LOCUS       NC_007364                865 bp    cRNA    linear   VRL 13-AUG-2018
DEFINITION  Influenza A virus (A/goose/Guangdong/1/1996(H5N1)) segment 8,
            complete sequence.
ACCESSION   NC_007364
VERSION     NC_007364.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Influenza A virus (A/goose/Guangdong/1/1996(H5N1))
  ORGANISM  Influenza A virus (A/goose/Guangdong/1/1996(H5N1))
            Viruses; Riboviria; Orthornavirae; Negarnaviricota;
            Polyploviricotina; Insthoviricetes; Articulavirales;
            Orthomyxoviridae; Alphainfluenzavirus; Alphainfluenzavirus
            influenzae.
REFERENCE   1  (bases 1 to 865)
  AUTHORS   Xu,X., Subbarao, Cox,N.J. and Guo,Y.
  TITLE     Genetic characterization of the pathogenic influenza
            A/Goose/Guangdong/1/96 (H5N1) virus: similarity of its
            hemagglutinin gene to those of H5N1 viruses from the 1997 outbreaks
            in Hong Kong
  JOURNAL   Virology 261 (1), 15-19 (1999)
   PUBMED   10484749
REFERENCE   2  (bases 1 to 865)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-AUG-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 865)
  AUTHORS   Xu,X., Subbarao,K., Cox,N.J. and Guo,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-1999) Influenza Branch, Center for Diseases
            Control and Prevention, 1600 Clifton Road, Atlanta, GA 30333, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to AF144307.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..865
                     /organism="Influenza A virus
                     (A/goose/Guangdong/1/1996(H5N1))"
                     /mol_type="viral cRNA"
                     /strain="A/goose/Guangdong/1/1996"
                     /serotype="H5N1"
                     /db_xref="taxon:93838"
                     /segment="8"
     gene            15..852
                     /gene="NEP"
                     /locus_tag="FLUAVH5N1_s8gp1"
                     /gene_synonym="NS2"
                     /db_xref="GeneID:3654622"
     CDS             join(15..44,517..852)
                     /gene="NEP"
                     /locus_tag="FLUAVH5N1_s8gp1"
                     /gene_synonym="NS2"
                     /note="nuclear export protein"
                     /codon_start=1
                     /product="nonstructural protein 2"
                     /protein_id="YP_308672.1"
                     /db_xref="GeneID:3654622"
                     /translation="MDSNTITSFQDILQRMSKMQLESSSVDLNGMITQFERLKIYRDS
                     LGESMMRMGDLHSLQNRNATWRNELSQKFEEIRWLIAECRNILTKTENSFEQITFLQA
                     LQLLLEVESEIRTFSFQLI"
     misc_feature    568..849
                     /gene="NEP"
                     /locus_tag="FLUAVH5N1_s8gp1"
                     /gene_synonym="NS2"
                     /note="Influenza non-structural protein (NS2); Region:
                     Flu_NS2; pfam00601"
                     /db_xref="CDD:278996"
     gene            15..707
                     /gene="NS1"
                     /locus_tag="FLUAVH5N1_s8gp2"
                     /db_xref="GeneID:8656648"
     CDS             15..707
                     /gene="NS1"
                     /locus_tag="FLUAVH5N1_s8gp2"
                     /codon_start=1
                     /product="nonstructural protein 1"
                     /protein_id="YP_308673.1"
                     /db_xref="GeneID:8656648"
                     /translation="MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALK
                     GRGSTLGLDLRVATMEGKKIVEDILKSETNENLKIAIASSPAPRYITDMSIEEMSREW
                     YMLMPRQKITGGLMVKMDQAIMDKRIILKANFSVLFDQLETLVSLRAFTESGAIVAEI
                     FPIPSVPGHFTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGIHDENGGPSLPPKQ
                     KRYMAKRVESEV"
     misc_feature    15..665
                     /gene="NS1"
                     /locus_tag="FLUAVH5N1_s8gp2"
                     /note="Influenza non-structural protein (NS1); Region:
                     Flu_NS1; pfam00600"
                     /db_xref="CDD:366187"
ORIGIN      
        1 gtgacaaaga cataatggat tccaacacga taacctcgtt tcaggtagat tgttatctat
       61 ggcacataag aaagctactc agtatgagag acatgtgtga tgcccccttt gatgacaggc
      121 tccgaagaga ccaaaaggca ttaaagggaa gaggcagcac acttggactc gatttaagag
      181 tggctacaat ggaggggaaa aagatcgttg aggacatcct gaagagtgag acaaatgaaa
      241 acctcaaaat agccattgct tccagtcctg ctcctcggta tatcaccgat atgagcatag
      301 aggagatgag ccgagaatgg tacatgctga tgcctaggca gaaaataact ggaggcctta
      361 tggtgaaaat ggaccaagcc ataatggata aaagaattat ccttaaagca aatttctcag
      421 ttctatttga tcaactagag acattagtct ctctgagggc attcacagaa agtggtgcta
      481 ttgtggctga aatatttccc attccctccg taccaggaca ttttacagag gatgtcaaaa
      541 atgcaattgg aatcctcatc ggtggacttg aatggaatga taactcaatt cgagcgtctg
      601 aaaatataca gagattcgct tggggaatcc atgatgagaa tgggggacct tcactccctc
      661 caaaacagaa acgctacatg gcgaaacgag ttgagtcaga agtttgaaga gatcagatgg
      721 ctcattgctg aatgtagaaa tatactgaca aagactgaaa atagctttga acagataaca
      781 tttttgcaag cattgcaact cttacttgaa gttgagagtg agataaggac cttctctttt
      841 cagcttattt aatactaaaa aacac
//