GenomeNet

Database: RefSeq
Entry: NC_010297
LinkDB: NC_010297
Original site: NC_010297 
LOCUS       NC_010297               1338 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Cardiospermum yellow leaf curl virus satellite DNA beta, complete
            genome.
ACCESSION   NC_010297
VERSION     NC_010297.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; complete genome.
SOURCE      Cardiospermum yellow leaf curl betasatellite
  ORGANISM  Cardiospermum yellow leaf curl betasatellite
            Viruses; Tolecusatellitidae; Betasatellite.
REFERENCE   1
  AUTHORS   Salim,N. and Stanley,J.
  TITLE     Characterisation of Cardiospermum yellow leaf curl virus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1338)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JAN-2008) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1338)
  AUTHORS   Stanley,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JAN-2008) Stanley J., Department of Disease and
            Stress Biology, John Innes Centre, Colney Lane, Norwich, NR4 7UH,
            UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AM933578.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1338
                     /organism="Cardiospermum yellow leaf curl betasatellite"
                     /mol_type="genomic DNA"
                     /isolation_source="Cardiospermum microcarpum"
                     /db_xref="taxon:497865"
                     /collection_date="Oct-2004"
                     /collected_by="Nazeera Salim"
     gene            complement(267..620)
                     /gene="beta-C1"
                     /locus_tag="CaYLCVb_gp1"
                     /db_xref="GeneID:5867169"
     CDS             complement(267..620)
                     /gene="beta-C1"
                     /locus_tag="CaYLCVb_gp1"
                     /codon_start=1
                     /product="beta-C1 protein"
                     /protein_id="YP_001661327.1"
                     /db_xref="InterPro:IPR018583"
                     /db_xref="UniProtKB/TrEMBL:B0JEU4"
                     /db_xref="GeneID:5867169"
                     /translation="MPITKKTSSGKLLQLSVNVFDSKFIVLLHITDTKSPQIQLQKIK
                     LPYSFNSDDLLINVTGLEEELMQHLSLICDEHVPSKVYTDYLISAIDILILENSQELG
                     LQVLEPCVVTITYTV"
     misc_feature    complement(270..611)
                     /gene="beta-C1"
                     /locus_tag="CaYLCVb_gp1"
                     /note="Beta-satellite pathogenicity beta C1 protein;
                     Region: Pathogen_betaC1; pfam09593"
                     /db_xref="CDD:150305"
ORIGIN      
        1 acagagggcg agttggagct cagaggcgaa gtgggcccca caaagaaggt aaaacataaa
       61 caaatggtca aatctgaatt tgaccattct aattgaagta ttaatgcact atttgtcatt
      121 tgttattagt caattatcgt tatttagtag atttggattt tagtttagtt ctagatgatt
      181 agttattagg aggtaataca aaattaaata tatatattag gatgacgaat agtaaaagga
      241 tttaattaat taaaacagaa agatagttat acagtataag ttatggttac aacacaaggt
      301 tcaagaactt gcaggccaag ttcttgagag ttctctaata tcagaatatc tatggcgctg
      361 atcaggtaat ctgtgtagac cttgcttggg acatgttcat cacagataag ggaaagatgc
      421 tgcatcaatt cctcttctag cccagtcaca ttaatgagga gatcatcact gttgaagctg
      481 tatggtagtt tgatcttttg tagttgaatt tgaggagatt ttgtatctgt aatatgtagt
      541 aaaactataa actttgaatc aaaaacattg acagatagct gtagaagttt gcctgaagaa
      601 gtttttttag taataggcat tatagatatt gtgtgattaa aataataaga agtgcttgtt
      661 tatatagtat gtagttgaat aagatgtatt caaaatatct agatattttg attaatagaa
      721 ataaagaaga aagaggatag aaacaaagaa gaaatcttat gtgaatctaa tggccacgca
      781 gtggaataga caggactaga aaaaacaggg aggaagaagg agaaagaacg tgagcaagga
      841 aaaagaaatc tgataatatc tagatattat cagaggagaa aaagaaaaaa atatggactg
      901 aatgaagaaa ggggtcttta tataaataac taaagatctg ggctctaatg gaaatatatg
      961 tgtttagttt tatttgcagt taaaacttgt tttaactgag taggtggtat atatttactg
     1021 cagggtgaaa ggtataggaa ggtaggtaat ttgatcccca atatccccga ttgagccccc
     1081 aatatattgg ggtctcaaat gggagctctt ttctggcttt taccgttttg ccctcatccc
     1141 tgttctttgg aaggcgcgtg ggtgcgctgc aaaagttaga ctttctctct cccaaaaact
     1201 aaaaatccgg tcgaaacccc tcttccggtc atcaattcac gacacgcgcg gcggtgtgta
     1261 cccctgggag ggtcgaaacc actacgctac gcagcagcct tagctacgcc ggagcttagc
     1321 tcgccctctt ataatatt
//
DBGET integrated database retrieval system