LOCUS NC_007364 865 bp cRNA linear VRL 13-AUG-2018
DEFINITION Influenza A virus (A/goose/Guangdong/1/1996(H5N1)) segment 8,
complete sequence.
ACCESSION NC_007364
VERSION NC_007364.1
DBLINK BioProject: PRJNA485481
KEYWORDS RefSeq.
SOURCE Influenza A virus (A/goose/Guangdong/1/1996(H5N1))
ORGANISM Influenza A virus (A/goose/Guangdong/1/1996(H5N1))
Viruses; Riboviria; Orthornavirae; Negarnaviricota;
Polyploviricotina; Insthoviricetes; Articulavirales;
Orthomyxoviridae; Alphainfluenzavirus; Alphainfluenzavirus
influenzae.
REFERENCE 1 (bases 1 to 865)
AUTHORS Xu,X., Subbarao, Cox,N.J. and Guo,Y.
TITLE Genetic characterization of the pathogenic influenza
A/Goose/Guangdong/1/96 (H5N1) virus: similarity of its
hemagglutinin gene to those of H5N1 viruses from the 1997 outbreaks
in Hong Kong
JOURNAL Virology 261 (1), 15-19 (1999)
PUBMED 10484749
REFERENCE 2 (bases 1 to 865)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (26-AUG-2005) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 865)
AUTHORS Xu,X., Subbarao,K., Cox,N.J. and Guo,Y.
TITLE Direct Submission
JOURNAL Submitted (20-APR-1999) Influenza Branch, Center for Diseases
Control and Prevention, 1600 Clifton Road, Atlanta, GA 30333, USA
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence is identical to AF144307.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..865
/organism="Influenza A virus
(A/goose/Guangdong/1/1996(H5N1))"
/mol_type="viral cRNA"
/strain="A/goose/Guangdong/1/1996"
/serotype="H5N1"
/db_xref="taxon:93838"
/segment="8"
gene 15..852
/gene="NEP"
/locus_tag="FLUAVH5N1_s8gp1"
/gene_synonym="NS2"
/db_xref="GeneID:3654622"
CDS join(15..44,517..852)
/gene="NEP"
/locus_tag="FLUAVH5N1_s8gp1"
/gene_synonym="NS2"
/note="nuclear export protein"
/codon_start=1
/product="nonstructural protein 2"
/protein_id="YP_308672.1"
/db_xref="GeneID:3654622"
/translation="MDSNTITSFQDILQRMSKMQLESSSVDLNGMITQFERLKIYRDS
LGESMMRMGDLHSLQNRNATWRNELSQKFEEIRWLIAECRNILTKTENSFEQITFLQA
LQLLLEVESEIRTFSFQLI"
misc_feature 568..849
/gene="NEP"
/locus_tag="FLUAVH5N1_s8gp1"
/gene_synonym="NS2"
/note="Influenza non-structural protein (NS2); Region:
Flu_NS2; pfam00601"
/db_xref="CDD:278996"
gene 15..707
/gene="NS1"
/locus_tag="FLUAVH5N1_s8gp2"
/db_xref="GeneID:8656648"
CDS 15..707
/gene="NS1"
/locus_tag="FLUAVH5N1_s8gp2"
/codon_start=1
/product="nonstructural protein 1"
/protein_id="YP_308673.1"
/db_xref="GeneID:8656648"
/translation="MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALK
GRGSTLGLDLRVATMEGKKIVEDILKSETNENLKIAIASSPAPRYITDMSIEEMSREW
YMLMPRQKITGGLMVKMDQAIMDKRIILKANFSVLFDQLETLVSLRAFTESGAIVAEI
FPIPSVPGHFTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGIHDENGGPSLPPKQ
KRYMAKRVESEV"
misc_feature 15..665
/gene="NS1"
/locus_tag="FLUAVH5N1_s8gp2"
/note="Influenza non-structural protein (NS1); Region:
Flu_NS1; pfam00600"
/db_xref="CDD:366187"
ORIGIN
1 gtgacaaaga cataatggat tccaacacga taacctcgtt tcaggtagat tgttatctat
61 ggcacataag aaagctactc agtatgagag acatgtgtga tgcccccttt gatgacaggc
121 tccgaagaga ccaaaaggca ttaaagggaa gaggcagcac acttggactc gatttaagag
181 tggctacaat ggaggggaaa aagatcgttg aggacatcct gaagagtgag acaaatgaaa
241 acctcaaaat agccattgct tccagtcctg ctcctcggta tatcaccgat atgagcatag
301 aggagatgag ccgagaatgg tacatgctga tgcctaggca gaaaataact ggaggcctta
361 tggtgaaaat ggaccaagcc ataatggata aaagaattat ccttaaagca aatttctcag
421 ttctatttga tcaactagag acattagtct ctctgagggc attcacagaa agtggtgcta
481 ttgtggctga aatatttccc attccctccg taccaggaca ttttacagag gatgtcaaaa
541 atgcaattgg aatcctcatc ggtggacttg aatggaatga taactcaatt cgagcgtctg
601 aaaatataca gagattcgct tggggaatcc atgatgagaa tgggggacct tcactccctc
661 caaaacagaa acgctacatg gcgaaacgag ttgagtcaga agtttgaaga gatcagatgg
721 ctcattgctg aatgtagaaa tatactgaca aagactgaaa atagctttga acagataaca
781 tttttgcaag cattgcaact cttacttgaa gttgagagtg agataaggac cttctctttt
841 cagcttattt aatactaaaa aacac
//