GenomeNet

Database: RefSeq
Entry: NC_009087
LinkDB: NC_009087
Original site: NC_009087 
LOCUS       NC_009087               8855 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Chrysanthemum virus B, complete genome.
ACCESSION   NC_009087
VERSION     NC_009087.2
DBLINK      Project: 18985
KEYWORDS    RefSeq; Alkylated DNA repair protein; Carlavirus endopeptidase;
            Coat protein; complete genome; Nucleic acid binding protein; ORF1
            gene; ORF2 gene; ORF3 gene; ORF4 gene; ORF5 gene; ORF6 gene;
            polyprotein; RNA dependent RNA polymerase; Triple gene block 1
            Protein; Triple gene block 3; Triple gene block protein 2; Viral
            RNA helicase.
SOURCE      Chrysanthemum virus B
  ORGANISM  Chrysanthemum virus B
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus.
REFERENCE   1
  AUTHORS   Singh,L., Hallan,V., Martin,D.P., Ram,R. and Zaidi,A.A.
  TITLE     Genomic sequence analysis of four new chrysanthemum virus B
            isolates: evidence of RNA recombination
  JOURNAL   Arch. Virol. 157 (3), 531-537 (2012)
   PUBMED   22179900
REFERENCE   2  (bases 1 to 8855)
  AUTHORS   Singh,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2007) to the INSDC. Singh L., Floriculture
            Division, Institute of Himalayan Bioresource Tech., P.O. Box - 6,
            Palampur, Himachal Pradesh - 176062, INDIA
REFERENCE   3
  AUTHORS   Singh,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-FEB-2007) to the INSDC. Singh L., Floriculture
            Division, Institute of Himalayan Bioresource Tech., P.O. Box - 6,
            Palampur, Himachal Pradesh - 176062, INDIA
  REMARK    revised by [3]
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AM493895.
            On Aug 7, 2007 this sequence version replaced NC_009087.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..8855
                     /organism="Chrysanthemum virus B"
                     /mol_type="genomic RNA"
                     /isolate="Punjab"
                     /host="Chrysanthemum"
                     /db_xref="taxon:12165"
                     /country="India:Punjab"
     gene            1..6249
                     /gene="ORF1"
                     /db_xref="GeneID:4910898"
     CDS             1..6249
                     /gene="ORF1"
                     /note="6-9 base pairs short of Methionine start"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="YP_001086452.2"
                     /db_xref="GOA:A3KL92"
                     /db_xref="InterPro:IPR000606"
                     /db_xref="InterPro:IPR001788"
                     /db_xref="InterPro:IPR002588"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR007094"
                     /db_xref="InterPro:IPR008041"
                     /db_xref="UniProtKB/TrEMBL:A3KL92"
                     /db_xref="GeneID:4910898"
                     /translation="MALTYRSPMEENVGAYDSSVQAAIASTSANYHREAEVSNFQFFN
                     YYLRPIAKRHLIEAGIYLSPYSAVPHSHAACKTLENHLLYNVLPPLVDNRFHFVGIKQ
                     SKLEFLKLRNSKLSTISKINRFVTSADKARYGSDFVKKVSKPHVGFKRHELQVETPTL
                     RDLLPCLKEREAKYLFLHDELHYWSKEDLISLLEVLQPEMMLGTMVYPPELLFGSNRS
                     LNPWCYAYEVKKKNFLFYPDGVRSEGYEQPLNGGYLLECGKITLVDGTVYKVDILCSK
                     FAHHLVSITRGEAAGPTMRSFGPFEATACNGLDPLTRDVSCSFPIPYEVVSKVYRYLK
                     TLRKPDEQSSMAKLTQLLPCPTGEEIVFVQEILKSCDRHQHSENHGLVQTGLKIFMGQ
                     VTLELSCPKILADVFETVLEISLHEFIKNLEPFTVDVQLKELKWNNVWTLELKDDGLA
                     DEFLDPVRMIEERFGRGEYVAVPDRTSAGYYLAKPSLAKLRGPLIEIEQRVLRITLAA
                     ICYKSLSNSDGTIASINEIAAFFRMICAKPFLRPAKYKVYDLYGEGGAIGLQKYMRSR
                     WAHHVRFYWANIGLLWFRSNYKFYQKFLTAQPDGHGTYKSLMHPWSKVMHEVTNHQFH
                     SSKTSNYSWLRCERSTDKPTETCGVHGGARSEAVGGGRKKAESKGSAGVEDPKSDQGE
                     GKDQGEERPVDEAAHGELPFHRPQAYFNEEKGCTHGGSGPCSVVLSIRNDGATRLHKF
                     PNAGPAQNRYAGFYSKNGVGYSYNGGEHQSLNWPGWISVWMRLVGIPEIYNCCLVQRY
                     DENAKIGMHSDDEECFVTGGPIYTVNIEGRATFMTTCKEGKTKEITSFELGPGDLFEM
                     PGGFQETHKHAVFETSKDRLSVTFRLMKQICQDEQKDHEETDTSGGKKAGEAEETEQP
                     NTEKENPDEEGAGNEEGEHGSSNSRNKEREQGNDGSDCTNTAESGAEAFTRHFNGCKV
                     SVHAEKLPYTYNTTDCGGNGNCFWLCLANELGLCPFRGKKLALEYDLGSAGANETARS
                     CAGEGVYAVDEAIACAASVFRVAIKIYQPELSVMTVFEPTKGERVIYLELSGEHFRLM
                     RIINGCVVKAMASALNRKESEVMHVIEENCDPMMVTSLWNGEGVDLGVFHSLLELFSI
                     KALIFEGSREVLYNREGRFEASFEIKGDHIEHVHRKKGACNALFEECGKTHEVKAESL
                     ELLNRAGTLLNYESTLARARRLADSLCSGTTGVVSSSLFNKKPNLFPVQFREKNESLS
                     RDVLAVIGTLGSGKSTILKNFFKINLGRKVLYVSPRRALLNEFQRGVCGCSRNQEERK
                     AARKKGQENWDFMTFETFILKCSNLPSGMAVVLDEIQLYPPGYLDMICYLTKKGVHLI
                     VAGDPCQSDYDNERDRAWLSTMRSDVEQLLEGQSYKFNVQSHRFNNENFRGRLPCEIT
                     EKNVAEPRLEEHLLYTGCEELVLIMDEYSKVFLVSSFEEKKIIETHFPVCEQRKVYTF
                     GESTGLNFRVGTIIITNVSAATSEKRWLTALSRFSDNVCFVNLLGTDWNGLFGLYKHR
                     ALGHFLSKRAQLKDLLDHLPGQPQFQNGFSTLIGKDAGKREEKLIGDPWLKCMIDLGQ
                     TEDVEEVELLEEVMQEEWFKTHLPQADLEGVRARWVHKIMLKEAREVRMGDIVSEQFT
                     DDYPKELGTNLTNAAERFETIYPRHRASDTVTFIMAVKKRLRFSRPAVEKAKLQEAKL
                     YGQFLLNEFLKKVPLKQAHNTTMMERAKFDFEEKKTSKSAVIIENHAGRSCRDWMIEV
                     GLIFSKSQLCTKFDNRFRVAKAAQSIVCFQHAVLCRFAPYMRYIEAKLHEALPSRFYI
                     HSGKGLDELNEWVIKGKFEGICTESDYEAFDASQDQYIVAFELALMEYLGLPRDLIED
                     YAFIKCHLGSKLGNFAIMRFSGEASTFLFNTMAIMLFTFLRYNIKDSEHINSIGDDMC
                     ASEPPCIKKEHEGFLSKLKLKAKVFFLAKPTLCGWHLCSDGIYKKPQLVLERMGSAKE
                     KNNLANCLDNYAIEVSYAYNLRERAVNRMDEEELEAAYNCVRIIIKNKKLLKSDILSF
                     YSSIEKQI"
     misc_feature    127..1059
                     /gene="ORF1"
                     /note="Viral methyltransferase; Region: Vmethyltransf;
                     pfam01660"
                     /db_xref="CDD:279929"
     misc_feature    <2269..2643
                     /gene="ORF1"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy; cl21496"
                     /db_xref="CDD:304390"
     mat_peptide     2278..2643
                     /gene="ORF1"
                     /product="Alkylated DNA repair protein"
     mat_peptide     3274..3534
                     /gene="ORF1"
                     /product="Carlavirus endopeptidase"
     misc_feature    3274..3534
                     /gene="ORF1"
                     /note="Carlavirus endopeptidase; Region: Peptidase_C23;
                     pfam05379"
                     /db_xref="CDD:283122"
     misc_feature    3787..>3912
                     /gene="ORF1"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     mat_peptide     3802..4608
                     /gene="ORF1"
                     /product="Viral RNA helicase"
     misc_feature    3817..4608
                     /gene="ORF1"
                     /note="Viral (Superfamily 1) RNA helicase; Region:
                     Viral_helicase1; pfam01443"
                     /db_xref="CDD:279750"
     misc_feature    3817..3831
                     /gene="ORF1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    4060..4071
                     /gene="ORF1"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    4975..6207
                     /gene="ORF1"
                     /note="RNA dependent RNA polymerase; Region: RdRP_2;
                     pfam00978"
                     /db_xref="CDD:250270"
     mat_peptide     5071..6207
                     /gene="ORF1"
                     /product="RNA dependent RNA polymerase"
     gene            6282..6977
                     /gene="ORF2"
                     /db_xref="GeneID:4910896"
     CDS             6282..6977
                     /gene="ORF2"
                     /codon_start=1
                     /product="Triple gene block 1 Protein"
                     /protein_id="YP_001086453.1"
                     /db_xref="GOA:Q6ZZC9"
                     /db_xref="InterPro:IPR000606"
                     /db_xref="UniProtKB/TrEMBL:Q6ZZC9"
                     /db_xref="GeneID:4910896"
                     /translation="MDVFVKILSDFGFTRLSSSLHLPIIVHCVPGAGKSSCIRALLKA
                     DSRFAAYTLGVPDPCNLDGLCIRTFTGSVDPKCFNILDEYTRFNGEICNFFALFGDPV
                     QNPPRTLYRAHFKSTLSRRFGKCTAQFLRELGFEVESTKEDAVSIKGLYDFDPVGTVL
                     YYEKEIGCLLRAHSIGAYEPEEVVGKTSETVPLVSAENHIPAEARHLVYQGLTRHRSV
                     LHLMTPDASYTST"
     misc_feature    6351..6950
                     /gene="ORF2"
                     /note="Viral (Superfamily 1) RNA helicase; Region:
                     Viral_helicase1; pfam01443"
                     /db_xref="CDD:279750"
     gene            6955..7278
                     /gene="ORF3"
                     /db_xref="GeneID:4910897"
     CDS             6955..7278
                     /gene="ORF3"
                     /codon_start=1
                     /product="Triple gene block protein 2"
                     /protein_id="YP_001086454.1"
                     /db_xref="InterPro:IPR001896"
                     /db_xref="UniProtKB/TrEMBL:Q6ZZD1"
                     /db_xref="GeneID:4910897"
                     /translation="MPLTPPPDHTKVLLVAAIGLSIVASILTYSRNTLPQVGDHSHLL
                     PHGGVYKDGTKTIVYGGPRKLNSLEGGFNLPVQPWFLVILLSAAIFLLSCRSGHRRCV
                     CGQCH"
     misc_feature    6964..7263
                     /gene="ORF3"
                     /note="Plant viral movement protein; Region:
                     Plant_vir_prot; pfam01307"
                     /db_xref="CDD:279627"
     gene            7269..7463
                     /gene="ORF4"
                     /db_xref="GeneID:4910900"
     CDS             7269..7463
                     /gene="ORF4"
                     /codon_start=1
                     /product="Triple gene block 3"
                     /protein_id="YP_001086455.1"
                     /db_xref="InterPro:IPR003411"
                     /db_xref="UniProtKB/TrEMBL:Q6ZZB7"
                     /db_xref="GeneID:4910900"
                     /translation="MSLSYLDLLLAFGCVLAVGVIINCFSVSHNNCVIEITGEAVRIS
                     GCTFDRTFVELVKGLKPARH"
     misc_feature    7284..7460
                     /gene="ORF4"
                     /note="7kD viral coat protein; Region: 7kD_coat;
                     pfam02495"
                     /db_xref="CDD:280630"
     gene            7518..8465
                     /gene="ORF5"
                     /db_xref="GeneID:4910899"
     CDS             7518..8465
                     /gene="ORF5"
                     /codon_start=1
                     /product="Coat protein"
                     /protein_id="YP_001086456.1"
                     /db_xref="GOA:Q70HV5"
                     /db_xref="InterPro:IPR000052"
                     /db_xref="InterPro:IPR013569"
                     /db_xref="UniProtKB/TrEMBL:Q70HV5"
                     /db_xref="GeneID:4910899"
                     /translation="MPPKPAPGDTEGNASGSTPTPPPPPPAQTAEEARLRLAEMERER
                     EQEQLLDEMNSNTPAEDARNISRLTQLAALLRREQTNVHVTNMALEIGRPALQPPPNM
                     RGDPTNMYSQVSTDFLWKIKPQRISNNMATSEDMVKIQVALEGLGVPTESVKEVIIRL
                     VLNCANTSSSVYQDPKGVIEWDGGAIIVDDVVGVITEHSTLRKVCRLYAAVAWNYMHL
                     QQTPPSDWSAMGFHPNVKYAAFDFFDYVENGAAIRPSGGIVPKPTRAEYVAYNTYKML
                     ALNKANNNDTFGNFDSAITGGRQGPAIHNNLNNANNKTL"
     misc_feature    7716..7871
                     /gene="ORF5"
                     /note="Carlavirus coat; Region: Flexi_CP_N; pfam08358"
                     /db_xref="CDD:149427"
     misc_feature    7896..8315
                     /gene="ORF5"
                     /note="Viral coat protein; Region: Flexi_CP; pfam00286"
                     /db_xref="CDD:278703"
     gene            8481..8804
                     /gene="ORF6"
                     /db_xref="GeneID:4910895"
     CDS             8481..8804
                     /gene="ORF6"
                     /codon_start=1
                     /product="Nucleic acid binding protein"
                     /protein_id="YP_001086457.1"
                     /db_xref="GOA:Q5F2R1"
                     /db_xref="InterPro:IPR002568"
                     /db_xref="UniProtKB/TrEMBL:Q5F2R1"
                     /db_xref="GeneID:4910895"
                     /translation="MDVIVKMLILRKFVEQGNVCPIHLCVDIYKRAFPRSVNKGRSSY
                     ARRRRALELGRCHRCYRVYPPLFPEISRCDNRTCVPGISYNSKVRDYILWGVTEVIPH
                     PGYNF"
     misc_feature    8481..8756
                     /gene="ORF6"
                     /note="Carlavirus putative nucleic acid binding protein;
                     Region: Carla_C4; pfam01623"
                     /db_xref="CDD:250753"
ORIGIN      
        1 atggcactca catacagaag tccaatggag gagaatgttg gtgcatatga ctcaagtgtt
       61 caagcagcaa ttgccagcac atcagcgaat tatcacaggg aggcagaggt aagcaacttc
      121 cagtttttca attattatct tcgccccatt gcgaagcgcc acttaattga agctggtata
      181 tacctaagtc catactcggc agtaccacat tcacacgccg catgtaagac ccttgagaac
      241 catctattgt ataatgtatt accacccctt gtagacaata gatttcattt tgtaggaatt
      301 aaacaatcaa agttagaatt ccttaaatta aggaatagta aattaagtac tatatctaaa
      361 ataaataggt ttgtgaccag tgccgacaaa gcaaggtacg gctctgattt tgtcaagaag
      421 gtgagtaaac cacatgtagg atttaagcgt catgaattac aggtagagac accaactttg
      481 cgtgatctct taccttgttt gaaggagaga gaagctaaat acctctttct tcacgatgag
      541 ttgcattact ggagcaagga ggacttaatc agtttgttag aagtgctgca gcctgaaatg
      601 atgttgggca ccatggtgta cccacccgaa ctgctattcg gatctaatcg aagcttgaac
      661 ccatggtgtt atgcttatga ggtcaagaag aaaaatttcc ttttttaccc tgatggggtg
      721 cggagtgagg gctatgaaca gcctttaaac gggggttact tgctggaatg tggcaagatt
      781 accctcgtcg acggcacggt gtacaaggtt gatatcctat gcagtaaatt cgcgcaccac
      841 ttagtctcta ttacgcgtgg agaagctgca gggccgacta tgcgctcatt tgggcccttc
      901 gaagcgacgg cgtgcaatgg cttggatccc ctcactagag acgtgtcctg tagcttccca
      961 attccctatg aggtagtttc gaaggtttac aggtatttga agaccctcag gaagcccgat
     1021 gaacaatcct ccatggcgaa actcacacaa ctacttcctt gccctacagg cgaggaaatc
     1081 gttttcgtgc aggaaattct caaatcttgt gatcgccacc aacacagtga aaaccatgga
     1141 ttagtgcaga cagggcttaa gatcttcatg gggcaagtta ctttggagtt aagctgccca
     1201 aagatcttgg ctgacgtttt cgaaacagtt ttagaaataa gtctgcatga attcatcaag
     1261 aatcttgagc cattcacagt cgacgtgcaa ttaaaagaac tcaagtggaa taatgtatgg
     1321 actctagagt taaaggatga tgggctcgct gacgagtttt tagatcctgt taggatgatc
     1381 gaagaaaggt tcggccgtgg agaatacgtc gcagtgcctg acagaacaag tgccggttat
     1441 taccttgcca agccaagcct ggccaaactg cggggtcctc tgatcgagat tgagcaaaga
     1501 gtgctcagga tcacgttagc tgctatttgt tacaagagtt tgagtaatag tgatggcacc
     1561 atcgcttcaa tcaacgaaat agctgctttc tttaggatga tatgcgccaa gcctttctta
     1621 cgtccggcaa aatacaaggt ttacgatctc tatggagaag ggggagctat aggtctacaa
     1681 aaatacatga gaagtcgttg ggcgcatcac gttaggttct actgggcaaa catcggacta
     1741 ttgtggttta gaagtaacta caaattttac cagaagtttt tgaccgcgca acccgatggc
     1801 cacggcactt acaagagttt aatgcaccca tggagtaagg taatgcatga agtgaccaat
     1861 caccaattcc actcaagtaa aacgagtaat tactcatggc tcaggtgtga gcgcagcact
     1921 gataaaccga ctgaaacctg cggagtgcat ggaggggcta gatcagaagc agtgggcggt
     1981 ggtaggaaga aagcagaaag caagggcagc gccggtgtag aagatccaaa aagtgatcag
     2041 ggcgaaggaa aggaccaagg ggaagagaga cccgtggatg aagctgctca tggcgaattg
     2101 cccttccaca ggccgcaggc gtactttaat gaagaaaaag ggtgcacaca cggtggcagt
     2161 ggcccttgca gtgtcgtttt gagcatccga aatgatggag ctacacgtct ccataaattc
     2221 ccaaacgccg gaccggctca aaataggtac gccggttttt actctaaaaa tggcgtaggg
     2281 tactcgtata atgggggaga gcaccaaagc ctaaactggc ctggctggat cagtgtttgg
     2341 atgagacttg ttggcatacc tgaaatttat aactgctgtt tggtgcaacg ttacgacgag
     2401 aatgcaaaaa ttgggatgca cagtgatgat gaggaatgtt ttgtcaccgg cggtcccata
     2461 tacaccgtta atattgaggg gcgcgccact ttcatgacca cctgcaagga aggaaagact
     2521 aaagaaatta caagttttga actaggaccc ggagacttgt tcgagatgcc cgggggcttc
     2581 caggagactc ataaacatgc tgtatttgag actagcaaag acaggctttc cgtgacattt
     2641 agactaatga aacaaatctg ccaagatgaa cagaaagatc acgaagagac agacacaagt
     2701 ggtggaaaaa aagctgggga ggcagaagag acagagcagc cgaacaccga aaaagaaaat
     2761 ccagatgaag aaggtgctgg gaacgaggaa ggtgagcatg ggagttcaaa cagcagaaac
     2821 aaggagcgag aacaaggaaa cgacggtagc gattgcacaa atactgctga atccggggcc
     2881 gaagctttta ccaggcattt taatggctgc aaggtgagcg tgcacgcaga aaaactccca
     2941 tacacgtaca atactaccga ttgcggcggt aatggaaact gcttctggct ttgcttagct
     3001 aatgaattgg gcctgtgccc tttcagggga aagaaactgg ccttggagta cgacctgggt
     3061 tcagcagggg caaatgagac tgcgcgcagt tgcgctggag agggagtgta cgctgtagat
     3121 gaagccattg catgtgcggc aagtgtattc agagtcgcca tcaaaatata ccagcccgag
     3181 ttgagtgtca tgaccgtttt tgaaccgact aaaggagagc gagtgattta tttagaatta
     3241 agcggggagc acttcagact catgcgtata atcaatggat gtgtagtcaa agctatggct
     3301 tctgcactca atcgcaaaga aagtgaggta atgcatgtga tcgaagaaaa ttgtgatcca
     3361 atgatggtga cgagcctttg gaatggtgaa ggtgttgact taggtgtttt ccattcactg
     3421 ctggaacttt tctcgattaa agctttgatt tttgagggat caagggaagt gctgtacaac
     3481 agggaaggac gttttgaagc ttcttttgaa ataaaaggtg accatataga acacgtgcat
     3541 aggaaaaaag gggcttgcaa tgcactgttt gaagagtgtg gcaagactca cgaggtgaag
     3601 gcagaatctc tagagctact aaatagagca ggtactttgc ttaattacga gagtaccctt
     3661 gctagagcta ggagactcgc agatagtttg tgttccggaa caacgggtgt cgtgagctct
     3721 tctttgttca acaaaaaacc aaaccttttc ccggtccaat ttagggagaa aaatgagtcg
     3781 ctcagtaggg atgtgcttgc agtgattggc accttgggat cgggcaagag cacgattctc
     3841 aaaaacttct tcaaaatcaa tttgggtcgc aaggtgttgt acgtatcccc acgtagagcc
     3901 cttttgaatg aattccagag aggcgtctgt ggttgctcaa gaaatcaaga agaacgcaaa
     3961 gcggcccgga agaaaggcca ggagaattgg gacttcatga cttttgagac cttcatactc
     4021 aaatgttcta atttaccttc agggatggct gtcgtacttg atgagataca gctgtaccca
     4081 cctggatacc tggacatgat ctgctatctg acaaaaaagg gcgtgcactt aattgttgct
     4141 ggtgatcctt gccagagtga ttatgataac gaacgtgatc gagcatggct aagcactatg
     4201 agaagtgatg tggaacaact gcttgagggc caaagctata agttcaatgt gcagagtcat
     4261 cgcttcaata atgagaattt caggggtcgg ctgccttgcg aaattactga gaaaaatgtt
     4321 gcggagccac ggttggaaga gcatttgttg tacacagggt gtgaggagtt agtgctgatc
     4381 atggatgaat atagtaaggt tttcctcgtt tcctctttcg aggaaaagaa aattattgag
     4441 acccatttcc ctgtgtgcga gcaacggaaa gtgtacacat ttggtgaatc tactggtttg
     4501 aatttcagag tgggtaccat aatcatcaca aatgtctcag ctgccacctc agagaaacgc
     4561 tggttaacag ccctgagccg atttagtgat aatgtctgtt tcgtcaacct cttgggaact
     4621 gactggaatg gtctatttgg tttgtataaa catcgagctt tgggtcactt ccttagtaag
     4681 agggcgcagt tgaaagacct attggaccac ttaccaggcc aaccacaatt ccagaatggt
     4741 ttctcaacgt taataggtaa ggacgcaggg aaaagggaag aaaagctcat tggtgatccg
     4801 tggcttaagt gcatgattga tctaggtcag actgaggatg tggaggaagt ggagctcctt
     4861 gaggaagtta tgcaagaaga atggttcaaa actcacctac cccaagccga cctggagggc
     4921 gtacgtgcta ggtgggtaca caagataatg ctcaaagagg caagggaagt gcgaatgggt
     4981 gacattgtgt ctgaacaatt cacagatgat tatcccaaag aattgggaac caatctcacg
     5041 aatgcagctg agcgtttcga gaccatttac cctaggcata gagcttcaga taccgtgacc
     5101 ttcataatgg ctgttaaaaa acggttgaga ttttcacgac cggctgttga gaaagcgaaa
     5161 cttcaggaag ccaaactgta tgggcaattc cttctgaatg aatttctcaa gaaagtacct
     5221 ttgaagcaag ctcataacac tactatgatg gagcgagcaa agtttgattt tgaggaaaag
     5281 aaaacaagca aaagtgcggt cattatagag aatcatgcgg gtcggtcatg tagagactgg
     5341 atgattgaag tagggctcat cttctccaaa agtcaattat gcacaaagtt tgataatagg
     5401 tttagggtcg cgaaggcagc acagagtatt gtttgcttcc aacacgccgt actttgccgt
     5461 ttcgcgcctt atatgcgcta cattgaagct aaactccatg aggcgctacc tagcagattc
     5521 tatattcact cagggaaggg tctggatgag cttaatgagt gggttatcaa gggcaaattc
     5581 gagggcatct gcactgagtc agattatgag gccttcgacg cttctcagga tcagtatatt
     5641 gttgcttttg agttagccct aatggagtat ctaggtttgc caagggactt aattgaggac
     5701 tacgcgttca tcaagtgtca tttagggtcc aaattaggca acttcgcgat catgcggttt
     5761 tccggggagg ctagtacgtt tctgtttaat actatggcca tcatgctctt caccttcttg
     5821 cgatacaata ttaaagacag cgagcacatc aactcaattg gggatgacat gtgcgcatcc
     5881 gaacccccgt gcatcaagaa agagcatgag ggttttttga gcaagttaaa attgaaagcc
     5941 aaagtattct ttctggctaa accaactctt tgcggatggc atctctgttc tgatgggata
     6001 tataagaagc cgcagttggt attggaacgt atgggtagtg ctaaagagaa gaataatcta
     6061 gccaactgtc tagacaatta cgccattgag gtttcctacg cctataacct ccgtgagcga
     6121 gcggttaata ggatggatga ggaggagttg gaggctgcct acaattgcgt caggataatc
     6181 atcaagaata agaagctcct aaagtccgat atccttagtt tttactctag tatcgagaaa
     6241 caaatttaaa tacgcttagg ttgaagctat aggattgtta tatggatgtg tttgtaaaga
     6301 ttttgagtga ttttggtttc acacgtttaa gtagtagttt acatttacct attatcgtac
     6361 attgtgtgcc tggtgcaggg aaaagtagtt gtattcgagc gctgttgaaa gctgattcaa
     6421 ggttcgcagc ttacacattg ggtgtgcctg acccctgcaa cttggacggc ttatgcatca
     6481 gaactttcac cggctcggtt gatccgaagt gctttaatat acttgacgaa tacacgcgct
     6541 ttaacggtga aatttgtaat ttctttgcgc ttttcggaga tcctgtacag aaccccccgc
     6601 gtaccttgta tagagctcat ttcaagtcta ctctcagtcg gcgtttcggc aagtgcactg
     6661 cgcaattcct ccgggaactt ggttttgagg tagaaagtac aaaagaggac gcagttagta
     6721 tcaaggggtt gtacgacttc gatcctgtcg gcacggtcct ttattacgag aaggaaatag
     6781 gttgcttatt gcgggcccat tccattggag cttacgagcc tgaggaggtt gtcgggaaga
     6841 cttccgaaac agtccctttg gttagtgctg agaatcacat acccgccgaa gctagacatt
     6901 tggtttacca aggcctcaca cgacaccgct cagtactaca ccttatgact cctgatgcct
     6961 cttacacctc cacctgacca cacgaaagtt ctccttgttg cggccatcgg cttaagtatt
     7021 gtagcatcta tattgactta cagcaggaat acactccctc aagtcggtga tcattcacat
     7081 ttgttgccgc acggtggtgt gtacaaagac gggacaaaga ctatcgttta cggaggtcct
     7141 aggaaactga attctctaga gggtggattt aacttaccag tacaaccttg gttccttgtt
     7201 atactattaa gcgcagccat tttcttgctt agttgtcgta gtgggcatcg taggtgcgtc
     7261 tgtggtcaat gtcattaagt tacttagact tacttttagc ttttgggtgt gttttggccg
     7321 taggtgttat tattaattgc ttttcggtta gtcataataa ttgcgtgatt gaaataactg
     7381 gtgaagctgt gaggatttcc ggttgtacct tcgatagaac cttcgtcgaa cttgtcaaag
     7441 ggctcaagcc ggctaggcat tagtgatact cttaggtttg tgagtggtta gatcgttata
     7501 tttgaatttt agtcactatg cctcccaaac cggcaccagg tgatactgaa ggtaacgcaa
     7561 gtggatccac tccaactcca cctccacccc caccagctca gactgctgaa gaggcaagat
     7621 tgaggcttgc agagatggaa cgagagcgtg agcaggagca attgctagat gagatgaact
     7681 ccaatacccc agcagaggac gctaggaaca taagccgtct gacacaactc gcggcactgc
     7741 tgaggagaga gcagacgaac gtgcacgtta caaacatggc tttagagata ggcagacctg
     7801 ctctccagcc tccacctaat atgcgagggg atccaacgaa tatgtacagc caggtttcta
     7861 ccgatttcct gtggaagatt aaaccacaga ggatttctaa caacatggcg acttccgagg
     7921 atatggtgaa gatacaagtg gccctcgaag gcctaggagt gcctaccgaa tcagtcaaag
     7981 aagtgatcat ccgtctggtg ctcaattgtg caaatacaag cagttccgtt tatcaagatc
     8041 cgaagggggt aatcgagtgg gatggtggag cgattattgt cgacgatgtc gtaggggtta
     8101 tcactgagca cagcacactt agaaaggttt gccgtctcta tgcggctgtg gcgtggaact
     8161 acatgcattt acaacagacc ccaccttctg attggtcggc tatgggcttt catccaaatg
     8221 tcaagtacgc tgcctttgac tttttcgact atgttgaaaa tggagctgca atcagaccaa
     8281 gtggcggcat tgtgcctaaa cccactcgtg cggagtatgt ggcgtacaat acttacaaga
     8341 tgttggctct caacaaggct aacaacaatg atacctttgg taatttcgat tctgctatta
     8401 cgggtgggag acaaggaccg gccattcaca acaatctgaa taatgcgaat aataagacat
     8461 tataaagtag tagttgatat atggatgtga ttgtgaagat gctaattcta cgtaagtttg
     8521 ttgaacaggg taatgtgtgt cctattcatt tgtgtgttga tatttacaag cgtgctttcc
     8581 ctaggagtgt gaataaaggt agatcatcat atgctagacg tcgccgagct ctagagcttg
     8641 gtcggtgtca taggtgttac agggtctacc ctcctttgtt tcccgagatt tctaggtgcg
     8701 ataatcgcac ttgtgtgcct ggtatttctt ataatagtaa agtgagagat tacatccttt
     8761 ggggagtaac tgaggtgata ccccaccctg gatataattt ctaaagtagt agctgcttct
     8821 aaagcctaat taatatataa ggtgtgaaac tataa
//
DBGET integrated database retrieval system