEDDEPYSAPGMGKVRGLARGVGEAVG
                     MYT"
     gene            complement(930423..931562)
                     /locus_tag="CNI03430"
                     /db_xref="GeneID:3259485"
     mRNA            complement(join(930423..931117,931203..931311,
                     931385..931562))
                     /locus_tag="CNI03430"
                     /product="transcription initiation protein spt4, putative"
                     /transcript_id="XM_572890.2"
                     /db_xref="GeneID:3259485"
     CDS             complement(join(930999..931117,931203..931311,
                     931385..931498))
                     /locus_tag="CNI03430"
                     /codon_start=1
                     /product="transcription initiation protein spt4, putative"
                     /protein_id="XP_572890.1"
                     /db_xref="GeneID:3259485"
                     /translation="MPPKSGRAELRACLVCSILQSTNDFLTQGCPNCEDILEMRGSAE
                     RVAECTSLLYDGMIAMIEPSESWVARWQRIDKRMRGIYAVRVTGRAPQDVIDAIEARG
                     GVYRPRDAVED"
     gene            931727..934225
                     /locus_tag="CNI03440"
                     /db_xref="GeneID:3259739"
     mRNA            join(931727..931984,932064..932092,932145..933398,
                     933523..933904,933972..934225)
                     /locus_tag="CNI03440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657864.1"
                     /db_xref="GeneID:3259739"
     CDS             join(931755..931984,932064..932092,932145..933398,
                     933523..933904,933972..934098)
                     /locus_tag="CNI03440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513450.1"
                     /db_xref="GeneID:3259739"
                     /translation="MSSQTPLSDPLTTQEKLLLSQAVYKLGAFSWAEVSSLLLDHPCI
                     KDATPHARPAKLFTPERCEGIYKELMGAIGINVPAPDGIKPHAKSHLRLAQNYYIARL
                     TELQNEISSYETRFTSLMSEITALKKGELDEQLREEIKAGLERKYGKKAVEEWMPGKA
                     EIQKAVEDGPVKEGEVDPELAKKEKEEKQKDVEEPRKGVEIVGASTLEENPAVSVLGK
                     QEGPSKSLKPEFLESKVKNPIEQMKTPDASRATLSPQPSPLSPAPSDHSPSRSVKTAA
                     DEEKEEEDAEKEEEKGEGEQDEEVVPEKKTNKRKAVSQPKGAPPTKRNSRRGAVTEEP
                     EEFEAGEAAEEEEEEGGGAEEKEEEPPTTRGRRSKRSSLTKPSASPSLPPKDTSPAIS
                     RRAPSVSSTTSAATPGGEGERRSSRRAAAPAAGRRGMRDDVVSKSVRGQTADAADADD
                     GPPTPTAAEEHEPEIRKSTRASRRKSGLPEQQQQAAATPTPVERERRGTRATTRNLRE
                     SVENEHASANNDDHDDHDDDDTTNNNDDDMENPDPDSPTAPTPNNSIKEKGKKSSKPF
                     LFSLLEAMASHRFGTIFESPVRKSDAPDYYSVIKRPMDLKTIKGKIKDGRIERIDELE
                     RDVLLMFSNAMMYNAPDSQVYEMAKEMMKDCEGHFAHFRNMEMELDNEG"
     gene            complement(934276..935353)
                     /locus_tag="CNI03450"
                     /db_xref="GeneID:3259657"
     mRNA            complement(join(934276..934393,934459..934623,
                     934702..934825,934889..934995,935071..935094,
                     935148..935184,935279..935353))
                     /locus_tag="CNI03450"
                     /product="expressed protein"
                     /transcript_id="XM_024657865.1"
                     /db_xref="GeneID:3259657"
     CDS             complement(join(934358..934393,934459..934623,
                     934702..934825,934889..934995,935071..935094,
                     935148..935184,935279..935298))
                     /locus_tag="CNI03450"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513449.1"
                     /db_xref="GeneID:3259657"
                     /translation="MPVLLEGSCHCKTVKYTVQSNTPVPFQQCQCSICRKVGGYMGSV
                     NMMGNTKTLNIIRGKDKIKVYVAALDFDENDKPTKMGTSKRSFCTECSSMLWNYHDEW
                     PDWIYPFASSIDKPNPLPSIPESASLICIKRDSCPEHVPVPAGAKVYDDYGPGNSIEG
                     WHKENKCWAD"
     gene            936173..938768
                     /locus_tag="CNI03460"
                     /db_xref="GeneID:3259680"
     mRNA            join(936173..936303,936382..936492,936545..936885,
                     936934..937132,937183..937277,937331..937975,
                     938025..938528,938582..938768)
                     /locus_tag="CNI03460"
                     /product="Golgi vesicle transport-related protein,
                     putative"
                     /transcript_id="XM_572617.2"
                     /db_xref="GeneID:3259680"
     CDS             join(936261..936303,936382..936492,936545..936885,
                     936934..937132,937183..937277,937331..937975,
                     938025..938528,938582..938665)
                     /locus_tag="CNI03460"
                     /codon_start=1
                     /product="Golgi vesicle transport-related protein,
                     putative"
                     /protein_id="XP_572617.1"
                     /db_xref="GeneID:3259680"
                     /translation="MAEQNFSAALATWKEINLSELQKNLDTTAVELVDNQKENLIGRK
                     KLAEQTREFKKLPDDAEKFAAIKVLLKAYQGEIDALTRRSKMSETSFLNVYKLLADAP
                     DPYPLLDAAVDQTIKVAEARMLESELARLREENGELKKSLGEAANVEEKRKKAESKVE
                     QLEEKMDDLIQERVTQKENELNAEYDERMRNYEEREKDLQRQVEMVKKQLRDLHMSNE
                     SAEAKLLNANQRQEQDVAARLAELDMVAADLARANERVASVERRNEILRSEIESVRSG
                     SQQAEKVKAFEAQISELEAEASRILAALDAAKDAKAEADRQFKKQAEESAKEIAARTA
                     EVDGLKAKMKGMADYDEIKRELEIMKYVEFSGADFEDNDGEEPRLPDPNASVANKQRG
                     QSLEKLLTSKNRRLLEDLTKLRVSWEDLSSEHAKAEEMIEGLQVDLALQRELVEKLES
                     DLMVLNNREDRVGTPGQGLAGLDIGSKPDGRASPANSGSQDTSILPIVTSQRDRFRQR
                     NAELEDELRKQFETISDLRTEVKSLQTDNLKLYEKVRYMGSYRDSSFAKAGPSGGAYS
                     SGGGTGGLLTGVLGRRDEEIGKYKDKYDESLNPFEAFKGREAQRAIQALNPVERGVFS
                     LTRAIVGNKRARNLFILYAGSLHILILFILWNTMAASDSTSHPPVTIHP"
     gene            complement(938737..940699)
                     /locus_tag="CNI03470"
                     /db_xref="GeneID:3259734"
     mRNA            complement(join(938737..938902,938956..939992,
                     940046..940222,940272..940331,940402..940417,
                     940472..940510,940571..940699))
                     /locus_tag="CNI03470"
                     /product="Machado-Joseph disease protein 1 (Ataxin-3),
                     putative"
                     /transcript_id="XM_572615.1"
                     /db_xref="GeneID:3259734"
     CDS             complement(join(938865..938902,938956..939992,
                     940046..940222,940272..940331,940402..940417,
                     940472..940510,940571..940586))
                     /locus_tag="CNI03470"
                     /codon_start=1
                     /product="Machado-Joseph disease protein 1 (Ataxin-3),
                     putative"
                     /protein_id="XP_572615.1"
                     /db_xref="GeneID:3259734"
                     /translation="MDLVPYMYYEKQEAGSQLCAQHCLNNLLQQYTYSEFDLADIAKR
                     LDQAENATLDVNHQLRKSYNYDDTGYFSISVLERALEVWDLTMVRWRGEAMKPYQDHP
                     EDQAAFILNLASHWFTLRRFAPNPPHAAASKRWYNLNSFLADGPEWISPTYLHMVLTQ
                     AEQEGYSVFVIRKATPGTKEGEEAGEAEGWGDGGIGQLPESLGDVMAVELGEPVGRSG
                     GLLSGTIGPTKESKTTQMSIPADPNTTTVDAEPSSPSRPPRRRRQPDLSSDPTEIVDD
                     PYARPAPSRSRQSSSRSNPAQHQVIGDDEGDIFDQTHGIPSHYDETPDDDNADDDFEM
                     SRSRAYAGTMDFQFQSRSYDDEDEALQAALKASMADLPEGWEMPDILKPESERQAFTT
                     TTSIMTTTTTTPPVAPEAQREESPVATSVAEEKDIVESNEVEDDSDDVQPAEEPSPEE
                     IRRRRLARFG"
     gene            940944..943041
                     /locus_tag="CNI03480"
                     /db_xref="GeneID:3259654"
     mRNA            join(940944..941112,941177..941203,941257..941291,
                     941348..941426,941479..941505,941569..941610,
                     941666..941804,941853..941874,941921..941979,
                     942039..942222,942276..942528,942591..942605,
                     942685..942792,942850..943041)
                     /locus_tag="CNI03480"
                     /product="Voltage-gated potassium channel beta-2 subunit,
                     putative"
                     /transcript_id="XM_572880.1"
                     /db_xref="GeneID:3259654"
     CDS             join(941077..941112,941177..941203,941257..941291,
                     941348..941426,941479..941505,941569..941610,
                     941666..941804,941853..941874,941921..941979,
                     942039..942222,942276..942528,942591..942605,
                     942685..942792,942850..942891)
                     /locus_tag="CNI03480"
                     /codon_start=1
                     /product="Voltage-gated potassium channel beta-2 subunit,
                     putative"
                     /protein_id="XP_572880.1"
                     /db_xref="GeneID:3259654"
                     /translation="MSGQRFEPKNMLYRNLGNSGLRVPVFSYGGWLTVGYNQKGDLVK
                     ELMQTAFDCGINMFDNAEAYAAGESESQMGRVIKELGWDRSDIIVTTKVFFGTGDKER
                     HNTRGLSRKHIIEGVNKSLKRLGLDYVDIVFAHRPDVTTPLEETVRAFNYLIDKGLTF
                     YWGTSEWSAMQIQQATEIARRLNMVGPVAEQPHYSMLHRERFEAEYEPLWRYENFGST
                     IWSPLDSGMLTGKYNDGIPQDSRYHHNLGGAMDERIKELESPEGKAKIEKVKKLTKIA
                     ERLGGSMTNLALAWTLKHKGVSTCILGATKPEQIKENVKALDIYPKLTSEVMEEIEKI
                     LDNKPDPPPSYGRLTTDGQLM"
     gene            943951..946552
                     /locus_tag="CNI03490"
                     /db_xref="GeneID:3259762"
     mRNA            join(943951..944308,944385..944510,944558..944683,
                     944737..944947,945003..945120,945169..945477,
                     945525..945808,945863..946109,946177..946552)
                     /locus_tag="CNI03490"
                     /product="sugar transporter, putative"
                     /transcript_id="XM_572882.1"
                     /db_xref="GeneID:3259762"
     CDS             join(944164..944308,944385..944510,944558..944683,
                     944737..944947,945003..945120,945169..945477,
                     945525..945808,945863..946109,946177..946308)
                     /locus_tag="CNI03490"
                     /codon_start=1
                     /product="sugar transporter, putative"
                     /protein_id="XP_572882.1"
                     /db_xref="GeneID:3259762"
                     /translation="MAGEDLAITSTSVENVPNSPSRKVSEDGLLLQEDKEMAAMYANA
                     AAATEKEQNMTLLEGLRLYPKAIAWSILISSCCAMEGYDISLLGNFYAFDPFNRKFGV
                     ELDDGTWQVPARWQTGLSNGAQCGQIIGLIVNGIFTERYGYRKVLIASLLWLAAVITI
                     FFCAPNIQVLLAGEILAGIPWGVFQSIAISYASDVCPIALRGYLTCYANFCWGWGQLI
                     GVGVIRAMFSRDDQWAYRIPYAVQWVWPPLILAGVIFAPESPWWLIRHGRLEEAKKSL
                     MRLASPKRNVSYDVDETADMIRHTTELEKDITSGASFLDCFRGVDLRRTEIVCAIWSM
                     QNLSGNTFSNYSTYFFEQAGLTGTVPYDFAMGQYAINMVGVFGAWSLMALGFGRRQLI
                     LIGLSGLFVALLIMGFMGLIPDSKQREAGLATGSLMLVWAIFYQCTVGTVAYSLVGEI
                     ASRRLSIKTVALGRAAYNVIAIICNVLTPYMINPTAWNWGNYAGFFWAGSCFLCLIYA
                     YFRVPEPSGRTYAELDLLFERKISARKFASTHVNAFDVALHHQVGEDKGVSDHVEKA"
     gene            946754..946836
                     /locus_tag="CNI03500"
                     /db_xref="GeneID:3259587"
     tRNA            946754..946836
                     /locus_tag="CNI03500"
                     /product="tRNA-Met"
                     /db_xref="GeneID:3259587"
     gene            946948..950673
                     /locus_tag="CNI03510"
                     /db_xref="GeneID:3259721"
     mRNA            join(946948..947375,947466..947864,947957..948169,
                     948226..948345,948407..948419,948467..948536,
                     948591..948644,948699..948726,948778..949297,
                     949354..949406,949476..949620,949683..949759,
                     949816..949917,950028..950094,950160..950347,
                     950426..950673)
                     /locus_tag="CNI03510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657866.1"
                     /db_xref="GeneID:3259721"
     CDS             join(947767..947864,947957..948169,948226..948345,
                     948407..948419,948467..948536,948591..948644,
                     948699..948726,948778..949297,949354..949406,
                     949476..949620,949683..949759,949816..949917,
                     950028..950094,950160..950347,950426..950438)
                     /locus_tag="CNI03510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513552.1"
                     /db_xref="GeneID:3259721"
                     /translation="MAFNSWLPPYLLSDLFSNMKQGLSALQNVSADRLTFLQTSLRKS
                     RQPYTYHETTLNMSDEIKKQSLTHHHLTNFHLDDYPDEKQIVADNGNLVTVEEVKIAE
                     DALLMADEYTEEQYKKLKRKVDWILLPLMWWCYGIQQTDKTGLGTMNLYGVQADTGMH
                     GNQYSLLTVVFYTAYGICEFPSNIILQRFNMGKCLTIYMFCWGIVVLAQGFLKSFAPF
                     LVLRLLQGAFECTISPGFNLIIANWYTTQEHNSRSLVFQSANAGWGIVVDLTMYGIAK
                     AANRNPGGFEAWRGIAVFLGGQTLLAAGVAFFLLGTPNEVSWLKPEEKRIACARVMKN
                     NAGTDLTGRKTWKWDQVCETFLDPVLYFQFINAFMSSVCNGALTTFGTVINKSFGFTE
                     SEVILYGIPRSVASVLWFAFIGILTGKFKGIRMYFMMISTVFPFIGLLFLALLPEDDT
                     YRWVKWGMYFMTVTFVVPLFSAWALISSNTAGRTKRSVMSSMTFIAYCTGNIAGSQVM
                     KAKDAPHYIPGTIAIACCMGVEFATIVIWRIWLEYCNRKKTRAIAEMGLSEEEIEKRG
                     QELGAEDTTDMKNPFFIYST"
     gene            complement(950927..953359)
                     /locus_tag="CNI03520"
                     /db_xref="GeneID:3259666"
     mRNA            complement(join(950927..951392,951453..952133,
                     952185..952474,952531..952647,952706..952987,
                     953125..953359))
                     /locus_tag="CNI03520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657867.1"
                     /db_xref="GeneID:3259666"
     CDS             complement(join(950942..951392,951453..952133,
                     952185..952474,952531..952647,952706..952987,
                     953125..953352))
                     /locus_tag="CNI03520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513446.1"
                     /db_xref="GeneID:3259666"
                     /translation="MAAYHALAAMANNPPASSISIRGAAAAPARVVANALRGAGISAR
                     SQGMDVDGGGARGGDRPRGIERRKRSSGPLDQTGRHRPPQGGPPVDRPYGRSAPLRGT
                     ARRGARGGLSNPGRAPSGTPPGISALRQAPSKAEKDHAKSELSRKLSSAEMKAWLENR
                     MIAPGVLDMSNLPNDEWIKSNGIFPPGHPHAPPTAGLVFWRLIDQTFQKTDKITIHTL
                     SLANNNFSHLKQLEKLPIWLPDIRALDLSGNPINHISELDNILASGEKKGKANAGMGS
                     LKSLVELKLNDCLFREKTLARPDGEAVYKHEILRRFPGLRILDGVSLERVIFPIERKP
                     KVKHTEEEKAALIARPFSFPVEVRPDFFSEEAARNFAMAFCAKFFPCFDNNRTECLPA
                     YAPNALISIAANTLTSRSAQQQVVLKSRLDRPNPVPFEPWINLPSRNFFRNATSIHQR
                     METLKTAADPAQLAEWWEKAVPRTEHPLTEASKWCFECWVLDSERGHVRLCLMIQGQF
                     RELPSGTYRSFSRTFILVEAPEGSPAFNAGYPASILSDTMIVHSFFGTGAFDTTRPLG
                     MNGVTIQPPSIPFTPSAVPAQAASGLGSGVNPSLSSISPGAGAGVGPGASPNGSSSSA
                     AAAPDPTTQQSLISQISSRTGMNAQYAGMCLVQNGWDPEAAIKNFEEIKSSIPAEAFQ
                     "
     gene            953542..954405
                     /locus_tag="CNI03530"
                     /db_xref="GeneID:3259589"
     mRNA            join(953542..953636,953679..953992,954043..954118,
                     954159..954405)
                     /locus_tag="CNI03530"
                     /product="expressed protein"
                     /transcript_id="XM_572611.2"
                     /db_xref="GeneID:3259589"
     CDS             join(953565..953636,953679..953992,954043..954118,
                     954159..954182)
                     /locus_tag="CNI03530"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572611.1"
                     /db_xref="GeneID:3259589"
                     /translation="MGAAQSSQPADQLIHPQEPNTSVQFSPALISRLSTPHEPTPTST
                     TDDVVRRRLAAESAHLRAQEADILSAISAALEKENLDREKPGMSAHVLASDIDHIREK
                     IERMKDKRNKEGDGVKLARQGVETCYRANGDRPLDCWKQVEAFKAEVAKLEQAFVKSL
                     Q"
     gene            complement(954261..959430)
                     /locus_tag="CNI03540"
                     /db_xref="GeneID:3259730"
     mRNA            complement(join(954261..954624,954684..954851,
                     954907..955230,955281..955379,955435..956428,
                     956486..958003,958051..958197,958247..958367,
                     958420..959430))
                     /locus_tag="CNI03540"
                     /product="signal transducer, putative"
                     /transcript_id="XM_024657868.1"
                     /db_xref="GeneID:3259730"
     CDS             complement(join(954506..954624,954684..954851,
                     954907..955230,955281..955379,955435..956428,
                     956486..958003,958051..958197,958247..958367,
                     958420..958727))
                     /locus_tag="CNI03540"
                     /codon_start=1
                     /product="signal transducer, putative"
                     /protein_id="XP_024513536.1"
                     /db_xref="GeneID:3259730"
                     /translation="MSTLSQHSTAPLNTKKASTKPPSNILSPRVPSPTNVPSSVGSPN
                     PQHHHHDHMHAHSPTGAKYPGLGISQGEGFPPMNGMDAKCGGCGLMIDQESGGVVVAF
                     GSSLWHVDCFRCAKCKEKVSADTNLLLLSDGSPVCGNCSYQCFVCKQAITEEAIMTGD
                     ESYHAHCFTCRTCKRRIEELVFAKTSQGIYCMSCHNERVAKSRRHAEAKRQRQARREA
                     KEREREEEEQRQKEEEARQAASSSGQAPPLNYLNAGHSTPSSMSLSHFAQKPQSRPHS
                     PYTGVANAGNAFEDAERENESRRDLGVVDKHVNPRSASPAGRQLIEAQNMPLPASPSE
                     SNDGHQLKPCASSPQIRPSPHSVSQSGLGVPTSKAEKRRSISPGMTFNLDAQNSTFTE
                     QRLGAYPPSPLRSSFTDGSGSASNEQRPVRSPTSPSPAPSGNHAFPFKDGSGSGAQLQ
                     QAQAQGTEQLSRSGSTGVANQPPARTSSLPEHLANRAKPDEHVCTEPHSSQPNSAELA
                     PVGPSKAQLIGEARTPKLHTPDLPHMSFSLSDPDFAVILSNMDQSPQKIKTGEKVRPE
                     VEIPSGESAPSSPPVSSPSLARSPTLDMLSTIESDPQSRSQPVALGRSRLLPNDPSPH
                     MLNRRQASGDSCFSVKSRHGDGSFEKLVELLAGAKFREEESVNVDVAVLSGIVKEVED
                     LREAMVGLKNRYTGAKRSSQQYSEGLSVAGEEYDKERSKRTELEAEVSRLRAQLHSQT
                     ARLSVISGDEKRAEHMKRRSRDLASNLTGLERDISRLRAERDMKLAEVDELAERTPGA
                     VLDPGSLAQSLSVRLESIRDQYATELESLSGQVENLEREISELRQIKEASLEESAALA
                     AKNEDLAELNTQLTRQTEALQDTLSRVRPPTIFSKGKGHQLQNSPSLASLTGQGLQDV
                     PEETVTARVVKVSKPEPIEAAPVKRFKWYKSSKGPDASNTPANISKPLALDVGKTRGG
                     MTLGVAGLAMGGIGGGARPSTEFGMRDHAFQQHTMMRFTRCELCGEKMWGLQEVKCSS
                     CGIVCHSKCAEKLPRGCTGTKGAVKDEPEGPLPPSMFGRPLVEQVSADKQSVPVIVTK
                     CINAVEAVGMEYEGIYRKTGGSSQSKQITQLFERGDYDAFDLADVDAFNDISSVTSVL
                     KTYFRSLPNPLFTHELHESFVTAATIRDTNNKRQAVLALLHELPKEHYNTLKALMLHL
                     NRVTSYSGVNLMSSQNLGVVFGPTLMRSSDPNREFGDMAGKALSVQWLVDNAPSVFTL
                     DRD"
     gene            961860..964008
                     /locus_tag="CNI03560"
                     /db_xref="GeneID:3259637"
     mRNA            join(961860..962050,962098..962180,962232..962407,
                     962460..963794,963850..964008)
                     /locus_tag="CNI03560"
                     /product="phosphoadenosine-phosphosulfate synthase (PAPS)
                     bifunctional enzyme, putative"
                     /transcript_id="XM_572607.1"
                     /db_xref="GeneID:3259637"
     CDS             join(961937..962050,962098..962180,962232..962407,
                     962460..963794,963850..963887)
                     /locus_tag="CNI03560"
                     /codon_start=1
                     /product="phosphoadenosine-phosphosulfate synthase (PAPS)
                     bifunctional enzyme, putative"
                     /protein_id="XP_572607.1"
                     /db_xref="GeneID:3259637"
                     /translation="MANAPHGGVLKDLLVRDAALHDSLLQEARSLNDIFLTERQLCDL
                     ELILNGGFSPLEGFMNERDYTSVVETLRLAPYNGQKHGDVFPIPITLDVSQEDINTLG
                     LKQGGRVALRDPRDDAALAILTVSDIYRPNKAIEAEKVMGADDIAHPSVAYLRNNVKE
                     FYVGGKVQAIQAPTHFDYVPLRFTPAELRAHFHKLAWRKVVAFQTRNPMHRAHRELTV
                     RAARQRRANVLIHPVVGLTKPGDVDHYTRVRAYQALMPSYPEGMAHLALLPLAMRMAG
                     PREAVWHAVIRKNFGATHFIVGRDHAGPGKNSQGQDFYGPYDAQELVTQFKDELQIEM
                     VPFQAMTYLPGSDEYQPVDEVPKGTPTADISGTELRKRLRTGASIPDWFSYTGVVKVL
                     RESYPPRPQQGFTILLTGLHNSGKDTIARALQVTLQQQGSRSVSLLLGEELRSDLDPQ
                     IGRAITPEQKHINLERIGFVAGELTKAGAAVIAAPTAPYERSRQAFKKQVVGSGGGNY
                     FLVHVATPLEWCEKVDRRGLYKAARAGEIKNLTGVDDVYEAPEDADLVCDLRNDTVPE
                     IVHSIIMILESQNLV"
     gene            complement(964302..964404)
                     /locus_tag="CNI03570"
                     /db_xref="GeneID:3259586"
     tRNA            complement(964302..964404)
                     /locus_tag="CNI03570"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:3259586"
     gene            964549..966213
                     /locus_tag="CNI03580"
                     /db_xref="GeneID:36393043"
     mRNA            join(964549..964936,964993..966213)
                     /locus_tag="CNI03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657869.1"
                     /db_xref="GeneID:36393043"
     CDS             join(964756..964936,964993..965375)
                     /locus_tag="CNI03580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513443.1"
                     /db_xref="GeneID:36393043"
                     /translation="MTTPITVTFDAKHDLQLDAYLPDTSDKVNGRALSVPVIIHYHRG
                     GMLIGSKSDIYPPFMPVYLQSRKILLISPNYRLLFPSSADDMIKDVRSLFAYIASAEN
                     EPSFILYFKGLSVDTSRIVVMGVSGGNYPARAAATLSNIVPRPIGWLDLFGMGSDWLL
                     DFWINGVDVERTMPVDTTLHDMAKQMN"
     gene            966809..969033
                     /locus_tag="CNI03590"
                     /db_xref="GeneID:3259644"
     mRNA            join(966809..966866,967026..967169,967221..967408,
                     967460..967613,967665..968117,968175..969033)
                     /locus_tag="CNI03590"
                     /product="phosphoenolpyruvate carboxykinase, putative"
                     /transcript_id="XM_572603.1"
                     /db_xref="GeneID:3259644"
     CDS             join(967059..967169,967221..967408,967460..967613,
                     967665..968117,968175..968924)
                     /locus_tag="CNI03590"
                     /codon_start=1
                     /product="phosphoenolpyruvate carboxykinase, putative"
                     /protein_id="XP_572603.1"
                     /db_xref="GeneID:3259644"
                     /translation="MAPRQHHHDEFESNQFLGKELKYFSQAGFDLDRIHIKRNAPIAS
                     LYEDAILNEGAIISSNGALINFSGKKTGRSPKDKRIVFEETSKDDIWWGPVNIKMDEH
                     TFEINRERAIDYLNTRENVYVFDGFAGWDPKYRIKVRVIASRAYHALFMHNMLIRPTP
                     EELENFGEPDFIIYNAGQFPANRFTTGMTSTTSVGINFKRMEMVILGTEYAGEMKKGI
                     FSVMHYLQPVKFGQLSLHSSANQGIGKNDDVTLFFGLSGTGKTTLSADANRLLIGDDE
                     HVWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKFGSILENVVYNPADRKPDYDDVS
                     ITENTRCAYPIEYIPNAKIPCIADRQPSNIIMLCCDAFGVLPPVSRLTPEQAQYHFVA
                     GYTSKTPGTEDGIVEPSPTFSTCYGQPFIVLHPGRYAKMLAERMEKNSVNCWLINTGW
                     TGGKFGTGKRCPLKYTRAIVDAIHNGSLAKAEYENFPIFNLAIPKAVEGVPSDILNPE
                     KAWPSKEAFKAELDKLGNMFQKAFAKYETDIDEKVKLSGPVFA"
     gene            complement(968167..971299)
                     /locus_tag="CNI03600"
                     /db_xref="GeneID:3259474"
     mRNA            complement(join(968167..969008,969075..970474,
                     970533..970633,970695..971035,971099..971299))
                     /locus_tag="CNI03600"
                     /product="expressed protein"
                     /transcript_id="XM_024657870.1"
                     /db_xref="GeneID:3259474"
     CDS             complement(join(970013..970474,970533..970633,
                     970695..971007))
                     /locus_tag="CNI03600"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513551.1"
                     /db_xref="GeneID:3259474"
                     /translation="MATLLTLPSHLIESISHLLREDLELPDNLREPLLETIKQPQTYI
                     VASLDTRNSLYTQDDGDIDGKQEDSTAVPRPPTIDYDLVERLSRWATSDKGKMLLNRN
                     GLDPSRYTDISLLSGTEIYVEPKELARLQAAENPEKPNPYLPSYLSPAPPSFGSEYRN
                     LTRTLSTAFNVIFSILGSSGAVYVAAVSGAGYSREKGILLGILAGLIVGIADGVLVVL
                     FMSRVEKDRKERHERGRKLMKGSGKALDQIEDQAEIEEEVQEKLLAKEGSDSTAVSAR
                     QIQLRRRGLKPSNPE"
     gene            971516..972491
                     /locus_tag="CNI03610"
                     /db_xref="GeneID:3259377"
     mRNA            join(971516..971737,971795..971945,972001..972161,
                     972345..972491)
                     /locus_tag="CNI03610"
                     /product="lactoylglutathione lyase, putative"
                     /transcript_id="XM_572884.2"
                     /db_xref="GeneID:3259377"
     CDS             join(971555..971737,971795..971945,972001..972161,
                     972345..972422)
                     /locus_tag="CNI03610"
                     /codon_start=1
                     /product="lactoylglutathione lyase, putative"
                     /protein_id="XP_572884.2"
                     /db_xref="GeneID:3259377"
                     /translation="MLSAFITSKLPSLSRPSTFRQFAKMSTAASNPATYKFNHTMIRI
                     KDPKVSLPFYEKVLGMKVFYESPGGDFTNYFLAFANGFDDADLNKENIRDKLFDREGV
                     LELCHNWGTENDASFKGYASGNEEPGRGFGHICITVDNLEAACKRFDELGVKFKKRPE
                     DGRMRHIAFIYDPDGYWVEIVARSLNASNI"
     gene            complement(972463..975426)
                     /locus_tag="CNI03620"
                     /db_xref="GeneID:3259551"
     mRNA            complement(join(972463..972635,972692..972731,
                     972791..973179,973227..973476,973534..973622,
                     973673..973727,973779..974066,974119..974221,
                     974270..974445,974492..974575,974624..974723,
                     974771..975036,975075..975287,975332..975426))
                     /locus_tag="CNI03620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657871.1"
                     /db_xref="GeneID:3259551"
     CDS             complement(join(972520..972635,972692..972731,
                     972791..973179,973227..973476,973534..973622,
                     973673..973727,973779..974066,974119..974221,
                     974270..974445,974492..974575,974624..974723,
                     974771..975036,975075..975287,975332..975418))
                     /locus_tag="CNI03620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513580.1"
                     /db_xref="GeneID:3259551"
                     /translation="MSSYYNKGDAPSWEALDQDGLDDVIDTSEYAYASRDHILFCIDA
                     AQSMHKPYPDTTDESGQLVRGRSALHQALDVAQQIQRAKVLSGPDDSVGLLLYNVDPS
                     AVAEDPGNYQPGNYVFQTLRTINAEEMKRLVKLMQTAKEQYEAQDDDETVETTEPEIL
                     RKTFPPIEESHEMNIANVIQTCNFLFRDGGTQLRGNKRVFWITDNDMPPGMNNRQPAR
                     TSYGDLTTYGVTAETFFIDRPDHRFNPNIFWNDILDREAIDYNDDQPDPEGLSSLADL
                     MKDLVIKTSPKRTHFHVPLKLGKDGEIVIGVSGCSMVSEQGKGASRYVKMRGQVVEEV
                     QSKTEYTSAETGAVLKDSEIGQAYEFGNEAEVRNILEPNPWEAHVKERAKNQNAVDHV
                     LEDDKERRQREDEGEDLEEEEEDDKKGVEKWMGKQKAALPKIVARTRLQFSNEEVSQF
                     RSMGIEPQIKVLGFQAASQLRFQDNLKHPFFIYPNEEEYTGSTRTFAALLNSCLKYNR
                     HALALCRLRSNHVPEFCVLIPQEEKTSSNGQEYPPGFHLIILPYKDSIRPPPKKVAEF
                     LQSPPIATDEQINAMKAVIKRTRFKAAAYRPEIYPNPSLAYHYDQLQALAFEEDWDPE
                     DPAKQALDKTMPLYGGMHSRAGEFMEEFNKEIENDERAVEKLAAPTKRGKAEKETTVN
                     EWDLRNIPDMWKKGTLSQCKVQELKDWAKHYHVPLQGKTKKADIIDVVSEHLSTSEDD
                     LAGASSKKAKK"
     gene            975590..977888
                     /locus_tag="CNI03630"
                     /db_xref="GeneID:3259422"
     mRNA            join(975590..976019,976071..976162,976210..976910,
                     976955..977431,977484..977888)
                     /locus_tag="CNI03630"
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-bisphosphatase bifunctional enzyme, putative"
                     /transcript_id="XM_572601.2"
                     /db_xref="GeneID:3259422"
     CDS             join(975628..976019,976071..976162,976210..976910,
                     976955..977431,977484..977798)
                     /locus_tag="CNI03630"
                     /codon_start=1
                     /product="6-phosphofructo-2-kinase/fructose-2,
                     6-bisphosphatase bifunctional enzyme, putative"
                     /protein_id="XP_572601.1"
                     /db_xref="GeneID:3259422"
                     /translation="MSIPPPPPPNKSPSSSVSPSKSRSPKLKPLTPTSEKPSRTNDDG
                     QVYQPVEPHVLADAVSKLDMIRSAPAPMSTVTSPAASAAPSGPSSPRLSGVGQGPPST
                     GSWAMDHTASGDGRLSAPGTPHFGASTALLKTLDETTKVIRQSSRAPSRAPSVSGIGT
                     VVEKPDYSEAKIVVAMVGLPARGKSYLSNRLMRYLRWLEYNVQVFNVGQLRRSKARSA
                     LQAGQGKVDHSATYFSHSDAEATKKREELAEESLESLIAWLKKEGNVGIMDATNSTID
                     RREKIKKRIDKEPGLQVLYLESFCDDPVVIATNIALKVRSGDPDYQGMSKEDAERDFR
                     KRIAQYESVYQTINEPNIPFCRILNVGQRVTINRIEGYLQSRIAFYLMNLHLKPRSIY
                     LSRHGESMYNVEGKIGGDSDLSPRGWEYARALPALIKDNIGGGPLEVWTSTLQRTQQT
                     ASYLPFEKKTWKSLDELDAGVCDGMTYKEIEQKYPEDYESRDDDKFNYRYRGGESYRD
                     VVVRLEPVIMELERQNNILIIAHQAILRCLYAYFQARPQQELPYINIPLHTLIKITPQ
                     AYGCQEERYPLPIAAVDTHRPRPSKGRNTAGISVAEGTSMADQPVKRDYYGDTQQGVG
                     YGLKPEAISQALENEMEQGKLTPRAAGGAQLHHE"
     gene            978087..980983
                     /locus_tag="CNI03640"
                     /db_xref="GeneID:3259393"
     mRNA            join(978087..978205,978263..978582,978634..979159,
                     979214..979328,979378..979817,979873..980361,
                     980415..980764,980817..980983)
                     /locus_tag="CNI03640"
                     /product="cell cycle-related protein, putative"
                     /transcript_id="XM_572599.2"
                     /db_xref="GeneID:3259393"
     CDS             join(978134..978205,978263..978582,978634..979159,
                     979214..979328,979378..979817,979873..980361,
                     980415..980764,980817..980913)
                     /locus_tag="CNI03640"
                     /codon_start=1
                     /product="cell cycle-related protein, putative"
                     /protein_id="XP_572599.1"
                     /db_xref="GeneID:3259393"
                     /translation="MPKPKTARGILLTSNLPQLQNLIKRDPEGYKEEFLTQYNHYLSL
                     LRLHSVASSTPSSSNDKSNELFADLITFISQVAQCYPEATKDLPMQLSGLLLGGESGT
                     SNVVTGDLRKTAVKNLVMLRNKEIIDSIQLLQTLLPLLPTVPSTLRSIIRHTILTDIK
                     TSNAKTKNHRLNRVVQSLLFGMVESGMGAEVVGDKGRNKGKGREKGGEAMWAVMMVKE
                     LWRKGVWTDAKTVSIVSLAAFHPNTKVQSAALHFFLGSENEDEDDSEDEDEVGEARRD
                     VRKMEHRMEVSRGKRKKEKQVKQLKREASKKRKKRAEGAGVTPNFPALELLQDPQTFG
                     EKLYDNLHRHDKIYSLDHKVLIMQLLSRVMGVHKLCVLGFYSYIIKYLTYHQLQVTLI
                     LVSLAQSVHDLTPPDVLTPVIRKLAQEFVHPGVGAEVIAAGLNAIREVCRRQPWCMEE
                     DLLGDLIEYRKSKDKGVVTASRGLLQLFREVNPGMLKRRERGKAASMGLIGSQVLAYG
                     HSADAAEGIEGLELLEEHYAKLRKEANGDVGDGSDVEMDVGEDDDEGWEGWEAESDSE
                     ADSNGWESVSSGGEDLEISDSEDESDKRRDKKDKREKKRLARGKGKAKAEDGETDEDE
                     EMDDAVSVAATEATEASQTTKKLSLLAQQRILTPADFELLNELRLKAAKELAAAGGGS
                     AAKRKLAALEASKRHVGEDEADRFLTEAEILGPRKKAKATWEERMESIQKGREGREKF
                     GSMKGKKKKAAPSSSTNKEKAKNKPIMMALHSNRVVSKKKASLRDKQIRLRAAIEKRK
                     KQKH"
     gene            981492..984171
                     /locus_tag="CNI03650"
                     /db_xref="GeneID:3259664"
     mRNA            join(981492..982567,982616..982900,982952..983056,
                     983115..983264,983316..983414,983475..984171)
                     /locus_tag="CNI03650"
                     /product="protein phosphatase, putative"
                     /transcript_id="XM_572886.2"
                     /db_xref="GeneID:3259664"
     CDS             join(981572..982567,982616..982900,982952..983056,
                     983115..983264,983316..983414,983475..983681)
                     /locus_tag="CNI03650"
                     /codon_start=1
                     /product="protein phosphatase, putative"
                     /protein_id="XP_572886.1"
                     /db_xref="GeneID:3259664"
                     /translation="MPTTHTEPSTEAPAMSPQNTTPGPAHTTSIDHNTATATDTQQPS
                     TGLQPSILPPVATPTTQHPVSAAEMTKDGGATAAQPSTAQTTLPESGTTSTAIKSTEG
                     ETGKGTPLENLSRRLSNKTPSTTASSAPQTTAEKADPKPASSHTQPTTSTSKTTVNTP
                     ASPSVNGATKSKAAPISNTTAPKAGQKKKRKRKGLAGILLALGCLSVDEFEEEPSKSS
                     STTASTGPGKSAGAGATTGTSTKADVSAKPTSGGVGVSSGVAKAPNGSVAPAPSDPSA
                     AKIQDATVGAEQKVDATGPTDSTVVAEGPTEAHKGVVSSEQVVVPPTEPHTLPEDETA
                     GVTSSAVQPPGGGSALLGTPSKHVSHRESETNLGTSSNERTETSGGYSDISNSEMVDE
                     STGQGGDELGEDYLEYDDEEDRLIEQGGIGIPVDENGNPAPLLPPVAAKHRGRKCLVL
                     DLDETLLHSSFKQLPTADYIVPVEIESQVHNVYVIKRPGVDHFLTEMAKIYEIVVFTA
                     SLSKYADPVLDMLDENRVVAHRLFRESCYNHKGNYVKDLSQLGRDIEHSIIIDNSPAS
                     YIFHPNNAVPVSTWFSDPHDSELTDLCPFLADLATVDDVRGVLDGRI"
     gene            complement(984120..986989)
                     /locus_tag="CNI03660"
                     /db_xref="GeneID:3259425"
     mRNA            complement(join(984120..984450,984515..984583,
                     984640..984865,984921..985129,985182..985309,
                     985365..985694,985744..985952,986014..986196,
                     986277..986989))
                     /locus_tag="CNI03660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657872.1"
                     /db_xref="GeneID:3259425"
     CDS             complement(join(984429..984450,984515..984583,
                     984640..984865,984921..985129,985182..985309,
                     985365..985385))
                     /locus_tag="CNI03660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513549.1"
                     /db_xref="GeneID:3259425"
                     /translation="MYDGPGACGVFRAFQGWTSMSDTCPTEGTLKIYPLIKELTAYTM
                     MRPLFREKQSRAELPREEYLSASNWELDFETSRFPNSPIARSQEYNDETHPHLELGRT
                     MISIPRVKPGDQAWWHGDMIHSVESMHKGKGPSAVLYIPAVPLTPQNVDYIRDQKRLF
                     MEGRPAPDFPGGVGESQFVGRGKMEDIESIEGKQAMGLEPFDVSGQLTPGERHILEQA
                     NKVLGF"
     gene            987135..989507
                     /locus_tag="CNI03670"
                     /db_xref="GeneID:3259404"
     mRNA            join(987135..987360,987457..988108,988163..988762,
                     988814..989138,989194..989507)
                     /locus_tag="CNI03670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572894.2"
                     /db_xref="GeneID:3259404"
     CDS             join(987155..987360,987457..988108,988163..988762,
                     988814..989138,989194..989447)
                     /locus_tag="CNI03670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572894.1"
                     /db_xref="GeneID:3259404"
                     /translation="MSMNKESLTDEEAIQLRLQLGLSAPGAAAADGGEPPVDTDAIAE
                     ENYAQRKAEMKREKEERELKERIEKARNKSALNAKLKGTTLSAPSTDDSLDAKTWIKK
                     QKKREKQRAREIAAMQARDKEEQDRLMYGEEDLAGLKVGHGVEEFEEGEDVILTLKDT
                     GVLEGGEDELQNVNLVEDAAIKAAKERKRKAQQAYTGYDDEEFEENRIGKRADVLGKY
                     DEDFATGKVRTEGFRLGAPVEKKMKIQDEDEQMGIAPARKVKLNLDYTKEFEVSDYAK
                     EGEAGFKKPKKKKAKRSIRRTEAEEDTMEVDGEPTFTRRVVTEGPDNLVDDEDLQAAL
                     SRARRANAKKKPKVKPEDVAAQIAQRKQEEGEQVKEEDGEEDGRITFDETSEFARNVS
                     LESRAISVKRERISPPPSGITPAADSGPSEEPVVVKIERREEGEVDDEDDEMGEEEAD
                     LAEIAAREGMSLEEYREKIDRQMREMEEMKKEMKDESELEPTVGQGVAGVLALLRHQG
                     ALKARTAEDEERERVQKQKDLWLADYRRRMAQRELERIQARGGNKDQAQREWENRMRE
                     QQEARDALDIYKNYKPDVNIAYHDEFGRQMTPKEAWKSLSHKFHGKTSGRMKTEKRLK
                     KIAEERKQLTMNSSDTPLGMTDAFSRRQQMTGEAHMVLSVGNKQSVQAGSSKRR"
     gene            complement(989475..995726)
                     /locus_tag="CNI03680"
                     /db_xref="GeneID:3259423"
     mRNA            complement(join(989475..990313,990366..990577,
                     990629..991967,992027..993135,993200..993744,
                     993801..994799,994848..994910,994960..995123,
                     995175..995280,995331..995390,995446..995537,
                     995606..995726))
                     /locus_tag="CNI03680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572939.2"
                     /db_xref="GeneID:3259423"
     CDS             complement(join(989592..990313,990366..990577,
                     990629..991967,992027..993135,993200..993744,
                     993801..994799,994848..994910,994960..995123,
                     995175..995280,995331..995390,995446..995537,
                     995606..995675))
                     /locus_tag="CNI03680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572939.1"
                     /db_xref="GeneID:3259423"
                     /translation="MSFIGAGELEHKITQLQRQLSHKDHELNSIKNEQMKKQENLEEA
                     KRAKQTAEYKLRDEADRALKAENDSLAKTNELAQLKLKLSNLEASLMQTSEKLKKEEK
                     EKANIQDALDEALSRGSDGAATQIKSQQARIKQLEDNLRKTEDEKDRLRHQASSGDSW
                     GSDEPLSHRERNRLMALQNENAELKTKLESLSPQNVTTSDSFNPESPQKSSKPRASVT
                     AADLRDLETQVDKLKTQLANTKREYDKAVNEKLAAEISARKTAERFENEMYELNGELE
                     YYRRSDGGVDMKQLNELKKTAQDARAEKEELSKKLAQKEREVEHHVSEMARLEEKAQL
                     VQKLKEELEEERQTRQQLEAASNSASFVDEASLAKINALEVELARSKAASSTTAGSRS
                     GDSELRQVRRDLQKALRDKEYLESLVKENDELLAEKDEELARMRAAVPLPGSPSLDSQ
                     AADPGLVAALEEEKAALIDDLEKQVRAHEEGTLRIEAQLAEKTKELEVLRESEQLLRE
                     QHLRGQTEIESIKAQHQFVIVDLQKARDDLSIKEANAQQIIEQLAQVQASLNEHQAAA
                     ISAREEAASTAKQLTELGVSLENKNRELEEVLQQRRALEVSLASRSHDDAEFDEHVLS
                     IKKLQDEISRVSQELSDRTTANAQLINRLAVAEETREASERMVQELEHKVSDSQRKVE
                     ISMEELEVHRAQSKEAIESLNTQLETLNTELTSLEQLVRDKTTELAEVNRLSEQTSCR
                     LAESETTVITLRNQVAELECKLDESAAENVSENDDERIQLRKEKEALEEALQLAKKEH
                     ESELAAIEADSQKALSNAQIHIDTLQNLIQDAPQPNTKDVDVIHKFEEKIGRLRIERD
                     ELRHNISFVQNERHFAVRAANAEKETAIEEVGKAREELKRTSAICERLQQEMEEFRAA
                     LAEKDVEFGDAIATTREVANEKEKLAKQLADIEHELSSSHEAVSTQQTRVFELESQLQ
                     AQEANLKQVEARAGLLQTELTNVLHHMAQSKKLSDRPESRASVPEEEDSDLPKDLAGA
                     VSSQNRRHSHRRSTSGMSITMLQNLQTERNLQAKIDRRDARITLLTNDLSKVQANLTL
                     LQSAQEETMAENAELEEEREKLLSELHEIKAQGADPEALQGCILALILHHRHVRNLES
                     QLRLAREILHKSRETERQLFVSEIEAKKKKVADDKRIAELEYEKTEVESQLNSAKANE
                     QLVRKELDDALASVNNLQSQLTKAESASVLAAESILSLATVEAQIAEKEERIREIEAH
                     NTELVSKLEKLEEELTANKLEKEIKTEALTTKVVELEQKMVDRGAELERMTQEKEQLL
                     EELTAAEKTLADGFADVEAQREALDTTRRELEERLALMGHDMKEKSSELEEMINKSNA
                     LAAELAAERSKSDQAGIALEEHQVTISQLQNDISALQKASQDVDSERQTLRAQISVFE
                     EKATAAEERIRQLQAEVGHCMGETERVKKELVDASSQLEKTMVEKEDLNARRTAEMEQ
                     ATEARMGMEKSLSEREQEISKLTRDLGIIQEELTAATSKLEQAVKESAFKQADIDNLR
                     AENVEVKQKLAKATISSVSSADEQLVADLKERIEDLEASLTQKNQEVDEADDQTREAF
                     KANVKLERKIGKLQRQLDQAQLELNTALNKLMSSQPIALAPVARSQPASSVAAQRTAM
                     PPPPMSTSAPTQSPALALSTAATRTPHTIPPNIFSPPTVPSSGQKRLREADDAEFAHK
                     PAEAIMLPPASVISPRKPFGTRPSFTPQRGISDKTYASKPIGVNANMTSEKAEEGLKK
                     PIDAGRNIFARSPSVSSDPIKRTGFPEPPTRTPFATMPRNAS"
     gene            996214..998107
                     /locus_tag="CNI03690"
                     /db_xref="GeneID:3259512"
     mRNA            join(996214..996440,996611..996778,996826..996856,
                     996914..997002,997058..997284,997343..997443,
                     997496..997635,997702..997801,997855..997887,
                     997943..998107)
                     /locus_tag="CNI03690"
                     /product="2,4-dienoyl-CoA reductase (NADPH), putative"
                     /transcript_id="XM_572896.1"
                     /db_xref="GeneID:3259512"
     CDS             join(996420..996440,996611..996778,996826..996856,
                     996914..997002,997058..997284,997343..997443,
                     997496..997635,997702..997801,997855..997887,
                     997943..998028)
                     /locus_tag="CNI03690"
                     /codon_start=1
                     /product="2,4-dienoyl-CoA reductase (NADPH), putative"
                     /protein_id="XP_572896.1"
                     /db_xref="GeneID:3259512"
                     /translation="MTETASSKRRVVLMEERTTELYKLRGQVLEGVRARAQEPQKKSD
                     RLRGKVGIITGVGPETGIGTAASKLFAKEGIEHLYLLDYNDKGLPELVSYLKEHYPRT
                     KVTFVKGDAADHKAVSFLVDRTLEEEGHLDLFFANAGISQITKPVKGKSGNIMSFSQP
                     FKDVEEAEFNEIMRINALGVFVAIKYASIAMAKLCPEKGKSIPGGSIVLTASIAGLKA
                     NAGPIPYSASKAAVISMAQTAAYALTGLNIRVNAVCPGLIETDMTKPMFDFARASGND
                     SKIGQLNPTLRQGIGHEVAQAALFLVSDESSYVNGQALPVDGGLSASVPYVRSKI"
     gene            998227..999566
                     /locus_tag="CNI03700"
                     /db_xref="GeneID:3259635"
     mRNA            join(998227..998461,998517..998585,998636..998885,
                     998939..999039,999095..999272,999331..999566)
                     /locus_tag="CNI03700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657873.1"
                     /db_xref="GeneID:3259635"
     CDS             join(998312..998461,998517..998585,998636..998885,
                     998939..999039,999095..999272,999331..999482)
                     /locus_tag="CNI03700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513442.1"
                     /db_xref="GeneID:3259635"
                     /translation="MPYLTEEQKQRWKEDGYLVLPSFFTDEETKDMLNEAKRLCGEFD
                     IEGHPMTTFKTAADDAHIGDEYFLNSGDKIRYFLEPSSVTPATATTPAKLLVPPAQSI
                     NKIGHALAVLNPVFRKYTLETPKMSNLAKELGEQESPRVLQSMVICKQPRIGGVVPCH
                     NDSTFLYTDPPSAIGAWIALEECTPQNGCLSFLPGSHRLSRTSTRFVRAPNGGTTFVD
                     VPGVEPNTENWDEMEGWKEAACPPGTLVLIHGSVMHKSPPNPSDKSRLIYTFHMIEGG
                     KGVKYDERNWLQPTKEMPFPALF"
     gene            complement(999543..1001955)
                     /locus_tag="CNI03710"
                     /db_xref="GeneID:3259752"
     mRNA            complement(join(999543..999754,999843..1000077,
                     1000156..1000314,1000378..1000499,1000554..1000687,
                     1000741..1001042,1001105..1001371,1001428..1001479,
                     1001535..1001576,1001633..1001692,1001758..1001781,
                     1001847..1001955))
                     /locus_tag="CNI03710"
                     /product="thiamine biosynthetic bifunctional enzyme,
                     putative"
                     /transcript_id="XM_024657874.1"
                     /db_xref="GeneID:3259752"
     CDS             complement(join(999607..999754,999843..1000077,
                     1000156..1000314,1000378..1000499,1000554..1000687,
                     1000741..1001042,1001105..1001371,1001428..1001479,
                     1001535..1001576,1001633..1001692,1001758..1001781,
                     1001847..1001915))
                     /locus_tag="CNI03710"
                     /codon_start=1
                     /product="thiamine biosynthetic bifunctional enzyme,
                     putative"
                     /protein_id="XP_024513440.1"
                     /db_xref="GeneID:3259752"
                     /translation="MPKPTLDYSLYLVTGRELLPPGKDYYESLEESLQGGVTLVQVRE
                     KYADTGEFIEVARRTKAICDKYNVPVLINDRIDVHLAVGTAGIHVGQTDCPIGLARSL
                     VGPDAIIGLSVSNVNEAKRAIQQGADYVGIGAVWPTNSKDVANKKMLGPDGVGEILDL
                     LHGTGVQSVAIGGIHLPNVAQLLHASIAPQSRNALDGIAIISDIVASLTPREAATNLR
                     EVVQSFKRARSQLSNLEAVYGTNLFSGPRGVDGFIKEAVHLMDVIKRETPLINQMTNN
                     VVINDSANVTLAIGASPIMATHPRDVHDLSPAIGALLINFGTITDKAGMLVAGRQANI
                     NRKPIIFDPVAIGATPYRQETSVELLSHWQPTIIKGNAGEIGFMARSTEVASRGVDSV
                     GSGFSRPGAVVKALARKQAAIIVLTGEHDYISDGSTTLKISNGHHYLERITGSGCQLG
                     SVIASFAATARLEHLAKHGEWENASQLVQGDMLAAAVTGVLVYTIAAEVAAAREDVKG
                     PGTFRAALIDELYNLTPEVLQQRAKVEIL"
     gene            1002150..1005474
                     /locus_tag="CNI03720"
                     /db_xref="GeneID:3259766"
     mRNA            join(1002150..1002552,1002604..1002782,1002838..1002908,
                     1002958..1003307,1003367..1003467,1003517..1003647,
                     1003722..1003879,1003949..1004650,1004738..1005003,
                     1005063..1005474)
                     /locus_tag="CNI03720"
                     /product="expressed protein"
                     /transcript_id="XM_024657875.1"
                     /db_xref="GeneID:3259766"
     CDS             join(1002246..1002552,1002604..1002782,1002838..1002908,
                     1002958..1003307,1003367..1003467,1003517..1003647,
                     1003722..1003879,1003949..1004650,1004738..1005003,
                     1005063..1005311)
                     /locus_tag="CNI03720"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513439.1"
                     /db_xref="GeneID:3259766"
                     /translation="MIFPQSQSFTHLSTFPLPSKHYLHPKACNPAMDLIVLLSSYPAP
                     TTAPAPTPMQLHMMRMRGLGGNLKDEGKTKVSLWRTGGDKVWEIDVGGRVTGMAWMED
                     GLHLSLLVINSSKKTTETLSVHSGEVARSVPLELDVPDLQDGQWLDMEYRDSGLRWEK
                     PLNGSAPMIIDSLPRVTPVEPPKPVNVLPFMRPKEQVAPKPTLHPRLISFPALLPANP
                     PTPPTVLHIQPGHASSISLLTGTFQLPSIPSAELLSLAQVSDRITGLLDIVLRGLESA
                     EAAFRDGEKQTMIHREDLETCAKQQGTSIPDVYADLFRFLMTGRTGVAVSEWLGSRMT
                     PRTIAKWESTMDSSYRTIQKLISESITPALERILLLLEEIKGWSLTRRYIENLNLGSS
                     SAIQRCMDLVSGLGKLVEGMRVRAKHEWMAASEFMKWLKYEASRTTIQDRSTDDYPYA
                     VHDLKYVWAFMENGFIRPPFRRHFPELIERERPPQDLLPEEFISRLGVKPEKRLLSEV
                     LQETLTCLKKPPGSGSGCESQVMTSQSDRQSASQSISMSLTAAEDDSLFHDESGVANL
                     SLSSSVDTVAAPKDDLAHREGEEGEKTVARTLEEEPWVWANTVVEKCEELVKNAAGKE
                     SRDVERPDRGVKEWAGMKDVRVVGGGGTWMALLSANSNDNEQMWIIYDHPEEPARITA
                     CQLHSEEESATCLAIQFFDDEELVLLLEETESGQRYLVTVRYADLLEDMSIVPEDMGM
                     WDVSMLVEMGKREVTELPAIPIARCRPLATRHPQTVSVALNGRKGRRLGCILVETEDD
                     RQIEVLDLDADEDEEEEGEEPEEEDGIEYGGQHWDGDVV"
     gene            complement(1005343..1006071)
                     /locus_tag="CNI03730"
                     /db_xref="GeneID:3259546"
     mRNA            complement(join(1005343..1005477,1005532..1005795,
                     1005846..1005925,1005973..1006071))
                     /locus_tag="CNI03730"
                     /product="expressed protein"
                     /transcript_id="XM_024657876.1"
                     /db_xref="GeneID:3259546"
     CDS             complement(join(1005387..1005477,1005532..1005795,
                     1005846..1005925,1005973..1005975))
                     /locus_tag="CNI03730"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513548.1"
                     /db_xref="GeneID:3259546"
                     /translation="MPPKEASIHHVTFHFYRSAVLLSLPNTTTFTSLKSSLLPALQPL
                     AQTLPISLPASPNDIQFWEFTNSSSAGEEGDAAAAGAAGEQKTLRCLENDPGIAGRDI
                     KQLGWPRWKAILVSFKGEDGSFKEPIYTIPDPDDDYGGSEAEA"
     gene            1006053..1008192
                     /locus_tag="CNI03740"
                     /db_xref="GeneID:36393044"
     mRNA            join(1006053..1006650,1006700..1006750,1006806..1008192)
                     /locus_tag="CNI03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657877.1"
                     /db_xref="GeneID:36393044"
     CDS             join(1006153..1006650,1006700..1006750,1006806..1008005)
                     /locus_tag="CNI03740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513438.1"
                     /db_xref="GeneID:36393044"
                     /translation="MQPPASPARSPFPTHLSDVAIWGSSNDRGPSTDSSELARTDSFV
                     RRRHTPLGSGTSLGEAAGRSTPSLLSDSATVPGPSRRRPSRTLSSTPSNEHPLSYASS
                     PPHHPQTLADTRPALQRATSATERQVAESSRSGSEWGSTRGSLDVLRMSSMDESSGEV
                     EVLIHTVKPHESLAGIALLYGVDLATLRKVNKLWASDPIHIRTHLYVPLDACRWNKAS
                     ETLVRGPGEGQVTLMPKNVRDKGKGKETDEFLAAGGGEQRDDLWFSQGVNGDSPHSFL
                     PCTNIAYDHPTLPTIPPPIPHPNDPTLDPPINSTPEPTPRVLDVVRIPSSQLRFFPRA
                     RPSEPSSRASTEQDRPSPPGGNTHPDDNDEDGNDLSNALRRASITLNANRSDGNGPSI
                     VPNLFTLPEPLRPPPSNFSLPPAKPSHTRSKSTTVVRLRPPQPAPIQTGNNSSLANRL
                     SSFFTVPPPPTNMSPISGPSSAGAGVGVGVGAGSASGRLPQGKSRRSLESTGSHRTAT
                     PKSATSVTRRGSGIDPGTSTGKAGREQREEMELVTRVREGVGSGMGMGSLGERVGNGF
                     GARKYVVKGKKSQKND"
     gene            complement(1008162..1009362)
                     /locus_tag="CNI03750"
                     /db_xref="GeneID:3259526"
     mRNA            complement(join(1008162..1008391,1008474..1008588,
                     1008658..1008733,1008807..1008886,1008956..1009362))
                     /locus_tag="CNI03750"
                     /product="expressed protein"
                     /transcript_id="XM_024657878.1"
                     /db_xref="GeneID:3259526"
     CDS             complement(join(1008311..1008391,1008474..1008588,
                     1008658..1008733,1008807..1008886,1008956..1009314))
                     /locus_tag="CNI03750"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513547.1"
                     /db_xref="GeneID:3259526"
                     /translation="MAIPHTIQEQHPADPLLLLPIPEKLPPLPLPALPSLISAFEPYI
                     DPSKASSSSENEAIALPVLVSSMRQITRNAQVLLNAARLGAAEAREELDGVDVRLREV
                     EYERNRIREETERCMNYESSREPIDLPDVETFLASVDQSVLNTLPPKDDEGYEHALTI
                     LRLEHELEEILKREAQVAQLTKDRDAYIRAKKEIKIKTDAVDVHLAGFARTANAVGSK
                     VKDVADVHAPSVSGPSTS"
     gene            1009510..1010243
                     /locus_tag="CNI03760"
                     /db_xref="GeneID:3259707"
     mRNA            join(1009510..1009660,1009753..1009862,1009931..1009992,
                     1010059..1010243)
                     /locus_tag="CNI03760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573017.1"
                     /db_xref="GeneID:3259707"
     CDS             join(1009527..1009660,1009753..1009862,1009931..1009992,
                     1010059..1010205)
                     /locus_tag="CNI03760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_573017.1"
                     /db_xref="GeneID:3259707"
                     /translation="MPRLVPSFSSLPKTQPVQGYKHFLTPLRKLIFDYDAESPSQHGI
                     RSYIRKPLLDMARENPDVEIVVRRLKRGKAAVLRGHYVNGRDKVICVNKLEANEVANK
                     VGLLLNSSGAKIKHLKNLTLEAAPGAESARGIWSALHDKTRDGKGYQI"
     gene            complement(1010292..1011392)
                     /locus_tag="CNI03770"
                     /db_xref="GeneID:3259369"
     mRNA            complement(join(1010292..1010788,1010852..1010959,
                     1011018..1011096,1011183..1011392))
                     /locus_tag="CNI03770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572589.2"
                     /db_xref="GeneID:3259369"
     CDS             complement(join(1010384..1010788,1010852..1010959,
                     1011018..1011096,1011183..1011337))
                     /locus_tag="CNI03770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572589.1"
                     /db_xref="GeneID:3259369"
                     /translation="MSKQLIVFDFDWSFVDQDTDRWVFEVLSTELRRLLQSRKSAGTG
                     MQCTPDVVNDTMKDLYEKGFKKEDVLEALRILPVHPAMKRAVTSLKQRSAETTFLCLS
                     NSNEVYIGTILEKHGLTDLFSEIITNPAHWSEEAPDHLIIGRRLPASEPPHGCSVGCL
                     ANMCKGDELDRYLAANGGKDAFKKIVYVGDGGNDFCPLLRMRQGDLALVRKGLELDER
                     VKKEGEQCGLKVDVKFWEQAWQIDEYFQEL"
     gene            complement(1011552..1012402)
                     /locus_tag="CNI03780"
                     /db_xref="GeneID:3259582"
     mRNA            complement(join(1011552..1011669,1011730..1011738,
                     1011815..1011919,1011983..1012048,1012118..1012180,
                     1012301..1012402))
                     /locus_tag="CNI03780"
                     /product="expressed protein"
                     /transcript_id="XM_572628.2"
                     /db_xref="GeneID:3259582"
     CDS             complement(join(1011601..1011669,1011730..1011738,
                     1011815..1011919,1011983..1012048,1012118..1012156))
                     /locus_tag="CNI03780"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572628.1"
                     /db_xref="GeneID:3259582"
                     /translation="MVYVIVVHLQSLPEHVEEIKAKLKEAAEVYRKDKETIDWHVMQD
                     PKDETKFCIVERYEQESSQQYHLSNPYWKTFDPYVVPRLARPMDLTRWEEF"
     gene            1012603..1013901
                     /locus_tag="CNI03790"
                     /db_xref="GeneID:3259424"
     mRNA            join(1012603..1012791,1012857..1013011,1013072..1013357,
                     1013426..1013517,1013587..1013654,1013730..1013901)
                     /locus_tag="CNI03790"
                     /product="2,4-dienoyl-CoA reductase, putative"
                     /transcript_id="XM_572626.2"
                     /db_xref="GeneID:3259424"
     CDS             join(1012628..1012791,1012857..1013011,1013072..1013357,
                     1013426..1013517,1013587..1013654,1013730..1013834)
                     /locus_tag="CNI03790"
                     /codon_start=1
                     /product="2,4-dienoyl-CoA reductase, putative"
                     /protein_id="XP_572626.1"
                     /db_xref="GeneID:3259424"
                     /translation="MSPPPPLTPDPKSTFRPDLFKGKVLFCTGGRSGICYQIVETMMS
                     LGVDAAIVGRDAKGLEESAKKLEASTGGKCIPAPADVRQPDQLKDAVKRTQEAFGRID
                     FVICGAAGNFLAPISGLSERAFRTVIEIDLLGTYNTLKATLPLVRASRGSYVHISATL
                     HYRGVPYQSHVGAAKAGVDALNHSIAVEEGPWGVRSNVIAPGPIAETVGMDKLGTKGR
                     KVEREVPLGRLGSTVDIANAAVFLFSPASAWITGATLVVDGGEHHIRSTMLPYPESLL
                     DPESVKSLIKPRL"
     gene            complement(1013943..1016247)
                     /locus_tag="CNI03800"
                     /db_xref="GeneID:3259625"
     mRNA            complement(join(1013943..1015289,1015340..1015656,
                     1015726..1016247))
                     /locus_tag="CNI03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_572959.2"
                     /db_xref="GeneID:3259625"
     CDS             complement(join(1014036..1015289,1015340..1015656,
                     1015726..1016191))
                     /locus_tag="CNI03800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572959.1"
                     /db_xref="GeneID:3259625"
                     /translation="MPTQPPPTPWLPNTRFADQSLLLDAQPIFDVSFDDESMWGGETM
                     LVDNGNKTQENKNLEASDNVDAGDEATMNMTLDLGDYLPDEVDQKEVRQKDKTVSQGS
                     NRKRGLSEISTSAISTSTTISDSSTSSATATSRLAHKREGSPTPLSVAGPSKRPRRPK
                     EKNDDLFSRRLSDSNRRSSLTPIPQISIIMTPSSVVKTQEETRLKANKAPTSSVAFAS
                     SSSQPYNQSTTSSNTASARLKARLHADGSKSEPSNNSTSHHAQQPESSRPAQTVSEKS
                     SALSRYLAKSTVLAAKESHEVPAEKGNQKVPNPSATESSHTQQSSVPLPNTSQLQTVT
                     LTPQPYDNGEPAPDVPHNGSLKRRESRRSSIGEKVVNFISGLIRPATPATVEIYPKGQ
                     KDEEQTKEKLLFDPLKVAPTIDEKERVEATVSQSGRIRRKESEGVSHVRTLTKPVPFS
                     RPLHVRAPPQRDVEAKEQRAKQQPLVAKATVVAISKVPSRGPLQPSRTQPNTKPVSKT
                     GPSSPNSKNNPPHLRPASTSAFASAALAKLPPPGKGHKVAAEPIKVRDVEKIHDIAAV
                     RGVFERLSSTSSSLNRPPTTESCTKSHANRPGVLQRTVPIRGHTPGKSSALRAQQRAV
                     FDQAVKEKMEEKEKKEAEERQRKEMEEEMEYRRRRKETVIRANPVPDMYRGRRQ"
     gene            1016431..1017299
                     /locus_tag="CNI03810"
                     /db_xref="GeneID:3259624"
     mRNA            join(1016431..1016528,1016589..1016762,1016823..1016876,
                     1016933..1016975,1017034..1017299)
                     /locus_tag="CNI03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657879.1"
                     /db_xref="GeneID:3259624"
     CDS             join(1016505..1016528,1016589..1016762,1016823..1016876,
                     1016933..1016975,1017034..1017056)
                     /locus_tag="CNI03810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513453.1"
                     /db_xref="GeneID:3259624"
                     /translation="MVCKKCEKKTSTLATTDPFQPASSTRKIGENKLLSARAKAAPYT
                     KPGQGSKKGSINPYGNKCIDCKQSVQQNNATRCQKCAYKKGLCAICGNLILDTSRYKQ
                     TAK"
     gene            complement(1017080..1024905)
                     /locus_tag="CNI03820"
                     /db_xref="GeneID:3259757"
     mRNA            complement(join(1017080..1017893,1017944..1018106,
                     1018174..1018249,1018301..1018454,1018502..1018785,
                     1018839..1019091,1019140..1019623,1019677..1020735,
                     1020789..1022430,1022487..1023646,1023701..1024301,
                     1024354..1024671,1024762..1024905))
                     /locus_tag="CNI03820"
                     /product="cytoplasm protein, putative"
                     /transcript_id="XM_024657880.1"
                     /db_xref="GeneID:3259757"
     CDS             complement(join(1017223..1017893,1017944..1018106,
                     1018174..1018249,1018301..1018454,1018502..1018785,
                     1018839..1019091,1019140..1019623,1019677..1020735,
                     1020789..1022430,1022487..1023646,1023701..1024301,
                     1024354..1024671,1024762..1024841))
                     /locus_tag="CNI03820"
                     /codon_start=1
                     /product="cytoplasm protein, putative"
                     /protein_id="XP_024513590.1"
                     /db_xref="GeneID:3259757"
                     /translation="MSSQQPYMASSYHSFRDSAPGPSRSQHVTGTWQPLPYIYSGFVI
                     YPFHPEVPPPTPTTLDETSPKLPPFVPQHGLDILPWSGGKPDLAGGDLYPQGERNPYE
                     IRLDIGDEFYAFEEYRCPIEEDGRGDLWYRGFVVQAVSITSLSPVIPSEAMSAQTVSF
                     PRPEPSVLTGIFPASVCHIRPGNENDTGELSIAYEKAIQAAEQRNRRVLEESDYNLRA
                     LGTGILSEMDTVKEEDEGYAGLVSKPQNFGLERGVVEVGSSEGRPVDALSRKGSKNSF
                     SKPNRPKSLVLEQRKTVIEEDKDQPPLPRLTAGDSTAGGQQWPLIDEIACAIREWYSR
                     LPTYLANREYRLFNTVTQHIDALSLGRRQLLSQMLSGDELVRVRRECVSRLVKCNVAQ
                     GLDVIVRNLEDGSVVVVDRERAYSGTKWVGGISCYVYQVRLAYIDVIPLDNVFAEVFL
                     TPQKAVFQSHTLTSSKGELSDLPAGSFYHLFLELRAFVANPCAPGETAELYFSLYNKA
                     DKRFISEEYCLILNHYGSPARDSEQRLGRIRTLFTDLKVEDLAPDTYLVCKIIRNGAM
                     KMRSDDSMLPASLSASVAGQRSSLYGISETGLSGHNQWRGDSLMNLTDDSFSVTSAYG
                     PETHRPPTTTGTTNAPSSTIGGGSGFGGKVRVRRPLGWAVMLLPPMSKLMGDGLDRDG
                     GGVEQSVKIYVPREEKDFAGMFDDVIHNRVKQYMDFSRAQSIVLYLKSLRGPAPQLVR
                     EHPSLLLDIPLTSRLSFPDVVFPGHSRHDLYIKLCSASFTSAPSSSSGSMRLKKNVSP
                     GYNSDVQVTMEMRKADGTVVEDAIMAGGSGEPGTSQWNSMVFHHNDKPVYDELVKIPL
                     PVQLSEYHLFLTFGSKSKNKQMTADEAEKPFAFTYLPISTANIFVKDDDHELVLYHMD
                     KNFQSTPSLYFDAPHSAKDWAHDPVLPDTILKGMSPLRDRVMIRTRLCSSVHTQDETL
                     RSLFAWQTATESENAIGLCEMLKMFGFVEEEEISRFVPQVLDSLFGILVTSLSERQEQ
                     LNDLVFKGMVKVLTMANDRRFPNFKAILHMYTSKQFHFPAASFQLLRSMKSVMALPHT
                     KDYRLFLKVWHLFFQFIIRSREQDRGRSVGADVTSAHIEAEFQSQIKHILKEINNLME
                     SPDKSLIGTQTLAVQHYANILPDLAHIFQPLEIAEIIIAFADTLSYATGSIAVYKLLL
                     LLQVVKNTFEMSESRRLLVPAIVRWLKPHLGRFDEYSGGMEPDQTAKDGRRMKWLECN
                     RLAVTGLAWMTDKLQQCYVSPQVQANEDVKRQEEDNLEYCLTLLSGLYSSYAELSNPR
                     TLDAFHRQRSSITSSIWEDTPDIFPTSYPFALISQLPPPSLFEAHQNANDSGMSASEL
                     FNCGLAECAVVIVNVILATPVDSIIRWIRETLEIEGAESCGKLFIHSFDFVKSVISFE
                     AFPSQWLTLRSMCFSGLLKLLECIATVMEDDIFVPSPPKSTGNSIFPSKIEGFDANLW
                     RKCFELLCDFCGSEELTLEDQTPQRRRAEWIISGDLREGGARLLLRLWNAVGWPLDIP
                     GGHALRMGGYQTKFTGLGSKVLELCQSGHDVLCETAVEILFSLIYAEHLLDKECTSIE
                     TEVFVTLDKLFTAEATPSSSDPTLKSYFVAELRNVFESSPEIHPSFTTKLSSFLSQAE
                     YFIDLLLALRDVPVGPLWHDERATAIYQLMNFVSAMGRKGLYVRYVHELVKNSKSVKN
                     WLGAGLALKLHADIYKWKVGDEHWVDAGRWGDLELPAHSEFARKQAIYYHILGYLAQA
                     EAHEFSINLCQELITQHQRLTYDINMITELLGHQAKLWMTIGEAPRPKQEYFRVAYFG
                     DILSLDKNKDYVIRAQVGQKYTDFCDILQTKYRQATIHRSKIPPPESIKRGTDPVIWI
                     MPVTPEPDLTNPVFGENVSDNVQSYWRWNGIRRFSSVRPYLKDPGERETALAWTEKTL
                     LITKDELPGVLCRGEIVNIRYEQIAPIAMAIMEIKAAIKSLQKSSRGENGRLPESKAL
                     GTAINNAVDSPVSERIKRYRELFIEGTYLDSHPEDCEEIQQLKTAIIQYVRAIQDSLE
                     VHKRICRDVAFYEILKNQLYKSFAEEAGFPSSSASSDDHFPSFPSFAPDSSDHGKYYS
                     STKSQPSISISFHRSSADRSFSDHREPNITSTMGSEGYNLPPLRIGRLPSSGGQPLTV
                     HSASTHTHTPRESTSTTHNTPSTPVRAGITTPTSPPFRTPSRTGSARKKDHRRSLTSP
                     LGPSELGHGKNRSVSSLSIRAKNMMRIASRSSGNVVAENDVDEEAPPAPAKEKGLKRF
                     GSLIRKTK"
     gene            1025050..1027498
                     /locus_tag="CNI03830"
                     /db_xref="GeneID:3259509"
     mRNA            join(1025050..1025093,1025139..1025407,1025461..1025487,
                     1025536..1025556,1025611..1025760,1025811..1026188,
                     1026244..1026416,1026468..1026498,1026566..1026754,
                     1026812..1026845,1026933..1027041,1027157..1027498)
                     /locus_tag="CNI03830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657881.1"
                     /db_xref="GeneID:3259509"
     CDS             join(1025068..1025093,1025139..1025407,1025461..1025487,
                     1025536..1025556,1025611..1025760,1025811..1026188,
                     1026244..1026416,1026468..1026498,1026566..1026754,
                     1026812..1026845,1026933..1027041,1027157..1027285)
                     /locus_tag="CNI03830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513537.1"
                     /db_xref="GeneID:3259509"
                     /translation="MPISKQFVRIAPLKATFTHTRFHLALRTVDHPVVYHRLLLFRIN
                     KPGAESSGSVIGQVSTGLSSWRAPELYCMEETCPHLGAPLSHAEIEDIEDTRAIVCPW
                     HQYDFDLKDGSSSTGLQACTYEVKVQGIEDEAEVWVEAPHTESFGTDADRQWELVEMR
                     GVSEEFLDPPIPSLASLSVSGHCSPSSLPPHLSHSAPTLPDPLPTSLLAFAHLILRTS
                     DPQLKCLLTREAVTRLRAGQLKSIRPTKGEIKRERENGGLVDEPPREVEIIAPGKTPR
                     RGKGGSEKSRILMLHALANIEQYAIDLAWDIIARFAHVEVNGERLPVEFFLDWAKVAE
                     DEAKHYTLLARRLVEMGSYFGAHTVHAGLWESATQTADSLSARIAIIHLVAEARGIDM
                     NPLTLAKLQAAGDVESSKVLEIIHADEITHVTTGHRWFTWLCAKQGLDPIATFRSEVE
                     ANFRGKIKGPFNAEDRLKAGLTPDFYEDLTGQLGWKEELVKRAEKAAREAEGDEHLHP
                     RLT"
     gene            1029541..1034985
                     /locus_tag="CNI03840"
                     /db_xref="GeneID:3259596"
     mRNA            join(1029541..1030498,1030564..1031115,1031172..1031290,
                     1031357..1032195,1032251..1032439,1032491..1032604,
                     1032657..1033107,1033158..1034392,1034446..1034985)
                     /locus_tag="CNI03840"
                     /product="cell division control protein, putative"
                     /transcript_id="XM_024657882.1"
                     /db_xref="GeneID:3259596"
     CDS             join(1031006..1031115,1031172..1031290,1031357..1032195,
                     1032251..1032439,1032491..1032604,1032657..1033107,
                     1033158..1034392,1034446..1034727)
                     /locus_tag="CNI03840"
                     /codon_start=1
                     /product="cell division control protein, putative"
                     /protein_id="XP_024513451.1"
                     /db_xref="GeneID:3259596"
                     /translation="MSISGPISRRRIGSVSQRGNESLPQLDIQSIQMPSNPQNALALK
                     TAALSTSTRSLHQICSILKKRLLCVDGFQPFLEQPPNAEPLDVVSHMCHLFRLGSPLC
                     HLYNLLIPSFVDPLSPLYADLPAPAKIEYDFPQFYDSSNGVRNWAKRPENAKPCQRYI
                     AAFCMAMKKRIEEGRWTSDMWALHELWGKSTGEDIEAYDSTGLMKVLSTVEEMLDNLP
                     VSAMSPISPQTPFAASGSIAQRAQSRQSYDLPFSMGGIGSGASAVANMAATMNGGVHI
                     EAGPSENSPTAVEMQRGLSTSLADANAFKSVEELVASEKSYVQELEILVRCSQEMLEA
                     QLVSTETNHQIFSNLSKILDFHRKFLIKLETEYEPIQERGPGAWAEGVWGRPFILSEA
                     EFDCYGPYCANYLDAITVVNEQMPILMRGQELSPTERPCLDPQRELQAFMIKPIQRIT
                     KYGLLLDAILHATAKHEYPFRPELEEASAAVKRIAAGINEVTDFKAKQATVRELIERV
                     DDWKGHDVDKFGSLHIDDHFTVTKADQPREYHVFLFEKMMLCCKEITPEKKKQNKNSS
                     MLRKDRGTSKSGPLDKKKLALKGRIFVSNIKEATILPSEPGDAYGAARLLIGWTIPLR
                     NQDGYHDDQEDSFVMIGKSEEQMRKWSEKVLELANNERKIQEDMRAARMKAGRLSNSE
                     RQYYQHSSFGPPTPATEHPPVSPFNMPPLPNGSTTPYYSEDEDPEGLRSGRTTPSIQG
                     YHPYAYSGQPSTGRRVQSQQSVTSVLPTELRARAMTEDQYGPSMTQWRTQQPTAPPLP
                     RLTSAMSGMSVASEISFGSGPGSTGIRTGMVRQMSSTRLPRATEVDEGEGNPMDTRES
                     YGRYGSLRGMMRAPSHAMPSVPHPPPLRNRSASSPNVYQQPTVTGAVSLPYTAGPNGT
                     WTTSPLASTLQMSTHPYVQSTPVPGFGPSSSTTLVGGTAYFNKRMSNEKRSSGESHHS
                     TTTTDTSDQTSPATPYGSGNGDVRGPLRQNSGDNVSGSVLVKLRFGNDQFVLGVSQEI
                     DFITLYQKIHKKIRLCSSSNRPANVHDKLQIRYVDNDGDEIQVKFDSDVELMFEDARD
                     QAGHINLIARWAEDRRGSPQGEIY"
     gene            complement(1035267..1038816)
                     /locus_tag="CNI03850"
                     /db_xref="GeneID:3259788"
     mRNA            complement(join(1035267..1035654,1035710..1035808,
                     1035859..1035929,1035982..1036229,1036280..1036341,
                     1036399..1037516,1037579..1037741,1037792..1037851,
                     1037906..1037934,1037986..1038171,1038232..1038295,
                     1038355..1038816))
                     /locus_tag="CNI03850"
                     /product="expressed protein"
                     /transcript_id="XM_024657883.1"
                     /db_xref="GeneID:3259788"
     CDS             complement(join(1035547..1035654,1035710..1035808,
                     1035859..1035929,1035982..1036229,1036280..1036341,
                     1036399..1037516,1037579..1037741,1037792..1037851,
                     1037906..1037934,1037986..1038171,1038232..1038295,
                     1038355..1038735))
                     /locus_tag="CNI03850"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513558.1"
                     /db_xref="GeneID:3259788"
                     /translation="MTATPPGRIALPPKPTITDILGGSSALASDTPSPQAHQSFNSPH
                     SSAVNGHSRGTIPRSKARTKSARLSFSSYGRGRAASSRGPAGGIVDDLLDDEDFGPKL
                     PTLVPGIRAAYATPLPALPMIVMCIAMLSELLAANLCTPFILKQVEGFFLNSGREKNS
                     ETEAAVGLWTGNLVSVFFITQFFTSLLWSSIADRHGRRAVLVASLAGSAIALVIFGTS
                     ESLPEAICVRLIQGIFGGAVGVFRGSIRDLTDDTNAARAYAMLGFSWGFGGVIGPIIG
                     GVFESPKENFPGTALAQIPLFQNFPYILPTIIGGGVLAVGAILSCLLSWDGGVRGGRR
                     ITLAVEKNEPLAGISPAAGRHASPAPSSRTAIRVPSVSLRRVLSPSQEEEDAAHGAGY
                     PELSRSAGGRRDSRASLGTAYGYGGIRSKHPTLAARAALEAARRASAAVGRPDESDEE
                     DGEMGNRALKVAQRLLLANEENTFNINDLWVSAAVAQDTAVFDDEEETEDDQEEEVNE
                     AVPDTSFASPSLHALSPSTYDGHQGDLSFRRSSRARLTSVGNISLHRNLPGHRLSVSH
                     GGRRFSTTSGHMPAIFSNTGVKTPPAVAAAYEAESPRHEADSFFRAASPSPDHGRGST
                     GGLSAIAEGPGNAVDSATAGVAAQISEKEASSFSLLPVQVIIQYGLLALHNTIHDQIF
                     LSFLVTPYRSGGLGLNPAHFSLVVALMCLCQLVYQFYIYPRLGPPLGRFTHLQMFRIG
                     CALYLPAYFSLPILHKIASPDSEGSFFLMFCLVTITAVRYCAGTFSYTSVMVLINAMS
                     PPHVVGLANGLAQSTVSFSRFFGPVIGGAVWSASINGNPSGYPYGFYFCTVACFIQWS
                     LSFFIR"
     STS             1039965..1041535
                     /standard_name="ha3112"
                     /db_xref="UniSTS:515652"
     gene            1040053..1043033
                     /locus_tag="CNI03860"
                     /db_xref="GeneID:3259508"
     mRNA            join(1040053..1042163,1042214..1042355,1042405..1042654,
                     1042712..1043033)
                     /locus_tag="CNI03860"
                     /product="chitinase, putative"
                     /transcript_id="XM_572898.1"
                     /db_xref="GeneID:3259508"
     CDS             join(1040267..1042163,1042214..1042355,1042405..1042654,
                     1042712..1042906)
                     /locus_tag="CNI03860"
                     /codon_start=1
                     /product="chitinase, putative"
                     /protein_id="XP_572898.1"
                     /db_xref="GeneID:3259508"
                     /translation="MLLSTPAFLSFALLLVSQSSAQGHTAPPGRHRHPRIFKDLQERG
                     QLDERLLPITATTTVVVPMTATRTIWVDSTQLVLGDGGNDGDNDASGDVSSVWSSQAS
                     QSTEGASTSSEAMLPTASASSSVSDLTSSSYDTDAQSSSFVTGSYIEDVTATSSLLSD
                     SLPTSSSISSDYPSLSVSQSEASSSTTGVATSSATVTDSSFSTFAEEPASTGSSSSQS
                     IAADSAPSSSASTSASTGSSSSRPTSLPQTESATKSEDLGAASTNIASNATVSDNVSV
                     SESQWASVTSTKSSSISETGSASLSGSESVSLSDSFSISATSTDSAAVIGTASSSYSR
                     FESSATASETASASANETGSKTKSHGNWWETSTSSSAWASSSLSASESASESASLTAS
                     GTVSVSDSSTWPESASVSSAATATTFESSTSISATSTSTSSSSSPTSTLASTLMLGYY
                     PDWSAYYLSPESVDWDRFDILDFAFAIPNSDGSLYFTDDSSTDSLQRLVTTGHAAGKR
                     VKLSIGGWTGSAYFSTIVADDSLRATFVSNIYDIYNQYNLDGIDIDWEYPGTAGADGN
                     AVSSDDSANFLIFLQDLRAALPSEAIITSATQVWPFADSNGNPMTDVSEFAKVLDWIL
                     IMNYDVWGSSSTPGPNAPLSDGCGNSTQPLANAYAAVSSWTSAGMPANQITLGVPAYG
                     YIQVSSASSLIQRRSLPLLPHKRSKHAKKASYVTVQNESGGTTDGQVMWYGLLNQGAL
                     TLSDGEYVATGGFTRHWDDCSSTPWLKSSESGQIVTYDDPQSMNLKAQFAAQAGLRGC
                     NVFSVDGDWTGSSWPLTDAVRSGLGLPAV"
     gene            1043283..1047299
                     /locus_tag="CNI03870"
                     /db_xref="GeneID:3259784"
     mRNA            join(1043283..1043494,1043555..1044260,1044309..1044671,
                     1044719..1044984,1045043..1045133,1045183..1045357,
                     1045412..1045735,1045785..1045858,1045915..1046015,
                     1046063..1046151,1046204..1046367,1046422..1046496,
                     1046546..1046672,1046724..1046781,1046844..1047299)
                     /locus_tag="CNI03870"
                     /product="spindle pole body duplication -related protein,
                     putative"
                     /transcript_id="XM_024657884.1"
                     /db_xref="GeneID:3259784"
     CDS             join(1043337..1043494,1043555..1044260,1044309..1044671,
                     1044719..1044984,1045043..1045133,1045183..1045357,
                     1045412..1045735,1045785..1045858,1045915..1046015,
                     1046063..1046151,1046204..1046367,1046422..1046496,
                     1046546..1046672,1046724..1046781,1046844..1047240)
                     /locus_tag="CNI03870"
                     /codon_start=1
                     /product="spindle pole body duplication -related protein,
                     putative"
                     /protein_id="XP_024513581.1"
                     /db_xref="GeneID:3259784"
                     /translation="MFMTSTSSSRSAYTDSTTLAVDLDIVEEIFQRGRYATSFPQVFK
                     SYTEVLQEHGISATNDSVYYNFLLKVGVLKASTWGDKWDLWKSTRLNQTLPSSASVSR
                     INQEDFGNKKSQKSFASSHLPEVRKRVPFLASASSDLDEGYTGGEESEASIRASPRIQ
                     LVKKEIADYTPVETVDVTGEDLLSFDPPIRTSTPIFAQYPQSGYPPDYTASDVSQDLE
                     QATEEFSTLGLSTPKAQTKQTLQTVSWVDRIDDLPLEMKRQMEQKADTFYMYGLTWRC
                     WNMWFKTSEWYRITYKNIITARNNLLLRQMLERWHKSSRRLLSLPPIADRHREQHLKS
                     ATLKTWMTKLKERDLDRMEQRLTRRKEVERIRKALAHWKRKWDDRRTERWKKDMAERE
                     LGFIERRRENHILTVFQHWRVEARLRYLKAFKEQGLILSIFYAWHDLTTKQRYLKSIL
                     QDIQLRQKEDALHLWQKMAMLKPKEKLAIDTGKGRLLARVWNDWNVANWLSQQSSAFD
                     RRCLFNKVMTKWKSATINQQALGRRSETFDKLRLLQTSLKQWRIASRESLFNQIREKR
                     LQSRAFVVWKGEMDRVEKLNALAHQFTRRRQSHALSSHFIRWRSHLSSLQTLSLQARL
                     VHKQHLVINCFSKWKASSRTVIANQALADKAHGFFALRMAFKTWGVQYRRRKATAWIK
                     EKEKERLKPIFDRWRVLAKRYRGLEKRETAFQRFVEERTKERLLAKWTERVVEVKDLE
                     LKIVRQRDEQTVKNALGRWKSHLEEIRASKKKADDFLEIRENENLRRAFRFWRSQAKR
                     SKRLRLASERSIIERKNKLLRCIWDKWWNRKREKDLDDIRKEVEFLHENVILYGVMDK
                     WKANTHILPGITADSQRVKSKTWATWERALERRKWAKAMRKEWDQKLLAEVFRLWKEA
                     AAHKSMLNARKHRGRPRPSGSTPTTTTHTIGARRSLPLTHSCDPAPSSSHILLSAAAS
                     GTSASGRTQSNQHRHDARGSESVASEPVYSRLREELGRKRRGVSEEPAYGNMIGGESR
                     NAERLETPRSGSEMLRALRGVMPGR"
     gene            complement(1047267..1048608)
                     /locus_tag="CNI03880"
                     /db_xref="GeneID:3259651"
     mRNA            complement(join(1047267..1047440,1047493..1047917,
                     1047974..1048101,1048158..1048308,1048364..1048608))
                     /locus_tag="CNI03880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572936.2"
                     /db_xref="GeneID:3259651"
     CDS             complement(join(1047392..1047440,1047493..1047917,
                     1047974..1048101,1048158..1048308,1048364..1048522))
                     /locus_tag="CNI03880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572936.2"
                     /db_xref="GeneID:3259651"
                     /translation="MTSAQPKPVSSPAQPEEPPARVINENTDMSTLTDQEIMNLMENM
                     ENQENTSDKPLVSTPVPLSVIREEYLKGSQQIVKKLDYLQENGWDQVWRARGDGDCFY
                     RSFTLAYLLRILHSPEPDVEANLAYDAIQRALPAMEQCGFQKDIYEEFLDPLLALIRS
                     FAESDETTANEYSIVQALQDPERSNYIVVSLRLITSSYIRTHADLFSPFLFSPTTFLP
                     LSTEEFCRQEVEPCGKEADNAQIMALAEAMNAGVRVAYLDRSEVGGKTINWVEFGKDT
                     SENARPLTLLYRPGHYDVVTKDVPPKV"
     gene            1048768..1052914
                     /locus_tag="CNI03890"
                     /db_xref="GeneID:3259470"
     mRNA            join(1048768..1050066,1050132..1052914)
                     /locus_tag="CNI03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_572947.2"
                     /db_xref="GeneID:3259470"
     CDS             1048796..1050034
                     /locus_tag="CNI03890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572947.1"
                     /db_xref="GeneID:3259470"
                     /translation="MTQPRPYRAGLGLPQVMTITSDPAPPRSAHEDIHEYTSPPGSPI
                     QSSTDAPSQVSISGQPEKKAEHYVYESLPKHIAWREWNINPSRHGPERLKHPPVFVKS
                     QTVYDELGRSVVDGVGVEVSLGEKEEKPGKILHNGDSMKDWYLKLAKKSDAQQEDSQP
                     SNKPAIAVAKTTMEPANTVSDSKSSAEAIRIHRSEWFIRRALLSKSQTPNSTPEISKP
                     TTPSSISSLLTIPSQAQSKKMAPNYALGPENKGYGMLKGFGWGGGGLGKPERWEEENA
                     DTPKEDRKGKRRAESDDEIQEVDASGNAIIDLTLSSSEESSSEDEEALSGPGRTAPIP
                     TALKLDRLGLGHRSASESKITHTHKEIVQAQKRAKYGQRRTNKGEEKGEMGRKQKIDW
                     KRKDKREREERRRLVATLNS"
     gene            complement(1050386..1053396)
                     /locus_tag="CNI03900"
                     /db_xref="GeneID:3259796"
     mRNA            complement(join(1050386..1051362,1051416..1052190,
                     1052241..1052592,1052650..1053396))
                     /locus_tag="CNI03900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572620.2"
                     /db_xref="GeneID:3259796"
     CDS             complement(join(1050617..1051362,1051416..1052190,
                     1052241..1052592,1052650..1053383))
                     /locus_tag="CNI03900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572620.2"
                     /db_xref="GeneID:3259796"
                     /translation="MSGPYRMDSQPDEDQGDISLSLAAARTPTRRTSPSQPTPAIDLD
                     VAVPQPKRLFLEPQRARGVSTDKLISATTNTHSRNESAGNDLSDDGATTPESITRKFW
                     DGKASDIGPRPSSAQPPVSENPSQDAFSPFPAQPPARRTPSSLGRSRSLNVRMPSADT
                     SCRQLGSSSTPLSATEVCPTPSDKIGWARRPGEPRPPPLMSEDVARKMGRWVKEIVVC
                     NFDLERGPVVERRAGGRRWGLGEKENVAFSSFPDTSLFSEGTILFSFKIRHISPDPVT
                     LAKPEPLSPLPKEKSMEERLMDTTVQDTEGSPVDVMPGNGTVPALMSTGQKAEEYRKW
                     DERGREWLYGFVWFEQRRDKRITRGYMQKSLVILTHLPFPALFSAVQQKIAPNFFEYG
                     YSAIEAACHSIASWPDPTPDTVLHLPLLSDIITVKLPDTTENPQILKIAPASPLPVPI
                     LASLPTSSPLRAFAPFIASLWSLWECLILAEPILIIAPDPRTCSEIVWWLRDFLRPIP
                     PTGDFRPYLHIHDHDLPLLINANKPQPGVVVGVTNPFFRNAASHWPNVISIPSQRGKR
                     KPTGGAGSGTGTIGGGVGGWEEPEGFISRRTRSVQKDRVLLKRLEGLIAEGKLDDPAG
                     NEALRTHFQQITERFLVPLNRYFQTLVPTRTPQPSSRSSSPFPTSSTTPSINTPNPTS
                     THLSPLPQFPHPSPTFSLHTATSTAGIRPFSLPTFLSHLRTSGPNPLLFKTKGLTSKS
                     RVENDFYASFCMSPGFAGWLAGRVDSLRAVLGGGANGITGNQKPMRRGLNIVQKTPPR
                     GKSPHSQTRSVSTTVPASSPGARRLNARGGSEGSTPRPPFGRSASVGLGITGPVIYGE
                     PETTREEDEEKV"
     gene            1053580..1055872
                     /locus_tag="CNI03910"
                     /db_xref="GeneID:3259461"
     mRNA            join(1053580..1054324,1054389..1054460,1054515..1054608,
                     1054665..1055872)
                     /locus_tag="CNI03910"
                     /product="transmembrane protein, putative"
                     /transcript_id="XM_572899.1"
                     /db_xref="GeneID:3259461"
     CDS             join(1053771..1054324,1054389..1054460,1054515..1054608,
                     1054665..1055666)
                     /locus_tag="CNI03910"
                     /codon_start=1
                     /product="transmembrane protein, putative"
                     /protein_id="XP_572899.1"
                     /db_xref="GeneID:3259461"
                     /translation="MSSPPTPPTPSSPPSYTHLNTPPKAYPQPPTFHPRRSAAAIIPI
                     HSADDSDGTSTPSTSSLSPPSELDDEESVHSQDSCDQPCHPAHALPLHMRSNTLSRVP
                     SNASSLAEEGEATPLLSSGEDDGYRGKWYKGPLFVAAFKLGILFAVFTAIVGITFYWG
                     MPKLDDEDKGIIKLPKSFADLQALNALFQKYKHRYPLKLLACGVVSYLFVQTFSLPGS
                     MYISILFGAAYGIMYGLLLSCICESIGSLFCYSLSAVLAPPLLTLPFYRARVETWRTK
                     IMGDPKKGKKVTWDSIFAILLVLRIAPFPPHWIANFVAPHLGIGMFLFWSSCFIGIAP
                     VSVIHVTIGSSLDDMTSAADFHILSLRNILGLSAVIIAVLIPIGLKRIFKKDLGDLGE
                     AEEALASTRGGDREVNVPAVGQNHGRMYHAIDSGVVLATPSKGNGMDMRRKLVKSQGR
                     VLEIIPDHESDAEDREHVELDDHSPSPLPRQLISFDNIEEPLMDDNAPGPSSRSSLQS
                     TSHKDDYIVFDPANHFHKIQVKPYRPNTQKGYGTIEQPAPVMDDSERTTTAVGMGWWP
                     WARDGVA"
     gene            complement(1055821..1058094)
                     /locus_tag="CNI03920"
                     /db_xref="GeneID:3259607"
     mRNA            complement(join(1055821..1056047,1056105..1056163,
                     1056235..1056442,1056499..1056565,1056633..1056696,
                     1056767..1056932,1057002..1057038,1057103..1057657,
                     1057713..1058094))
                     /locus_tag="CNI03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657885.1"
                     /db_xref="GeneID:3259607"
     CDS             complement(join(1056021..1056047,1056105..1056163,
                     1056235..1056442,1056499..1056565,1056633..1056696,
                     1056767..1056932,1057002..1057038,1057103..1057657,
                     1057713..1058068))
                     /locus_tag="CNI03920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513589.1"
                     /db_xref="GeneID:3259607"
                     /translation="MSSNPSHLLISRNPPRSPAHPQLDPALTSRHSSSRSDNRSSSGR
                     WVYAEDRPSRYLSEDDIDEEAELEDEGPIDVHPTFRSDAELPGKVKVIVGRNEFWCHK
                     EVLWFASPFFEGLLNGNWAESNPLHEDAYSRPSTVIETDVSSSDVPDVDGMASRLAVE
                     AKITTDQPAPAIMIEKLENNQAGNVTAAQGLEMNHGQDIQGPHSHSATVSDETQETFS
                     LREVPQDLTNTPVHRPTPHAETSSTTPTVISKKRDRTALRASFSSSLHSFQNFKSSPL
                     PGGAETVVELHEESASAFQDFLFWAYPHLECKVTWTNVAPLLSLAAKLIVPCLQKLCT
                     HFLLTHASGRPVMALALAEQHGNAELYREASRFVLDQPTWDESEMKMLSVETQLKLSN
                     RRSWFLERLLKLGTIDVRKDYSCRPDCPDPSRCQSQLDDKWRQAHHAVIKYGPPQPSV
                     AFRCLRQLETFPTNPSLVMPHALCQLAAKAWVMSLFDRMFQLKIVHSANPGTEKYWLW
                     VSMT"
     gene            1058184..1059271
                     /locus_tag="CNI03930"
                     /db_xref="GeneID:3259547"
     mRNA            join(1058184..1058255,1058308..1058733,1058784..1059068,
                     1059127..1059271)
                     /locus_tag="CNI03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657886.1"
                     /db_xref="GeneID:3259547"
     CDS             join(1058229..1058255,1058308..1058733,1058784..1059068,
                     1059127..1059222)
                     /locus_tag="CNI03930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513448.1"
                     /db_xref="GeneID:3259547"
                     /translation="MHVLSGTVQPPLLSLLSSTSSPALSPLFIAVTDSSSSNSVITTV
                     NDNQQIEKKGPCIIIPKNPAQGSIADQVIHIQSPDLRRTYIQAGCSQTAFGRSLKGKE
                     QDEVMIPLGVELPWIGMQVKRLSRRELSFEVGVVDSRGREGVIRCSSYKNDPSIHSHR
                     SPPLVHLPLSLSSSESFSELTSWRHIELNLSSIIPLFQSLARKHEENEDHGSRKKRKT
                     EVELPNGGFGSVSYVRVYANCRIRRIWFSSAGEKTLEGMGRGVKDEWALHAAQNISSL
                     S"
     gene            complement(1059245..1061659)
                     /locus_tag="CNI03940"
                     /db_xref="GeneID:3259670"
     mRNA            complement(join(1059245..1059949,1060017..1060099,
                     1060160..1060282,1060333..1060477,1060537..1060792,
                     1060854..1060970,1061024..1061082,1061128..1061382,
                     1061439..1061659))
                     /locus_tag="CNI03940"
                     /product="expressed protein"
                     /transcript_id="XM_024657887.1"
                     /db_xref="GeneID:3259670"
     CDS             complement(join(1059316..1059949,1060017..1060099,
                     1060160..1060282,1060333..1060477,1060537..1060792,
                     1060854..1060970,1061024..1061082,1061128..1061382,
                     1061439..1061602))
                     /locus_tag="CNI03940"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513588.1"
                     /db_xref="GeneID:3259670"
                     /translation="MPICPVCDSSIDADQAAFEHHVNNHFVESAGTSSIGKETSKEGS
                     MKRGREESLVAPELDICPACDFPLSFLTPIESQTHLATCLSGQEIEDDVEFDYSSIDI
                     TAQQQRDNDVIDKEWDGPARPGKWTGWVGRKVEKGDRWWDPLNGSTVPSELPSNFSPG
                     VIIILAAALRTSAHQGKTRRAVLCRDTAHIKGVWKFDLGWGCGYRNALMSLTSLLSVP
                     SYAPLFSKSINGAEPGVRRVQGWIEEAWEEGYDPEGKQQLGGTVLGRRKWIGPSDLYA
                     MFTYKGIPCIICQYCHFLSVFGGLTRSSDDFPKPPSAKDDSKAAYARLQQWVKDYFNE
                     STESPSNGSAFDVLMRSGENGSGRGEVVRVSIKFPLILQHSGHSRTIVGYEENARGDV
                     NLLLFDPGKTMPKDIRNAALTHLAKSRAQALPLINTSLSTSGNDNAGNDERSRRPGGL
                     RKKSSSQSQLEKTHESVPFSPPFTNGRAEVIYDVDRDKNTSGVESQTVEHLRGGAQDG
                     SDQGGKSPSTAIPIEDDEEITPSGWVRKKRALKSKISSPSSTSRTLIDPTSPTQAIKT
                     LNHFRVNLGNLSKHTQYQILMFTGGPVLSDSEKERRKIVSSTVIR"
     gene            1061871..1063248
                     /locus_tag="CNI03950"
                     /db_xref="GeneID:3259743"
     mRNA            join(1061871..1062005,1062067..1062597,1062647..1063248)
                     /locus_tag="CNI03950"
                     /product="expressed protein"
                     /transcript_id="XM_572949.2"
                     /db_xref="GeneID:3259743"
     CDS             join(1061931..1062005,1062067..1062597,1062647..1063171)
                     /locus_tag="CNI03950"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572949.1"
                     /db_xref="GeneID:3259743"
                     /translation="MSDNRQDAQRELHTQVETNIEDSLGSALESSFNIPPPAPKPKVP
                     VPSQEKESAPAATASAPVPGLDEWPQTLQGYLDEWQAESATARAKAEATRKRFEEERA
                     AEAKALEDAKKAEKTNKEEEEKRKRDAERLRQELEGEEDEVQGGKGHGHGDKSRVKEA
                     WELVAKKEGQSKDTPVVETDVRGVTGEDVFAGQAGEKKEVKAPAYDPTTSTDPIPPIF
                     QDPKPVAPAPAPTESATLSRHSATSQAWEEISGQSSGSGEQVSPPRSSGSDDIVQVPS
                     NPEKAPEAPRPPTQPPSLTLTLFTNASSLSIPRIFAVIGINLVLPFINGVMLGFGEIF
                     AREVVKVGKAVWRGERSLFNWNRGSGLGGRGTTGVGLSGAGF"
     gene            complement(1063175..1064021)
                     /locus_tag="CNI03960"
                     /db_xref="GeneID:3259600"
     mRNA            complement(join(1063175..1063490,1063541..1063875,
                     1063927..1064021))
                     /locus_tag="CNI03960"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_024657888.1"
                     /db_xref="GeneID:3259600"
     CDS             complement(join(1063281..1063490,1063541..1063875,
                     1063927..1063933))
                     /locus_tag="CNI03960"
                     /codon_start=1
                     /product="ADP-ribosylation factor, putative"
                     /protein_id="XP_024513545.1"
                     /db_xref="GeneID:3259600"
                     /translation="MGVTFSSLWSRLFARKETKVLLIGLDNAGKSTILYRITTGAVVA
                     SAPTVGSNHEIYDYKGVRFGLIDIGGQTSLRSSWSQYFNGTEAVILVIDSCDGPRLGL
                     VKQELMKIVADESLSTALLLVLANKQDLPVSQGRLTPAQISEALSLTDLRQREWQIMG
                     CSALTGAGLMEGMDWLVTKLAAR"
     gene            1064105..1065170
                     /locus_tag="CNI03970"
                     /db_xref="GeneID:3259552"
     mRNA            join(1064105..1064219,1064315..1064380,1064448..1064732,
                     1064818..1064823,1064886..1065170)
                     /locus_tag="CNI03970"
                     /product="small nucleolar RNP protein, putative"
                     /transcript_id="XM_024657889.1"
                     /db_xref="GeneID:3259552"
     CDS             join(1064162..1064219,1064315..1064380,1064448..1064732,
                     1064818..1064823,1064886..1065088)
                     /locus_tag="CNI03970"
                     /codon_start=1
                     /product="small nucleolar RNP protein, putative"
                     /protein_id="XP_024513538.1"
                     /db_xref="GeneID:3259552"
                     /translation="MSGRGFSRGGGGGFRGGARGGRGGGRGGFQQRDMGPPDTVLEIG
                     SFQHDVESEMLCSLTAPTKIPYFNAPIYLQNKTQIGKVDEILGPINEVYFTVKMEQGM
                     LASSFKKEDKVYISGEKLLPIERFLPKPKVAGGKVEKRGAQGGRGAPRGRGGAGSRGG
                     RGGFSSRGGPGGRGGARGGAGGRGGFSSRGGGAPRGRGGFRGRGQ"
     gene            complement(1065195..1067133)
                     /locus_tag="CNI03980"
                     /db_xref="GeneID:3259677"
     mRNA            complement(join(1065195..1065398,1065453..1066534,
                     1066588..1066787,1066856..1066968,1067023..1067133))
                     /locus_tag="CNI03980"
                     /product="translation initiation factor, putative"
                     /transcript_id="XM_572932.2"
                     /db_xref="GeneID:3259677"
     CDS             complement(join(1065251..1065398,1065453..1066534,
                     1066588..1066787,1066856..1066968,1067023..1067111))
                     /locus_tag="CNI03980"
                     /codon_start=1
                     /product="translation initiation factor, putative"
                     /protein_id="XP_572932.1"
                     /db_xref="GeneID:3259677"
                     /translation="MFDPRAGAPKRWASQSQDFQAVILVGYGENLYPFNQGTNVISKA
                     LLPVGNVPIINCVIDWVLAAGLLDILIIVPNAFHDQIADHIAEAYNKSTHSRVRINLR
                     KNSEGERDEDEGDSEEKDGTARILKKFRSFIKSDFVLLPCDISPPSYLPLKTILDKHR
                     SSPKAVMTSVFYEPIESVKDAEEKILVGLDKTSDELLLITPLEGMEEDLELRMSLLNR
                     HPTLSLTTRILDAHVYVFRRTFLDLLATRRAKDLSSMKEQVVPWLVKGGWQRGLGERW
                     EPILDPPSRDPLAEALARSTTAPPSRSLLHPSSSPSSDRTPLPQTSPASPSGDADTMY
                     SSGILPTAPSRTRKGFKPEWKCQVLVITPPPAPPAPAPVQGKGGKQDKSRAPVYEPEH
                     LIRANSLAGYWELNRRFIKSLSSTTPAAKSAQPVRNIIPEDAGTAPAISPAAQISPDS
                     VLGEGTRVGEKTSIKKCIIGRHCVIGKGAKLNNCVIWDFVTVEENARIENSIICSNGR
                     IGEKAQVKDCEFGTGFEAKPGAILKGERLIAGQEA"
     gene            1067304..1069014
                     /locus_tag="CNI03990"
                     /db_xref="GeneID:3259431"
     mRNA            join(1067304..1067521,1067577..1067630,1067686..1067805,
                     1067849..1067922,1067979..1068183,1068238..1068456,
                     1068510..1068591,1068650..1068912,1068963..1069014)
                     /locus_tag="CNI03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657890.1"
                     /db_xref="GeneID:3259431"
     CDS             join(1067494..1067521,1067577..1067630,1067686..1067805,
                     1067849..1067922,1067979..1068183,1068238..1068456,
                     1068510..1068591,1068650..1068857)
                     /locus_tag="CNI03990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513447.1"
                     /db_xref="GeneID:3259431"
                     /translation="MDYVSVLPQDIDLSSSHQYLRIPHPRTGEAQLYLPYTTAAGQDV
                     VLEAAKLNGSQRRTWFIGDSGIDAGAMLVHYPIDPLFIVIPLILALVPNGPPPPFQPL
                     HDLLSAASTSTSFALPLPFTSGTKGKSPNRSEGVNEDIERLLTLKNVKRAFKACCEKK
                     VISTAPPSPDPSSSPQPPTQSFYRPSQDLIIQHLKRKAGFFAGPEEFEKFDHLVRGLG
                     RDGLLEKDIDEELLSSARLRAACDHLAQWLPGPVLSKLVKSYDFAALEEHLASRSAAA
                     FAASQITTSNNKKEAKGIKRKAPPASRGVESLKKVNTNKMAKLTSFFKPKEKK"
     gene            complement(1068950..1071681)
                     /locus_tag="CNI04000"
                     /db_xref="GeneID:3259430"
     mRNA            complement(join(1068950..1069823,1069884..1069960,
                     1070022..1070709,1070762..1070822,1070871..1070972,
                     1071040..1071174,1071244..1071681))
                     /locus_tag="CNI04000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657891.1"
                     /db_xref="GeneID:3259430"
     CDS             complement(join(1069111..1069823,1069884..1069960,
                     1070022..1070709,1070762..1070822,1070871..1070972,
                     1071040..1071174,1071244..1071468))
                     /locus_tag="CNI04000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513556.1"
                     /db_xref="GeneID:3259430"
                     /translation="MAHQITYDYVEHVDPNLTCAICQSALVDPVTTTSCKHTFCRDCI
                     TRAIVHNPQCPIDRSALTMSSLRDTEQLVKLMLDELKVKCGAEGCGTVLQRGLLLAHL
                     KTCSKAIVTCQDGDCGLSMTRQRLPHHRAYECFQRKMECRKCGTILVFKDQTTHTNIE
                     CRDETGVCGLCGQNMGPDAHMHKWQCPLVRIPCPHSARGCSSIIPRSDLQAHISICPF
                     EAFSGFFEMNDARLKSLTSRVESLEEELERMREHLKRIEGNVETMGNMRRETGDEWRW
                     REVGRMRLGDTPPPVASSHSDPQTTSTILSSPLTPTSSHPSPQPVISSIFPGISILSS
                     GGARPDLAPHHHRSLVAPSFGSHQSYADWAFSRLSGNAGNVGWEEVINGLRAVVIQLA
                     SGLDSMERRNEVRTMTESLRVLEEVGSLRAIVTTMRMLMMERPFRPPSFQFQGDSLFS
                     RTAESTLTPTLNQQATVAFSSTTDQSTSEQRSQSSDENLSVSVSGDQEDSGRETASIT
                     ESVVFSAQGHPASSSRPSSSTNSLITAGAGLSGNKRTPMSRARPNLGGYQGVTVEVRY
                     DENADGIEGGASYSRTSNAASGNRNTIGTSGAEMTGRPMAFPPASQDDDDVSATTNRN
                     AGGDVNEATERSMGTRERKVNLANPIARLMRRGPQGNGSPRL"
     gene            complement(1071683..1071772)
                     /locus_tag="CNI04010"
                     /db_xref="GeneID:3259802"
     tRNA            complement(1071683..1071772)
                     /locus_tag="CNI04010"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:3259802"
     gene            complement(1071997..1074508)
                     /locus_tag="CNI04020"
                     /db_xref="GeneID:3259414"
     mRNA            complement(join(1071997..1072431,1072483..1073239,
                     1073285..1074508))
                     /locus_tag="CNI04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_572614.2"
                     /db_xref="GeneID:3259414"
     CDS             complement(join(1072055..1072431,1072483..1073239,
                     1073285..1074487))
                     /locus_tag="CNI04020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572614.1"
                     /db_xref="GeneID:3259414"
                     /translation="MDHLVLDPVIDPALADNSPQHTDDHHQPLQNSASTSPVAQPSQR
                     TTKTGRPSKARGTVPGSAADFRRREANRLAADRSRSRQAEKGAALENASRILSEENAR
                     LKEQIAALEGGIEGSDFQHGVQDAEHQPTPGPSRTEEPHDDDQQVSQESDTQAQEQEA
                     HSHTILAALTDITGVDFSEGNEANWMQGMETFLKDSESGRLGELAAVAMGHDDPQLQH
                     QEKADAPHTSPFKIGNMSIPFPLPGQMSIPGASAAIGLAAALNTEMERIIMEDLALTK
                     AAIVRVENQISHLRAHPDADIDAASNDSSIAPLLPKDIFSEDLEALQVVQTDIQNSIS
                     YLENTLPPVRDEFVRTRDDKTAEEKRIIDLVKEVKELEVRDEDQKEKVLSNLRSVGTF
                     VENLLTEEHPDNQYLTGAFSSPALARRRRGRPPKGEVSRTFYQSYLIGPLSQEVDPKG
                     KGKAPTAKNPRRSRLGESPLTGHASSHEQDDHHVAESSQSAQAHLPDSHEPGTLQAAQ
                     HDQDHPDEHDTTEAVNRAEAYILSHLNASNATDGQDADPHPEREDAIGLESTSFADFL
                     PAQEALERQVEGPASQHGNADAFGQSASSNGQNQELVHVSQGDHDVPLSVLSRLKQGP
                     PGSCDICMRTETTVWRKLVLGGIDHKVCNACGLYHSKFGVIRPPELWGDGKSLKKRRS
                     TRPATDEEDADAHAKKKVKKSIGEGSEQLESLDDEHQELGNMVENHLSAQQREEEEAA
                     TVTAGENVEGTIVDRSVIQGAVQPGIGMDEAEGNVFEV"
     gene            1074704..1076845
                     /locus_tag="CNI04030"
                     /db_xref="GeneID:3259780"
     mRNA            join(1074704..1075068,1075121..1075264,1075315..1075373,
                     1075423..1076845)
                     /locus_tag="CNI04030"
                     /product="ubiquinone biosynthesis monooxygenase, putative"
                     /transcript_id="XM_572612.2"
                     /db_xref="GeneID:3259780"
     CDS             join(1074768..1075068,1075121..1075264,1075315..1075373,
                     1075423..1076736)
                     /locus_tag="CNI04030"
                     /codon_start=1
                     /product="ubiquinone biosynthesis monooxygenase, putative"
                     /protein_id="XP_572612.1"
                     /db_xref="GeneID:3259780"
                     /translation="MRPPTTIYKPGLSNALKVSSKPAISVPAITSRNLHLARPAFSSI
                     PLRATVSKSAHVTFKRSHSHHAPQPTEPIPEISSENTYDIVIIGGANAGLAFACALLS
                     QPTISQTCRILLVEGSSLDRTRNWPESSEWENRISSLTHENIEWLESIGVWRHITNDR
                     SCPVHEIIVWSNPSPTETPTIHFPPVGRPLARMTENLNLQKALLRRIEEAGKGIVDIR
                     ENSRVREMRLGEGGRWVGLRIGDEWVRGSLVVGADGPNSPVRHFSEIESYGHGYNTHA
                     VVATLNHDPDPLYPNTTAFQRFLSTGPIAFLPLSDTSSTMVWSTLPENAAALKKLSHD
                     ALTQMVNAAFTLPEETLSSLCEAMLSAQSEGTPLTAPQIVTLIATLPTPLTSSDQPII
                     PPAITSIHPPSVASFPLRISHATSYLGERTALVGDAAHTIHPLAGQGLNMGLADVKCL
                     AEVLEETRRLGGDLGSLEGTKGYPKERYPLNHLMLSATDKLHYIFRARNGLVNWVRGT
                     GFDVINELGPIKRILMGGAGSGVGLGGASARTEKEREFGRARAEDKLKPAGGWPMAVA
                     NGVEGWFALKGVMGMVGGVVGEAARNGLRRAADALDGKR"
     gene            complement(1076751..1079100)
                     /locus_tag="CNI04040"
                     /db_xref="GeneID:3259595"
     mRNA            complement(join(1076751..1076879,1076937..1077187,
                     1077251..1077585,1077640..1077822,1077873..1078316,
                     1078365..1078442,1078504..1078572,1078628..1078792,
                     1078857..1079100))
                     /locus_tag="CNI04040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_572930.2"
                     /db_xref="GeneID:3259595"
     CDS             complement(join(1076866..1076879,1076937..1077187,
                     1077251..1077585,1077640..1077822,1077873..1078316,
                     1078365..1078442,1078504..1078572,1078628..1078792,
                     1078857..1079045))
                     /locus_tag="CNI04040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_572930.1"
                     /db_xref="GeneID:3259595"
                     /translation="MSKAGNYLKTAISMVTSLEEGKPHSSITDWIEVLSSDRYEELSL
                     DGISELVESVNILGSQGTTEASRAIRKKLKYGNVHRQIRALVILRALTENAGKGFQLN
                     WANEQLMERLRLMAADQLTDPKVKRMLLLVFHAWSLQYKDEPRMHEVAGLYRKYTGHG
                     TRPAPRKPTTASSPTTATSATAGHGTFDDIFSHDWNPAPGNRGADTYTDLAAAKADAE
                     ERKRAREARIALEQREAEIERRERELRRKRDMAEIEERRRKDAAEEAENRRKLKEQGK
                     KKNQQPKRLPFSFEKEKPQIMVAVANAIQCANNLVNACRLVNREVENVTESPKVQDNL
                     DKAKVARRSVIKYIQLVTDEEYVGTLLDANERIVEAIQLYDRLSKPAVLDSDSEDDAA
                     DVSALHKRLAAQKLEADRTGELQKIQEDQKRESARRQQRQLLRQASETGTPVRGTQQP
                     SSTYSDLQDLDFGSIAHTQANLPPPMRPDSGDDESYGGSLSDFSDYDSSDAEWQAVHG
                     SGSVANKGAPTAGPSSRVPRQYASLEDDYPGQSGLLAKEDDNPFGDPFADELDTPVQE
                     KQRLQWAEI"
     gene            1079246..1080775
                     /locus_tag="CNI04050"
                     /db_xref="GeneID:3259445"
     mRNA            join(1079246..1079305,1079352..1079436,1079485..1079658,
                     1079714..1080539,1080590..1080775)
                     /locus_tag="CNI04050"
                     /product="conserved protein"
                     /transcript_id="XM_572610.2"
                     /db_xref="GeneID:3259445"
     CDS             join(1079285..1079305,1079352..1079436,1079485..1079658,
                     1079714..1080539,1080590..1080662)
                     /locus_tag="CNI04050"
                     /codon_start=1
                     /product="conserved protein"
                     /protein_id="XP_572610.1"
                     /db_xref="GeneID:3259445"
                     /translation="MSSERVRGIQVHRPIIFGSHARLLTEAEKQLAPAGHTHKWTVFL
                     NSAASPPLKQGEPPDYEDIDYLPGGADDLSYFIRKVTFKLHETYATPNRVIDKPPYRV
                     SETGWGEFTVQIRIQLIPESSEKPLGLQHNIKLHHWGAPVEPLPVVSGAPTPTPVPTE
                     SNTEVKLEPDTPAPLEESVTPAPTIQRPASEPATNEPGSNQGTPAPPGGDSTEQIKVD
                     VATPALEVIEPSATPAPLSLAARLPIHAWQYDEIVFSDPPRQFLDILNAHPPTPLPAK
                     SRRPRDQREDYEARKKGKSAARGASVTASARASRAGTVDTAAAGTPAPAQIGIPGEPG
                     SADVPLEFTQEMLKGEHNAMLDARVKIVEQMDRWRERLIALEKELAKAKEDVKATAAM
                     "
     gene            complement(1080644..1082041)
                     /locus_tag="CNI04060"
                     /db_xref="GeneID:3259484"
     mRNA            complement(join(1080644..1080844,1080896..1080973,
                     1081029..1081157,1081215..1081362,1081421..1082041))
                     /locus_tag="CNI04060"
                     /product="mitochondrial genome maintenance protein,
                     putative"
                     /transcript_id="XM_572928.2"
                     /db_xref="GeneID:3259484"
     CDS             complement(join(1080784..1080844,1080896..1080973,
                     1081029..1081157,1081215..1081362,1081421..1081964))
                     /locus_tag="CNI04060"
                     /codon_start=1
                     /product="mitochondrial genome maintenance protein,
                     putative"
                     /protein_id="XP_572928.1"
                     /db_xref="GeneID:3259484"
                     /translation="MSLLASTARRAPNSLQLSTRNLSTTSARFAEAAPIASRYVRKTA
                     VPARAKPTAYSRPATFNSASTAASRTRPAPAARPVVDEFPEDLPLPSTEPPIDDYAHL
                     SAPPSAKVSPPLSELPSENYEPLPSATASARVGGKLAGEVPVGLDWSTSFSGLSEKPF
                     PKEAADELLKPLTPVDVEIKPDGLLYLPEIKYRRTLNAAFGPGGWGLAPRGETDVGPR
                     IVSREWGLVCLGRLVSVARGEQEYFDPSGIATATEACKSNALMRCCKDLGIASELWDP
                     TFIRDFKKQHCVEVFVEHAVKKNKKKLWRKKNSDKFEYPWKEL"
     gene            complement(1082221..1084841)
                     /locus_tag="CNI04070"
                     /db_xref="GeneID:3259476"
     mRNA            complement(join(1082221..1082340,1082390..1082467,
                     1082522..1082573,1082633..1083747,1083797..1084135,
                     1084191..1084524,1084571..1084644,1084701..1084732,
                     1084786..1084841))
                     /locus_tag="CNI04070"
                     /product="DNA-(apurinic or apyrimidinic site) lyase,
                     putative"
                     /transcript_id="XM_024657892.1"
                     /db_xref="GeneID:3259476"
     CDS             complement(join(1082274..1082340,1082390..1082467,
                     1082522..1082573,1082633..1083747,1083797..1084135,
                     1084191..1084524,1084571..1084644,1084701..1084732,
                     1084786..1084809))
                     /locus_tag="CNI04070"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase,
                     putative"
                     /protein_id="XP_024513544.1"
                     /db_xref="GeneID:3259476"
                     /translation="MRILTWNVNVLRTCLDYHPFSSMKKKNIEGLLDELDAQIFCFQE
                     HKTVRTRLEKSMACPGPYDGFWTFPRSKTGYSGVCTYVDSRYCVPLKAEEGITGLLLG
                     DRLSTMKPPWTDAERIGSYPDVNDMEWMDELDGTKFDVKKLDMEGRAVVCDFGLFVLF
                     NLYCPNETNSARRPYKMNYLHALQERVQLLQAAGREVMLVGDINIVRQPMDSGEGPVR
                     SSAEQHYSHPARRILDDWCAPKGPMIDVVRESWPQRDDMFTCWNQKLDARSANYGSRI
                     DYVLCTPGLRPWIKGGDILPKVYGSDHCPVYVDLHESIVTPEGETLHLRDMLNPKDRP
                     TSTSPVYPNDVKREAPEPPRFATKFMDEFSGRQTSLKSFFGGGSKRAQEKTNGASLST
                     SVSASASPAPTPTASELSSAVQASESGATKIVSLPQAPEECVSAPFSLARTAFSSLDN
                     PSPVHSRELSSKTSDGAPVKATLSSKQDKSSAKPIDMTLDDDEDDEPILVSSKSENKP
                     PPKPTRSSLSGSKSASSQVKLSSFFSQPHTEGKRKSPPPPSSAPSISKRPSLAPLPQS
                     NNAPFAASPSATTAEDECQGMTEEENQLISQAIAEADAERAEKNAKAAPQWSSLFAKK
                     LPPLCTVHHKPCKDFVVMKPGPNKGKRFWLCSLPVGAGYDMGRSKRPREDVNPKFRCN
                     FFLWDSANSRKETPNEGKEKKL"
     gene            1085006..1086865
                     /locus_tag="CNI04080"
                     /db_xref="GeneID:3259432"
     mRNA            join(1085006..1085225,1085277..1085336,1085390..1085454,
                     1085517..1085613,1085676..1085748,1085798..1085967,
                     1086019..1086323,1086381..1086468,1086523..1086618,
                     1086671..1086865)
                     /locus_tag="CNI04080"
                     /product="peptidase, putative"
                     /transcript_id="XM_572901.2"
                     /db_xref="GeneID:3259432"
     CDS             join(1085029..1085225,1085277..1085336,1085390..1085454,
                     1085517..1085613,1085676..1085748,1085798..1085967,
                     1086019..1086323,1086381..1086468,1086523..1086618,
                     1086671..1086728)
                     /locus_tag="CNI04080"
                     /codon_start=1
                     /product="peptidase, putative"
                     /protein_id="XP_572901.1"
                     /db_xref="GeneID:3259432"
                     /translation="MLITPAILALPLLASAVPTAKEQLAFQGSIGSAILEGQDIFAAH
                     DGFSLDLGEMRLVQFSEEEPPVWMSELEKIQAKAKGLRFMDITETPGLGFSSYFLPSA
                     ANVKYSYPTPGNHTKTISSIIKKLDIDHMKDFLTKFTSFRTRYYKSDTGKDSQKFLLK
                     TLKEIAKPHSGITVKEFAHPWGQNSIIVRFAPADPANEDAPITIVGSHQDSANMWPFL
                     PAPGADDDGSGTTSSLEGFRALVNANYTPSTPLEFHYFSAEEGGLLGSQAVAKSYEDE
                     GKKVLAMLQMDMTAWVKAGTEERVGIIQDFVDPDLTEFIETLVEEYLSIPPVKTQCSY
                     ACSDHASFAKAGYQSAFAIEATFDDSNTRNIHSTADTMDHPEFSFTHMREFSKLVVAF
                     SVELAGIADQ"
     gene            complement(1086793..1087907)
                     /locus_tag="CNI04090"
                     /db_xref="GeneID:3259793"
     mRNA            complement(join(1086793..1086930,1086991..1087185,
                     1087239..1087444,1087517..1087907))
                     /locus_tag="CNI04090"
                     /product="SNAP receptor, putative"
                     /transcript_id="XM_024657893.1"
                     /db_xref="GeneID:3259793"
     CDS             complement(join(1086863..1086930,1086991..1087185,
                     1087239..1087444,1087517..1087857))
                     /locus_tag="CNI04090"
                     /codon_start=1
                     /product="SNAP receptor, putative"
                     /protein_id="XP_024513587.1"
                     /db_xref="GeneID:3259793"
                     /translation="MSTPTSASISQRLTTTSSLLLERSRILSLNLKPSPSSTQQIVRN
                     LTSIRSDLEQLELESKGLVLGGKKGKGKGGDDGEEEVKELEERYDRLLGMLEEDDLGR
                     EKAKDLKRTSQIPPSPIASPQPDTLSPPADASPSAQDVPTFNVDPPAPAVGYQPFKDY
                     PENEEPELAPHEMLSNQQMLMNDQDERLNLLSHSIGRQNDLSLQIGSELDVHHQLLEE
                     TDTAMDRTAASLGRAKRRLDRVADEAKQHGSTITIVLLIFILLILIIVFKT"
     gene            1090194..1093039
                     /locus_tag="CNI04100"
                     /db_xref="GeneID:3259439"
     mRNA            join(1090194..1090407,1090477..1091329,1091408..1093039)
                     /locus_tag="CNI04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657894.1"
                     /db_xref="GeneID:3259439"
     CDS             join(1090976..1091329,1091408..1092679)
                     /locus_tag="CNI04100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513554.1"
                     /db_xref="GeneID:3259439"
                     /translation="MDQSSGSSSSRHLPFGGPGARTILDDEPGPSSLPDSQGYPENMY
                     ESHPDGAQQLSQQSRETHTASPSLDGPPIKRVGGKANVSSACGPCKRAHLACDIGRPC
                     KRCINMGKQDQCEDVPHKKRGRPKVARPPLGEPYHRTSRPVPVAADAGGIGRWRGPSV
                     YDPSFVPNMDAAPGPSMTGRVSPRRASSSSMDASAASYPTPDPTAHPFTLFTTTDFKI
                     LRASPSCFSLVGYHPNEFVNLNLLDWIHPQDRHLIDMERNKLLAVPYVEGQLRSVEVT
                     QAAITQRTELELLSPAEGMREPYPNKNVRVLHVDNRFSPFNVRLHLGGGLGASLWQPV
                     TLGRVYLVVSFLAIPRSHHFPPDVPPVRRLSQISPPTPITPAPGMSGQGLPGFSSIAA
                     GVDGPQPRYDQPPPQVYYPPPQPPTARPPPPLSAQPYPSYPQTAMPANAPMYPPRRSS
                     SPNSAYRTPQTASYPISPTEYQMQPGFYPPAGPHPLGPPTVIAGGEYRRSNYEEWRMA
                     QQAGAPASLLPPRDHAAVTGGSSNDATRRTWEL"
     gene            complement(1092837..1095041)
                     /locus_tag="CNI04110"
                     /db_xref="GeneID:3259639"
     mRNA            complement(join(1092837..1093227,1093283..1093416,
                     1093467..1093768,1093822..1093886,1093938..1093955,
                     1094006..1094130,1094184..1094257,1094317..1094387,
                     1094441..1094551,1094603..1094650,1094749..1094779,
                     1094847..1094855,1094910..1095041))
                     /locus_tag="CNI04110"
                     /product="calmodulin-dependent protein kinase, putative"
                     /transcript_id="XM_572924.2"
                     /db_xref="GeneID:3259639"
     CDS             complement(join(1093180..1093227,1093283..1093416,
                     1093467..1093768,1093822..1093886,1093938..1093955,
                     1094006..1094130,1094184..1094257,1094317..1094387,
                     1094441..1094551,1094603..1094650,1094749..1094779,
                     1094847..1094855,1094910..1094962))
                     /locus_tag="CNI04110"
                     /codon_start=1
                     /product="calmodulin-dependent protein kinase, putative"
                     /protein_id="XP_572924.1"
                     /db_xref="GeneID:3259639"
                     /translation="MAPQTVPCQYKTGKTLGSGTYAVVKECVHITTGEYYACKVLNKK
                     FLMGREHMVRNEIAVLKRVSAGHKNIVQLHDFFETTHNLYLVFDLCTGGELFDRICAK
                     GSYFEKDAANIVRTVTSAVKYLHDQGIVHRDLKPENILFKSKAEDADLMLADFGLSKV
                     LDDDKFAILTTTCGTPGYMAPEIFKKAGHGKPVDIWAIGVITYFLLCGYTPFDRDSQY
                     EEMQAICKGDYRFEPVEYWGGVSETARQFVRDCLTVDPTNRPTVDELLNHPWLRDVEA
                     SKDEPAEAKGVDLLPNVKAAFDAKKTFRKAVLGMMAVHRLQDHSATIHGQTEAEQEKL
                     KKEVEAFKEEAAQEDVKDVIQPGAPASI"
     gene            complement(1095357..1096633)
                     /locus_tag="CNI04120"
                     /db_xref="GeneID:3259621"
     mRNA            complement(join(1095357..1095511,1095571..1095691,
                     1095745..1096115,1096171..1096266,1096320..1096452,
                     1096506..1096633))
                     /locus_tag="CNI04120"
                     /product="expressed protein"
                     /transcript_id="XM_024657895.1"
                     /db_xref="GeneID:3259621"
     CDS             complement(join(1095488..1095511,1095571..1095691,
                     1095745..1096115,1096171..1096266,1096320..1096452,
                     1096506..1096519))
                     /locus_tag="CNI04120"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513445.1"
                     /db_xref="GeneID:3259621"
                     /translation="MEARLQKLKVTDLKELLAKYHLPQTGKKDDLVKRLLENNISYEE
                     PQEELIDPDAPISGTNVPKTIPQVTTAPAAPDTSLIDPPRTSDASASELPAAETNDIL
                     APAPSTEPEVELTPDQKAMKARAERFGIPFNLPKPSATKPAKTEKAESKPAETREKAA
                     SINKDSLGLSDDILAKRAAKFGLPEKKEAGKPASKPEKKAEEVDPELAAKLAAEEEKK
                     RKRAEKFGSNKPPVVEETEGQNAASEPDTKKVKV"
     gene            complement(1096802..1098462)
                     /locus_tag="CNI04130"
                     /db_xref="GeneID:3259379"
     mRNA            complement(join(1096802..1097288,1097335..1097493,
                     1097546..1098462))
                     /locus_tag="CNI04130"
                     /product="acyl-CoA thioesterase, putative"
                     /transcript_id="XM_572953.2"
                     /db_xref="GeneID:3259379"
     CDS             complement(join(1096929..1097288,1097335..1097493,
                     1097546..1098145))
                     /locus_tag="CNI04130"
                     /codon_start=1
                     /product="acyl-CoA thioesterase, putative"
                     /protein_id="XP_572953.1"
                     /db_xref="GeneID:3259379"
                     /translation="MSLASRISVSPYPNKSFTFIPHDTWIPPGARSIYGGLVISQALC
                     SSLLTVESPFGLHSIHCYFLHPALPDGDIEYRVDKLAEGQRYCRREVRGWQNGRIFFI
                     LFASYESLYERSSASSEDHTSIKVSHSLTAMTQPWDEDPTQKNGESFEVKQSFQMPFP
                     KELRPWDQCEENEVFLQRLVQEKSKEELGWKWEYFDNWSKKRGSAPFFTSVARKIPGV
                     PSSKEYYLNGLPTTRMTWYRPRIDPDETISEEMYKSMIIYLTDYQLVGAATRSIGLNM
                     SSTPQIGLIASLDHSVHFYPLPPDLNYQEPVLHVMESQVADMSSGRAVARGRVYSAKG
                     KLLAVTCQEGVFKVREPGKKPMGVAASGIDEEDLQARL"
     gene            1098632..1100655
                     /locus_tag="CNI04140"
                     /db_xref="GeneID:3259792"
     mRNA            join(1098632..1099049,1099104..1099152,1099207..1099319,
                     1099372..1099696,1099762..1099914,1099971..1100044,
                     1100110..1100215,1100279..1100437,1100499..1100655)
                     /locus_tag="CNI04140"
                     /product="metalloendopeptidase, putative"
                     /transcript_id="XM_024657896.1"
                     /db_xref="GeneID:3259792"
     CDS             join(1098736..1099049,1099104..1099152,1099207..1099319,
                     1099372..1099696,1099762..1099914,1099971..1100044,
                     1100110..1100215,1100279..1100437,1100499..1100633)
                     /locus_tag="CNI04140"
                     /codon_start=1
                     /product="metalloendopeptidase, putative"
                     /protein_id="XP_024513444.1"
                     /db_xref="GeneID:3259792"
                     /translation="MSMLKSFIRVRPLGRTHRSIIPTQPFASAPISAGHNLHSTESKT
                     IPTVRHIPSLARFPNNSLSRSFHSTNRRQDVLFVAMPALKSGLLNITRFSLLFLPFAI
                     RYKLWKRYRRISLLLLQIPIFAICIILALGLDQSPRTKRWRLLLMSEHEELAWSRRKQ
                     REILRNDGHKLLPPDDPRSRQVARVTTRLVTALEEEDRHIVYGANWPPKSQELSRLIS
                     EREALIGEGDRYYLPSGTAKSTYVPYRPPTNNPLKQFESPDWRVYVIDSPEVNAFALP
                     SRDVFVYTGLLDTLPGDDVMLSAILAHEIAHVVERHTVENLGFLNLATVGFDVLRGLA
                     FAFTISFPFITDSAGMCINWINNVLADRAYSRKLEMEADAVGLEIMATAGYDPRAASD
                     LWELMACVEDDAAAMGQGISVENRFTLLRTHPTSDVRLKALSKDMEGALKIWRDHRRK
                     RQPKRVEKKQEKKDNVPESDKAVSE"
     gene            complement(1100711..1102976)
                     /locus_tag="CNI04150"
                     /db_xref="GeneID:3259627"
     mRNA            complement(join(1100711..1100931,1100988..1101061,
                     1101116..1101372,1101427..1101736,1101792..1102016,
                     1102072..1102231,1102284..1102450,1102500..1102577,
                     1102626..1102976))
                     /locus_tag="CNI04150"
                     /product="cytosine-purine permease, putative"
                     /transcript_id="XM_572604.2"
                     /db_xref="GeneID:3259627"
     CDS             complement(join(1100841..1100931,1100988..1101061,
                     1101116..1101372,1101427..1101736,1101792..1102016,
                     1102072..1102231,1102284..1102450,1102500..1102577,
                     1102626..1102868))
                     /locus_tag="CNI04150"
                     /codon_start=1
                     /product="cytosine-purine permease, putative"
                     /protein_id="XP_572604.2"
                     /db_xref="GeneID:3259627"
                     /translation="MSHNLKEPIQPLPISSESYELKDRRKSSSVNQVDYLPQYSDELV
                     KKKGRQGERVVGLAKRTMDILVEHGVEERGIDPRPENERDELNKWTYLPQFTLWAAWN
                     TNILSFSEGVIGPSLFGLDWKTSCLCIVFFTAASALPVAYCATNGPKTGMRQMVQARY
                     GMGYGLALIYGILNCATMIGFMALTAILAGQCLALASNSTMSWDVGIVIAALIALILS
                     FVGLNALHIVSLASFPVMVILYVVLAGVVGDKLHLVQSDVAKAATAVTASGVLGYGAS
                     LIGFSITYTSLASDFTTSLPPQTPGWKLFLCVYVGMVVPMILCQMFGAACQLAAYSIP
                     DWETASNVGVPNLIYTMTGNGNGASRFVMVLFSLSVVANTAPTIYSAGLSGQVAIPWL
                     VRVPRYFLALVVSAIYLPIAICGASKFYSALENFSSVLSYWSALYIPPTLIEPILFRG
                     PVSRKTYPVEIWNQIGKLPIGLAAIFAAICGIPVVTGGMAQSWWTGWIARKIEGTGDI
                     AFEIGFVVVGLIYIPARYLERKFTGR"
     gene            1103153..1107492
                     /locus_tag="CNI04160"
                     /db_xref="GeneID:3259603"
     mRNA            join(1103153..1103270,1103362..1103632,1103711..1104251,
                     1104298..1104908,1104962..1105018,1105066..1105180,
                     1105243..1105377,1105427..1105569,1105623..1105673,
                     1105731..1105816,1105871..1106003,1106063..1106141,
                     1106196..1106347,1106411..1106548,1106602..1106679,
                     1106733..1106785,1106853..1106941,1106993..1107036,
                     1107090..1107492)
                     /locus_tag="CNI04160"
                     /product="signal transduction-related protein, putative"
                     /transcript_id="XM_024657897.1"
                     /db_xref="GeneID:3259603"
     CDS             join(1103257..1103270,1103362..1103632,1103711..1104251,
                     1104298..1104908,1104962..1105018,1105066..1105180,
                     1105243..1105377,1105427..1105569,1105623..1105673,
                     1105731..1105816,1105871..1106003,1106063..1106141,
                     1106196..1106347,1106411..1106548,1106602..1106679,
                     1106733..1106785,1106853..1106941,1106993..1107036,
                     1107090..1107374)
                     /locus_tag="CNI04160"
                     /codon_start=1
                     /product="signal transduction-related protein, putative"
                     /protein_id="XP_024513560.1"
                     /db_xref="GeneID:3259603"
                     /translation="MKFGRYLQENLTPEWKRAYIDYRACKKAIKVIAARLGQIKQEED
                     VDGGGSSSGPDDDHGPSAPQIKSPDTLRGSKGSLRSRLGTARDTPRLARFSSRPSENQ
                     SPNYGSTLESPHPHPPQPAVSNPPPLDLGEPGVDDDYTPSTDLRTDELHLASNPDQCK
                     DRSHTPNPKKGVAFSPTAEEIGGQRIDELPETSTRSQSSEDGKSSDGVVQSDSREPLK
                     RRPADLIVNTDKTAPSPRLLGRSGKGFLTPRLSSIRGDATPTSRGNKSPARSPARSLR
                     SMTLPSPALGIRTTATSAHPTETFDDLYDRMERDEKAFFDLLQRQLDKVEKFYVEREQ
                     EAIKRAHDLRVQLRELADHRKLYHEIYPEGIPEWEAKMGRILPNGVQPRAPAFTKIRS
                     RFKYTFDDRENTSSNPNERPNGDPNVTSSGSQSPVMSEHERQHLRQAMAEDKEHQTYS
                     PERYQKYKKDLRNAVLEFYRQLELIKNYRIMNLTGFRKALKKFEKVTKIPCLEMYTDE
                     RIAKCTFSKSEAIDDLIKQCEELYTVHFEHGDSKKARERLRRQQMEKTHYQSVFRSGL
                     MLGIGLPAAIAALVEACRDETRREIPSWEGLLQAYGGLYLPVIFALLFELNLWAYVRA
                     RINYEFVMELARPAIDYRSFMEIPAFLFLTLSYCFYFSFARVGSSNIDPTTWPAAWLI
                     FLCVFWLNPLPVLRRGTRYWLLRVMFRVLTPGYSRVEFIAFFLADELNSLAYSLQNIY
                     FIACSYANKWPGNIFTVCPAGRSWQYAIFLCLPALSRLIQCLKRYHDSKLNIHLINAG
                     KYASVITQQCLFVWWRNKGNNDSGASFIIWVIIATISAIYTCSWDFIIDWSLFRPNSG
                     LLRKDLGYSRRYVYYFAMVSNFLIRFVFVWYIPFSTQNIRLRSFFFSLAEMLRRWQWN
                     FFRVETEHLGNADAYRVTREIPLPYRRVDRDSDEESDPHEIEKSKGRSGRHHMSVNLD
                     RLRRSIRDRNTDEGRGPDALDAGPRGHAPERDYEARRPGDIQERVPIGEQRV"
     gene            complement(1107459..1110773)
                     /locus_tag="CNI04170"
                     /db_xref="GeneID:3259559"
     mRNA            complement(join(1107459..1107742,1107795..1108142,
                     1108195..1108425,1108481..1108663,1108727..1108938,
                     1108997..1109082,1109141..1109216,1109267..1109429,
                     1109484..1109585,1109640..1109780,1109839..1110010,
                     1110061..1110129,1110178..1110493,1110549..1110686,
                     1110734..1110773))
                     /locus_tag="CNI04170"
                     /product="DNA ligase, putative"
                     /transcript_id="XM_572602.2"
                     /db_xref="GeneID:3259559"
     CDS             complement(join(1107575..1107742,1107795..1108142,
                     1108195..1108425,1108481..1108663,1108727..1108938,
                     1108997..1109082,1109141..1109216,1109267..1109429,
                     1109484..1109585,1109640..1109780,1109839..1110010,
                     1110061..1110129,1110178..1110493,1110549..1110686,
                     1110734..1110740))
                     /locus_tag="CNI04170"
                     /codon_start=1
                     /product="DNA ligase, putative"
                     /protein_id="XP_572602.1"
                     /db_xref="GeneID:3259559"
                     /translation="MSDIEYPVKSNIRKKRTVILSDDEDEGLGPSVIKEQVSSPKHSH
                     LSDEETEPPRKVAKTSSKVAPIFAPKEKKEKPSPKTSSALSKAPAKKIEVKSKGEKPL
                     ASIFTKATRKPEPKDDDEMSDEVKQKGKDEEEEDEIYDEVEDKQEGEAAVKLASIFTK
                     NQKSVPVADKGWKDGEAVPYPALVSTFEKIEATTKRLEILEFLTQFLLVVAKRDTATD
                     AKGSMLLKVVYLCINRLCPDYMGIELGIGESLLIKAIAESTGRAMPKIKEDLKKEGDL
                     GKVAMNSRNTQSTMFKPKPLTVPYVFQCLTDIAKASGNASQAKKVGIIKKLLAACQGT
                     EAKFIIRSLEGKLRIGLADKTVVVALAHAIVLKTIGDKKPPPEKLAIMLEQGAETVKA
                     VYSELPSYDLVIPALLQGGVEGLRERCKLTPGVPLKPMLAKPTKAITEVLDRFEGKEF
                     TCEYKYDGERAQVHLLEDGTISVFSRNSENMSAKYPDLVDQIPRSMKPTAKTFVIDAE
                     AVAYDLETKKILPFQDLSRRKRKDVKAEDITVRVHIFAFDLLYLNGESLLAKELKERR
                     QLLQEHFQPVESEFAFAKSSDGSTTEEIQALLEESVKDGCEGLMVKMLTSESSTYEPS
                     RRSMNWLKLKKDYLSGVGDSLDLVVVGAYHGKGKRTAVYGAFLLACYDPDSEHYQTIC
                     KIGTGFSEEILTQFYELLKPLELEVVRGDIEVGGAKPDVWFEPRVVWEVLTADLSLSP
                     IYAAAHGVIDSRGISLRFPRFIRIRDDKSADEATTAEQVSEFYQRQISAGGKKGAGAD
                     VDDFW"
     gene            1110943..1113656
                     /locus_tag="CNI04180"
                     /db_xref="GeneID:3259428"
     mRNA            join(1110943..1111066,1111120..1111407,1111448..1112051,
                     1112099..1112733,1112787..1113656)
                     /locus_tag="CNI04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_572963.1"
                     /db_xref="GeneID:3259428"
     CDS             join(1110962..1111066,1111120..1111407,1111448..1112051,
                     1112099..1112733,1112787..1113632)
                     /locus_tag="CNI04180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572963.1"
                     /db_xref="GeneID:3259428"
                     /translation="MESSRSSQHGKRSERLTRTPYARPTPQGARTTPNSALGAIKSAL
                     SLFTSPFSRSTSTLPTHNAIEVDRRSESGSEDNWDGEAPAAMKGQDVFSLAAAAGRSG
                     EDFEGRQIAWRGKGEALGGKREVARRELQLAPPKASAEIRNGQPITPNTPIFPGHFHK
                     DGAASQSDPSHPSRALPAPLVPSSGVLNAATGQNSTASATAKPQPVTPSSLSLPSRLP
                     LPASFMTPTRSAIASASSSQCALALSSFLDDKQGKVLTSEDRTIIEALSSRIAVEENA
                     SPVAQERRGGWLPSSTSGEVAFRGNLSQSTSSSYLGSGTPYKQRYLGPGMSPKKMPSS
                     RSSPASDRLQSSQSNPPASVGPDASALPPSFPNRHLVNTILRYSATSSPLRQSYRPGA
                     PSTPAAAAPEPVARSPAAGGKRKPESPADRDVSKRREIEAAGRQKAAAIMQSLIEETD
                     STTPKPNTEPVRWNAYDRGSLHAKATGEPFAGPSTPAKQVPPVPISTPSTAHAGSTPR
                     KRTPLRGAAAKLEAHRQAMKGAKPLSTIERIKGVRPWDNNQSANLTAAEKVVEPEQQV
                     EEPEESEIDELDSEREQDTDAADISEVEDASRARRRAAPLTPAEEVPHPSKVPEATKF
                     EPFPTQPIGFASSSISKPAVSSPAPAAAESYDSPLRKSIIEAPKKAEESAKTFKFSFD
                     QPAKSASEAETEPATQPIVRSEIPKTSRQEKTYLSAKEAALKVDKLSLPFFTFVPPAS
                     GPIPANSTKERTEKAKAEAAKLSPPTFAFKLELSAPVRASSTPLSSAVKKVSGGKWTC
                     SMCMLENPESATEKCTICEEPRKNSTV"
     gene            complement(1114394..1115510)
                     /locus_tag="CNI04190"
                     /db_xref="GeneID:3259617"
     mRNA            complement(join(1114394..1115102,1115170..1115510))
                     /locus_tag="CNI04190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_573024.2"
                     /db_xref="GeneID:3259617"
     CDS             complement(join(1114441..1115102,1115170..1115302))
                     /locus_tag="CNI04190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_573024.1"
                     /db_xref="GeneID:3259617"
                     /translation="MAPYALYARDNSSSSNSTDSSSSSDTSSDSSVSSFMDAHGKQVY
                     IALAVIGVLLLLVFIWALCTHRLSFAPFNQRRCSKCGHGIPKSAKLDDDYFKNDDDNG
                     KKGGYLCRKCQEEKEDEELEEELESEGLGKKGLRKKDDAGTGYAGRGGRKKNKRMKDW
                     EDEDEGHNDYPDEEKQVGKQTEIKSTRATRDDIPSDRSPSVKNEKMERTTAKAAKDDS
                     GRNDNIRSTRRQEEGRRPSRQRGKEEQRKPPVRKKREESDDDDYSD"
     gene            complement(1116527..1117895)
                     /locus_tag="CNI04200"
                     /db_xref="GeneID:3259580"
     mRNA            complement(join(1116527..1117092,1117180..1117211,
                     1117269..1117315,1117367..1117411,1117469..1117570,
                     1117629..1117895))
                     /locus_tag="CNI04200"
                     /product="expressed protein"
                     /transcript_id="XM_572922.2"
                     /db_xref="GeneID:3259580"
     CDS             complement(join(1116818..1117092,1117180..1117211,
                     1117269..1117315,1117367..1117411,1117469..1117570,
                     1117629..1117802))
                     /locus_tag="CNI04200"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572922.1"
                     /db_xref="GeneID:3259580"
                     /translation="MFIQAIFGASVTAMAGLYALKSGANPTHSDNVPYEVDLHWMRKS
                     IEVMPPCHFNAYGSVIVNASNNELLCSGYNSQLEIGDPTEHGEVNAIRNCVKKYTELG
                     WTPAQITEIWPQSWIYTTAEPCPMCGSTILQSGFKRVVYGTSSPDLVGMGWTEYLVSV
                     RNKWLRKAAVVQPGFGGNRPVTQVVGHVGNNETDPRLAWQFNLDYPCPEGCHRHGEEQ
                     ICKPVA"
     gene            1118275..1120510
                     /locus_tag="CNI04210"
                     /db_xref="GeneID:3259682"
     mRNA            join(1118275..1118480,1118535..1118596,1118651..1118822,
                     1118879..1118981,1119043..1119211,1119266..1119388,
                     1119453..1119628,1119689..1119800,1119870..1120201,
                     1120280..1120510)
                     /locus_tag="CNI04210"
                     /product="cytosine-purine permease, putative"
                     /transcript_id="XM_572600.1"
                     /db_xref="GeneID:3259682"
     CDS             join(1118301..1118480,1118535..1118596,1118651..1118822,
                     1118879..1118981,1119043..1119211,1119266..1119388,
                     1119453..1119628,1119689..1119800,1119870..1120201,
                     1120280..1120422)
                     /locus_tag="CNI04210"
                     /codon_start=1
                     /product="cytosine-purine permease, putative"
                     /protein_id="XP_572600.1"
                     /db_xref="GeneID:3259682"
                     /translation="MSITPPEYDEKDIEAQTYVSPAGRQHDHASAGGLLEADDGVPRG
                     KGISAPLWKAMAWFDRFGVEARGIERVPEDDRPHTSWWDNGTLWFSVNSCVGTFSVGY
                     LGHLYYGMGLRDAALTIVFFNLLSCAPVAYMCTFGKELGLRQMVLSRFALGYWTGVIP
                     VIFNLIACCGWATMNTIAGISCWRAISTTHQIPVVAAAVILALLTLIVSFCGYKVIHL
                     YEKFAGYPVLIAFLVSMGTSAKYMDLPGAWGPSGPVEAAGVLTFGCAIVGYAIGWVGF
                     AADFTVSMPRETSTKKLFWVTFWGLAIPLIFIELMGALAVTTFSARPDWEEMFNDGAA
                     GGLLAGLLQPCGGFGKFLLVILGLSTVAVNTPNVYIFTNTFHALSPYCQAIPRPFIAL
                     IVSIIYAVLAAAGANSFSAVLENLLLFLAYWLAMYFGIVATEHLVFRKNSFDNYVPDD
                     YTNWRMLPLGVAGFFALGLGWTGAALGMNTSWFIGPIAKQIGGGGDVGFELAFGFAVT
                     TFIPLRYFEKKYWGH"
     gene            1120663..1121780
                     /locus_tag="CNI04220"
                     /db_xref="GeneID:3259488"
     mRNA            join(1120663..1120975,1121051..1121126,1121200..1121333,
                     1121457..1121780)
                     /locus_tag="CNI04220"
                     /product="GTPase inhibitor, putative"
                     /transcript_id="XM_572598.2"
                     /db_xref="GeneID:3259488"
     CDS             join(1120776..1120975,1121051..1121126,1121200..1121333,
                     1121457..1121724)
                     /locus_tag="CNI04220"
                     /codon_start=1
                     /product="GTPase inhibitor, putative"
                     /protein_id="XP_572598.1"
                     /db_xref="GeneID:3259488"
                     /translation="MSRSPSPTLSDSALLDSLEDSFDFSAHREARMEALSRQIKQVKD
                     LRESEYGRVVEFNEEKALIERMAKEKYCVLHFVHPNFQRCDIMDRHLSQLAPKHKHTL
                     FLRANVDNVPFLVTKMAIKVLPCVMSYVDGRAVDRLIGFEELGQTDNFTTKALEFRLS
                     QTGVLPTDLTLATNVSSSLLTQKQQGSRSDFEEEDSEEEKDRRRGKSGIRGGFRNKRG
                     DESDDDW"
     gene            complement(1121113..1123008)
                     /locus_tag="CNI04230"
                     /db_xref="GeneID:3259777"
     mRNA            complement(join(1121113..1122059,1122113..1122507,
                     1122564..1123008))
                     /locus_tag="CNI04230"
                     /product="spliceosomal zinc finger-containing protein,
                     putative"
                     /transcript_id="XM_572920.2"
                     /db_xref="GeneID:3259777"
     CDS             complement(join(1121846..1122059,1122113..1122507,
                     1122564..1122944))
                     /locus_tag="CNI04230"
                     /codon_start=1
                     /product="spliceosomal zinc finger-containing protein,
                     putative"
                     /protein_id="XP_572920.1"
                     /db_xref="GeneID:3259777"
                     /translation="MSEAPAPVVTFKKGPSRRPAQSRQRRRSPSPLDPVAEASASASG
                     SNVVRPERKSLANPLVQGTKRRRTNANNEEEEDGVGGGLDEFDYAAEGGLTRKGDELA
                     TRANDWDLEDVDGQGQRDKKVRLDEDGEIVTDDGLYRGASAYLPTINKTRETLDKKMK
                     SGPIKATSHVRTITLMDYQPDVCKDYKETGFCGYGDSCKFLHDRGDYLAGWQLDKLPE
                     EGVREVEEEDEEEEVPFACLICRQPFTQPVVTKCGHYFCMGCAAKRFQKSPKCYACGA
                     PTQGIFNIADKVIAKIEARNKARREAREERAEQTGGGGIEIGGGSDEEGSDEE"
     gene            1124007..1126805
                     /locus_tag="CNI04240"
                     /db_xref="GeneID:3259687"
     mRNA            join(1124007..1124157,1124215..1125343,1125414..1125937,
                     1126002..1126438,1126520..1126805)
                     /locus_tag="CNI04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657898.1"
                     /db_xref="GeneID:3259687"
     CDS             join(1125786..1125937,1126002..1126438,1126520..1126677)
                     /locus_tag="CNI04240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513582.1"
                     /db_xref="GeneID:3259687"
                     /translation="MKYKGSNPFQTSLYITSLPPGIRPAHLNRILAHPPRPLGKRRRK
                     RDTGVELIQIYTIPKKPKRRYLPKSRSTQPTGLLDPRHSPPQAIERVVSLLRTILCIP
                     HAPDLGPQRPATSTEEGSLKSQLSISSPLPSGVGDRNGTGTEVVVERELGEGELNEDE
                     NDQTTMVDEDENVMDQKQEADGEETVGYIHFCCEQHMYLGKRILRHVTIDGYRPKVRT
                     RRFNVGILRHWARPIGRITTNVDRKDKHKP"
     gene            1127492..1129143
                     /locus_tag="CNI04250"
                     /db_xref="GeneID:3259473"
     mRNA            join(1127492..1127728,1127781..1127946,1127999..1128199,
                     1128261..1129143)
                     /locus_tag="CNI04250"
                     /product="expressed protein"
                     /transcript_id="XM_572902.2"
                     /db_xref="GeneID:3259473"
     CDS             join(1127600..1127728,1127781..1127946,1127999..1128199,
                     1128261..1129003)
                     /locus_tag="CNI04250"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_572902.1"
                     /db_xref="GeneID:3259473"
                     /translation="MPAKKLPPYHPSQPEPDIAPFDISTAVDAEHDKPAGDDELLPKI
                     PKDANDKTVVFPPLILGCSTFGYGIYADDDNVRSSMPLRVVRLALRSGMNAFDTAPWY
                     HPSEIILGNALAALDYPRGSYHIITKVGKYGPNSSDHMYSPEVVQASVERSLRRLRTD
                     YLDAVYLHDVEYALPGPSYEGDPVSLLSTILSQPPVPTAEELKILDGIGALRKLQTTG
                     HIILVGIAGYPLPILLRLALLVLHSTRKPLDVVQTYAHHTLQNDALQQGYLQALAEKA
                     GVRQIVSASPLAMGLLTTSGGPGWHPAKDYPELFNATRAAVELCKEKGTKLEDVALSF
                     GYRPLSQPNGRRVPIVVGCKDLQEMKETVRRWKEVNPAQGGEGGLEKKELEEEVKKLF
                     TEKGVQGWSWACPSEAQRAG"
     gene            1129692..1130417
                     /locus_tag="CNI04260"
                     /db_xref="GeneID:3259565"
     mRNA            join(1129692..1130176,1130244..1130417)
                     /locus_tag="CNI04260"
                     /product="expressed protein"
                     /transcript_id="XM_024657899.1"
                     /db_xref="GeneID:3259565"
     CDS             1129748..1130137
                     /locus_tag="CNI04260"
                     /codon_start=1
                     /product="expressed protein"
                     /protein_id="XP_024513539.1"
                     /db_xref="GeneID:3259565"
                     /translation="MSPQSILVSYNLCPPAETPQPTAGPSSQPVPSSATFSFPIPPPS
                     LKTKASTLSATTQYYTSASAALLAAQATLNEKLTYWKDAIGDKEKAKEDVGAVGFGRG
                     KAMMMSNEVIGEMKNGQEQEESSEEEE"
     gene            1130811..1135022
                     /locus_tag="CNI04270"
                     /db_xref="GeneID:3259810"
     mRNA            join(1130811..1131216,1131279..1131365,1131433..1132127,
                     1132187..1132303,1132383..1132999,1133084..1133179,
                     1133256..1133344,1133447..1134001,1134114..1134336,
                     1134407..1134651,1134710..1135022)
                     /locus_tag="CNI04270"
                     /product="protein phosphatase, putative"
                     /transcript_id="XM_024657900.1"
                     /db_xref="GeneID:3259810"
     CDS             join(1130909..1131216,1131279..1131365,1131433..1132127,
                     1132187..1132303,1132383..1132999,1133084..1133179,
                     1133256..1133344,1133447..1134001,1134114..1134336,
                     1134407..1134487)
                     /locus_tag="CNI04270"
                     /codon_start=1
                     /product="protein phosphatase, putative"
                     /protein_id="XP_024513540.1"
                     /db_xref="GeneID:3259810"
                     /translation="MSDPPTPLTLPPTLPYPITLTRLVARPGDKIKRGSRLLEYTFMS
                     SDLKEKVAKRRLQGGGMGEIENEKEKDDLSGTWESLIDGDVVEWKGAKPGMIVERNQA
                     SQIIVTVQQACSHPVQLHGLCGVCGADLTEDDYLSRPVSNQTQAGPSRYPGGFEIAHD
                     AMGVTVSKNEAQRLENLTRDALLSTRRLSLIVDLDQTIIHTTVDPTVAEWMDEIHREE
                     MKDAQEKANVPTEEVKGKGEETTTPPGSPGPGALGITVESPKEKNPNAEALRDVAKFQ
                     IADDLPPGYVKLKTKTTKGQNPPESEGRWYFTKPRPGLQRFLDEMCQLYEMHVYTMGT
                     RTYADAIVKVIDPDGKIFGGRILSRDESGSFSSKNLKRLFPTDTSMVVVIDDRSDVWG
                     DCPNLVKVVPYDFFLGIGDINSSFLPTNKSTPPPSAATTAATTAAAASSSSAPLSPSL
                     STSPSPPPTLPPSPPSASSNASTPPPVTPSEVSADLEPIERVEPVEPTREEELMMQAK
                     LLDQLSTSRPLARLQEELEKEDSEDDESGEGQGGEAAVAAEAETGMKKVTGKEEEKEK
                     EHEEKAVASVRDDSRKERSKSPNKHRKPLLNPNDYELVRVANILQEIHSRFYKAFDAI
                     DGWDPKKALPMSCDVEFIIPEMKAEVLDGCNLVFSGMIPREANPSTTAIWQTAESFGA
                     LITPSLTPRTTHLVTALLNTEKTWRAGKMEGVKVVWAEWFWDSVALWERQDEEKYIAG
                     KKEGTGDAGKGVGPEGEAGNSDNHKDLKEEDEDGEEHEDMNDDTQVGQGWDEEAEREW
                     EEFMAGEDDWSDGEGSVGSRKSVKGESAPSTPSKKRVRYADEELLPLEEFKDPSPTAS
                     SDAPPSKRHKAYLIEDTTSGEERSEESRSQHKDHWTYEADVEKHDEKAGDEDDGRSVA
                     ESMEGAEGDDEFALLLMDSLANDDADGDENRDGDSVVAGEK"
     gene            complement(1134997..1140426)
                     /locus_tag="CNI04280"
                     /db_xref="GeneID:3259457"
     mRNA            complement(join(1134997..1135874,1135930..1136013,
                     1136065..1136284,1136336..1136763,1136812..1137193,
                     1137259..1137432,1137491..1138054,1138100..1139234,
                     1139279..1139417,1139467..1140025,1140083..1140426))
                     /locus_tag="CNI04280"
                     /product="Rho guanyl-nucleotide exchange factor, putative"
                     /transcript_id="XM_024657901.1"
                     /db_xref="GeneID:3259457"
     CDS             complement(join(1135321..1135874,1135930..1136013,
                     1136065..1136284,1136336..1136763,1136812..1137193,
                     1137259..1137432,1137491..1138054,1138100..1139234,
                     1139279..1139417,1139467..1140025,1140083..1140403))
                     /locus_tag="CNI04280"
                     /codon_start=1
                     /product="Rho guanyl-nucleotide exchange factor, putative"
                     /protein_id="XP_024513441.1"
                     /db_xref="GeneID:3259457"
                     /translation="MPPSGPRQKQSNDNPNVRNQVFENIFGRPARGHHLATQSSQQQY
                     VNPAQPNYPPTMPYHPTPPPQSQVPPPPPQPQVPPQRQPTYPMYRPVPTRRPDPYDGV
                     EYLPNDNEGRRRSSLAPSSYSAASSPSVYSPNPELSPPQPTVRLPPTAFPTPMPRLPS
                     GPTQAFPAGAMTPAQAYQASQGYPTSSVAFPRPSTASPAIPTQATQNIGTPFDPSSSV
                     TSFSTTNSATSRIPTSTSITSFHKPTSQSPSLAETSKERSATPDYIGKMGQLAFESNP
                     GENWMEDVTGISVSPDDGRNPVLPPKSLHGHGTLSDIGRASMHKRMASDSSILSGDNA
                     TKAGLASRSPAASPTYDTASSPTTPTVDMSFHPRASTDSTVSLPLALHTTESLPPGAR
                     RGYENRSTSFSGSSREIIRPLSNPAARLSNPQAQSQTRAPLPSLYPAILSMVSAAFKS
                     YIPLADLTKDGITYKDSFSGQAAVTLIAELIKTSDRNLALLLGRSLDAQKFFHDVTYD
                     HRLRDNPKEVYRFKDRLAAPFTDTNGNGESPVSEGRLTRNGSGASSTAMGLGGGLKAL
                     TAARPADSSSSMHTESTPVSMTPSRSSTMPFLDSDSPDGLDSEDTLPVGVFTLLTDCY
                     SPTCSRDSLCYSINCPRRLEQMKRLNMKPEPGLNRKLSRESLVDVKETGTLWIHSVSQ
                     EILDSVDDKEKKRQEAINEVIYTERDFVRDLEYLRDSWVKPLRTQEVIDAKRRDDFVR
                     QVFWNVHDVLSVNHVLAERLTKRQKKEPVVSRIGDIFLERVPLFEPFVTYGAHQLFGK
                     YEFEKEKGANPVFQKFVDDTERKPESRKLELNGYLTKPTTRLGRYPLLLEAVLKYTPD
                     DHPDKEDLPEVIKMIRGFLTKVNAESGKSENIFELAQIEQQLVFRPNERIDLRLRDKN
                     RQLVHKGPLKRRGGNREEIADLLGFLFDHAFLLVKPKWVNKSEQYKVYRRPIPLELLV
                     LVTPDEQYNSGKLSYGHGRSRLITRHPNSKTNHSSQNNSITAPPKPESKHGFSITILH
                     LGKKGYSMQLWVDTHIGRKKWLENIDKQQGLLREKSTVFVSETITEGILSGVRKVNCS
                     SPYDQGNRMIFGTDEGVYFANLRDEKLREPVKVINLIDVTQVDVIEEFQLLIVLHERC
                     VTTFPLDSLDPSDPNAALKRGKRISSHTSFIKSGVCLGKTLVAIVKSSTLSSTIKVME
                     PVDLSQNRKKTQAGFMKRLNGKDDALKLFKEFYIPTESSSVHFLKTKLCVGCTKGFEI
                     VDLETLDMQGLLDPSDGSLDFVLKRDNVRPIAIYRIEEDFLLCYDEFAFYVNKNGWRS
                     RPKWAIVWEGIPTSFALQYPYVIAFEPTFIEVHHVETGHLVQIIPGNNIQCLFADTPP
                     SRVNAPLPPNRMMYAPPTLGTPPYARPPNMPGYPAYPNVSYPGHPQQPRQTSNGAYPP
                     HRINQAPSAGVRHPQQTPMGYGMPAPHPPPLMNRFARPQVVFVSDDSHVQFLKFPPAS
                     HSHPQRPVMTHYQTAPAGHSARSSR"
     gene            1141610..1145546
                     /locus_tag="CNI04290"
                     /db_xref="GeneID:3259653"
     mRNA            join(1141610..1142224,1142280..1144664,1144728..1144922,
                     1145006..1145140,1145200..1145546)
                     /locus_tag="CNI04290"
                     /product="protein kinase, putative"
                     /transcript_id="XM_024657902.1"
                     /db_xref="GeneID:3259653"
     CDS             join(1141635..1142224,1142280..1144664,1144728..1144922,
                     1145006..1145140,1145200..1145281)
                     /locus_tag="CNI04290"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_024513550.1"
                     /db_xref="GeneID:3259653"
                     /translation="MSGRPFKRESWRPTKRPPTFAAAAQQPPLSSANALPARTWGGTP
                     VPTAPKRFERDPSSNVKEEAHLSRWDDKGSNDGKWDQRDWDQRDDRSRYGNSGNGKRR
                     QSPSRQPDSTRDERFSSARRSYSPPVPAPSPANPSNYPATRRPLPPAQPPASHHHTRA
                     RRPSPDYGTSGPAAKKRKGGARKRDSPDYGVGSREDAASSYRRSPSPLSNRSRSRTRS
                     RSRSPAPSHHSQSNSYSLPKTQTHTYTPSQSHRKRSPSPSMSDRQSSSGRWSKRDRYN
                     NHQYGKYDKDDRNGKFDSRDNGWENEGNRNWRDRDTDRDGHRRDRGMGDRGGRRDKDW
                     RQDKGYVYDRRDRERDRDRERDRDRDRDRGSGWQASRRDRDYPPIGPRGYTSSASQLR
                     HDYQTAPSPPHSAHVQAPPPPSDFYDRRRDSPDSYGHQNHSHGQRQGRSPIQDREYPS
                     RSNFVTNANANSILGTSTTRKWGESGRYLYEQSYQPPSTVSRATSVSRDYSPSPQHSY
                     ALPAATSDTVPLPVHPPAPVYPPQPMSFAEYIPKADDPISVPRPQLESSFQSLPDTAG
                     PTAELQTRTSPVKISFGQPSGGAVKKGWKSISPKKKARVSLFDEDEEEIQGAKGEKED
                     KKEVMPEKEQDIMGEALPHPDTLIHRLTLASTRYTTLLTSLSAPLRAAFDSFSTLPSS
                     PPPPPIDLFLDEYLGRKARDDEVKRVEEVWDAKKEWEREEEMGRRYLEEVGKGGRVEG
                     VNVAPAEPGGARVSPAAVVVAPKPEPELAPIPVSGTELQAPAPGAEPHPQTQKVPIPL
                     PPAATLVYQKLAAVGEGTYGKVYKALSLITHQPVALKRIRMENEKDGFPVTAMREIKL
                     LQMLQHENVLRLVEMVVERGGVYMVLEYMEFDLTGLLAHPEIKFSPANIKSLSHQMLS
                     GLSYLHRQSILHRDMKGSNILVNSRGELKLADFGLARVYAKKRREDYTNRVITLWYRS
                     PELLMGETIYGPEVDMWSAGCIILELYTTKPIFQGSDELNQLEVIYALLGTPTEAEWP
                     SVKELPWYELVKPKEEIGSKFRTSFAKWLSPAALDLVEGLLFYDPSQRLLADSALQTD
                     YFLMEEPKMEKPTQLEGMGEHHEMSAKAERKRRRMEEGGE"
     gene            1145686..1145765
                     /locus_tag="CNI04300"
                     /db_xref="GeneID:3259725"
     tRNA            1145686..1145765
                     /locus_tag="CNI04300"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:3259725"
     gene            1145845..1148868
                     /locus_tag="CNI04305"
                     /db_xref="GeneID:36393045"
     mRNA            join(1145845..1146204,1146248..1146313,1146380..1146628,
                     1146677..1146920,1146970..1147176,1147226..1147613,
                     1147678..1148073,1148158..1148283,1148342..1148403,
                     1148484..1148868)
                     /locus_tag="CNI04305"
                     /product="hypothetical protein"
                     /transcript_id="XM_024658745.1"
                     /db_xref="GeneID:36393045"
     CDS             join(1146068..1146204,1146248..1146313,1146380..1146628,
                     1146677..1146920,1146970..1147176,1147226..1147613,
                     1147678..1148073,1148158..1148283,1148342..1148403,
                     1148484..1148702)
                     /locus_tag="CNI04305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024514415.1"
                     /db_xref="GeneID:36393045"
                     /translation="MPRHVIRPLPKAFQPHRESHSHNDRNMWETLDRVQVLGDNQQGH
                     HGCVNALSWSDDGQTLLSGSDDRRICIWQPDTTSHFSPSPHPLKLSETISTGHRANIF
                     SAKFLPYANTPRIVSVAGDRDVRVYDVESLGRRMGESGDWELDGVSGEGVTLLKCHKN
                     RVKRIATENSPSLFLTVSEDGTVRQHDLRRPHSCSSECPEALFQAPRGVDLYSLSVST
                     VTPHIFAVAGTSPYAYICDRRMLPRQTPSWGPYIKSAGDVYCVRKLGLPDEEWETVSP
                     RGRRRLFDGERHVSCVKMSGENADEVAVNFMKHSTALFSIHDSPSSPSARSPSASSVI
                     APEISSGRSRRSKSHDPTGVLPQSGAGEGVENTDEPVSRERRMSTRNISDSGRGRDGR
                     QISTDGESVSGRIEDLASLLERQIAEEEREEEEDSDEGDFAHLRGLAQGFQHDSGEYN
                     IVGPVRSLEERGDGMDYLMSDDYLDLVRNGDENGPQNEDDDGHEDENEDEDEDEDDED
                     EAMFDDDEFFDSPIFGFPFGGHSSTAPREAYDNVEIIHPRRMFKGARNVETVKDCNFL
                     GTKSDKIASGSDDGYFFVWDKESGRLEGIWEGDGSVVNVMEQHPTLPLIAVSGIDSTV
                     KMFSPIHNRPAPSISFNRSHLASTIVDRNTRPPRFVSGSIFESAALLQLLESRGVTVA
                     NLEDEADGERECTTQ"
     gene            complement(1149069..1151396)
                     /locus_tag="CNI04310"
                     /pseudo
                     /db_xref="GeneID:3259616"
     gene            complement(1152282..1155408)
                     /locus_tag="CNI04320"
                     /db_xref="GeneID:3259620"
     mRNA            complement(join(1152282..1153781,1153841..1154985,
                     1155101..1155408))
                     /locus_tag="CNI04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657903.1"
                     /db_xref="GeneID:3259620"
     CDS             complement(join(1152331..1153781,1153841..1154969))
                     /locus_tag="CNI04320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513586.1"
                     /db_xref="GeneID:3259620"
                     /translation="MRPVAMAVAGPGPTSWLHRIALFSSRSPMPASSSRSSSSTTSQK
                     SRRKPSSFKPTPKSQHPPSKKPITLRRMDVIENDVILLRPPPDYPITAQLEELSIAMK
                     EYNLDRVIFIWSHLVDLGAISRFDSITFKYISEFIADILHRRGSPNLNKLAAISPEKY
                     GLLLNMSIESAARDHISGFFFILLRLLEIGRPGDVVNAFNTCKVKMRELQGKDANDLL
                     SWDREKRLAARLEGEGLRSLMMVNIAALTLLDQCDEAALFGMLDATADLRPNSKFNFA
                     PIHRSLSRANVSNKQHDLYSQFRQNVDKLILALQCYHPNAFVHRITIHGRAKTFGALN
                     KLYQQVLEATVGPDAFVKVRNLGDHSAHFQSSKHIPLPAIVWHQFLRAFEHRNDVDRI
                     VSMIDTDLPLRNLRPDSTILSLAMVHMAIISTRLHLPLQTRQNARYWADEYWRRLAQN
                     GWHMEDLAFSRRVRTLDILGRKEAQLKGEVDKLYDMAKAGHLSKIGRQTRAAFVESFM
                     ARNDIKQTLDVFKMFPHNPSAEQHDFTPAVSAFIRLLATRNYTANKSFTFCARILKLV
                     AQTGTPIETSTLGPLLSIQLNAGLPIQPAVDTILSHSLTPTHPIPGINKWTRILTGLL
                     TKWSHCRPATKVELEAGLYILSKARDEDLYGRKREREYDLWLAFLRPAAKTTSLNNEE
                     RYEIIETAMSLFPRGGKGKLSTIVWFEVVHALVTRPDGLGFGEGWARWCELVKIRELE
                     GIWWDRMLRTIVRINHNFAVNLVRSAWEHGNTKVRVDEAFWMRAEAEGLVKELGIEQH
                     LEKKRNGLVEGKSWRQNLVTHMMEEDDDMVDWDMMLGKEEVIDEVEAEYGGGDELSMG
                     EEE"
     gene            1155592..1157391
                     /locus_tag="CNI04330"
                     /db_xref="GeneID:3259570"
     mRNA            join(1155592..1155644,1155714..1156400,1156445..1156786,
                     1156832..1157391)
                     /locus_tag="CNI04330"
                     /product="cell division control protein, putative"
                     /transcript_id="XM_572594.1"
                     /db_xref="GeneID:3259570"
     CDS             join(1155604..1155644,1155714..1156400,1156445..1156786,
                     1156832..1157339)
                     /locus_tag="CNI04330"
                     /codon_start=1
                     /product="cell division control protein, putative"
                     /protein_id="XP_572594.1"
                     /db_xref="GeneID:3259570"
                     /translation="MLEENTSSNLPGDVSNPFITKPNSPKKSRGNSSTSDSTLASLRQ
                     GMGRMDISSKGSSIPYTIDVRERKDSKDTRRELDRFVPARPASLSHNSHSSSTLPTLA
                     IDSAGHTPDTSVDHSLSQDQSTLSLQASLGLNSNRRILSFQSAPPLASHATSHLDAQR
                     NYLLQSSASANRGTGSHSGKDTKKRAPPYMPERVLDAPGFEDDYYLDLIDWSCANRVA
                     IGLGDMGYVWDAETGSVSALGSGAEEDTNKVTSVSWSNDGAYLAIGLDTGDIEVWDVE
                     ENKKMRTMKGHLARVPVMSWHGHVLTSGCRDGSIYHHDVRVAKHKVMELVGHNAEVCG
                     LAWRSDGQFLASGGNDNVVNCWDGRIGASILNDEGTPRGVAKWTKRNHTAAVKAIAWS
                     PWQSSLLATGGGTADKHIHFWSTSTGARTASLPTSTQVTSLIFSPHSKEILGTHGYPD
                     NTLTLWTYPTLEKIWEVPAHDSRIISSALSPDGTTVCTGAGDENLKFWKVWEVRQAKK
                     EREEGESGRGKTAVRIR"
     gene            complement(1157371..1159209)
                     /locus_tag="CNI04340"
                     /db_xref="GeneID:3259390"
     mRNA            complement(join(1157371..1158086,1158150..1158517,
                     1158568..1158862,1158916..1159134,1159189..1159209))
                     /locus_tag="CNI04340"
                     /product="40S ribosomal protein S0, putative"
                     /transcript_id="XM_572918.1"
                     /db_xref="GeneID:3259390"
     CDS             complement(join(1158010..1158086,1158150..1158517,
                     1158568..1158862,1158916..1159054))
                     /locus_tag="CNI04340"
                     /codon_start=1
                     /product="40S ribosomal protein S0, putative"
                     /protein_id="XP_572918.1"
                     /db_xref="GeneID:3259390"
                     /translation="MSADKLPKALQATEDDIQLLLAAQCHLGTKNCDKSMENYVWKRR
                     ADGIHVINVGKTWEKLVLAARVLATIENPNDVCVISARPYGHRAVLKYGSFTGAQAIA
                     GRFTPGSFTNYITRSFKEPRVIIVTDPRVDHQAIREAAYVNIPVIAFCDTDASTKFVD
                     IAIPANNKSRHSIGLMWYLLCREVLRLRGTVPRGPTGPSGWDVLPDLFFYRDPEEIER
                     EAAEKAAAAAAQEGADAEAAATSAAAGVTAEYDAGNAADAVLAAQPTETALDWSDEPV
                     AGDWAAEPAADAQGGW"
     gene            1159487..1164240
                     /locus_tag="CNI04350"
                     /db_xref="GeneID:3259710"
     mRNA            join(1159487..1159801,1159853..1160161,1160220..1161197,
                     1161260..1162901,1162965..1163054,1163135..1163250,
                     1163408..1164240)
                     /locus_tag="CNI04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657904.1"
                     /db_xref="GeneID:3259710"
     CDS             join(1160390..1161197,1161260..1162901,1162965..1163054,
                     1163135..1163250,1163408..1163742)
                     /locus_tag="CNI04350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513583.1"
                     /db_xref="GeneID:3259710"
                     /translation="MSRAATATPPPQTYFPQRNATPSMRHAAPSPAIHFGRQHQHLGQ
                     SHVKRRVKGNGGSGLKKQHIPNSREQNEEDQLGMSFEDLGAERVLQNPNSDKADIDVD
                     IDIDLDLDPNLTPASSRASIVSGLSQDQGPVLLTPVQSDSEGRGPVLVSNSGRVSSAG
                     SEGGEEEGRASPGWMGKMAMAVVNTGMSVSRGFGNAQAHGKRVQSQPQPQPQAQAQAH
                     DQTLAHPAEKIDDQQRQREWAEAENRRIHECARLCSQWPLSGYNLGKYGPGGAATFYQ
                     PQSFCNPQHVAWVMHRQAQIEQRLALTEGTFFDCRKVRQRKRQGDCENGRGCRAREED
                     EQSEVSTSTDDSTLSSRLSGSTCSTDSRSNSTANSSNPSSSQDENNSEPLSLVQPQRP
                     SAPRSLTAEHYAYGRTAQKMEREKEMAEDLREAMACSLLEFSHPERRGSVTSSATKDV
                     SADGRDENGEKLENAEVEGRRERGRKMFAELEALARDVGLGHVGEGMDVDEDLCEESQ
                     PQPQPDTQATPSAQTHAASYSSEPSMPRTRTQRAQSCGSKRPIPSTRCSADGEEEKRR
                     KVRPVAPPTTSSGFDPMCTATMEVEEAVDEAMVVEEAVDNGVIMPATQTQSQNQSHTG
                     ESRLKTGRGKGMSSSVPDLSKTYPHSESATTYPPQRQQQPEQSNSRDIYPPPAVFGVV
                     VKTSESHPIIISPFFPKDLLGILAEHLVLPLGGARKPLLLGSKLDVPSLLLSYSPGMP
                     FPSSGSMRNQSQSTQTQPVSNLCQAPRVPALGNLLLSSCPGKRLRMEGPSKGRGPVCR
                     DLATDLKRIKGEGVGCLVCCLDDEELELLGVPWETYRDVAAETGLDVIRLPMPDGFTP
                     VSMELFDSQVSLIATKYTLQGINVLVHCRGGVGRAGMTACAWAIKMGFVQPHPSLVIV
                     EEAARQRYNLTHGISPTSNSPTPIAPSAAVPAELEHQIVMSMVERVIAMIRCRRGLKA
                     IESFEQVAFLMRYVGWLRQGARSA"
     gene            complement(1164336..1166139)
                     /locus_tag="CNI04360"
                     /db_xref="GeneID:3259636"
     mRNA            complement(join(1164336..1164620,1164699..1164812,
                     1164905..1164941,1165043..1165253,1165366..1165528,
                     1165596..1165676,1165738..1165745,1165805..1165886,
                     1165950..1166139))
                     /locus_tag="CNI04360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_024657905.1"
                     /db_xref="GeneID:3259636"
     CDS             complement(join(1164467..1164620,1164699..1164812,
                     1164905..1164941,1165043..1165253,1165366..1165528,
                     1165596..1165676,1165738..1165745,1165805..1165886,
                     1165950..1166023))
                     /locus_tag="CNI04360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_024513585.1"
                     /db_xref="GeneID:3259636"
                     /translation="MLSNQLARSMEIGMQMPRIMYGTAWKKERTAELVCQAVKAGFRG
                     IDTACQPKHYREDLVGQAIKSLISEGVVKREELYIQTKFTSVDGQDPSLPLPYDPSSP
                     IEEQVKQSFETSLKNLGVEYLDAVVLHSPLKSREDTLKAYLTLSRFFSTKQIRHLGIS
                     NCYDPLLLQWLIDSVAEYSSKHQEEPEVKVGIVQNRWYEGNGWDWDVYDICRAHGIRY
                     QSFWTLTGSPTLLKQPFLINLAAKYGLTPEQTVYKLCQLWDITPLCGTSSLAHAKEAV
                     SVENATGLMSSTEEVVELWNAMGGRYKEGSH"
     gene            complement(1166246..1168107)
                     /locus_tag="CNI04370"
                     /db_xref="GeneID:3259650"
     mRNA            complement(join(1166246..1166574,1166705..1166749,
                     1166839..1167034,1167088..1167209,1167294..1167483,
                     1167563..1167801,1167851..1168107))
                     /locus_tag="CNI04370"
                     /product="lectin, putative"
                     /transcript_id="XM_572915.2"
                     /db_xref="GeneID:3259650"
     CDS             complement(join(1166533..1166574,1166705..1166749,
                     1166839..1167034,1167088..1167209,1167294..1167483,
                     1167563..1167801,1167851..1168051))
                     /locus_tag="CNI04370"
                     /codon_start=1
                     /product="lectin, putative"
                     /protein_id="XP_572915.1"
                     /db_xref="GeneID:3259650"
                     /translation="MRRNPTLSLLSLTALTAISGVNAAESEDSLASVIERTVPLRTHS
                     LAAPYVDTDLQNRWWDFGGDTIINTNKHVRLTQDKPSQSGWLWARMPLSVSNWQIDVE
                     FKVDGKAHNIFGDGWAFWLTSDRAKQGPVFGSVDWFKGIGIFFDTYANSKHAYTFPRV
                     SAMLGDGKTSYDHDRDNEANEIGGCSENFRRRGDVPTKARLTYVKGRALQLKLQTKKS
                     DEWKICFETNVDLPESPYIGFSAATGDVSDDHDIVAVNTYSLTLKPEYRASKSSSDSK
                     SKSKSDGKQAAMNANTNGMSGKGRKEVKSGGTGWFMFILKVIGVLAFIAFAVAAFKTY
                     NEQQKSKRHW"
     gene            complement(1168175..1169457)
                     /locus_tag="CNI04380"
                     /db_xref="GeneID:3259577"
     mRNA            complement(join(1168175..1168756,1168816..1168852,
                     1168904..1169457))
                     /locus_tag="CNI04380"
                     /product="glutathione S-transferase, putative"
                     /transcript_id="XM_572592.2"
                     /db_xref="GeneID:3259577"
     CDS             complement(join(1168396..1168756,1168816..1168852,
                     1168904..1169402))
                     /locus_tag="CNI04380"
                     /codon_start=1
                     /product="glutathione S-transferase, putative"
                     /protein_id="XP_572592.2"
                     /db_xref="GeneID:3259577"
                     /translation="MCRAFPLHSIFRIATVSHTAIRNMTASSLPSSPIPSPRRPESFP
                     PEATTVTPKLHLFTAATPNGYKPSILLEELHDAYPDNPEIVYDFTQLRFDHTDQKKPE
                     FLKINPNGRIPALVDDSVEGGHSVFESASILLWLVERYDKEYKFWFKDPLQRSKALSW
                     IFFAHGGVGPMQGQANHFFRYAPEKIPYGIKRYQDETARLYSVLESQLAKSDSQGYLV
                     GGKFSVADINVFPWVRSYSWAGVDITPFPNVAKWLERIEARPATYKGLGVPERRKGKR
                     SKEEEEEDAREASKWVMDGQKK"
     gene            1170295..1171447
                     /locus_tag="CNI04390"
                     /db_xref="GeneID:3259566"
     mRNA            join(1170295..1170574,1170685..1170758,1170841..1171048,
                     1171118..1171447)
                     /locus_tag="CNI04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657906.1"
                     /db_xref="GeneID:3259566"
     CDS             join(1170354..1170574,1170685..1170758,1170841..1171048,
                     1171118..1171337)
                     /locus_tag="CNI04390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513437.1"
                     /db_xref="GeneID:3259566"
                     /translation="MSRSYSCLLTLPSRYLIVVVRLLVPFFAALTVLFLILPGVSGNK
                     TGFYWVNIEYEGNEGTWEVGALGSCQYGTECSSAGQTSPPYWGSIHSLLTFHIASAAI
                     FFLTSCFASALSHFPSAPFTMKYGPFASIFGPLFPCIVMISDIMVVHRLKSEGDVKVV
                     EVVDSYWLGTVGFVMSVLWFLAVQYDGYLRRLEAGDNEEVKEVKDEENNIVTRLAHAS
                     YSWWPWSSETGQETTMTRNGRG"
     gene            1172086..1174759
                     /locus_tag="CNI04400"
                     /db_xref="GeneID:3259684"
     mRNA            join(1172086..1172307,1172364..1172557,1172698..1172768,
                     1172831..1172986,1173052..1173293,1173362..1173423,
                     1173474..1173504,1173554..1173845,1173972..1174055,
                     1174123..1174147,1174221..1174312,1174379..1174759)
                     /locus_tag="CNI04400"
                     /product="kinase, putative"
                     /transcript_id="XM_024657907.1"
                     /db_xref="GeneID:3259684"
     CDS             join(1172235..1172307,1172364..1172557,1172698..1172768,
                     1172831..1172986,1173052..1173293,1173362..1173423,
                     1173474..1173504,1173554..1173845,1173972..1174055,
                     1174123..1174147,1174221..1174312,1174379..1174397)
                     /locus_tag="CNI04400"
                     /codon_start=1
                     /product="kinase, putative"
                     /protein_id="XP_024513541.1"
                     /db_xref="GeneID:3259684"
                     /translation="MSKFKISSALWDKIYHFASFPQTGVSLQQMILFGQNPSQGTLLK
                     ASQFLSEELPIRLSHRVVELEGLPDGLNKMTSINIVKEWYAQSFDELVSFPRPRLKPE
                     LEDILRIPPAPTQPFPSATPNPSLDPLMREGPVGSGFVSERHIGTGGNGIGVGKRLRI
                     PIERRYFSPPPPTIIYPPEVHDYNEKFTQLLQVIKHRHDPTVTTVAQGVLEWKRMQKT
                     SVIGTPIQEFLDRFYMSRIGIRFLIGQHIALNTLPPHPDYVGIICTRANIHDICQEAI
                     DNARYVCEEHYALFKSPNIKLVCPPNLTFPYIPGHLSHICFELLKNSLRAVVERYGVD
                     NDDEYPPIKVVVVEGREDITIKISDEGGGIPRSAIPHIWTYLYTTMSDEGLEDTIQGS
                     DFKAPMAGFGYGLPLSRLYARFFGGDLRLISMDGYGTDVYISLNKLSSSREPLQ"
     gene            complement(1174963..1176341)
                     /locus_tag="CNI04410"
                     /db_xref="GeneID:3259689"
     mRNA            complement(join(1174963..1175651,1175727..1176007,
                     1176079..1176341))
                     /locus_tag="CNI04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_024657908.1"
                     /db_xref="GeneID:3259689"
     CDS             complement(join(1175316..1175651,1175727..1176007,
                     1176079..1176325))
                     /locus_tag="CNI04410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_024513584.1"
                     /db_xref="GeneID:3259689"
                     /translation="MYTHNSINAPPPPYTPLAPPGRPSAKPSLANLPLHIVHRILILT
                     LDQKATPSKFWSDPDEERVRRLWGMFRGLRGVNRVFWLVATSILRAHYLPFYLALVKP
                     SYSSDPFPLESSTLASPSLSIDPSNLGDVYAMRGRETAVLDKFVATRVGEELRRMESE
                     LSEGSEAERDIFGRLQPSARSEDLLSTLPQTLITPTTLLPSPPSPKRALPLPQSLVSI
                     NFTPTWAQLYINASPVALTKVGGGREMVVEVRRVDREGNMRSLEGTVRMIGEALEDMR
                     RGLVKWGGRVG"
     gene            1176685..1178007
                     /locus_tag="CNI04420"
                     /db_xref="GeneID:3259529"
     mRNA            join(1176685..1177181,1177247..1177582,1177665..1178007)
                     /locus_tag="CNI04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_572588.2"
                     /db_xref="GeneID:3259529"
     CDS             join(1176699..1177181,1177247..1177582,1177665..1177907)
                     /locus_tag="CNI04420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_572588.1"
                     /db_xref="GeneID:3259529"
                     /translation="MFRLTLTKRLARASAHVTPSPHPRLLSTSYSLFNKGPPTTQGHA
                     VGKGNDDPQAEAAKQGAAVKGTSSSSSTSTSGEAEPFDAARQAGGEKKWSKSQETSGA
                     GKGQSGAFKDQVGGQEGSTPGVSYGGQEDAAADRTHQGIKNTQPGSNKGNFDNLKKMR
                     EEGKNLHTSTRASFPTPSSVPFAPTSANPPGSNKPIESLPSDQNEHLKHSPASSPDKG
                     KGNAGEEPHLPSQQGQNKAGGSKGQTKGLHTSAKVSGNPPGRKYAKAFPGDRSGGDAP
                     AEALPPELESDYGPEANQPAPEDLKPSSGLPHSSTAQEPPHPVLADHAKSGKLAERNS
                     QPTAEMGRQGNSEAWKHRK"
CONTIG      join(AE017349.1:1..1178688)
//
DBGET integrated database retrieval system