GenomeNet

Database: RefSeq
Entry: NC_014107
LinkDB: NC_014107
Original site: NC_014107 
LOCUS       NC_014107             199562 bp    DNA     circular CON 31-JAN-2021
DEFINITION  Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A,
            complete sequence.
ACCESSION   NC_014107
VERSION     NC_014107.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603901
            Assembly: GCF_000025565.1
KEYWORDS    RefSeq.
SOURCE      Enterobacter cloacae subsp. cloacae ATCC 13047
  ORGANISM  Enterobacter cloacae subsp. cloacae ATCC 13047
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
REFERENCE   1  (bases 1 to 199562)
  AUTHORS   Ren,Y., Ren,Y., Zhou,Z., Guo,X., Li,Y., Feng,L. and Wang,L.
  TITLE     Complete genome sequence of Enterobacter cloacae subsp. cloacae
            type strain ATCC 13047
  JOURNAL   J Bacteriol 192 (9), 2463-2464 (2010)
   PUBMED   20207761
REFERENCE   2  (bases 1 to 199562)
  AUTHORS   Wang,L., Ren,Y., Ren,Y., Zhou,Z., Guo,X., Feng,L. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2010) TEDA School of Biological Sciences and
            Biotechnology, Nankai University, 23 Hongda Street, TEDA, Tianjin,
            Tianjin 300457, China
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            CP001919.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 01/31/2021 10:49:15
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 5.0
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,501
            CDSs (total)                      :: 5,384
            Genes (coding)                    :: 5,204
            CDSs (with protein)               :: 5,204
            Genes (RNA)                       :: 117
            rRNAs                             :: 9, 8, 8 (5S, 16S, 23S)
            complete rRNAs                    :: 9, 8, 8 (5S, 16S, 23S)
            tRNAs                             :: 85
            ncRNAs                            :: 7
            Pseudo Genes (total)              :: 180
            CDSs (without protein)            :: 180
            Pseudo Genes (ambiguous residues) :: 0 of 180
            Pseudo Genes (frameshifted)       :: 75 of 180
            Pseudo Genes (incomplete)         :: 88 of 180
            Pseudo Genes (internal stop)      :: 24 of 180
            Pseudo Genes (multiple problems)  :: 7 of 180
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..199562
                     /organism="Enterobacter cloacae subsp. cloacae ATCC 13047"
                     /mol_type="genomic DNA"
                     /strain="ATCC 13047"
                     /sub_species="cloacae"
                     /culture_collection="ATCC:13047"
                     /type_material="type strain of Enterobacter cloacae"
                     /db_xref="taxon:716541"
                     /plasmid="pECL_A"
                     /note="type strain of Enterobacter cloacae subsp. cloacae"
     gene            1..1014
                     /locus_tag="ECL_RS25780"
                     /old_locus_tag="ECL_A001"
     CDS             1..1014
                     /locus_tag="ECL_RS25780"
                     /old_locus_tag="ECL_A001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_013087098.1"
                     /translation="MNDNQISVHWSDLPKDELTRFCQDVDAGTQGNFLIAPVKKLTRR
                     KRGEHSTKAKCENPAWYRPEHYKKLSGQLGHAYNRLVKKDKETGQVSLRMHVSRHPLY
                     VAGRRKAGRKYGFRPERQRLLDALWPVLISFCDAGKHTVGMCISRLAKELSAKDAKGN
                     VIPETEVTVSRLSRLIEEQVRFGVLGLAEERAWDRESRTWLPTYVYITPVGFQMLGVD
                     MDKLFKEQEKKLRQSAEREQLIREGVMSEHDDVQAHSARKCWSGRKRREALVYRRNKG
                     AERKRANNLIKLPADERLHAMSEWIYRTLPPDEAYWCTSERLKALAIQHLYQLDLALS
                     PPD"
     gene            1965..2771
                     /locus_tag="ECL_RS25785"
                     /old_locus_tag="ECL_A003"
     CDS             1965..2771
                     /locus_tag="ECL_RS25785"
                     /old_locus_tag="ECL_A003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4225 domain-containing protein"
                     /protein_id="WP_013087100.1"
                     /translation="MDIILPGNKSQARLWAETMINLEARKLVNTANIVGARHLGDGLT
                     RLKFIDEIKSVINGEFERARRAKSDEECMTCLRNLQAENSSLLEQSRQLQTGYAKLYA
                     QIKYVRDEDRMVGYVISGIKVVLAGMQGVFGFVLTSSMTPVGVLAGAILIVDSANTIT
                     REVGRQFLNEPDTQGMFGDGAMNIAKFMGFERSTGLGIYNGIALAGNIYSVYGLMARP
                     GTWRLFNYISTDFYRKIDTMSRGKLTMKIVGWGVKAKVVFDLITSDDSGK"
     gene            complement(2746..3075)
                     /locus_tag="ECL_RS25790"
                     /old_locus_tag="ECL_A004"
     CDS             complement(2746..3075)
                     /locus_tag="ECL_RS25790"
                     /old_locus_tag="ECL_A004"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087101.1"
                     /translation="MNHESDLMNHGFSEEDIVRLRASSAKTGTEMDTLLNDLANRFKA
                     LIWVLSVMLLIFVATLLAGSRMHTISFGVAILVLGTLFTITMPLKLAYKSWHYRRKNL
                     ISRSHQK"
     gene            complement(3158..3496)
                     /locus_tag="ECL_RS25795"
                     /old_locus_tag="ECL_A005"
     CDS             complement(3158..3496)
                     /locus_tag="ECL_RS25795"
                     /old_locus_tag="ECL_A005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014172383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087102.1"
                     /translation="MAISEKELLEAGFSNRDVDTLLERLSATGGTMQGFIAALSRRFR
                     VSVWITVALALIMLVILIAGSRTHILSGGMSSLVVLTIAWLTFPPALGWKAFRLQKNA
                     RGRFQQSDSP"
     gene            complement(3511..4281)
                     /locus_tag="ECL_RS25800"
                     /old_locus_tag="ECL_A006"
     CDS             complement(3511..4281)
                     /locus_tag="ECL_RS25800"
                     /old_locus_tag="ECL_A006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014172382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraX"
                     /protein_id="WP_013087103.1"
                     /translation="MNHSLPDVLPTIRNASQLSPAALDMVKLLALLAMIIDHTNTVFL
                     SSALPVMYALGRMAFPLFTLIWAMNVQRTPERLQKRANRLWIWAVITQPVFSLAFQNQ
                     QPWWALNILFVFAGVTQLLALQYRHGRKGMLAGYLLLALMIWPLQPASYGLAGITLAI
                     SMATVSGSDTPGVQRLAAITAVLSLICLNGLSHLLDMPAETLLLATLPTLAFPLAVVS
                     FCRQICPEGRRRFMPRNFFYYAYAGHLGIIGLVQTTFG"
     gene            complement(4648..5172)
                     /locus_tag="ECL_RS25805"
                     /old_locus_tag="ECL_A008"
     CDS             complement(4648..5172)
                     /locus_tag="ECL_RS25805"
                     /old_locus_tag="ECL_A008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087105.1"
                     /translation="MLSCSLKRELEMKLTENRVDTLIDTLNDLICDEQSITREQRENL
                     IKTVATLGGLKERLRLISAEKEARQIAKNEKVKKPREPDLVFPRTGKPWLSEDLDVIH
                     SIIDDIPDDRIDDHILWLSKQQGRTPYAVALKIVGVGRMDDEWAKAWKPAAKSLREDY
                     AKLHPAPSSDISQE"
     gene            5314..5574
                     /locus_tag="ECL_RS25810"
                     /old_locus_tag="ECL_A009"
     CDS             5314..5574
                     /locus_tag="ECL_RS25810"
                     /old_locus_tag="ECL_A009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011906492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system ParD family
                     antitoxin"
                     /protein_id="WP_013087106.1"
                     /translation="MARTMTVDVGDELREFIDSLVKAGDYRTQSEVMRDALRLLREKQ
                     AESRLQELRDLLAEGISSGEAKPWNKDAFLNNVRARMANERD"
     gene            5561..5857
                     /locus_tag="ECL_RS25815"
                     /old_locus_tag="ECL_A010"
     CDS             5561..5857
                     /locus_tag="ECL_RS25815"
                     /old_locus_tag="ECL_A010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="WP_013087107.1"
                     /translation="MKEIELTPKAEEDLEAIWDYSFRQFGVVQADAYIGRIAAVFDVL
                     AMHDIGTHRAELGEDICSLPVEQHMIYFVSSHSVVTIIRILSQSQDTARHEPWI"
     gene            complement(6077..6511)
                     /gene="pcoE"
                     /locus_tag="ECL_RS25820"
                     /old_locus_tag="ECL_A011"
     CDS             complement(6077..6511)
                     /gene="pcoE"
                     /locus_tag="ECL_RS25820"
                     /old_locus_tag="ECL_A011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000723069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance system metallochaperone PcoE"
                     /protein_id="WP_013087108.1"
                     /translation="MKKILVSFVAIMAVASSAMAAETMNMHDQVNNAQAPAHQMQSSA
                     EKSAVQGDSMTMMDMSSHDQAAMSHDMMQNGNSAAHQDMAEMHKKMMKSKPAASNETA
                     KSFSEMNEHEKAAVVHEKANNGQSSVIHQQQAEKHRSQITQN"
     gene            complement(6729..>7835)
                     /gene="pcoS"
                     /locus_tag="ECL_RS25825"
                     /old_locus_tag="ECL_A012"
                     /pseudo
     CDS             complement(6729..>7835)
                     /gene="pcoS"
                     /locus_tag="ECL_RS25825"
                     /old_locus_tag="ECL_A012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001211179.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance membrane spanning protein
                     PcoS"
     gene            complement(7891..8859)
                     /locus_tag="ECL_RS25830"
                     /old_locus_tag="ECL_A013"
     CDS             complement(7891..8859)
                     /locus_tag="ECL_RS25830"
                     /old_locus_tag="ECL_A013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5-like element IS903B family transposase"
                     /protein_id="WP_013087110.1"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     gene            complement(<8893..9195)
                     /locus_tag="ECL_RS25835"
                     /old_locus_tag="ECL_A014"
                     /pseudo
     CDS             complement(<8893..9195)
                     /locus_tag="ECL_RS25835"
                     /old_locus_tag="ECL_A014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001211179.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(9192..9872)
                     /gene="pcoR"
                     /locus_tag="ECL_RS25840"
                     /old_locus_tag="ECL_A015"
     CDS             complement(9192..9872)
                     /gene="pcoR"
                     /locus_tag="ECL_RS25840"
                     /old_locus_tag="ECL_A015"
                     /function="transcriptional regulator responding to pcoS
                     and pcoS*"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020239536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper response regulator transcription factor
                     PcoR"
                     /protein_id="WP_001188930.1"
                     /translation="MQRILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKG
                     QYDLIILDVMLPFLDGWQIISALRESGHEEPVLFLTAKDNVRDKVKGLELGADDYLIK
                     PFDFTELVARVRTLLRRARSQAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLE
                     LLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAG
                     YVLEIREE"
     gene            complement(9927..10856)
                     /gene="pcoD"
                     /locus_tag="ECL_RS25845"
                     /old_locus_tag="ECL_A016"
     CDS             complement(9927..10856)
                     /gene="pcoD"
                     /locus_tag="ECL_RS25845"
                     /old_locus_tag="ECL_A016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004098940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance inner membrane protein PcoD"
                     /protein_id="WP_013087112.1"
                     /translation="MNDLIMIVIRFLLYLDLMVIFGLPFFQIYGISGVRHETYNLTNF
                     RSFITFAVVTGIILTGINMLLVSNAMSGVTDLRELSIHVIEMVIEETDVGISWIVRLC
                     ALFTTLGALFLYTNKRLLSCLLMTMSGGVALATLAWGGHAVMHDGLHYYLHLLSDLTH
                     LGAAGAWTGALVAFAILLMRRNEHNAQSVIVISDSLAKFATAGTVIVVALILSALVNY
                     LYIAEGNLTPLFNSSWGRILLAKTALFVLMLLLAAANRFHLGPRLEVMVREGNYDRSV
                     ALMRNSILTEFVVAIIILGAVAWLGMLAPSQVS"
     gene            complement(10861..11241)
                     /gene="pcoC"
                     /locus_tag="ECL_RS25850"
                     /old_locus_tag="ECL_A017"
     CDS             complement(10861..11241)
                     /gene="pcoC"
                     /locus_tag="ECL_RS25850"
                     /old_locus_tag="ECL_A017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004098941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance system metallochaperone PcoC"
                     /protein_id="WP_000025662.1"
                     /translation="MSILNKAILTGGLVMGVAFSAMAHPELKSSVPQADSAVAAPEKI
                     QLNFSENLTVKFSGAKLTMTGMKGMSSHSPMPVAAKVAPGADPKSMVIIPREPLPAGT
                     YRVDWRAVSSDTHPITGNYTFTVK"
     gene            complement(11281..12171)
                     /gene="pcoB"
                     /locus_tag="ECL_RS25855"
                     /old_locus_tag="ECL_A018"
     CDS             complement(11281..12171)
                     /gene="pcoB"
                     /locus_tag="ECL_RS25855"
                     /old_locus_tag="ECL_A018"
                     /function="copper binding"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001378118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance outer membrane transporter
                     PcoB"
                     /protein_id="WP_001378118.1"
                     /translation="MKRNLKAIPVLVAGLFTSQLSIAAGSVSADPHAGHDMSAMQMPA
                     DENFTEMTSMEPIVTESRTPIPPVTDADRKAAFGNLQGHAIHDSAINYLVLLDQLEWQ
                     RSDNTNNFSWSVNSWIGGDTDRIWLKSEGERSNGETEAAEAQLLWGHAVGPWWDLVAG
                     VRQDFRPASARTWAAVGFQGLALYNFESEITGFVSNGGKAALRLGGEYDVLLTNRLIL
                     QPSYEVNFYSQDDESRGRGRGLTDTELGLRLRYEIRREFAPYIGVSWNQLYGKTSDMA
                     KREGEKDHQVVFLAGARIWF"
     gene            complement(12177..13994)
                     /gene="pcoA"
                     /locus_tag="ECL_RS25860"
                     /old_locus_tag="ECL_A019"
     CDS             complement(12177..13994)
                     /gene="pcoA"
                     /locus_tag="ECL_RS25860"
                     /old_locus_tag="ECL_A019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001480786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase PcoA"
                     /protein_id="WP_000925242.1"
                     /translation="MLLKTSRRTFLKGLTLSGVAGSLGVWSFNARSSLSLPVAASLQG
                     TQFDLTIGETAVNITGSERQAKTINGGLPGPVLRWKEGDTITLKVKNRLNEQTSIHWH
                     GIILPANMDGVPGLSFMGIEPDDTYVYTFKVKQNGTYWYHSHSGLQEQEGVYGAIIID
                     AREPEPFAYDREHVVMLSDWTDENPHSLLKKLKKQSDYYNFNKPTVGSFFRDVNTRGL
                     SATIADRKMWAEMKMNPTDLADVSGYTYTYLMNGQAPLKNWTGLFRPGEKIRLRFING
                     SAMTYFDIRIPGLKMTVVAADGQYVNPVTVDEFRIAVAETYDVIVEPQGEAYTIFAQS
                     MDRTGYARGTLATREGLSAAVPPLDPRPLLTMEDMGMGGMGHDMAGMDHSQMGGMDNS
                     GEMMSMDGADLPDSGTSSAPMDHSSMAGMDHSRMAGMPGMQSHPASETDNPLVDMQAM
                     SVSPKLNDPGIGLRNNGRKVLTYADLKSRFEDPDGREPGRTIELHLTGHMEKFAWSFN
                     GIKFSDAAPVLLKYGERLRITLINDTMMTHPIHLHGMWSDLEDENGNFMVRKHTIDVP
                     PGTKRSYRVTADALGRWAYHCHLLYHMEMGMFREVRVEE"
     gene            14229..14678
                     /locus_tag="ECL_RS25865"
                     /old_locus_tag="ECL_A020"
     CDS             14229..14678
                     /locus_tag="ECL_RS25865"
                     /old_locus_tag="ECL_A020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004388333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance protein"
                     /protein_id="WP_001023257.1"
                     /translation="MNILITTTAFTALFCGAAFAQSSDIAHEAHRFVNNASAVSHVNS
                     STHENLPDRVNKNNTPSFSEMNEHERAIVAHSFMNNSASYAHQKMIEEHKKMLSGSDA
                     NSKTSSSSFNELNAGEKAALVHEQVNNAGAEAHQTQARKLRGLYSTR"
     gene            14967..>15353
                     /locus_tag="ECL_RS25870"
                     /old_locus_tag="ECL_A021"
                     /pseudo
     CDS             14967..>15353
                     /locus_tag="ECL_RS25870"
                     /old_locus_tag="ECL_A021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002436617.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
     gene            complement(15412..16701)
                     /locus_tag="ECL_RS25875"
                     /old_locus_tag="ECL_A022"
     CDS             complement(15412..16701)
                     /locus_tag="ECL_RS25875"
                     /old_locus_tag="ECL_A022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISL3-like element ISPpu12 family transposase"
                     /protein_id="WP_004574636.1"
                     /translation="MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQ
                     GEFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRL
                     HEYVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLN
                     KRYRCILTNIEERTLLDLLATRRQDVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAV
                     LPQARIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRE
                     RLIMETWTGAFPQLLAAYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDL
                     VRAVGNWREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKH
                     KKKAPTAKVSPFYKKTIGYGLPDFAEELNYGVDLSTI"
     gene            complement(16723..17235)
                     /locus_tag="ECL_RS25880"
                     /old_locus_tag="ECL_A023"
     CDS             complement(16723..17235)
                     /locus_tag="ECL_RS25880"
                     /old_locus_tag="ECL_A023"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013504665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="WP_004863699.1"
                     /translation="MLIIGKKLSPYALLSISGLLAASDQAVKWLVQQSMAYGEYVSVT
                     PFFNWVHLWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSL
                     ILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKA
                     NTNAEPDGSD"
     gene            complement(17239..18135)
                     /locus_tag="ECL_RS25885"
                     /old_locus_tag="ECL_A024"
     CDS             complement(17239..18135)
                     /locus_tag="ECL_RS25885"
                     /old_locus_tag="ECL_A024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014702287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_004574643.1"
                     /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPS
                     EERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAAN
                     PETIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADA
                     AVYGLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIA
                     FVALIANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITAGALVAWTGSNYPDL
                     IIGTIAGGIVLNGARRILALKG"
     gene            18231..18638
                     /gene="cadR"
                     /locus_tag="ECL_RS25890"
                     /old_locus_tag="ECL_A025"
     CDS             18231..18638
                     /gene="cadR"
                     /locus_tag="ECL_RS25890"
                     /old_locus_tag="ECL_A025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001219642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cd(II)/Pb(II)-responsive transcriptional
                     regulator"
                     /protein_id="WP_004364961.1"
                     /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHG
                     EGLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALE
                     KQLVSLRASCNDDREVEACGVLAGISEGNMHQQ"
     gene            18734..19084
                     /locus_tag="ECL_RS25895"
                     /old_locus_tag="ECL_A026"
     CDS             18734..19084
                     /locus_tag="ECL_RS25895"
                     /old_locus_tag="ECL_A026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007779022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-metalloendopeptidase family
                     protein"
                     /protein_id="WP_013087114.1"
                     /translation="MPMNTKIVSVIDGKITRAEYNSTMGFFVEVTGKAGVKTRYLHLN
                     KILVTKGARVTRGGAIALSGNSGRSSGPHLHYELVINNNPVNSLAFRAAAPADNKLEQ
                     HAFAHARDYERYLD"
     gene            complement(19118..19315)
                     /locus_tag="ECL_RS25900"
                     /old_locus_tag="ECL_A027"
     CDS             complement(19118..19315)
                     /locus_tag="ECL_RS25900"
                     /old_locus_tag="ECL_A027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000843499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2933 domain-containing protein"
                     /protein_id="WP_000843497.1"
                     /translation="MKSTTYALIAVAAIAAFALLREHWSHVAGYWPYLLLLVCPLMHL
                     FHGHGGHGDHQHQGSENDKKN"
     gene            complement(19356..21827)
                     /gene="silP"
                     /locus_tag="ECL_RS25905"
                     /old_locus_tag="ECL_A028"
     CDS             complement(19356..21827)
                     /gene="silP"
                     /locus_tag="ECL_RS25905"
                     /old_locus_tag="ECL_A028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_032489447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ag(+)-translocating P-type ATPase SilP"
                     /protein_id="WP_129244003.1"
                     /translation="MLQICIRRVTVKNDNAVEHNNQTASEQTSSPDESHALHKVRDPV
                     CGMVILPDKAHSSIRYQDHQLYFCSASCESKFKAHPDHYFTEDASEHHHHHDHHEVSP
                     DKIKQSHRQAEKEISEGVWTCPMHPEIRRSGPGSCPVCGMALEPLVATASTGTSDELR
                     DMTRRFWLGLLLAFPVLILEMGSHLFPALRNTVPPQYNTWLQLLLASPVVLWCGWPFF
                     ARAGMSLRNRSLNMFTLVAMGTGVAWVYSVIATVFPSWFPASFRNMDGLVAIYFEAAA
                     VITVLVLLGQVLELRAREQTSGAITALLNLAPKTARRLDQDGHETDINAEDVLPGDKL
                     RIRPGESIPVDGIVVEGKTTVDESMVTGESMPVTKTEGDPVIGGTINQTGSLIIRAEK
                     VGDETMLSRIVQMVADAQRSRAPIQRMADSVSGWFVPLVILIAVVAFMIWSVWGPEPR
                     MAHGLIAAVSVLIIACPCALGLATPMSIMVGVGKGAQAGVLIKNAEALERLEKVDTLV
                     VDKTGTLTEGSPTVTGIISLNPGGETSLLRVTAAVEKGSQHPLGMAVVKAAQEKGIAI
                     PAVTHFNAPSGKGVSGDVEGQRVVIGNELAMQENSIVIDNQKAVADTLRMEGATVIYV
                     ATDGHLAGLIAISDPVKATTPDALKALRQAGIRIVMLTGDNQLTAEAVARKLGIDEVE
                     AGILPDGKKAVITRLKASGHVVAMAGDGVNDAPALAAADVGIAMGTGTDVAIESAGVT
                     LLKGDLMILNRARHLSEITMKNIRQNLFFAFIYNALGVPVAAGLLYPVYGILLSPVIA
                     AAAMALSSVSVIVNALRLKSVRLGK"
     gene            complement(21925..22365)
                     /locus_tag="ECL_RS25910"
                     /old_locus_tag="ECL_A029"
     CDS             complement(21925..22365)
                     /locus_tag="ECL_RS25910"
                     /old_locus_tag="ECL_A029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002436620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002436620.1"
                     /translation="MKKVVLMALALGLSLPAMASEKVIDMYKSENCGCCSLWGKAMEK
                     DGFEVRTHVMNDQALSALKEKHAVPAGLRSCHTAVVGNLIIEGHVPAATIHKAMQSGS
                     GIYGLATPGMPAGSPGMEMGARKEAYDVIAFSPEGSKKVFQRIE"
     gene            complement(22452..25598)
                     /gene="silA"
                     /locus_tag="ECL_RS25915"
                     /old_locus_tag="ECL_A030"
     CDS             complement(22452..25598)
                     /gene="silA"
                     /locus_tag="ECL_RS25915"
                     /old_locus_tag="ECL_A030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011711636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(+)/Ag(+) efflux RND transporter permease
                     subunit SilA"
                     /protein_id="WP_013087115.1"
                     /translation="MIEWIIRRSVANRFLVMMGALFLSIWGTWTIINTPVDALPDLSD
                     VQVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTD
                     LYWARSRVLEYLNQVQGKLPAGVSSEIGPDATGVGWIFEYALVDRSGKHDLSELRSLQ
                     DWFLKFELKTIPNVAEVASVGGVVKQYQIQVNPVKLSQYGISLPEVKQALESSNQEAG
                     GSSVEMAEAEYMVRASGYLQSIDDFNNIVLKTGENGVPVYLRDVARVQTGPEMRRGIA
                     ELNGQGEVAGGVVILRSGKNARDVITAVRDKLETLKASLPEGVEIVTTYDRSQLIDRA
                     IDNLSSKLLEEFIVVAIVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMS
                     LGGIAIAVGAMVDAAIVMIENAHKRLEEWDHQHPGEQIDNATRWKVITDASVEVGPAL
                     FISLLIITLSFIPIFTLEGQEGRLFGPLAFTKTYSMAGAAALAIIVIPILMGFWIRGK
                     IPAETSNPLNRVLIKAYHPLLLRVLHWPKTTLLVAALSIFTVIWPLSQVGGEFLPKIN
                     EGDLLYMPSTLPGVSPAEAAALLQTTDKLIKSVPEVASVFGKTGKAETATDSAPLEMV
                     ETTIQLKPEDQWRPGMTIDKIIEELDRTVRLPGLANLWVPPIRNRIDMLSTGIKSPIG
                     IKVSGTVLSDIDATAQSIEAVAKTVPGVVSVLAERLEGGRYIDIDINREKASRYGMTV
                     GDVQLFVSSAIGGAMVGETVEGVARYPINIRYPQDYRNSPQALKQMPILTPMKQQITL
                     GDVADINVVSGPTMLKTENARPASWIYVDARGRDMVSVVNDIKTAISEKVKLRPGTSV
                     AFSGQFELLEHANKKLKLMVPMTVMIIFILLYLAFRRVDEALLILMSLPFALVGGIWF
                     LYWQGFHMSVATGTGFIALAGVAAEFGVVMLMYLRHAIEAHPELSRKETFTPEGLDEA
                     LYHGAVLRVRPKAMTVAVIIAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFI
                     IPAAYKLIWLRRHKKSVS"
     gene            complement(25609..26901)
                     /gene="silB"
                     /locus_tag="ECL_RS25920"
                     /old_locus_tag="ECL_A031"
     CDS             complement(25609..26901)
                     /gene="silB"
                     /locus_tag="ECL_RS25920"
                     /old_locus_tag="ECL_A031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017146627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(+)/Ag(+) efflux RND transporter periplasmic
                     adaptor subunit SilB"
                     /protein_id="WP_013087116.1"
                     /translation="MASLKIKYAAIIISSLIAGGLISVTAWQYVNSSQKTVQTEQKAP
                     EKKVLFWYDPMKPDTKFDKPGKSPFMDMDLVPKYADESGDKSSGGIRIDPTQVQNLGL
                     KTQKVTRGMLNYSQTIPANVSYNEYQFVIVQARSDGFVEKVYPLTIGDHVKKGTPLID
                     ITIPEWVEAQSEFLLLSGTGGTPTQIKGVLERLRLAGMPEEDIQRLRTTRTIQTRFTI
                     KAPIDGVITAFDLRTGMNISKDKVVAQIQGMDPVWISAAVPESIAYLLKDTSQFEISV
                     PAYPDKTFHVEKWNILPSVDQTTRTLQVRLQVSNKDEFLKPGMNAYLKLNTRSQEMLL
                     IPSQAVIDTGKEQRVITVDDEGKFVPKQIHVLHESQQQSGIGSGLNEGDTVVVSGLFL
                     IDSEANITGALERMRHPEKTESSMPAMSDQPVNMHSGH"
     gene            complement(27015..27368)
                     /gene="cusF"
                     /locus_tag="ECL_RS25925"
                     /old_locus_tag="ECL_A032"
     CDS             complement(27015..27368)
                     /gene="cusF"
                     /locus_tag="ECL_RS25925"
                     /old_locus_tag="ECL_A032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009654303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation efflux system protein CusF"
                     /protein_id="WP_001246153.1"
                     /translation="MRNSLKAVLFGAFSVMFSAGLHAETHQHGDMNAASDASVQQVIK
                     GTGVVKDIDMNSKKITISHEAIPAVGWPAMTMRFTFVNADDAINALKTGNHVDFSFIQ
                     QGNISLLKSINVTQS"
     gene            complement(27397..28782)
                     /gene="silC"
                     /locus_tag="ECL_RS25930"
                     /old_locus_tag="ECL_A033"
     CDS             complement(27397..28782)
                     /gene="silC"
                     /locus_tag="ECL_RS25930"
                     /old_locus_tag="ECL_A033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001572989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(+)/Ag(+) efflux RND transporter outer
                     membrane channel SilC"
                     /protein_id="WP_001507116.1"
                     /translation="MFKLKLLSISTIFILAGCVSLAPEYQRPPAPVPQQFSLSKNSLT
                     PAVNSYQDTGWRNFFVDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQ
                     LNASSGITYNGGLKGDKPTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARR
                     AVHILLVSNVSQSYFSQQLAYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQA
                     RGQIESTRAEIAKREGDLAQANNALQLVLGTYRAVPSEKGIKGGEIAPVKLPPNLSSQ
                     ILLQRPDIMEAEYQLKAADANIGAARAAFFPSITLTSGLSSSSTELSSLFTSGSGMWN
                     FIPKIEIPIFNAGRNKANLKLAEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQL
                     ESQQRYLDSLQITLQRARGLYASGAVSYIEVLDAERSLFATQQTILDLTYSRQVNEIN
                     LFTALGGGWVE"
     gene            28972..29652
                     /gene="silR"
                     /locus_tag="ECL_RS25935"
                     /old_locus_tag="ECL_A035"
     CDS             28972..29652
                     /gene="silR"
                     /locus_tag="ECL_RS25935"
                     /old_locus_tag="ECL_A035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001572351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper/silver response regulator transcription
                     factor SilR"
                     /protein_id="WP_000697968.1"
                     /translation="MKILIVEDEIKTGEYLSKGLTEAGFVVDHADNGLTGYHLAMTAE
                     YDLVILDIMLPDVNGWDIIRMLRTAGKGMPVLLLTALGTIEHRVKGLELGADDYLVKP
                     FAFAELLARVRTLLRRGNTMITESQFKVADLSIDLVSRKVSRAGNRIVLTSKEFSLLE
                     FFIRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDYETKLIQTVRGVG
                     YMLEVPDA"
     gene            29645..31120
                     /gene="silS"
                     /locus_tag="ECL_RS25940"
                     /old_locus_tag="ECL_A036"
     CDS             29645..31120
                     /gene="silS"
                     /locus_tag="ECL_RS25940"
                     /old_locus_tag="ECL_A036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004385431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper/silver sensor histidine kinase SilS"
                     /protein_id="WP_007374412.1"
                     /translation="MHSKPSRRPFSLALRLTFFISLSTILAFIAFTWFMLHSVENHFA
                     EQDVSDLQQISTTLNRILQSPVDPDDKKISKIKESIASYRNVALLLLNPRGEVLFSSA
                     QGAALRPAVNSADFSEHSRARDVFLWTVEDPAGPMDTGSEMKMETYRIIASSGQAIFQ
                     GKQQNYVMLTGLSINFHLHYLDALKKNLIAIAVVISLLIVLIIRIAVRQGHLPLRNVS
                     NAIKNITSENLDARLEPTRVPIELEQLVISFNHMIGKIEDVFTRQANFSADIAHEIRT
                     PITNLVTQTEIALSQDRTQRELEDVLYSSLEEYNRMTKMVSDMLFLAQADNNQLIPDR
                     VMFDLRAEVMKVFEFFEAWAEERNITLKFNGMPCLVEGDPQMFRRAINNLLSNALRYT
                     PEGQAITVSIREQESFFDLVIENPGKPIPEEHLSRLFDRFYRVDPSRQRKGEGSGIGL
                     AIVKSIVEAHHGRVQVESDVRSTRFILSVPRLEKMIPETQY"
     gene            31366..31797
                     /gene="silE"
                     /locus_tag="ECL_RS25945"
                     /old_locus_tag="ECL_A037"
     CDS             31366..31797
                     /gene="silE"
                     /locus_tag="ECL_RS25945"
                     /old_locus_tag="ECL_A037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000790485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="silver-binding protein SilE"
                     /protein_id="WP_007374411.1"
                     /translation="MKNIVLASVLGLSLISTAWATETVNIHERVNNAQAPAHQMQSSS
                     TPAAIQGAAPRMAGMDQHEQAIIVHETMNNGSADAHKKMAESHQKMMGTGTVNASRPA
                     TSFAAMNEHERAAVAHEFTNNGQSGPHQAMADAHRRMINAG"
     gene            31943..32311
                     /locus_tag="ECL_RS25950"
                     /old_locus_tag="ECL_A038"
     CDS             31943..32311
                     /locus_tag="ECL_RS25950"
                     /old_locus_tag="ECL_A038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000647571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF305 domain-containing protein"
                     /protein_id="WP_013087117.1"
                     /translation="MKITNSLFVILMLSLPAISAEHSEMKMSDISSSASSSSSSSSQE
                     YMSGMKGMHDKMMAAVKESDPDKAFAKGMVAHHEGAIAMAETELKYGKDPEMRKLAQD
                     IIKAQKGEIEQMNTWLGNQK"
     gene            complement(32719..33627)
                     /locus_tag="ECL_RS25955"
                     /old_locus_tag="ECL_A040"
     CDS             complement(32719..33627)
                     /locus_tag="ECL_RS25955"
                     /old_locus_tag="ECL_A040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001568530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_007374408.1"
                     /translation="MIKKICEVIDGEYVCDIDISVEEWKTLLTNDKVFDTKSIAALKK
                     WFIEPNHSCTCFDIGKKYDLHSMSANGVINGLGGRVQKELGRFEVKGVGNIASGTKFI
                     TVMKSKEIGGKPKRNLWTIREELVQAINELDFFGTTEMASSEYYSDDELINAIEKSNI
                     FDNVQTFEYTGEAKPKKNAIEVKNGLSYPRSKGVSQNALNKAGYRCEVDSDHPTFRRR
                     NSSLNYTEPHHIVPMSRQDAFDTSLDVEENIISLCCNCHKQIHLGQGYEDMLKEIYTA
                     RKRLLKKVGIDISLENLILYYKMESK"
     gene            complement(33857..34312)
                     /gene="merR"
                     /locus_tag="ECL_RS25960"
                     /old_locus_tag="ECL_A041"
     CDS             complement(33857..34312)
                     /gene="merR"
                     /locus_tag="ECL_RS25960"
                     /old_locus_tag="ECL_A041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001166627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="WP_001166628.1"
                     /translation="MQINFENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIR
                     RYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASGLAEHKLKDVREKMAD
                     LARMEAVLSELVCACHARKGNVSCPLIASLQDGTKLAASARGSHGVTTP"
     gene            34384..34734
                     /locus_tag="ECL_RS25965"
                     /old_locus_tag="ECL_A042"
     CDS             34384..34734
                     /locus_tag="ECL_RS25965"
                     /old_locus_tag="ECL_A042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transport protein MerT"
                     /protein_id="WP_001294660.1"
                     /translation="MSEPQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNL
                     TVLEPYRPIFIGAALVALFFAWRRIYRPAQACKPGEVCAIPQVRATYKLIFWIVAALV
                     LVALGFPYVMPFFY"
     gene            34750..35025
                     /gene="merP"
                     /locus_tag="ECL_RS25970"
                     /old_locus_tag="ECL_A043"
     CDS             34750..35025
                     /gene="merP"
                     /locus_tag="ECL_RS25970"
                     /old_locus_tag="ECL_A043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system periplasmic binding
                     protein MerP"
                     /protein_id="WP_000732276.1"
                     /translation="MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCSTCPITVKKAI
                     SKVEGVSKIDVTFETREAVVTFDDAKTSVQKLTKATGDAGYPSSVKQ"
     gene            35053..35460
                     /gene="merC"
                     /locus_tag="ECL_RS25975"
                     /old_locus_tag="ECL_A044"
     CDS             35053..35460
                     /gene="merC"
                     /locus_tag="ECL_RS25975"
                     /old_locus_tag="ECL_A044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017901292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organomercurial transporter MerC"
                     /protein_id="WP_000522993.1"
                     /translation="MGLITRIADKAGALGSVVSAMGCAACFPAIASLGAAIGLGFLQE
                     YEGLFISKLLPLFAVVALLANALGWLSHRQWYRSLLGMVGPAIVLAAMLLFFGNWWTA
                     NLLYVGLALMIGVSIWDLLSPANRRCELPPKHG"
     gene            35499..37181
                     /locus_tag="ECL_RS25980"
                     /old_locus_tag="ECL_A045"
     CDS             35499..37181
                     /locus_tag="ECL_RS25980"
                     /old_locus_tag="ECL_A045"
                     /EC_number="1.16.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000281123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury(II) reductase"
                     /protein_id="WP_000281123.1"
                     /translation="MYLNITGMTCDSCATHVKDALEKVPGVLSALVSYPKGSAQLATD
                     PGTSPEALTAAVAGLGYKATPADAPSTSARGRLLGKALGWLGGGDKAGGDGDGLHVAV
                     IGSGGAAMAAALKAVEQGANVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESP
                     FDSGIAATVPAIDRSKLLAQQQARVDELRHAKYEGILDSNPAITVLHGEARFKDDQSL
                     AVRLNDGGERVVAFDRCLVATGASPAVPPIPGLKESPYWTSTEALVSDTIPERLAVIG
                     SSVVALELAQAFARLGSKVTILARSTLFFREDPAIGEAVTAAFRAEGIKVLEYTQASQ
                     VAHVDGEFVLTTGYGEIRADQLLVATGRAPNTRSLALEAAGVAANAQGAIVIDKGMRT
                     STPHIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVG
                     YSEAEAHHDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSGRLIGVQAVAPEAG
                     ELIQTAVLAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSCCAG"
     gene            37199..37564
                     /gene="merD"
                     /locus_tag="ECL_RS25985"
                     /old_locus_tag="ECL_A046"
     CDS             37199..37564
                     /gene="merD"
                     /locus_tag="ECL_RS25985"
                     /old_locus_tag="ECL_A046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001277466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance co-regulator MerD"
                     /protein_id="WP_001277463.1"
                     /translation="MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDD
                     TALQRLRFVRAAFEAGIGLDALARLCRALDAADGDGASAQLAVLRQLVERRREALASL
                     EMQLAAMPTEPAQHAESLP"
     gene            37561..37797
                     /gene="merE"
                     /locus_tag="ECL_RS25990"
                     /old_locus_tag="ECL_A047"
     CDS             37561..37797
                     /gene="merE"
                     /locus_tag="ECL_RS25990"
                     /old_locus_tag="ECL_A047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="broad-spectrum mercury transporter MerE"
                     /protein_id="WP_001087807.1"
                     /translation="MNSPEHLPSETHKPITGYLWGALAVLTCPCHLPILAIVLAGTTA
                     GAFIGEHWGIAALTLTGLFVLSVTRLLRAFKGRS"
     gene            37863..38075
                     /locus_tag="ECL_RS26000"
     CDS             37863..38075
                     /locus_tag="ECL_RS26000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000993245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3330 domain-containing protein"
                     /protein_id="WP_000993245.1"
                     /translation="MNANAPNTASCTTCCVCCKEIPLDAAFTPEGAEYVEHFCGLDCY
                     ERFQARAKAATESDIAPVPGGSQPSD"
     gene            <38098..39093
                     /locus_tag="ECL_RS26005"
                     /old_locus_tag="ECL_A049"
                     /pseudo
     CDS             <38098..39093
                     /locus_tag="ECL_RS26005"
                     /old_locus_tag="ECL_A049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013023782.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(39198..40411)
                     /locus_tag="ECL_RS26010"
     CDS             complement(join(39198..40117,40117..40411))
                     /locus_tag="ECL_RS26010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612254.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_099516394.1"
                     /translation="MIFSPQHKTGDLMNKKTKRTFPPEFRLECAQLIVDKGYSYRQAS
                     EAMNVGSTTLESWVRQLRRERQGITPSATPITPDQQRIRELEKQVRRLEEQNTIFKKG
                     YRALNVRLAERFTIAARLSDSHTVVSLCSALEIHRSSYRYWRKRRDTVNPARVRLCSE
                     IRRAWNQSRGSAGARTLAEMLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQE
                     HTSLPNLLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHAD
                     TALISSALRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDN
                     SPMERFFRSLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENR
                     YHFYCKTVASIT"
     gene            <40468..40641
                     /locus_tag="ECL_RS26015"
                     /old_locus_tag="ECL_A053"
                     /pseudo
     CDS             <40468..40641
                     /locus_tag="ECL_RS26015"
                     /old_locus_tag="ECL_A053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004213076.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="korC"
     gene            complement(40631..40834)
                     /locus_tag="ECL_RS26020"
                     /old_locus_tag="ECL_A054"
     CDS             complement(40631..40834)
                     /locus_tag="ECL_RS26020"
                     /old_locus_tag="ECL_A054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000215610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087123.1"
                     /translation="MTVFLILTAIAYGIVSTGGYILLVDKGYQGWTLFWKNYDDLPHI
                     YRSRWRYQRRFILRRIWKRLFNR"
     gene            41377..41667
                     /locus_tag="ECL_RS26025"
                     /old_locus_tag="ECL_A057"
     CDS             41377..41667
                     /locus_tag="ECL_RS26025"
                     /old_locus_tag="ECL_A057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087126.1"
                     /translation="MNMKITLSVLFEALIILGHDRVWMEESEFEHIYGYGCYREIHTW
                     DDRTVAWWDDADDTWYLSTEVDVITPFLGPLPKKEGELSEEKCFQLMTLGRY"
     gene            41798..42328
                     /locus_tag="ECL_RS26030"
                     /old_locus_tag="ECL_A058"
     CDS             41798..42328
                     /locus_tag="ECL_RS26030"
                     /old_locus_tag="ECL_A058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087127.1"
                     /translation="MCKLTGFIMGLTILLGVTARDAGAATLSEMRMVNASQKPGMVII
                     CSRTSEIPQKGESPVRIESLLRGVVLQNDGDRMMFDVTYTQRNAEESIPFRTEKYRLT
                     TELEATRQKMAIDPETIELSLPRARGLEETFLAGMKASPVSFEDYTNYRVKSATEYLI
                     LPGPASPDAPVMHCTL"
     gene            42347..43123
                     /locus_tag="ECL_RS26035"
                     /old_locus_tag="ECL_A059"
     CDS             42347..43123
                     /locus_tag="ECL_RS26035"
                     /old_locus_tag="ECL_A059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="WP_013087128.1"
                     /translation="MMPALPGHSGAFSSAQLPVAIDYPAALALRQMALVQDELPKYLL
                     APEVSALLHYVPDLHRKMLLTTLWNTGARINEALALTRSDFSLAPPYPFVQLATLKQR
                     VEKAARTAGRAPAGSQPHRNVPLSDPQYARQLEMMVATLKIPLERRNKRTGRTEKVRI
                     WEITDRTVRTWLGEAVEAAAADGVTFSVPVTPHTFRHSYALHMLYAGIPLKVLQSLMG
                     HKSISSTEVYTKVFALDVAARHRVQFSMAQADAVAMLKKR"
     gene            43325..>43582
                     /locus_tag="ECL_RS26040"
                     /pseudo
     CDS             43325..>43582
                     /locus_tag="ECL_RS26040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012540156.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
     gene            complement(43826..44836)
                     /locus_tag="ECL_RS26045"
                     /old_locus_tag="ECL_A062"
     CDS             complement(43826..44836)
                     /locus_tag="ECL_RS26045"
                     /old_locus_tag="ECL_A062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_015572055.1"
                     /translation="MAMENNELPLNLQEVNKTTGEVVKLDVNSASTVQPVALMRLGLF
                     VPTLKSTSRSKTNRKNVTDATEELVQLSIARSEGYTDVRITGSRLDMDTDFKVWLGII
                     RSMYDFGVKDDTLKLSFVEFVKMCGFDSRRSNKKMRDRISNSLFKLASVTLKFQSETK
                     GWTTHLVQSAYYDITADVVEIRAEPKLFELYQMDRRVLLRLKAIDALQRKESAQALYT
                     YIESLPQNPAPISMKRMRDRLNLTSNLYTQNHTVRKAMAQLKDIGYLDYTEFKRGRAT
                     YFSVHYRNPKLISSKVVVPREPEEEVPEQNYDEVIKALKAAGIDPQKLAKALASVKPG
                     ND"
     gene            45577..46743
                     /gene="sopA"
                     /locus_tag="ECL_RS26050"
                     /old_locus_tag="ECL_A064"
     CDS             45577..46743
                     /gene="sopA"
                     /locus_tag="ECL_RS26050"
                     /old_locus_tag="ECL_A064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-partitioning protein SopA"
                     /protein_id="WP_013087133.1"
                     /translation="MGLMETLDQCITAGHEMTKAIAIAQFNDDSPEARKITRRWRVGE
                     AADLIGVSSQAIRDAEKAGRLPHPDMEMRGRVEQRVGYTIEQINHMRDVFGTRLRRPD
                     DSVPPVIAVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
                     HIHAEDTLLPFYLGERDDAAYAVKATCWPGLDIIPSCLALHRIETELMGRFDNGKLPT
                     EPRMMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQ
                     FFDMLRDLGKNVDLQGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRE
                     TDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
     gene            46743..47708
                     /locus_tag="ECL_RS26055"
                     /old_locus_tag="ECL_A065"
     CDS             46743..47708
                     /locus_tag="ECL_RS26055"
                     /old_locus_tag="ECL_A065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004117790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB/RepB/Spo0J family plasmid partition
                     protein"
                     /protein_id="WP_013087134.1"
                     /translation="MKRAPVIPKHTVKDIRPETEPSAAPAAPMVDSLIARVGAMARGN
                     TILLPVCGREVKFILEAIPGESVETASRVWSGNERDQELLTEDALDDLIPSFMLSGQQ
                     TPAFGRRVEGVIEIADGSRRRKAAILTSSDYRVLVGDLDDEQMMALSRLGNDYRPVSA
                     YERGNRYAQRLENDFNGNISALAEAENISRKIITRCINTAHLPKSVVALFTHPGELSA
                     RSGETLYKAFSGKEALLLQRTQQLHEQKKAGVIFESEEVIGLLTDVLKEPSGKKVNLN
                     TRHQFVPGATALYKGDKVIFNLDKSRLPAECIEKIESILRDLQKV"
     gene            complement(48358..49629)
                     /locus_tag="ECL_RS26060"
                     /old_locus_tag="ECL_A067"
     CDS             complement(48358..49629)
                     /locus_tag="ECL_RS26060"
                     /old_locus_tag="ECL_A067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000457616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Y-family DNA polymerase"
                     /protein_id="WP_013087135.1"
                     /translation="MFALADVNSFYASCERVFRPDLKGKPVVVLSNNDGCVIARSAEA
                     KPWIKMGMPWFQMKNETYPEKIYAFSSNYELYASMSARVMSCLEELAPRVEQYSIDEM
                     FLDLTGVEHCMDLEDFGRQLRQHVYDCTRLTIGVGAGPTKTLAKSAQWASKEWKQFRG
                     VLALTRGNPQRTRKLLSLQPVEEIWGVGNRIARKLNVLGIRTALDLALTNPAFIRKNF
                     SVVLERTVRELNGESCMSLEEAPPTKQQIVCSRSFGEKITEYDSLRQAVCQYAERASE
                     KLRKERQYCRHISVFIKTSPFAVKEPYYGNVATEKLLTPTQDTRDIIAAATTALERIW
                     KDGHLYAKAGVMLNDFTGSGVSQLQLFDERPPRPHSSELMKVLDGINHSGLGQIWFAG
                     RGIAPSWQMKRDMLSPAYTTRWKDIPVARIR"
     gene            complement(49629..50060)
                     /gene="umuD"
                     /locus_tag="ECL_RS26065"
                     /old_locus_tag="ECL_A068"
     CDS             complement(49629..50060)
                     /gene="umuD"
                     /locus_tag="ECL_RS26065"
                     /old_locus_tag="ECL_A068"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translesion error-prone DNA polymerase V
                     autoproteolytic subunit"
                     /protein_id="WP_013087136.1"
                     /translation="MKLQLFSTGKALPPQAHPLFADLASCGFPSPAADYVESDLDLHD
                     YCIRHPSATYYLRASGDSMSDGSLYNGDLLVVDSAEKPRHGDIVVASVQGEFTVKRLL
                     LTPRLTLQPMNAAWPPIYPDPDDLDIFGVVTHIIHRPREMY"
     gene            50292..51263
                     /locus_tag="ECL_RS26070"
                     /old_locus_tag="ECL_A069"
     CDS             50292..51263
                     /locus_tag="ECL_RS26070"
                     /old_locus_tag="ECL_A069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="StbA family protein"
                     /protein_id="WP_077681920.1"
                     /translation="MNIYCDDGSTNVKLAWFEGNELQTRVSANSFRHGWKVAEFSAAT
                     FNYQVGTLKYTWDSVSRDAIPTTNVEYQYGDLNLLAVHHALLNSGLEPQPVSLAVTLP
                     LSEYYDGDCQRNEENIRRKRENLMRELVLNKGRAFTVTDVKVMPESLPAAFSRLAELK
                     PGPAETTLIIDLGGTTLDAGVIVGQFDDISAVHGNPSVGVSQVTRAAAGALRAADSET
                     SALIADTVIRNRNDRQYLQRVINDAGKIDDVLNKITEAITSLGARVTSELTVFRSVNR
                     VFLVGGGASLIEEAIRQAWPLAPDRIEVIGDPQLALAREIALYNKED"
     gene            51266..51928
                     /locus_tag="ECL_RS26075"
                     /old_locus_tag="ECL_A070"
     CDS             51266..51928
                     /locus_tag="ECL_RS26075"
                     /old_locus_tag="ECL_A070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning/stability family protein"
                     /protein_id="WP_013087138.1"
                     /translation="MPDGQYSFYLHSDDRTDITAMATISTISQPLRGDFIRTAATAGA
                     VMYQTDARLPALIPVFFDGHLSAIRLCAVMALVSGTWSSLSGLPDEPDGGVAALAMSP
                     ETEYQRRRYTLTLQDDRSSERVERVLTGVSSRLRGELLRNLIITGLALHTTAPELPRL
                     LASMPVPPGTVSELQVLVQQMADTADVSMAAVPAKPAEPAAPVSAEATSIKKNMRRAF
                     GD"
     gene            51932..52195
                     /locus_tag="ECL_RS26080"
                     /old_locus_tag="ECL_A071"
     CDS             51932..52195
                     /locus_tag="ECL_RS26080"
                     /old_locus_tag="ECL_A071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087139.1"
                     /translation="MSVIKQKAVQCIHNFLRARNVPESQWPERVKKTGRGMILAGVAV
                     VVPGVLVDNISLPVTIAMQVCYASLIGLGVLLAFDEKKPEGRG"
     gene            52224..52427
                     /locus_tag="ECL_RS26085"
                     /old_locus_tag="ECL_A072"
     CDS             52224..52427
                     /locus_tag="ECL_RS26085"
                     /old_locus_tag="ECL_A072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087140.1"
                     /translation="MQLEELTGDERTLVVVALQALFRERLSASNAVFTVCSLSGKEQP
                     PEDIFGLREVEDALRRIGAAPAR"
     gene            52802..53269
                     /locus_tag="ECL_RS26090"
                     /old_locus_tag="ECL_A074"
     CDS             52802..53269
                     /locus_tag="ECL_RS26090"
                     /old_locus_tag="ECL_A074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087142.1"
                     /translation="MFRLTCIEPDNGEFAVYINHHYLGSEDASGERLSLGEVLEQLSL
                     LPGVELQTLLEPVPECDDWCWNDIADRVLPPRPACRDDVTVAGLIARLKQYPPDALCM
                     GTFWLEDDFLSLDSSLSEEEIAEAMRIGDHSHDAGIGFNWDTLQFAIDHVKGR"
     gene            53792..54484
                     /locus_tag="ECL_RS26095"
                     /old_locus_tag="ECL_A075"
     CDS             53792..54484
                     /locus_tag="ECL_RS26095"
                     /old_locus_tag="ECL_A075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007853273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="WP_013087143.1"
                     /translation="MSRFILGDCVQVMSRFPARAVDFILTDPPYLVGYKDRTGRTLAG
                     DNSAEWLQPACHEMYRVLKNDSLMVSFYAWNRADLFLNAWKTAGFRVVGHIVFAKSYA
                     SKSTFVGYTHESAYLLAKGRPQTPDRPIPDVIPWKYTGNRHHPTEKPVQSLRPLIESL
                     TRPGAIVLDPFAGSGSTCVAAAEASRRYIGIEMLEQYHAAGVRRLAQVERARRMPAAN
                     DGAFYPDWPEAA"
     gene            54481..54702
                     /locus_tag="ECL_RS26100"
                     /old_locus_tag="ECL_A076"
     CDS             54481..54702
                     /locus_tag="ECL_RS26100"
                     /old_locus_tag="ECL_A076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087144.1"
                     /translation="MNYPGLEHLRADVAALSNAMCDVRMLLNRLESQHRHDAATLTER
                     MAAQTLRRINTLLLEAYREALVLDETFQD"
     gene            54758..55180
                     /locus_tag="ECL_RS26105"
                     /old_locus_tag="ECL_A077"
     CDS             54758..55180
                     /locus_tag="ECL_RS26105"
                     /old_locus_tag="ECL_A077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1380 family protein"
                     /protein_id="WP_013087145.1"
                     /translation="MYGTREELCVQLKNMFTFDEPLVLLVWTEEGISVACREAQPEPD
                     GAEIRNLMKAIGEMKMTQYRQEGVNNLTVSDLLARQWEVANRQVSVPAVLLSRVLRNY
                     ECELENRIGMAWEAGRQEPESVRNELKDVHALQETLAA"
     gene            55537..55965
                     /locus_tag="ECL_RS26110"
                     /old_locus_tag="ECL_A080"
     CDS             55537..55965
                     /locus_tag="ECL_RS26110"
                     /old_locus_tag="ECL_A080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008502215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="WP_013087148.1"
                     /translation="MNQTVTCDAVRLEGAQRLTFLPDLFGGDFMTSEASVYAYAQRYC
                     PEYQGGFWQFYRLPEGGGYMAPDVESLTLCNPDNWFEETVSGEVAGIILTALVLNHRS
                     WHHSNHDHEELCRHFCRRYEQLMAFADTHPESATIWRALD"
     gene            56008..56418
                     /locus_tag="ECL_RS26115"
                     /old_locus_tag="ECL_A081"
     CDS             56008..56418
                     /locus_tag="ECL_RS26115"
                     /old_locus_tag="ECL_A081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1380 family protein"
                     /protein_id="WP_013087149.1"
                     /translation="MIGTAREIALEMFRHSDLDGEKYVFACWNRNDIRCVCLDWDLTD
                     EELDEVLRRLSSCLESGADIGQIRAIVETMLDERREKRTVTIPAKSLALVMQLAGREM
                     QRIAVCAEDGGGSAEETLKEENDVMMRLRAALDA"
     gene            56469..56666
                     /locus_tag="ECL_RS26120"
                     /old_locus_tag="ECL_A082"
     CDS             56469..56666
                     /locus_tag="ECL_RS26120"
                     /old_locus_tag="ECL_A082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071888820.1"
                     /translation="MQLSPETRSILRQYKTLINERRRESGLSPVTTAKVLEEICESAT
                     RQCAVYLCGHFILQGGQGDAQ"
     gene            57436..57708
                     /locus_tag="ECL_RS26125"
                     /old_locus_tag="ECL_A086"
     CDS             57436..57708
                     /locus_tag="ECL_RS26125"
                     /old_locus_tag="ECL_A086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009367026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087154.1"
                     /translation="MHTRNVNVKTAAPESSRKMGEEQNPVSVAREWVAQATSLKAGVT
                     VTLSDVSRYGDVQVEIRTNGTLNWRDWSFEPDFLFELKRNLQYVQL"
     gene            57752..58117
                     /locus_tag="ECL_RS26130"
                     /old_locus_tag="ECL_A087"
     CDS             57752..58117
                     /locus_tag="ECL_RS26130"
                     /old_locus_tag="ECL_A087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087155.1"
                     /translation="MQNLNTRPATRKVGQSTEIVKLLRIQASDTHVVEFDNVDTRFND
                     CNNWQVMAGGKRVLFSNRMYERFSDVKSGIVATINVCENSGSVTDNAMLEGAKVMMQV
                     LDGYPSFAALAAHPKRITG"
     gene            58185..60197
                     /locus_tag="ECL_RS26135"
                     /old_locus_tag="ECL_A088"
     CDS             58185..60197
                     /locus_tag="ECL_RS26135"
                     /old_locus_tag="ECL_A088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB N-terminal domain-containing protein"
                     /protein_id="WP_013087156.1"
                     /translation="MVATNTTAKKPARTTRQTKSAEKIAQSTEQKLVQLLADTPVQIF
                     PYSRLSHTDLNTRIIPHTDQEVEEMADSIQAMGILQNLIGAELPDGTIGIVGGEGRRR
                     GTGILVMRGVLDADTPFVPVKVLPVEMAVAASMIENGRRKNMHPAEQIIGFRTLQQEG
                     KTASQIGALMGYHPRHVQRCLKLANLAPSLLDALARDEISLEQCEVLTLADTHERQEQ
                     VWKEAVEQWRDPAVQTLRKMVTDDKMAISHPMFEYVGEEAYTAAGGTLTADLFSDKDS
                     TFADAALVKSLLAGKLTVLAARVKQEQGWGWAEFRMTELRASGEDGEQYRFAMPKAVL
                     TEEEQKRVSELEEQMEATESYDDEYELQQDIDDIYCEAQYREATPEFRAAHGIWVSWD
                     GSNFQVQPGIRKLTDEDRVAEEQARQERESNVIRHTTPEIPADAYPATLVKAMSAERT
                     LAVQAELAGRPDVSVALLTWTLCLSMFDRSYGKRSEPLKASVSSNQYHLASLAPSGEE
                     GKALTALKAQKEALQATLPENWHLDFTWLLSWSAEQVNTLLGFCAAHGINGIQERMYN
                     HTQKSELDGLEAALDFDLRKWWQPDAESYFGKLTIPQIGKAYEEAGLSARAGEIVKLK
                     RRDAAKAAEQDLNAQGWLPDWMVRTSPAAEAEEATETDAHTTDHAA"
     gene            60235..60669
                     /gene="psiB"
                     /locus_tag="ECL_RS26140"
                     /old_locus_tag="ECL_A089"
     CDS             60235..60669
                     /gene="psiB"
                     /locus_tag="ECL_RS26140"
                     /old_locus_tag="ECL_A089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugation system SOS inhibitor PsiB"
                     /protein_id="WP_032669078.1"
                     /translation="MTMQYDLNQINKLTASDLEFIRQQGEDARRALSDTVTGLLSTPE
                     GWRVCAEYRSEFGGFFPVQCRFSADGSDDWHLCVCSSGEVSPYWLLVLLSSGGEVVCT
                     LYQSDTLQPDRINPLIAQLAGMRRFNCTARTVVNLMSGEVTA"
     gene            60666..61397
                     /locus_tag="ECL_RS26145"
                     /old_locus_tag="ECL_A090"
     CDS             60666..61397
                     /locus_tag="ECL_RS26145"
                     /old_locus_tag="ECL_A090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="WP_013087158.1"
                     /translation="MIPSSHALVSLKPARQAAIQAISHVESARERGARLPAMPYVRTF
                     LRLLTGSGRLNATVANKIPGLHWVPNNRHSNLKQVEEALNTMIATSGEACPLPLTIDV
                     QAELFPEVMHTRTGRRLHRSGIKTTRQMRRQSREYEQRWKLRQNLLEQAKIDLNFQSP
                     ETVCTWYTRWSDEFDAAELAGPFWRWQSRFTSLKELDWLRISGEPLYAVMYEIPFIVR
                     ETPESVRTAERWQVPNKLRYLQGAE"
     gene            61394..61624
                     /locus_tag="ECL_RS26150"
                     /old_locus_tag="ECL_A091"
     CDS             61394..61624
                     /locus_tag="ECL_RS26150"
                     /old_locus_tag="ECL_A091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004146149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087159.1"
                     /translation="MRNNPCKTELKVARSQRNKLRTMSAKLKEMSCEWDGLSGWLETE
                     SEQLAESIDRHLEALEDQIREWSEGTDNREGY"
     gene            61666..61845
                     /locus_tag="ECL_RS26155"
                     /old_locus_tag="ECL_A092"
     CDS             61666..61845
                     /locus_tag="ECL_RS26155"
                     /old_locus_tag="ECL_A092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032669168.1"
                     /translation="MFRHAESGKILYRLDARLERDDWETVQSMISLVYNAGVAAGSEQ
                     RAAEIREALGYSGTG"
     gene            62067..63436
                     /locus_tag="ECL_RS26160"
     CDS             join(62067..62556,62556..63436)
                     /locus_tag="ECL_RS26160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611947.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_087654045.1"
                     /translation="MSRRKYTFQQRLEVVMHYFATDEGYRLTSARFNVPRTQVRIWVA
                     AYDAYGEEGLKPRDKGVSIAPDIRVEAVKAVLTGQISQTQAAAKFNVAGSASVGKWMK
                     VFSEHGEEGLRSLRIGKKRALHMIDDPVALEAALERSKDKRIQELEQKVRRLELRILY
                     LKKFESLSSIRDKVRIIDELRQHYSFEQLLQIAQIPRSTFYYHLKALRSPGKYDEVKC
                     RIKEIYDENQGRYGYRRIALALRREGGALNHKVVQRLMNVLRLKAAIRVKRYSSWRGE
                     HGRAADNILQRNFKASRPNEKWVTDVTEFAVNGRKLYLSPIIDLFNNEVISYSISERP
                     TMPMIDEMLIKAFARMDPNSKPVLHSDQGWQYRHRWYQYQLRDFGVTQSMSRKGNCLD
                     NACAECFFGTLKSECFYLGKFKDIDELKDAIEDYIRYYNTRRISLKFNGLSPVEYRLK
                     FHPLRI"
     gene            63654..64004
                     /gene="arsR"
                     /locus_tag="ECL_RS26165"
                     /old_locus_tag="ECL_A096"
     CDS             63654..64004
                     /gene="arsR"
                     /locus_tag="ECL_RS26165"
                     /old_locus_tag="ECL_A096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002438872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="As(III)-sensing metalloregulatory
                     transcriptional repressor ArsR"
                     /protein_id="WP_012540252.1"
                     /translation="MKLTTLQLFKYLSDETRLGIVLLLREMGELCVCDLCTALEQSQP
                     KISRHLAMLRESGLLLDRKQGKWVHYRLSPQIPSWAAQVIELAWLSQQDDVQAIARKL
                     ASANCSGSGKAVCI"
     gene            64052..64414
                     /gene="arsD"
                     /locus_tag="ECL_RS26170"
                     /old_locus_tag="ECL_A097"
     CDS             64052..64414
                     /gene="arsD"
                     /locus_tag="ECL_RS26170"
                     /old_locus_tag="ECL_A097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000855179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite efflux transporter metallochaperone
                     ArsD"
                     /protein_id="WP_012540111.1"
                     /translation="MKTLTVFDPAMCCSTGVCGSDVDQVLVDFSADVQWLKGRGVQVE
                     RYNLAQQPMSFVQNEKAKAFLEASGAEGLPLLLLDGETVMAGRYPKRAELARWFGIPL
                     EKVGLAPISCCGGNTSCC"
     gene            64432..66183
                     /gene="arsA"
                     /locus_tag="ECL_RS26175"
                     /old_locus_tag="ECL_A098"
     CDS             64432..66183
                     /gene="arsA"
                     /locus_tag="ECL_RS26175"
                     /old_locus_tag="ECL_A098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004152099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite efflux transporter ATPase subunit ArsA"
                     /protein_id="WP_013087164.1"
                     /translation="MKFLQNIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVST
                     DPASNVGQVFDQAIGNTIRPVTAVHGLSALEIDPQDAAQQYRARIVDPIKGLLPDDVV
                     NSISEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTAPTGHTIRLLQLPGAWS
                     SFIESNPDGASCLGPMAGLEKQREQYAHAVEALSDPERTRLVLVARLQKSTLQEVART
                     HEELSAIGLKNQYLVINRVLPKAEAEHDALAAAIWQREQEALANLPSGLSELPTDTLL
                     LQPVNMVGVSALKGLLDTRSETLPLPVTNILYTPENLSLSGLVDDIARSEHGLIMLMG
                     KGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAAHLSTTLNGSLKNLQVSRINPHDETE
                     RYRQHVLETKGRDLDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMDTAP
                     TGHTLLLLDATGAYHREIAKKMGSKGHFTTPMMQLQDPDRTKVLLVTLPETTPVLEAA
                     NLQADLERAGIHPWGWIINNSLSIADTRSPLLCQRARQEQPQIEAVKNQYANRIALVP
                     VLTSEPAGIEKLRELMS"
     gene            66231..67520
                     /gene="arsB"
                     /locus_tag="ECL_RS26180"
                     /old_locus_tag="ECL_A099"
     CDS             66231..67520
                     /gene="arsB"
                     /locus_tag="ECL_RS26180"
                     /old_locus_tag="ECL_A099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite efflux transporter membrane subunit
                     ArsB"
                     /protein_id="WP_012540054.1"
                     /translation="MLLAGAIFVLTIVLVIWQPKGLGIGWSAMLGAGLALISGVVHVG
                     DIPVVWNIVWNATATFIAVIIISLLLDESGFFEWAALHVSRWGNGRGRLLFTYIVLLG
                     AAVAALFANDGAALILTPIVIAMLLALGFSKGTTLAFVMAAGFIADTASLPLIVSNLV
                     NIVSADFFGLGFTEYASVMVPVDIAAIIATLAMLHLFFRKDIPPTYDLALLKAPTKAI
                     KDPATFRTGWIVLILLLVGFFVLEPLGIPVSAIAAVGAVILFAVAKRGHAINTGKVLR
                     GAPWQIVIFSLGMYLVVYGLRNAGLTEYLSGVLNVLADKGLWAATLGTGFLTAFLSSI
                     MNNMPTVLVGALSIDGSTATGVIKEAMIYANVIGCDLGPKITPIGSLATLLWLHVLSQ
                     KNMTITWGYYFRTGIVMTLPVLFVTLAALALRLSFTL"
     gene            67533..67958
                     /gene="arsC"
                     /locus_tag="ECL_RS26185"
                     /old_locus_tag="ECL_A100"
     CDS             67533..67958
                     /gene="arsC"
                     /locus_tag="ECL_RS26185"
                     /old_locus_tag="ECL_A100"
                     /EC_number="1.20.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_417960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-dependent arsenate reductase"
                     /protein_id="WP_013087165.1"
                     /translation="MSNITIYHNPACGTSRNTLEMIRNSGNEPTVIHYLENPPSRDEL
                     VKLIADMGISVRALLRKNVEPYEELGLAEDKFTDGELIDFMLQYPILINRPIVVTPLG
                     TRLCRPSEVVLDILPDAQKGAFAKEDGEKVVDETGKRLK"
     gene            complement(67993..68529)
                     /locus_tag="ECL_RS26190"
                     /old_locus_tag="ECL_A101"
     CDS             complement(67993..68529)
                     /locus_tag="ECL_RS26190"
                     /old_locus_tag="ECL_A101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008785735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_013087166.1"
                     /translation="MHIINAEEQHITAIRNIYAHHVLHGTGSFETEPPDTQEMLNRLR
                     SIQSRGFPWYVALHGDTVIGYCYISRYRERHAYRFTVENSIYIDPTYQRQGVGKALLN
                     HALKWAESQGYRQMIAVVGDSANVASVALHIRTGFTEIGTLKDIGFKHGRWLDTVLLQ
                     MKLGEGNRTLPEDSDLML"
     gene            complement(68654..70405)
                     /gene="arsA"
                     /locus_tag="ECL_RS26195"
                     /old_locus_tag="ECL_A102"
     CDS             complement(68654..70405)
                     /gene="arsA"
                     /locus_tag="ECL_RS26195"
                     /old_locus_tag="ECL_A102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_131199602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical pump-driving ATPase"
                     /protein_id="WP_162875198.1"
                     /translation="MPFLKDIPPFIFFTGKGGVGKTSLACATAVWLADQGKRTLLVST
                     DPASNVGQVFSQTIGHRITDISTVENLAAMEVDPMAAAQAYRDRVLDPVRGLMPADVV
                     SSIEEQLSGSCTTEIAAFDEFTGLLTNHELREKYDHIVFDTAPTGHTIRMLELPGAWS
                     GYLEANPDAAANLGPLVGLEKQQHQYSDAVKALSDAALTRLVLVARAQASTLKEVSHT
                     HDELSAIGLQHQHLAINGVLPPFAGEDDPLAQSILVREEKALQAMPDNLANLPRSQLY
                     LKPFNLVGLEALRELFTQSKAAPALPDTTLNVLDLPKLSSLVDELSQTGNGLVMTMGK
                     GGVGKTTIAASVAVSLAKRGHKVHLTTSDPAAHLSYTLDGSLPNLQVSRIDPKVETER
                     YRRFVLENQGKGLDAEGLAVLEEDLRSPCTEEIAVFQAFSRIIKEADDHFVIMDTAPT
                     GHTLLLLDATGAYHREMVRQMGQTHDNLLTPMMLLQDPEKTKVIIVTLAETTPVLEAA
                     NLQQDLRRAEIEPWAWVINSSLAAAKPSSPFLVTRASRELPLINDVTEQFAERIALTP
                     LQNEEPVGAALLAKMAG"
     gene            complement(70432..70794)
                     /locus_tag="ECL_RS26200"
                     /old_locus_tag="ECL_A103"
     CDS             complement(70432..70794)
                     /locus_tag="ECL_RS26200"
                     /old_locus_tag="ECL_A103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000034287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic metallochaperone ArsD family protein"
                     /protein_id="WP_013087168.1"
                     /translation="MSNIEIFEAAGCCATSSVVVSDEAIKWNASAEWAKKNGVDIQRY
                     SLAKNPQQFLNTPVIKEFLNTSGMESLPVTLLDGKLVMAGKLPTREDIARWAGIPLTQ
                     DWSEGSTQPRCCSIPRMP"
     gene            complement(70870..71415)
                     /locus_tag="ECL_RS26205"
                     /old_locus_tag="ECL_A104"
     CDS             complement(70870..71415)
                     /locus_tag="ECL_RS26205"
                     /old_locus_tag="ECL_A104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001286342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_013087169.1"
                     /translation="MSDVTAFNNCMSVFWRQHEAELARFLTSKTGDSEKAADLLQELF
                     LRARAHSDSFCEMENPRAWLYRAARNLLIDEYRTARDFVELEEDAPLTDASPEAISTL
                     GICLPETLQALPEDERWLIEESDLNRRPQQSLADELGITLTAFKSRLLRARKHLKEAM
                     TELCQIEADDTSSVCCHKKMN"
     gene            complement(71424..72137)
                     /gene="arsH"
                     /locus_tag="ECL_RS26210"
                     /old_locus_tag="ECL_A105"
     CDS             complement(71424..72137)
                     /gene="arsH"
                     /locus_tag="ECL_RS26210"
                     /old_locus_tag="ECL_A105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016151351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical resistance protein ArsH"
                     /protein_id="WP_013087170.1"
                     /translation="MPTELKNVDAGLFDTSITEAKFHVPAIPHPPRILMLYGSVRERS
                     YSRLATEEAARLLTAMGAEVRIFNPSGLPLPDDAPETHPKVMELRELVRWSEGMVWCS
                     PERHGAMTGIMKAQIDWIPLSEGAVRPSQGKTLAVMQVCGGSQSFNAVNQMRILGRWM
                     RMITIPNQSSVAKAWQEFDEDERMKPSSYYDRIVDVMEELVKFTLLTRGNSAYLVNRY
                     SERKESAEELSRRVNQSKI"
     gene            complement(72139..72462)
                     /locus_tag="ECL_RS26215"
                     /old_locus_tag="ECL_A106"
     CDS             complement(72139..72462)
                     /locus_tag="ECL_RS26215"
                     /old_locus_tag="ECL_A106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012540250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_013087171.1"
                     /translation="MELISASTVLKELGHATRLGIYKKLVKAGPQGLPVGDLQKQLEI
                     PASTLSHHISSLISVSLVRQERQGRTLYCHACYEKLSALIAFLTEECCTGADGLHNTN
                     NDVGE"
     gene            72763..73029
                     /locus_tag="ECL_RS26220"
                     /old_locus_tag="ECL_A107"
     CDS             72763..73029
                     /locus_tag="ECL_RS26220"
                     /old_locus_tag="ECL_A107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004213599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1778 domain-containing protein"
                     /protein_id="WP_012540086.1"
                     /translation="MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACQAAEN
                     VILDRRVFNFNDEQYAEFIDMLDAPVADDPAIDKLLARKPQWDV"
     gene            73017..73502
                     /locus_tag="ECL_RS26225"
                     /old_locus_tag="ECL_A108"
     CDS             73017..73502
                     /locus_tag="ECL_RS26225"
                     /old_locus_tag="ECL_A108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013087172.1"
                     /translation="MGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSAR
                     TFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNMPDPIPVIILARLAVDLSFRGKG
                     LGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
                     Q"
     gene            73921..75261
                     /locus_tag="ECL_RS26230"
                     /old_locus_tag="ECL_A109"
     CDS             73921..75261
                     /locus_tag="ECL_RS26230"
                     /old_locus_tag="ECL_A109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001481272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISNCY family transposase"
                     /protein_id="WP_000589001.1"
                     /translation="MIKETVTMSHKELDRLHIIQESLNRHITQEQAAARIGISIRQVK
                     RLVQRYRNEGPSGLVSRRRGKRPNNSFSTEFRATVISLLKGRYADFGPTLACEKLREI
                     HGLCLSIETLRKWMVEEGIWRERRRKFARIYQRRMRRPSYGELIQIDGSPHDWFEGRG
                     PKCTLIVFIDDATSALMALRFAPAETTRAYMETLRGYLNDHGVPLALYSDRHSIFRVN
                     NPEREGELTQFTRAIKTLGIEPIHANSPQAKGRVERANQTLQDRLVKEMRLQGISDIE
                     TANAWLPTFIEAYNNRFATPPRIADNAHLDVHHSEEELGYIFSLQAKRVLSKNLTFQY
                     KSSAFQIRSEGRGYRLRHSVVTVCESFNGEIKVLYDGKALGWEKYVDGPEPIPLDDEK
                     SVHERVDNARFDLRSKFYVKPKADHPWLTRRTQSNQQVKPPKLPRKKADPDKMD"
     gene            complement(75517..75939)
                     /locus_tag="ECL_RS26235"
                     /old_locus_tag="ECL_A110"
     CDS             complement(75517..75939)
                     /locus_tag="ECL_RS26235"
                     /old_locus_tag="ECL_A110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_131199603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel resistance OB fold protein NcrY"
                     /protein_id="WP_032072095.1"
                     /translation="MESAMQKQYFSQFVTGVLLTSFIAIPALAAQGGFSAEKEPVVTE
                     HMYAGHKVQQENSQSRIQIVSSMHEGAWITLEGNVVSQQQDEWYTFRDPTGTIKVRIP
                     QKVWNGQHFDAQDLVRVSGPVSHENDGSILYVAVISKP"
     gene            complement(76101..77231)
                     /locus_tag="ECL_RS26240"
                     /old_locus_tag="ECL_A111"
     CDS             complement(76101..77231)
                     /locus_tag="ECL_RS26240"
                     /old_locus_tag="ECL_A111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010953868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ni(II)/Co(II) efflux transporter permease
                     subunit NcrC"
                     /protein_id="WP_004196366.1"
                     /translation="MTDFSTLLQQGVANAWLFIPSAILLGALHGLEPGHSKTMMAAFI
                     VAIRGTVKQAVLLGLAATISHTSVVWLIAFGGMYISQKFTAESAEPWFQLISAVIILG
                     TAAWMFWRTWRGEKLWKMEQEEEHSHGHHDHDETRIIDTGHGSVELSIFEEGQPPHWR
                     LRSLSGKKWEARDISLVTNRGPGTFSQVFDFVEKDGFMESALAIPEPHSFDVRLSLGH
                     RGHVHDYDVEFREHEHDHDHSSLEGLDVNSREYQDAHEKAHANDIKKRFANRSVTTGQ
                     IILFGLTGGLIPCPAAITVLLLCIQVKEFTLGAALVLCFSIGLAITLVSVGAAAAFSV
                     RQATKRWSGLDTLARRAPYFSSVLIALVGIYMGYHGWIGVTS"
     gene            complement(77244..77513)
                     /locus_tag="ECL_RS26245"
                     /old_locus_tag="ECL_A112"
     CDS             complement(77244..77513)
                     /locus_tag="ECL_RS26245"
                     /old_locus_tag="ECL_A112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_032676615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-sensing transcriptional repressor NcrB"
                     /protein_id="WP_004196355.1"
                     /translation="MTVHASHPDIIKRLKRAAGHLKSTIQMLEDEKACLDIAQQLHAV
                     EKAITNAKRTLIHDHLDHCLEDALHADHTESDKTLSEFKEITKYL"
     gene            complement(77619..78917)
                     /gene="nirA"
                     /locus_tag="ECL_RS26250"
                     /old_locus_tag="ECL_A113"
     CDS             complement(77619..78917)
                     /gene="nirA"
                     /locus_tag="ECL_RS26250"
                     /old_locus_tag="ECL_A113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_063154576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel resistance membrane nickel efflux protein
                     NirA"
                     /protein_id="WP_004196314.1"
                     /translation="MLNILSNRTYRHLFMAQVIALIGTGLATVALGLLAYDLAGDRAG
                     AVLGTALAIKMSAYILVAPVAAAFADKFPRRTMLVTLDLVRALVAITLPFVTQIWEIY
                     ILIFILQAASAAFTPTFQATIPDILPDEREYTRALSLSRLAYDLESVISPMLAAALLT
                     VMSFHNLFAGTAVGFLASAALVVSVTLPKMKALTVKRSIYDKTTRGMRIFLKTPRLRG
                     LLALNMAVAAASAMVIVNTVVLVQADFGFSQRSTAIALAFFGVGSMVSALVLPRLLDN
                     MSDRMPMLAGTALLVIGLGSGIFLKDYITLVVLWALLGVGYSLSQTPGGRLLRRSSTA
                     EDRPALFAAQFALSHSCWLVTYPLAGWVGAAWGTQASFIALTVVATLSLVTAVLIWRP
                     EHEVYAQVHSHKDPETNNESTHEHDFVIDDEHPSWPKKEK"
     gene            complement(79151..79909)
                     /locus_tag="ECL_RS26255"
                     /old_locus_tag="ECL_A115"
     CDS             complement(79151..79909)
                     /locus_tag="ECL_RS26255"
                     /old_locus_tag="ECL_A115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004196325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004196325.1"
                     /translation="MTTLLPGETLAASLAEKVSETWQKINTRRNQQEAITPGWVLQSL
                     GLKPGSTELRRAIFELVRRIPYQLGAWNGESMSLFQQGFGDCRHKAAAAERLLTDGGI
                     TAKRKLVRFDWADLPVPADILAILPQTQGFHDTVAFELQGKTYLFDATWDMALRGAGF
                     PVMPSWDGNSDTWPVTSRMSTQQTVLMPQPGQDIYSTNQMSWPQREKTMAFNQALNNW
                     LEVIRANRDDWCTIIHSDIEATRLSLKTCLGQLS"
     gene            complement(79963..80883)
                     /locus_tag="ECL_RS26260"
                     /old_locus_tag="ECL_A116"
     CDS             complement(79963..80883)
                     /locus_tag="ECL_RS26260"
                     /old_locus_tag="ECL_A116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009651957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004196315.1"
                     /translation="MYKDSIQARREIARNFTALNYRVDPLHWQTLCMGVNRDLQAKKM
                     RPNVPVPSRRKVIPFLKMMHQETGSMLKAILAFGFDGPWTSSGGSFRLAREIGFDIAH
                     YAKNIHHKNGKVTFLEIGAAWAGFRAEECAGHQATISGLSGEFREQLGESVFLHFTNL
                     TPWHASLPKGVTEHPYVTAAGLGALENRGVQAGEVDIIYSQAAAYFEQDYTAFLRSAA
                     RLLKEDGVLIFNHDPVLASAMDEVAWEHGLRLVRRKQMGGMNGAIARYHRLRSSPVSQ
                     MVFPGVKRAEDEEVVCESLVMSALRRNVEV"
     gene            complement(80946..81317)
                     /locus_tag="ECL_RS26265"
                     /old_locus_tag="ECL_A117"
     CDS             complement(80946..81317)
                     /locus_tag="ECL_RS26265"
                     /old_locus_tag="ECL_A117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004196359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004196359.1"
                     /translation="MYPMFKRSPRYVLMIVIMAIGMMMSSMVTFASHGTNGLTGYEMN
                     LHDAEVTMSMQDHSHDSDIPQSGHAGHHQTDHFHETPEQPPSVEISLSPVTDRWLPLA
                     DLRSPVKATDIIYRPPSIRQI"
     gene            complement(<81442..81634)
                     /locus_tag="ECL_RS26270"
                     /old_locus_tag="ECL_A118"
                     /pseudo
     CDS             complement(<81442..81634)
                     /locus_tag="ECL_RS26270"
                     /old_locus_tag="ECL_A118"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_063154576.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
     gene            81664..82641
                     /locus_tag="ECL_RS26275"
                     /old_locus_tag="ECL_A119"
     CDS             81664..82641
                     /locus_tag="ECL_RS26275"
                     /old_locus_tag="ECL_A119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004118716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate resistance protein"
                     /protein_id="WP_004196334.1"
                     /translation="MKLHILILTLPTEQATLRMRVWRALKNTGAAMLRDGVYLLPEAQ
                     QSHEIFNEMSREISGEGGTAFVFDAETSDEEKIRPLFDRSQQYLILMESLQVCKNDLN
                     EETAVSQLKMVRKLRRELDRIVAIDFFPGEAQAQAIFALSELEAGINRFISPGEPHAV
                     SGLLTRLKPEDFHNRIWATRRRPWIDRLASAWLIRRFIDQDAQFLWLKDGNDCPEEAV
                     GFDFDGATFSHIDNRVTFEVLMVRFGLTGDALNGLGMLVHYLDVGGVQPPEAAGVESV
                     LAGLRESITDDDTLLTAACSLFDGLLTTFEMRSGHDEQNGVADAGRGKR"
     gene            82598..83974
                     /gene="chrA"
                     /locus_tag="ECL_RS26280"
                     /old_locus_tag="ECL_A120"
     CDS             82598..83974
                     /gene="chrA"
                     /locus_tag="ECL_RS26280"
                     /old_locus_tag="ECL_A120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016161235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate efflux transporter"
                     /protein_id="WP_004196363.1"
                     /translation="MNKTELLTLAEENVKPKPVPLKEAFWFWMKLGFISFGGPAGQIA
                     IMHQELVENRRWISESRFLHALNFCMVLPGPEAQQLATYIGWLMHRTLGGVIAGLLFI
                     LPSLFILIALSWIYIAWGDVAIIAGIFYGIKPAVAAIVLQAAHRIGSRALKHGAHWAI
                     AAAAFVAVFALNVPFPVIVISAAITGFIGGRIAPEKFHSGSGHNKQEKAAVDAAVIDD
                     HTPVPAHALFSWAKLLRIVAAGALLWLIPMTVLTLGLGWAHPVTQMGWFFTKAALLTF
                     GGAYAVLPYVYQGAVVNFGWLTAGQMMDGLALGETTPGPLIMVVTFVGFVGGYTHAVF
                     GADMLFVGGAVAACMVTWFTFLPSFIFVLAGGPFIETTHNKAGFTAPLTAITAAVVGV
                     IVNLGLFFIWHTVWPEGAKGGIDIPAALIAVAAAFALFRLKWKVTHVIAMAALAGLIL
                     RLTGLSAV"
     gene            complement(84005..84694)
                     /locus_tag="ECL_RS26285"
                     /old_locus_tag="ECL_A121"
     CDS             complement(84005..84694)
                     /locus_tag="ECL_RS26285"
                     /old_locus_tag="ECL_A121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004196322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087175.1"
                     /translation="MYNADLPTRAELPSAIKLMQSTILAAIVALTLLITVVMPSEYGI
                     DPTGVGRLLGLKQMGEIKTQLAEEADADNQASAVQQGQLAAPVNERPIPDNPPAITQN
                     TYPELSVPATTRAPEVPSAGSQRHQMLITLKPNEAAEVKLEMRKDARVTYQWTSSGPV
                     NVDAHGDPVNAPKGFYHGYGKARQITSGDGVLQAAFEGKHGWFWRNRGSETITIQLDT
                     TGDYLNIKRVI"
     gene            complement(84708..85445)
                     /locus_tag="ECL_RS26290"
                     /old_locus_tag="ECL_A122"
     CDS             complement(84708..85445)
                     /locus_tag="ECL_RS26290"
                     /old_locus_tag="ECL_A122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008460272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HupE/UreJ family protein"
                     /protein_id="WP_008460272.1"
                     /translation="MYTSLDTQGRLSARLLSAQARSACLFFLLLLLFYSQGAYAHGVA
                     EGDKGYIQEITGVNIIPFIYLGAKHMVTGYDHLLFLFGVIFFLYKMRDIGLYVSLFAI
                     GHSTTLLIGTFFDISVSAYLIDAIIGLSVVYKALDNLGAFQRWFGVQPNTKLATLIFG
                     FFHGFGLATKIQEFEISPDGLFVNLIAFNIGVEIGQLLALSAILIVMSYWRQTASFFR
                     HAYTANVVMMSAGFLLMSYQLCGYILA"
     gene            complement(85489..85854)
                     /locus_tag="ECL_RS26295"
                     /old_locus_tag="ECL_A123"
     CDS             complement(85489..85854)
                     /locus_tag="ECL_RS26295"
                     /old_locus_tag="ECL_A123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009651956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_009651956.1"
                     /translation="MFISREVISRIVLIIMAVAVLSSSFMAKPQAAYSVQETTSISDH
                     QHDSDEPLNEHDPLLFHSHGSVHHLNADHSHDLNKLFALPTLHAWNPGMRVIYALSSE
                     QILQMPQSTPERPPRILSA"
     gene            complement(85890..87010)
                     /locus_tag="ECL_RS26300"
                     /old_locus_tag="ECL_A124"
     CDS             complement(join(85890..86752,86752..87010))
                     /locus_tag="ECL_RS26300"
                     /old_locus_tag="ECL_A124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611474.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISSen4 family transposase"
                     /protein_id="WP_087451024.1"
                     /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKY
                     GGMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKLLTTDQKREAVMLMCD
                     ATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITELALERRRFGYRRIWQLLRR
                     EGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMDALST
                     GRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTC
                     RALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKIINDW
                     RQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
     gene            87330..87569
                     /gene="relB"
                     /locus_tag="ECL_RS26305"
                     /old_locus_tag="ECL_A126"
     CDS             87330..87569
                     /gene="relB"
                     /locus_tag="ECL_RS26305"
                     /old_locus_tag="ECL_A126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_416082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system antitoxin RelB"
                     /protein_id="WP_004196370.1"
                     /translation="MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERL
                     PFKQTLLSDEDAELVEIVKERLCNPKPVRVTLDEL"
     gene            87569..87856
                     /gene="relE"
                     /locus_tag="ECL_RS26310"
     CDS             87569..87856
                     /gene="relE"
                     /locus_tag="ECL_RS26310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_416081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system mRNA interferase
                     RelE"
                     /protein_id="WP_000323025.1"
                     /translation="MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKL
                     RGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL"
     gene            complement(<87923..>88678)
                     /locus_tag="ECL_RS26315"
                     /old_locus_tag="ECL_A127"
                     /pseudo
     CDS             complement(<87923..>88678)
                     /locus_tag="ECL_RS26315"
                     /old_locus_tag="ECL_A127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004152817.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS481-like element ISKpn28 family transposase"
     gene            complement(88687..89855)
                     /locus_tag="ECL_RS26320"
                     /old_locus_tag="ECL_A128"
     CDS             complement(join(88687..89606,89606..89855))
                     /locus_tag="ECL_RS26320"
                     /old_locus_tag="ECL_A128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611553.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISEc52 family transposase"
                     /protein_id="WP_085929673.1"
                     /translation="MKKRNFSAEFKRESAQLVVDQNYTVADAASAMDVGLSTMTRWVK
                     QLRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEIFKKGYRALDVRLPEQFSII
                     GKLRARYPVATLCHVFGVHRSSYKYWKNRPEKPDGRRAVLRSQVLELHGISHGSAGAR
                     SIATMATQRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIPNHLERQFAVT
                     EPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMKALEMAWETR
                     GKPVGVMFHSDQGSHYTSRQFRQLLWRYRIRQSMSRRGNCWDNSPMERFFRSLKNEWV
                     PATGYVSFSDAAHAITDYIVGYYSALRPHEYNGGLPPNESENRYWKNSNAVASFC"
     gene            complement(<89928..90209)
                     /locus_tag="ECL_RS26325"
                     /old_locus_tag="ECL_A130"
                     /pseudo
     CDS             complement(<89928..90209)
                     /locus_tag="ECL_RS26325"
                     /old_locus_tag="ECL_A130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004152817.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
     gene            90281..90439
                     /locus_tag="ECL_RS26330"
                     /old_locus_tag="ECL_A131"
     CDS             90281..90439
                     /locus_tag="ECL_RS26330"
                     /old_locus_tag="ECL_A131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system Hok family toxin"
                     /protein_id="WP_013087178.1"
                     /translation="MKLPRNTLLWCVLIVCLTLLIFTYLTRKSLCEIRYRDTDREVAA
                     FMAYESAK"
     gene            91315..91629
                     /locus_tag="ECL_RS26335"
                     /old_locus_tag="ECL_A133"
     CDS             91315..91629
                     /locus_tag="ECL_RS26335"
                     /old_locus_tag="ECL_A133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044157807.1"
                     /translation="MHTQNVNVKTAAPESSRKIGGKTVSYTILVAEQKKNSAEEPDVL
                     EFSSLAELKKLRRRCPETMRCTYFYALSSGVDKQFRHIHVAEADHFKQFVRLIARAGI
                     DI"
     gene            91690..92151
                     /locus_tag="ECL_RS26340"
                     /old_locus_tag="ECL_A134"
     CDS             91690..92151
                     /locus_tag="ECL_RS26340"
                     /old_locus_tag="ECL_A134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004146155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087181.1"
                     /translation="MNVNTPAAAPMAFFVPSHNAVYDRATQLEGQWVTQREAITLESL
                     RRLYPDAELIPATLVQEKQNDGYRRPWVEITGARYIDQLETLPPVDWCRGYGGESFKS
                     MEFTGGDVTAIFVRYGARFFECHDLHTRHHRELIGDVIARFCLDAPLNSAH"
     gene            92239..92439
                     /locus_tag="ECL_RS26345"
                     /old_locus_tag="ECL_A135"
     CDS             92239..92439
                     /locus_tag="ECL_RS26345"
                     /old_locus_tag="ECL_A135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087182.1"
                     /translation="MKFDPQTVAQAKAFVNALRAGKRARVPALRFSQWQPFLSVVNAE
                     TGYATDADCGLAVSVYPALGLA"
     gene            92480..93271
                     /locus_tag="ECL_RS26350"
                     /old_locus_tag="ECL_A136"
     CDS             92480..93271
                     /locus_tag="ECL_RS26350"
                     /old_locus_tag="ECL_A136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_013087183.1"
                     /translation="MSQLSFESLFLADQADLQPRASAPARMLSPAEARKQFASVFRQT
                     AKNMRRSEVFSDFITLAASELDLARIRSPENIENSRRICARYQPDDLDAMKQLFCLLV
                     EGLAGDIHDFLGALYMEQELGADEMGQYFSPSCISRLMAGLLMPGAQETIKREGWMTL
                     DEPACGSAGMVIAFAYWMAEAGYNPSEQLYATCTDIDPMVADMAFIQLALLGIPAKVV
                     TGNTLTLKANRVRYTPVYYFNDWQGRLAFRSRLDAMKNFLATVAA"
     gene            93313..93648
                     /locus_tag="ECL_RS26355"
                     /old_locus_tag="ECL_A137"
     CDS             93313..93648
                     /locus_tag="ECL_RS26355"
                     /old_locus_tag="ECL_A137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087184.1"
                     /translation="MTSNTLNAVPATVLETMAECLNGQPEPLKIRNNDDHAALAADVL
                     WQFARKTGLNRESESVQTVITDFLANLLHLCKQCDPDGAGIDGFNALLNMAMMHYEQE
                     NGGDSEEPV"
     gene            94337..94630
                     /locus_tag="ECL_RS26360"
                     /old_locus_tag="ECL_A139"
     CDS             94337..94630
                     /locus_tag="ECL_RS26360"
                     /old_locus_tag="ECL_A139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032662330.1"
                     /translation="MHTRNVNVKTAAQESTGRCDSNLTTSQFTDLFCWVLAASEGEPQ
                     PTIFTPPENATELTLINDECPDYISVWVVDGRPVAAAMPLDNFHRVIPSSLTK"
     gene            94647..95468
                     /locus_tag="ECL_RS26365"
                     /old_locus_tag="ECL_A140"
     CDS             94647..95468
                     /locus_tag="ECL_RS26365"
                     /old_locus_tag="ECL_A140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF945 domain-containing protein"
                     /protein_id="WP_013087187.1"
                     /translation="MVSFASRYRMPVSIRKDRPLTNEELQLIVPSAFSSDKHDSRSER
                     YTYIPTINILDRLRDEGFQPYYATQSRTRDQDKREFTKHMLRLRRHDQINGKEVPEII
                     LLNSHDGSSSYKMIPGMFRQVCSNGLVAWKDFGEIRVPHKGDIVGQVIEGAYTVLKTF
                     DAVDENIDLMKSIQLTLPEQRLFGATALELKYDGKPAPITPEQIINPRRVLDRGQDLW
                     TTFNVVQENVIRGGIRGRTQKGKVARTREVTGIDGDIKLNQVLWKMAEEFAKLKA"
     gene            complement(95497..96036)
                     /locus_tag="ECL_RS26370"
                     /old_locus_tag="ECL_A141"
     CDS             complement(95497..96036)
                     /locus_tag="ECL_RS26370"
                     /old_locus_tag="ECL_A141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase domain-containing
                     protein"
                     /protein_id="WP_032662327.1"
                     /translation="MKISILPAALLTLSMSAGAAPQMCFDQAGKDYQIDPLLLMSISI
                     KESRLKPGAINGSNRNGTEDVCGMQVNSSHYGKLKNFNITRERLLNDPCICVYTGAWV
                     LAHNFRSYGKNWDSVGMYNTGPSKKLIAQRKAYAQDIKNIYRVLLARKKLLSERLAPA
                     AGKEHAMQIAETTSLHSGQ"
     gene            96610..97005
                     /locus_tag="ECL_RS26375"
                     /old_locus_tag="ECL_A144"
     CDS             96610..97005
                     /locus_tag="ECL_RS26375"
                     /old_locus_tag="ECL_A144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016495608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087191.1"
                     /translation="MGRVGIYLKDKIEREVRDIIQQDLQNGATAGEANMSATCNELIR
                     LGLLVYKRDGEDGNHFDIEGYRRDLIRKAAGSREGTVLIATLLAEMYLKMTGKDGEGR
                     LEDTLDMILNGINTAEDEAETRHFINEKK"
     gene            complement(97038..97679)
                     /locus_tag="ECL_RS26380"
                     /old_locus_tag="ECL_A145"
     CDS             complement(97038..97679)
                     /locus_tag="ECL_RS26380"
                     /old_locus_tag="ECL_A145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Arc family DNA-binding protein"
                     /protein_id="WP_013087192.1"
                     /translation="MKVKEKLLDGRGRPRKFQPGEAVEWRLRAPDNLLMELRICARAG
                     NRSVNEEIIARLLLSLNYQPGKPVIKNAEGERLIALAVKFEEWLGKLLDGESVDVAED
                     VKVPPKQEQLWVWREGERILLPGKTTGYSMRIPENLADEIRAMAKVHNRSLNDEMLTR
                     LMNTLGYFTERLLDQNEDAQALKVLCMEFEVFLKEKIREVEKSDLPWDEKSSQ"
     gene            97874..98227
                     /locus_tag="ECL_RS26385"
                     /old_locus_tag="ECL_A147"
     CDS             97874..98227
                     /locus_tag="ECL_RS26385"
                     /old_locus_tag="ECL_A147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraA"
                     /protein_id="WP_013087194.1"
                     /translation="MLTKGSALNVGKGWAVASLFRKARENRQAKFYLKSAGAFLIALM
                     VTHPAFAGGTDLLSSQNTTVNSTFGSGSSLIKWFYIAEIIMGLFIYIKARSPLVFVGI
                     VMAIIFTRVAFGIAS"
     gene            98231..98533
                     /gene="traL"
                     /locus_tag="ECL_RS26390"
                     /old_locus_tag="ECL_A148"
     CDS             98231..98533
                     /gene="traL"
                     /locus_tag="ECL_RS26390"
                     /old_locus_tag="ECL_A148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraL"
                     /protein_id="WP_013087195.1"
                     /translation="MNGEEDKYNFPETMNQQDRYFGLPVDELIVTAPLLILGVLNNLS
                     VELGVIAGILWFIVRYLKKGQGSYWLLNFCYWHLPSLLFKVTFRQIPDSSFRHWRA"
     gene            98539..99120
                     /locus_tag="ECL_RS26395"
                     /old_locus_tag="ECL_A149"
     CDS             98539..99120
                     /locus_tag="ECL_RS26395"
                     /old_locus_tag="ECL_A149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraE"
                     /protein_id="WP_013087196.1"
                     /translation="MKLNIKGERDKQLRYAFIGLSALTLLMGAGNVLTGSLAWYFATT
                     QKTITTPLTFNRPFASDSKGVDAPGLTQFAASFIYWRLNVTPENIDNNQKMILGFVPS
                     DERDELKKALDIEAERIRKAGISTQFDTKEIRVMDDGSVQYSGVLKSSTTNGVIITPL
                     KDQEKTYRLKLSYENGVINLHSFEELQPVSTTN"
     gene            99132..99872
                     /gene="traK"
                     /locus_tag="ECL_RS26400"
                     /old_locus_tag="ECL_A150"
     CDS             99132..99872
                     /gene="traK"
                     /locus_tag="ECL_RS26400"
                     /old_locus_tag="ECL_A150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system secretin
                     TraK"
                     /protein_id="WP_013087197.1"
                     /translation="MKFRISPAAAAVFLAAGLFNSGLRAASAPAAIPFENDAAFNVTL
                     SNTNPSKVVVDGELITSISGPTGAYDQSQTDDGALILSPLVSQNFTLFIQTDRGSSLS
                     LNIRPQPGNGKTLRFTPMSPPLRKNDDAKTWEEGQTYEKTLVALSRAVVNGQVPDDYQ
                     EYPVSRMPAYTPASDVRLTPERQFVGNHLRVVRYRMSNPGSITRSLRERDFWHKGVRA
                     VMLSQNQLYAGGEGYAWIVFSDDGDTRP"
     gene            99869..101272
                     /locus_tag="ECL_RS26405"
                     /old_locus_tag="ECL_A151"
     CDS             99869..101272
                     /locus_tag="ECL_RS26405"
                     /old_locus_tag="ECL_A151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_013087198.1"
                     /translation="MSLNKNLKTRRKQLAILAAVITGGAAATSGVIWYGQHQQEQKQP
                     APVATPNMTGVVTAAFNQQVNDAALAQQQAKTSALEDRLATLTQQFAQNKLTTEQQLA
                     KKDEEIQRLNDQLTKAPGSKTTTGQQTPPAGQNGTPLPGPVAAGQARPPEYTVTPAGT
                     PAATGVNMGQGAAFYPGGSGQRMTGGLSTTKFSYESLKKKPTKLPWIPSGSFSDAIMI
                     EGADANASVTGQQNTQPVTIRLLGNIQMPNNKEYSADGCFVVGEIWGDISSERGIVRT
                     KSLSCVLKNGKHVDMEFDGHVSYQGKGGVRGKPVMRNGMIVGYAGAAGLLSGFGEGIK
                     SAATPSVGLGATADVGAADVFKQGFGGGASKAADTLSQYWIKRAEQYHPVIDIGAGNL
                     VTVVFQKGFRLETIEDADDAKAKEELQKAGNAAQNAVTPQPASQTTASSTTSVGNINP
                     DDVLRQASQLRLGDTIN"
     gene            101521..101805
                     /locus_tag="ECL_RS26410"
                     /old_locus_tag="ECL_A153"
     CDS             101521..101805
                     /locus_tag="ECL_RS26410"
                     /old_locus_tag="ECL_A153"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087200.1"
                     /translation="MKTTAQGDGPDHKAKDVNRRLRITVNWFYSICWVLWWVAVIAII
                     IKGVREEYAFRIFGAIFMAIVLIRIRPPIWPDDSAEPLPGPNDSDQKEGK"
     gene            101802..102242
                     /locus_tag="ECL_RS26415"
                     /old_locus_tag="ECL_A154"
     CDS             101802..102242
                     /locus_tag="ECL_RS26415"
                     /old_locus_tag="ECL_A154"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB family protein"
                     /protein_id="WP_013087201.1"
                     /translation="MKGPRIDDRINFLRGIERDWKDWSAGKKTKPHWIFFVGVLTATG
                     MLIFSFWSGNQRLAVASFAIGIAFILAGLLQPGETWEEKIQKKIRAYEPLDIDAMRTL
                     AVSVFHKDELMQEELRQWLDAEFSAISDAVLRDGRQPHSGDTIN"
     gene            102256..102744
                     /locus_tag="ECL_RS26420"
                     /old_locus_tag="ECL_A155"
     CDS             102256..102744
                     /locus_tag="ECL_RS26420"
                     /old_locus_tag="ECL_A155"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087202.1"
                     /translation="MSYKTRLDVIEEDLNKWRAGKKIYKYRRFLMPTALALLPCSIFL
                     YGVFHNKAVFVVLGFMLAFLLFRLFTGKEDTPDTWEDRINQALLSYSPMNQDAFEKLC
                     RTVNEKRAIEPDDVAVWLKDEKEARALFRRQRDERQRYSFTKWLDKRESDQKAECNEE
                     DK"
     gene            102862..103029
                     /locus_tag="ECL_RS26425"
                     /old_locus_tag="ECL_A156"
     CDS             102862..103029
                     /locus_tag="ECL_RS26425"
                     /old_locus_tag="ECL_A156"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_155404428.1"
                     /translation="MAKKKALADKDPWHAWLELSASDPGDISSDIREQYSELAASLVL
                     SATRKNNGQRN"
     gene            103095..103637
                     /gene="traV"
                     /locus_tag="ECL_RS26430"
                     /old_locus_tag="ECL_A157"
     CDS             103095..103637
                     /gene="traV"
                     /locus_tag="ECL_RS26430"
                     /old_locus_tag="ECL_A157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008325086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system lipoprotein
                     TraV"
                     /protein_id="WP_013087204.1"
                     /translation="MKKLLGAALLCSALTGCAGLNSDFDCNKTATDQCLTTGEANKLA
                     AQGKSLDDLTAEKTAKKPAGETLPALRNSAPVVNPFRPVSVAATGTSAAKPLTTAPAK
                     TSGSLVTPLATTSHVTPEPVNTAGRVPVQRIPDATQRLWIAPWVDTDDNFHQPAVVEF
                     VKNKSHWDEESYRVIGEGGE"
     gene            103634..103888
                     /locus_tag="ECL_RS26435"
                     /old_locus_tag="ECL_A158"
     CDS             103634..103888
                     /locus_tag="ECL_RS26435"
                     /old_locus_tag="ECL_A158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087205.1"
                     /translation="MSSHYVSGRNGIDHPVKSFTHTRKGTAQITATQSVDTDDETLAV
                     LSVSCGWQIKTAGDAAHTGQMNEEKLRRLELIRAAAEGRK"
     gene            103885..106494
                     /gene="traC"
                     /locus_tag="ECL_RS26440"
                     /old_locus_tag="ECL_A159"
     CDS             103885..106494
                     /gene="traC"
                     /locus_tag="ECL_RS26440"
                     /old_locus_tag="ECL_A159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein TraC"
                     /protein_id="WP_013087206.1"
                     /translation="MSFVDNLMDMLKNGKEEDGAATARENLSQTWGYPSLVAALPYRY
                     YDDINEIFVNAGSAGFIMEAAPLPGANEQVMAALDDMLRKKLPRQTPVTVIMLASKCV
                     GERIDRGVSNDMWKGGMADHLNKITRAFWQRSALHGLANEREYPLYLRNYRIFLVYGQ
                     PLKRASQTQRVIDDLVQIRNTIRVSLGAARIDSVNVDVNGFLSAVREQMNYRQEQVLT
                     SSGDYNEDEKLNRQVVDQGIGLDVYPSHLRMTLPETIDARGTRLPASACRIINMQLAK
                     TPKRFALWQGADNLQNIRFPDLGIPCPFMLTWTTELEEQTKSQSEAFRKDTDLSKKAN
                     SAYAALFPGTKRAAEEWRRTREQLNNNEIALCNTYFNLTLFAPDNNTDAQACELAAVN
                     VFRKNELEMVTIQYQQMRNWLAGFPFVMQEGMWEDLKTTGATLRAKSWNAVSLMPVVA
                     ERQLSNVGMPLPTYRNQVAFYDMFGEENGSTNFNIAVTGTSGAGKSFLTQGILRDVLN
                     AGGYAWVIDMGDSYKNYCHQAGGVYLDGAKLRFNPFANVKDIKHSAEGIVRLLTVLAS
                     PTQPLDGVCEAILQKAVMDAWEKKANKARIDDVHNYLTNEDVNQAFADKPTIIARLAE
                     LAMLLDTYCTWGPDGEYFNADTPTLDGETRFAVLELLSLEDKPKLLSAILFSLILAIQ
                     EKMYHSPRDLKKVCIIDEAWRLLGGSNPHAARFIETGYRTVRRHRGAFITITQGIKDF
                     SASKEAEAAWNNSSTKITLLQDAKAFKQYLADNPDQFSDMEKEVIRGFQPALQTGYSS
                     LLINAGEYSSFHRLFVDPVTRAMFSSRGEDFAFMQKLQKEAGATAEEAAYLLAEKKFG
                     SELRELEEWVKAA"
     gene            106491..106904
                     /gene="trbI"
                     /locus_tag="ECL_RS26445"
                     /old_locus_tag="ECL_A160"
     CDS             106491..106904
                     /gene="trbI"
                     /locus_tag="ECL_RS26445"
                     /old_locus_tag="ECL_A160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system protein TrbI"
                     /protein_id="WP_032662369.1"
                     /translation="MSEQQDKPYEGDTVNDGATIAGKTSRWVKAGMLGLAGLLAMTGV
                     AYMTAKAVTPEVVVFDMKGTVDLFMQQSAQLQLDEDKARVLTTRFNTALSDSLGEWQA
                     AHNAIILVKPAVMSPQRDITNEIRADIARRTQGGQ"
     gene            106901..107536
                     /gene="traW"
                     /locus_tag="ECL_RS26450"
                     /old_locus_tag="ECL_A161"
     CDS             106901..107536
                     /gene="traW"
                     /locus_tag="ECL_RS26450"
                     /old_locus_tag="ECL_A161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008325089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system protein TraW"
                     /protein_id="WP_013087208.1"
                     /translation="MKRRLKLMGMLLLMLSAGSGAKDLGTWGNVFEPAEQDMLAFIQN
                     RLKGMEQTGELDRLRKEATERVKEHAVRPTPVEGLTKAKEYRSFAWDPTFTVMETITD
                     MQGNVIARKGDTVNPLDKVPFNQVLFFIDGDDKEQVNWTRQQLAGQTSVKVILVKGNI
                     KETSDALNERIYFDQSGVLTRKFGFEHIPVRISRDGRVMKVEEIPVSGAKK"
     gene            107641..107925
                     /locus_tag="ECL_RS26455"
                     /old_locus_tag="ECL_A162"
     CDS             107641..107925
                     /locus_tag="ECL_RS26455"
                     /old_locus_tag="ECL_A162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_101731545.1"
                     /translation="MGTAERLKTLYPEIDSWHPVLVTKAWLHWCEQNQQDSREPSKRD
                     ERFPDYIIHLLLENMRAEDSAKRKKRPSMSLSERLDRLFAGEGQENAECH"
     gene            107916..108152
                     /locus_tag="ECL_RS26460"
                     /old_locus_tag="ECL_A163"
     CDS             107916..108152
                     /locus_tag="ECL_RS26460"
                     /old_locus_tag="ECL_A163"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087210.1"
                     /translation="MSLRHNTGTKGSEEEVNRLCQLYPEIASWQPALITGAWNQWCAE
                     NPHLPAMPEKRDEAFPLYLVRLIRNRMEEMNAWR"
     gene            108143..109156
                     /locus_tag="ECL_RS26465"
                     /old_locus_tag="ECL_A164"
     CDS             108143..109156
                     /locus_tag="ECL_RS26465"
                     /old_locus_tag="ECL_A164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087211.1"
                     /translation="MALISCFTSPQGLQGMLTCLRDTEGMTGILVVVALLAGWIAVQY
                     FADARCVRQAWESRPGLPVPLAQFGSARHADAVHAFANRELYQAMLRGLENGLTETGY
                     KLTRDRSRRVVAIPLEHRLTISRWVFRARQWYMSPGMSEQRTKDIEDDAVNDGYAGML
                     LNVLIRGCAHEGWYITEPVPEFTPTSFPLKQVSINVRATQAVLTSDVVSIINDVAGKV
                     RMQPSFPHHPTCTVADVVNSGLNYEVRQQEIDEPPGWFNSPAGCELPDDITEGHSPLF
                     MTSGHRHFIVRVQGGRFYTQGTLAFFIEQAAHRIAQGEVSGACYEDDSGYAFAVTPAK
                     NTP"
     gene            109261..109476
                     /locus_tag="ECL_RS26470"
                     /old_locus_tag="ECL_A165"
     CDS             109261..109476
                     /locus_tag="ECL_RS26470"
                     /old_locus_tag="ECL_A165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087212.1"
                     /translation="MKKDPDTEKGRNVTAVRHDEKSALRLKAILAENPLYYPSIVLRA
                     GLLALEDMSKEQRLTFIMKAADKAKNH"
     gene            109532..109855
                     /locus_tag="ECL_RS26475"
                     /old_locus_tag="ECL_A166"
     CDS             109532..109855
                     /locus_tag="ECL_RS26475"
                     /old_locus_tag="ECL_A166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087213.1"
                     /translation="MTHPETLRPVTVTRDRNGFWTHPHYFAPASDEATQTEFSDWMRQ
                     HRLTCATRWMENDAPPHVIAAWEKGIQDVSDWHPSAPEGEGWFMGSIHDTEDGPVCVW
                     LREVK"
     gene            109852..110850
                     /locus_tag="ECL_RS26480"
                     /old_locus_tag="ECL_A167"
     CDS             109852..110850
                     /locus_tag="ECL_RS26480"
                     /old_locus_tag="ECL_A167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013512885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraU"
                     /protein_id="WP_032662317.1"
                     /translation="MKHFSWLAGVLLVLISWMPSQATAAASNAGDGRWVNPITDVCWK
                     CLFPMTLGNIQLASGPQKDTSNPSSPIQICPVGILYRIGLAIGFWEPMAMVDVTREPG
                     VMVNMGGFKIDLGRTGTGTAGQSDRPAAGTFYHVHWYKYPLIFWLNIITSLGCLQTGD
                     MDIAYLSEVDPLWNDSTLSMLINPEAALFGNLIAQGACAADAAAASAGLPLSPLFWCA
                     GSQGSMYPLTGYTSGEFSPLEASLLVGERMAFKMHREGLVWNSIGADNAVCNQYPSPI
                     IPKERWRYQMVNMYPETNNCHPFGASTQLWGTKHNSPSSKKNFGYLFWRKRNCVFL"
     gene            110861..111487
                     /gene="trbC"
                     /locus_tag="ECL_RS26485"
                     /old_locus_tag="ECL_A168"
     CDS             110861..111487
                     /gene="trbC"
                     /locus_tag="ECL_RS26485"
                     /old_locus_tag="ECL_A168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     assembly protein TrbC"
                     /protein_id="WP_013087215.1"
                     /translation="MKNAYLRVLTIGVLIAFAPLALASAQTDISVSDHSWIKGQQDAL
                     AAMKEDLQGHPATDWSVLPQRQQDLISRLQGDIAAQTNAMGEKDTFPAIYFVSLGIPR
                     EGLLSMLKDARRFNIPPTLRGLVNNDMRQTAAAMFELNKEDKDAGVQIDPTLFTQYNI
                     TTVPALVVTCPGHHDVIRGSLPLQQALEKVAESGDCAATARHLLEAAR"
     gene            111484..113319
                     /gene="traN"
                     /locus_tag="ECL_RS26490"
                     /old_locus_tag="ECL_A169"
     CDS             111484..113319
                     /gene="traN"
                     /locus_tag="ECL_RS26490"
                     /old_locus_tag="ECL_A169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system mating-pair
                     stabilization protein TraN"
                     /protein_id="WP_013087216.1"
                     /translation="MKKLLSTMLMLFPLLAGAADPAFEAGASFGKGNASAGTGVLKNP
                     GTVTGTIPGYTANPPEKGYYGGVNGGDGGLANKGQAALQGNDAAQSVISSGTKNPAPT
                     IDPNAPFITIGKNAEGTAGGIMNGTSQQCKETTVSKSTFENFTCDRDVATIQTCGRTA
                     SITGHYEDNYSYKTITIDSDNLDVSSPEVSYSMPEGTVYSATMNYTFKKHLAFSNDLW
                     FLNITALGSLMTMYETSGSYDLPPGKSFTEGEKLTITFNNKQKVPERVASIWEMGKTN
                     HMYHFVITIVYRTGTKVWVPQTTWTESCGFDKKTALSSAGSTCTEPGGTRTVIVDGKE
                     YSQTNSCWAWSDEYVTGTSSRGNCGSLMDNPACTLSSHTCTTTESGVCTHQSETYQCQ
                     KTWSSSGLVCGGEYICKSGACDETNGTGDNGFDTAVAKLAGLASAAEDVRDQNSTIDV
                     RAFTGKAMSCRKAFAGFSNCCKDSGWGQDTGLAACNDDELALGKAKAKKITVSLGERC
                     DRKVLGACIQKSKVYCVFDGKLARIIQEQGRRDQLGVKFGSGDSPDCRGITVPELQSI
                     DFDKINFSDFYEDLMKNQKIPDTSAQVKQIKDRIAAQVNQQGGGK"
     gene            113316..114098
                     /gene="traF"
                     /locus_tag="ECL_RS26495"
                     /old_locus_tag="ECL_A170"
     CDS             113316..114098
                     /gene="traF"
                     /locus_tag="ECL_RS26495"
                     /old_locus_tag="ECL_A170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     assembly protein TraF"
                     /protein_id="WP_013087217.1"
                     /translation="MKRVLCGLLMALASHTALADEIVTPAEPFTGWSWYNEPKKPPEQ
                     PRKPQQPAPQAIPDLSKMSPMEQARVLKGYTQEALNRAILYPSRENTATFLRWQKFWT
                     DRASMFSQSFAAAQLSHPDLDYNLEYPHYNSMAPFMQTRDQQTRQSAVEQLAQQYGLF
                     YFYRGSDPIDVQMAGVVADFAKTNGISLIPVSVDGQVAATLPQSRPDTGQSRSMNITH
                     FPALFLVDPRNQNYRALSYGFMTQDDLSKRFLNVATGFKPNS"
     gene            114108..114599
                     /locus_tag="ECL_RS26500"
                     /old_locus_tag="ECL_A171"
     CDS             114108..114599
                     /locus_tag="ECL_RS26500"
                     /old_locus_tag="ECL_A171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087218.1"
                     /translation="MTKTLFTLIRDAGRAALYSFVLGPALVLYVFVMLAASDGSLSRQ
                     FLTTFHHLTEGAPAGKVMGCVNEHEMAGRFSPPEPGESLKPVPSVLDKAPPEVLCQLG
                     PVDSDSWARTTDATLLNTWIISVMFGFGVWFVLYGLSRAAQRRISPDTHSVLVRQNKE
                     TQE"
     gene            114596..114814
                     /locus_tag="ECL_RS26505"
                     /old_locus_tag="ECL_A172"
     CDS             114596..114814
                     /locus_tag="ECL_RS26505"
                     /old_locus_tag="ECL_A172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087219.1"
                     /translation="MKPTLLAGLIFWGMMARVLSELMTWSVEHTQQGLLWLCNGMWAG
                     AAGMVIYAGYRWYRDERGQTHKEGDHEH"
     gene            114804..115412
                     /locus_tag="ECL_RS26510"
                     /old_locus_tag="ECL_A173"
     CDS             114804..115412
                     /locus_tag="ECL_RS26510"
                     /old_locus_tag="ECL_A173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     assembly thiol-disulfide isomerase TrbB"
                     /protein_id="WP_013087220.1"
                     /translation="MNIKTGLTALLMCLPLLANAGAREELMALEATKTTSADAAAITA
                     STIPVPAPASLMALPDGRRANMKDYAVVLFMQAHCQYSAKFDPLLKGWADEHSVRVYP
                     YTLDGGGDVSYPTPMIPRKTDPNSPIADEIVTFFGNGLPIATPTAFMVNVNTLKAYPL
                     TQGVMDIPALESRMASLIQADMDNVDPKTLPPMPASAQVTPQ"
     gene            115430..115693
                     /locus_tag="ECL_RS26515"
                     /old_locus_tag="ECL_A174"
     CDS             115430..115693
                     /locus_tag="ECL_RS26515"
                     /old_locus_tag="ECL_A174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014063893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087221.1"
                     /translation="MTTNTYALSRTERVWLLFSVTLLVSAAFYGVLAHRVVSVLNRPE
                     LTTCLQDFPVLLLISLSIGFFFTVTGLYVCRQTLVRKPREEIA"
     gene            115690..116094
                     /locus_tag="ECL_RS26520"
                     /old_locus_tag="ECL_A175"
     CDS             115690..116094
                     /locus_tag="ECL_RS26520"
                     /old_locus_tag="ECL_A175"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087222.1"
                     /translation="MRHIRLKTFIRNQAIGILKDSSEDTETRKWTDLLTLKLFYALIF
                     TAVVERVYVKCAITTLSAISVDRSEQFTLSLLIHYPQYLLWGVMAAIIALIAVNLLVC
                     GWFCLATYLCRKLNRTDIPAGKDMQAVEVPND"
     gene            116087..117451
                     /locus_tag="ECL_RS26525"
                     /old_locus_tag="ECL_A176"
     CDS             116087..117451
                     /locus_tag="ECL_RS26525"
                     /old_locus_tag="ECL_A176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019843239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraH"
                     /protein_id="WP_013087223.1"
                     /translation="MIKALITAGVVFFSGLAALPAQADVNGDLNGFFGKLGYSGNVSQ
                     AQAWQGQAAGYFSGGSVYLRNPVKNVQLISMQLPSLNAGCGGIDAYLGSFSMISGEEI
                     QRFVKQIMSNAAGYAFDLALQTMVPELKQAKDFLQKLASDVNSMNMSSCQAAQGIIGG
                     LWPVTQVSQQKICQDIAGETNMFADWAASRQGCTVGGQGDKVTAKAGDAEKDQVLKNK
                     NLIWDTLSKNGLLGNDRALKELVMSTVGSIIFNKTGDVTILTPLVDNRDLIKVLMRGG
                     TAKVYGCDEATLCLGPVVTNLTITESNALVTLVKKLMLSMQNKLVDDKPLTDQEKGFV
                     NTTSVPVLKYLTNAQSMGMSATYLLQVSDFIAQDLMIQYLQELVKQASLSLAGKNFPE
                     EAAAKLRDNIIHAQGLLADMKLQSAADQNALDGIDRNMQYLQQQVSTIVSGSYQSNYH
                     WGDR"
     gene            117451..120849
                     /gene="traG"
                     /locus_tag="ECL_RS26530"
                     /old_locus_tag="ECL_A177"
     CDS             117451..120849
                     /gene="traG"
                     /locus_tag="ECL_RS26530"
                     /old_locus_tag="ECL_A177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer mating pair stabilization
                     protein TraG"
                     /protein_id="WP_013087224.1"
                     /translation="MLEIYTIYGGGMWKTALDAVVTLVGQNTFHTLMRIAGTFGVLAV
                     LLTFIKQRNPMVFVQWLAIFMILTTILLVPKRSVQIIDLSDPAAVWKTDNVPVGLAAI
                     ASLTTSIGYKMASVYDMLMARPDSVTYSKTGMLFGSQIVAETSDFTTQNPELAQMLPD
                     YVENCVIGDILLNGKYTINQLLNSTDPLTLITSNPSPLRGIFKMTSTSRQFLTCQQAA
                     TEIKTLANTDVNPGSATFTWLTRKVFGNKLNGASLLANAMGESYGFFYAGGMTAAQIM
                     KNNITNSAVRQGIKGFAARSSDTANLLNLATENAATKQRLSWAAGNELATRTLPFAQS
                     LLMLILVCLFPLMIALAASNHTMFGLNTLKIYISGFIYFQMWPVMFAILNYAANYWLQ
                     SQSGGTPLVLANKDVVALQHSDVANLAGYLSLSIPVLSFYLTKGAAAMGSQVAGSVLS
                     SGAFTSAGVAATTADGNWSFNNMSMDNVSQNKLDTNLMQRQGQQTWQADNGSTQTQTA
                     GGHTVIDGSGAMSNLPVNMKLSQLASSGFQESARQSQVQAQTALDGYNHSVTSGWSQL
                     SQLSHQTGTSDSLTSGSENSQATNSTRGASMMMSAAESYAKANNISTQEAYNKLMDIS
                     NQGSVSAGIKGTAGGGLNLGVVKLGAEGSISGDLRHSTGSSRGIQNSDSHSQDMRHDQ
                     NSQAVNDFRQGMDMVKSSRITDGANHSENAASSNVQQLAATLNDAESQYHQYTTSSTQ
                     SSEFSRMATVAQNQSASLDTNYTQEFVDWAANKYGDKAQSMLTSAPSAREAAMEFVNE
                     RLKPEIMGDYQQGRSDLTSGQEHAAFSGEHVVQPAHGSQQGSGPTGNDGGIRYSPVES
                     GAYNSNDTGNHHADGASQVTEYAGTYGGQVSSGGGSVSVRTGGSGSHESSLLAQNQTD
                     SENLAGQREISHNEVHTDYGRQEQSSQIQSGTHRSEQDSLSIKSSGHDTGRHSTERQR
                     SDSSAGMQQELRQSGTLREQGGAAGHGNDMSHSHATMNVEEPRVQGNAMQASFKENQA
                     KLHEQSGQGFGPQNDIQRRVAEQRSENEHKINESAGEIDKKQSTVQASSDILKGENLI
                     GQGRFKLGRAEAELDQSSKLNPFNDLQPDELQQRVAELRKKTGG"
     gene            120851..121540
                     /locus_tag="ECL_RS26535"
                     /old_locus_tag="ECL_A178"
     CDS             120851..121540
                     /locus_tag="ECL_RS26535"
                     /old_locus_tag="ECL_A178"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087225.1"
                     /translation="MTKKVSAYCCFIPIGIYAAYSLSLQLLFDVPFMAKSMLLSVIPS
                     AIYIFCFWKLRSSKKGMNLKATLLFNTLLAGLLTFLVEFVGNDTESALIAGIAVHSLI
                     AFIFAGVVLRPITYKDNTLLKDEDDGRVYVIRNGRAHVLTDNEAQLISTTDNKIISFS
                     GSQMSIQDGGITNIPMTTSFNDSFSNGITVNPASGMPMVGGISGLDIHGNSWGTNFNE
                     PSNTYDPNRGY"
     gene            121687..122285
                     /locus_tag="ECL_RS26540"
                     /old_locus_tag="ECL_A179"
                     /pseudo
     CDS             121687..122285
                     /locus_tag="ECL_RS26540"
                     /old_locus_tag="ECL_A179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003018683.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="complement resistance protein TraT"
     gene            122477..122791
                     /locus_tag="ECL_RS26545"
                     /old_locus_tag="ECL_A180"
     CDS             122477..122791
                     /locus_tag="ECL_RS26545"
                     /old_locus_tag="ECL_A180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087227.1"
                     /translation="MMHQINERADYSAEFWSLIHLESELMAARAWMNVFGSLPEGQGM
                     TIVAFWAGYEFTLYDLEPREWHSPVYKDVASSVRSVAAYINKQDWEDGCQQARYELSQ
                     MA"
     gene            122906..125461
                     /gene="traD"
                     /locus_tag="ECL_RS26550"
                     /old_locus_tag="ECL_A181"
     CDS             122906..125461
                     /gene="traD"
                     /locus_tag="ECL_RS26550"
                     /old_locus_tag="ECL_A181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system coupling
                     protein TraD"
                     /protein_id="WP_013087228.1"
                     /translation="MSFAGKNLTQGGQMTAYRWRMFIQVNNWIGFWIFILFAVLTTAI
                     FLWRIPQEALDNGSLWWFASINSSFIDLMPASGTPKIYDVHYWYAPTATAMVLKMTLP
                     QIYTDPYMQAMGDQCLRELHWAAGASGLFSMVVFIAVTWFIANIGRKESEDEYLSGMQ
                     LTDKPAEVNKLLRQNGELSDLRVADLHMVKRAEVMNFLMHGTINVGKSTIIRWLLDYI
                     RKRGDRAIIYDSGCTFTETHYNPSTDFILNAHDERCANWQMWGECIDAVDYDNLAASL
                     IPVEGESDPFWVSSSRTICADLAIRMSVDPDRSIEKFLKTLLSLSMKSLREYLVNTPS
                     ANLVEEKIEKTAISIRSVVTNYAKALRFLQGLDDGTKPPFTIREWMTQERYDNSWLFI
                     STQARHRKSVRPLISLWVSLATLLLQSMGENSERRVWFILDEAPSLQRIPELAETLAE
                     ARKFGGCFVLGMQNMAQLVHVYGRELAKSIFDLMNTRMYGRSPSAEMAKVVEEELGNQ
                     RKRKIREQNSYGLDQVRDGVSLGKDEVNNPIVDYEQIMRLPNLNFYVRLPGEYPVVRL
                     KLKYRPFKKRHAGLIERNIRDALSPELERVIQENERAAAIAGLTFPTGDEVLEKGSET
                     SSADDGPAPVSSAGASGSQATPVVEKVARTRMEEPKPSRSAAPERKPVPVREPDISRK
                     EPAVTENHRPVTAPVTGDKKDNVVSLRPSKPAPNHQKGTASLNPEIPAALQKIRSRTQ
                     LDIPSEPAAAGALGMLKRRLSTGATSDGGEDQASENAGESMNLDMKVTALPDGGLSLT
                     TAGKSVTPQTPDEAHSTHRKLAQEEENILLHRHADDPGYDENDHYYYDREPEL"
     gene            125458..130881
                     /gene="traI"
                     /locus_tag="ECL_RS26555"
                     /old_locus_tag="ECL_A182"
     CDS             125458..130881
                     /gene="traI"
                     /locus_tag="ECL_RS26555"
                     /old_locus_tag="ECL_A182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer relaxase/helicase TraI"
                     /protein_id="WP_013087229.1"
                     /translation="MMSVAPVASAGEAAGYYSNSDNYYFLGSLQSLWMGEGAKALGLE
                     GNVRGDDLTAVLEGRLPDGSRLGKEVNGQHVHRPGHDLTFSAPKSVSILALIGNDKEM
                     VEAHNHAVRVAAGYVEKLISARDTKDGVTSIVHTGKMVAAAYTHDTSRNLDPQLHTHL
                     LIANMTEYAGKWKALATDYIHNAGFIETVMKHQVTLGKIYRSALRERVEALGHEVEEV
                     GKHGMWEIMGVPEDVRDEYSSRGREIQGAVGAEATLRSRDVAAKDTRRAKVDPSRMRL
                     MERWLGQMKEKGFDLKAYQESVVPRDAGLRETATHPERDHLAKPVPAGPELASLQTSS
                     TAEKSVDTPAQPAERESQSRQPVPQQIDTLSQPAQTRPEKTPATRSFPAAQLDTEIPR
                     PELTEAVRLAISQLSDSKTRFTFGELMMTTAELSEQLPEIQDIRVAIDAALKDGMIVP
                     LDSEKGVFTSRIHLLDELSIQALSQEHLKSTKVVSFTRPAQYAPAALEVVEKDALVLM
                     NAPSGVAGIRDLTAQLAGIAGANGRDVQVLASSAERAISLAKSDDLRERIISRQHVLS
                     GDFHLKPQSTLIIEGAERLGLKETLVLLGEARAQDAQLVFLDSAGRQANGNAMSVLES
                     AGVARSRRTEPAPRLEAEVVSIPNKRDRYEALANRFAELSGGTENVTAVVVGRREQAQ
                     LTGLVREALQNAGQLGRDGVEIEARQPVWLDSKTRRMPGSYRPGMVLEDRADAKERKS
                     YVIDRVHEDTRVLSLIDGDGVLTRMKIGDISADWRLFSRETLSVATGEKLLSVAGDRE
                     HSLKAKDRLEVTGISEKGIEVKRGEDTLTLPKDQPLYLSHAYVTAPGGRDNDTGVVLA
                     ALNSRDISTQTMNSLAQSGHRAEVFTAEVQDRAEARLQRMKTNASPVQLVRNLSGHQD
                     ISQAVDSLHDRVRTDAGLAVWRAINDQRTVVISELKLATEAQKYHPDLEAIGNEIGAM
                     IKNGELLSVSAGGEPVLVSRSTWEMEKAILRVVEEGKGTQQPLLEQVPEAVLNGLTDG
                     QKKATTLVLGTTDQFIGIQGYAGVGKTTQLKAVISALETLPADVRPVMTGLAPTHQAV
                     KEMSDVGVRAQTIKSFVVEHDQATAGGGKPDYKGQVFLIDESSMAGNQDTAALFQAIA
                     SGGGRAVSMGDIDQFEAVDVGAPFKLMQERSPMDVAIMKQIVRQKDLQLRGAVHDIID
                     NRIDAALQRIETQPADRVARSASAALPESAIQETETPVNDIVADWKDRTPEARSRTLI
                     IAQLNADRKAINAGIHATLAARGELGEKAIKVPVLDKITHTRHAFNKTEAWEPGMVVK
                     RGDRYQDVVAVDRNGSTVTVRDEEGKIALVSPKELITGDVQLFRRSEMEVRSGDLLKF
                     TATDREQGQMANQRYTVESVSEEGNIRLKGENGRVTINPEKVRAQQHLDYGWAVTGYG
                     AQGASSDYVIALEGTKDGRKALASRRAFYISASRVKEHVQIYTDGKADWVKAVKTPER
                     DIKTAHDALAPETQRKQAKAIWAMGQPVNKTAIGRAWVRHQGMQDASLTAKIIPATRR
                     FPEPALALPVYDNNGRSAGLALVSLVASPEGRMTQGETRMVMTERARGAVLQRSQSGN
                     TIVASDLTAALDAVRNNPKDGVVWQTGDEPPSAWLLKVSGGTKQDVSPGIVSTLTDEQ
                     SVQQLREQMLADLVRNEEASRSRQPESLLAEVPQEEVIRLKPEDINPRKPEPLNPDAD
                     VIARVRGEENTDGREIKAAAGVRSELEGADKASGEQSRASRVIADLANAERDMLRAAE
                     NTERGRTPEREEQTLTRTIQKER"
     gene            130909..131694
                     /locus_tag="ECL_RS26560"
                     /old_locus_tag="ECL_A183"
     CDS             130909..131694
                     /locus_tag="ECL_RS26560"
                     /old_locus_tag="ECL_A183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin domain-containing protein"
                     /protein_id="WP_013087230.1"
                     /translation="MKANKLTALIVTTYIGFVSMAHASAPQAVFSPEQEARIGEIAAD
                     YLISHPEILVTVSQKLQEQQEVRKQKMFALSVMENQANLLHDPDTPAYGPENAKVAVI
                     EFFDYQCVFCSRFAPELEKVMKAQPDVRYHFKEWPIFGGRWEASFQAAQQGLTVWQKK
                     GPQAYVTYHNAIYATGHNEGKLTAEDIHGAASKAGLTTPAPGDHTASLEKNSNLAEAL
                     GLTGTPGIIVMPVSGATPDTITVFPEAVTAERLQAAILKATAR"
     gene            131795..132346
                     /locus_tag="ECL_RS26565"
                     /old_locus_tag="ECL_A184"
     CDS             131795..132346
                     /locus_tag="ECL_RS26565"
                     /old_locus_tag="ECL_A184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014172318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087231.1"
                     /translation="MMIMESVVVKFKIQHLQAAVALVLASFQPQPKAVACQPTIVERV
                     YEMGSRVNKTDISELTVALNDVAEELRSSRIELARYADSDFSGAIKVASDIRNHTIHV
                     AGIAESFVLMLPEKNIIQSYDRNSVEFAFFKAIKMVSLATKNYLSLIDQITRTTEVRD
                     SGINLSAMNHLLDSGDRAAAKWR"
     gene            132337..132753
                     /locus_tag="ECL_RS26570"
     CDS             132337..132753
                     /locus_tag="ECL_RS26570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014172317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system YafO family
                     toxin"
                     /protein_id="WP_023338064.1"
                     /translation="MALTAEYSHVTWDSFFQPTFAVYPELESQLQAEFITYKSTGAPS
                     NLLGRDAPFDFPPFAVDANVQHIHVNLHFQLTWSARQENYNRTSDHYLIYTEHMWDSG
                     RFLLMGLITPAHERMPARDTRLLSYFSEVAEDFHAS"
     gene            complement(132966..133943)
                     /locus_tag="ECL_RS26575"
                     /old_locus_tag="ECL_A187"
     CDS             complement(132966..133943)
                     /locus_tag="ECL_RS26575"
                     /old_locus_tag="ECL_A187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000600827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_013087234.1"
                     /translation="MILIPDDEPELSLPAASEEFLPALSGENAPVSPARAYLLSLNSH
                     RSRQTMASFLNIVAVMLGAASLESCSWGSLRRHHVMAVTELLRDTGRATATVNTYLSA
                     LKGVAKEAWMLRLMDVESFQHIRAVRNLRGSRLPRGRALPPEEIRALFGACEADDSSI
                     GVRDAAMLGVILGCGLRRSEAVGLDLCDIVTDERALRVLGKGNKERLAYMPAGTWQRL
                     RKWIDDVRGEKDGPLFTRIRRFDTLTNDRLTDQTVYHVLQVRQRLAGIAKCAPHDLRR
                     TFATSMLDNGEDLITVKDAMGHASVTTTQQYDRRGEARLRTARDRLDLI"
     gene            134176..135327
                     /locus_tag="ECL_RS26580"
                     /old_locus_tag="ECL_A188"
     CDS             134176..135327
                     /locus_tag="ECL_RS26580"
                     /old_locus_tag="ECL_A188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001072358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087235.1"
                     /translation="MNQKWKTLLISVLTPSGIISGIALTVLWGYFSRLDRLDVFFEVM
                     SIKSLFAMVCCAAVFSLAILLFIFFIISIFMPIIIPLDINNLPTYNKIQNNFLSILML
                     SGLFPMAFIYVFYYAFDFSQAVKNNSGWLSLLSIGVLTIIISCLISRKYLEHDLSIKN
                     TKVRWMRRCQIYVAIPLCIALLAHLQVFPLEIVFRNISASTEKVSFRIVAGMAFMSYM
                     VFFMTILPGLVYLRMDAKDKLPKKISTSLIVSLMILLFISTKITVLPVIFTHSVIKLS
                     GISDFSTHSYIIKSSEYPEEFFSNSVWDRKKIKAGEYYSVRAVSIFTTNQFSFLCPEE
                     IIKSYRESWKFNPLDSEFDTDVRLKLQKDAAYCVPVSATAVKRWDVPLQ"
     gene            <135591..135781
                     /locus_tag="ECL_RS26585"
                     /pseudo
     CDS             <135591..135781
                     /locus_tag="ECL_RS26585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343613.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            136145..137358
                     /locus_tag="ECL_RS26590"
     CDS             join(136145..136439,136439..137358)
                     /locus_tag="ECL_RS26590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612254.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_099516394.1"
                     /translation="MIFSPQHKTGDLMNKKTKRTFPPEFRLECAQLIVDKGYSYRQAS
                     EAMNVGSTTLESWVRQLRRERQGITPSATPITPDQQRIRELEKQVRRLEEQNTIFKKG
                     YRALNVRLAERFTIAARLSDSHTVVSLCSALEIHRSSYRYWRKRRDTVNPARVRLCSE
                     IRRAWNQSRGSAGARTLAEMLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQE
                     HTSLPNLLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHAD
                     TALISSALRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDN
                     SPMERFFRSLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENR
                     YHFYCKTVASIT"
     gene            complement(137369..138868)
                     /locus_tag="ECL_RS26595"
                     /old_locus_tag="ECL_A193"
     CDS             complement(137369..138868)
                     /locus_tag="ECL_RS26595"
                     /old_locus_tag="ECL_A193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012303502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kinase"
                     /protein_id="WP_032662300.1"
                     /translation="MANIVTCKTKDGETVQYVDEVIGSGSMKDVYFSPDKSYVVAFYH
                     KPQNEQARDRIDMITGRYRQNIFGQSGGEYWKDLFCWPTHVVEHGDKIGIVVPTYKSY
                     FFFKYGSKNDDFLGIKGREKEGKWFASASNQNKFLDPRERGNTLTYLKVCLLLTRAVR
                     RMHAAGLCHSDLSYKNVLIDPEMGHACIIDVDGLVVPGKYPPDVVGTPDFIAPEVVKT
                     SHLSKEDPNRVLPSISTDRHALSVLIYMYLFFRHPLRGGKIHDMSDEVRDETLSMGEK
                     ALFIEHPTDKSNAVKVSQLSSFSLPWADPEKIPYTIMGPYLTPLFERAFIDGLHDATK
                     RPTADEWESALVKTVDLIQPCQNKACEQKWYVFSGKTKPVCPYCGTPYKGKLPVLNLY
                     SSRKEGSYRPDDHRLMVWSGQSIYAWHVNRLIAPNERTTDAQRKRVGYFVFHNDQWWL
                     VNEGINGLMSLPDKRQIAIGEKIELTNNAQFVLSKEEGGRLVVVQLVEN"
     gene            complement(138894..140531)
                     /locus_tag="ECL_RS26600"
                     /old_locus_tag="ECL_A194"
     CDS             complement(138894..140531)
                     /locus_tag="ECL_RS26600"
                     /old_locus_tag="ECL_A194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000081622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase 2C domain-containing
                     protein"
                     /protein_id="WP_013087238.1"
                     /translation="MSQNALLEEKIIRLVLSELGHPVEGERLFLLSHDPSLTEEIMRL
                     KERIESLAQGLSARVSEGYNDAEIAPSSASSLSDQQQTVVSDADNPGIDATDTPLLQP
                     LPENEPHPPFWKLMPYYEFDKPAQREDENLSSLVLKPGQIPTGQQRAGLAVPPAVPPR
                     AKIVIPNARAGERFSSPVAIVLDEGQQATVRDVVFPRNIGLTFDKEHKLLTGTPTESG
                     DIELSVLWSCASHDECETKQLFIVNPDPRSLWKVVEPPAGASYPKSHLDAAGLVRGDI
                     RIAAASRRGRSHEHAGSFRDDDFYINHCQETGWSVMLVADGAGSAVNSREGSRIAVQT
                     AGDYLFNQLSGLKGVHLKQHITAWEGSDQQATINAMLHHFKQAATLAVNSIQNEAICA
                     EQPVKSYSTTLLATVALRTDNELFAAAFWLGDGAIGAYSPSGKVRILGNPDSGEYAGQ
                     TRFLDQSIIADPSFSGRISVGKWNDVSHLILMTDGVSDPLFETDNGLRSDEKWTRLLD
                     ELIPVLTDASIAPERLGDWLNFFSTGNHDDRTIAVLW"
     gene            complement(140531..141571)
                     /locus_tag="ECL_RS26605"
                     /old_locus_tag="ECL_A195"
     CDS             complement(140531..141571)
                     /locus_tag="ECL_RS26605"
                     /old_locus_tag="ECL_A195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001253653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_013087239.1"
                     /translation="MRRLPVFFVLDCSESMIGENLKKMTDGLQMIVGDLRKDPHALET
                     AWVSVIAFAGVARTIVPLHEIASFYPPRLPVGGGTSLGAALRELTVQIDTQVRKTTHE
                     AKGDWKPVVYLLTDGRPTDDTTAEVKRWKDHYASKVNLIAVGLGPSADLNTLRQLTEN
                     VMLFTESQEGDFTRFIKWITASVTAHSRSVGDDKQPELSQTEYIVRLAKDEPVKAYDE
                     ICVTLTGRCSKTRRPYLMKYERPPARISGLDFSLNLNSFNIAGCYPIDEDYFAWSDAT
                     ATGLQVNTSELHGVPGCPHCGNASAFALCSCGKLLCIDGPDDVICPWCETGLSFSNDG
                     GNTNFDVNRGRG"
     gene            complement(141657..142295)
                     /locus_tag="ECL_RS26610"
                     /old_locus_tag="ECL_A196"
     CDS             complement(141657..142295)
                     /locus_tag="ECL_RS26610"
                     /old_locus_tag="ECL_A196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_013087240.1"
                     /translation="MRRLPVYLVIDTSGSMRGESIHSVNVGIQAMLSALRQDPYALES
                     VHISIITYDNGAREFIPLTPLEDFQFSDIVVPSAGGTFTGAALECLMQCVERDVRRSD
                     GDTKGDWRPLVFLMTDGTPSDALAYGEAVKAIRGRGFGSIIACAVGPKAGHEHLKQLT
                     DKVVSLETLDSTAFAGFFKWVSASVSSGSTSAGINNGTDTLPPPPPEIQLVL"
     gene            complement(142295..142936)
                     /locus_tag="ECL_RS26615"
                     /old_locus_tag="ECL_A197"
     CDS             complement(142295..142936)
                     /locus_tag="ECL_RS26615"
                     /old_locus_tag="ECL_A197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002210396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerD family protein"
                     /protein_id="WP_000116681.1"
                     /translation="MSVSLSKGQGVSLKKNEYDLSSVTIGLGWDINEEKKGFLGGIFG
                     KKEEEYDLDVIAFLCNSAGKVTDLGNVENGKPTLVNGDIIFFNSLRHKSGNIWLTGDN
                     RTGAGDGDDEQIIVRLNSLDAQYEKIVFIVQIYNGEKLQQHFGKVQNAFIRAVDARNI
                     EMARFDLSGGPAFASQRSMVFAELIREATGWKLRAIGEPSESDSFVSHLRNYM"
     gene            complement(142959..143597)
                     /locus_tag="ECL_RS26620"
                     /old_locus_tag="ECL_A198"
     CDS             complement(142959..143597)
                     /locus_tag="ECL_RS26620"
                     /old_locus_tag="ECL_A198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015731191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_001388628.1"
                     /translation="MRRLPVYLLLDTSGSMHGEPIEAVKNGVQTLLTTLKQDPYALET
                     AYVSVITFDSSARQAVPLTDLLSFQMPALTASGTTSLGEALTLTASSIAKEVQKTTAD
                     TKGDWRPLVFLMTDGSPNDDWRKGLNDFKAARTGVVVACAAGHDADTSVLKEITEIVV
                     QLDTADSSTIKAFFKWVSASISVGSQKVESSKKEVIGLEDLPPPPPEVNVVL"
     gene            complement(144061..144528)
                     /gene="terW"
                     /locus_tag="ECL_RS26625"
                     /old_locus_tag="ECL_A201"
     CDS             complement(144061..144528)
                     /gene="terW"
                     /locus_tag="ECL_RS26625"
                     /old_locus_tag="ECL_A201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein TerW"
                     /protein_id="WP_001176767.1"
                     /translation="MQLNTRQARIFKLANLLGTGKPVSAADIITSLECSEPTLTRALK
                     ELRESYSAEIKYSKAGHSYHLVNPGQLDKKTLRRMNEALAQNAELKTGESTGKVVLDK
                     DKKTAVSLSLRMRILRKIDRLAALSGSTRSEAVEKLALHSVDELIKEYSAKKS"
     gene            complement(144546..145754)
                     /locus_tag="ECL_RS26630"
                     /old_locus_tag="ECL_A202"
     CDS             complement(144546..145754)
                     /locus_tag="ECL_RS26630"
                     /old_locus_tag="ECL_A202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4236 domain-containing protein"
                     /protein_id="WP_000506888.1"
                     /translation="MGFRFRKSINIIPGVRLNLSNGAPSLSVGPRGASVSFGSRGTYA
                     NLGLPGTGLSYRTRLDRAARSGGGNRTATDPGLRQALEQEAADLMSAVTAIRNIHELT
                     PDPKTGISWAELEAVYLHNRTSPFQVPAPVRPEKPDYLALPEKPAESEGISFLGKWFE
                     SESAKAERHAENLRRWQQELIDVERENTLRQHRYQQQRTAWAEQYANWKFEAEEHEKR
                     LATAQADARQQFRTDAAFFESYLAGVLAETEWPRETLVAFEVKPELSAVLLDVDLAEI
                     EDFPDKIYGVNARGTELTEKAMTQKAVRENYARHVHGCLFRLVGIVLHTLPFDNVIVS
                     GFTQRVSKRTGYLEDEYILSCKCSRSQMSSVNFAGLEHIDPVEALGDQPVIRKMSSTF
                     IFQPIEPLTL"
     gene            complement(145765..146721)
                     /locus_tag="ECL_RS26635"
                     /old_locus_tag="ECL_A203"
     CDS             complement(145765..146721)
                     /locus_tag="ECL_RS26635"
                     /old_locus_tag="ECL_A203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HpcH/HpaI aldolase/citrate lyase family protein"
                     /protein_id="WP_000797363.1"
                     /translation="MKNRLSPWNLGATLYMPATREDIADAVLHGKIPGLRSLVICLED
                     AVSEADIPIALKNLEHLLHELSNSMRSLGKNDWPLVFIRPRHADMGRWLKAHYDLSAV
                     DGFVLPKFTLSSLAEWWDIMGGTHLCMMPTLETEDVFDVVQMRELATRLVEHPCHDRI
                     IALRIGGNDLMNVVSLRRPRDLTLYDSPMGYVIKMLVSVFGPRDFALTAPVCEHIDDH
                     AVMARELALDMAHGLVGKTAIHPGQIEVIQNALMVTQGEHSDALRILNSTQAVFKSQG
                     AMCEPATHRRWAAGILDRARFYGLQNEQSADGIRLLTVTQHH"
     gene            complement(146721..147800)
                     /locus_tag="ECL_RS26640"
                     /old_locus_tag="ECL_A204"
     CDS             complement(146721..147800)
                     /locus_tag="ECL_RS26640"
                     /old_locus_tag="ECL_A204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309373.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine protease StiP family protein"
                     /protein_id="WP_001182415.1"
                     /translation="MQPHETFTGSYQPGDVEFLLKPVVIEMTPVDQKEELIQSGKKHY
                     SDMLSQEPAPTQWHLDLFHRALDRGAERLAKEVTQLAISLAERFGDEPIVLASLVRAG
                     VPLGVMLHQALRDMGKTSWHYGISIIRDRGIDGAALDVIEERHGTSGIVFVDGWTGKG
                     AITGELVRALKDRPGYPEQPRLVVLADPCGCSWLAASDDDWLIPFGIMGAPVSGLISR
                     SVWSSEGLHGCMVCEHLSEFECSRMLVDTVAHFRKKLTPTSLAPLSWNTESARILWQT
                     SRDVIAFLADEFKVDSVNRIKPGIAEATRAVLRRVPDHIFVRSIDDPDVALLVGLARE
                     KGIVVTEMGGTLGQYRAVTIIKKVL"
     gene            complement(147802..148575)
                     /locus_tag="ECL_RS26645"
                     /old_locus_tag="ECL_A205"
     CDS             complement(147802..148575)
                     /locus_tag="ECL_RS26645"
                     /old_locus_tag="ECL_A205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001040062.1"
                     /translation="MNKPVVLSDLDDTLFQTRRKMVDELALEPFRTGAVDRTLNPRSF
                     MTEEQSMLVDWLLEQAELIPVTARGTEEISRVRIPFHSWAITTHGAVILTPEGNPDEE
                     WKAHMLGQLAPYQEKLTSMQRLITEMMDAKGINAWARLNFEYGETAVYMVMKHRDSTR
                     LDELNAIADEIETVFPTEGFYIHRNSNNVAWLPTPVEKGLAVSWLLEKLRAERGVFPV
                     IGLGDSLSDHRFMKLCSWFGIPRQSQFADAISQRIFGEN"
     gene            complement(148568..149710)
                     /locus_tag="ECL_RS26650"
                     /old_locus_tag="ECL_A206"
     CDS             complement(148568..149710)
                     /locus_tag="ECL_RS26650"
                     /old_locus_tag="ECL_A206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase domain-containing
                     protein"
                     /protein_id="WP_001282603.1"
                     /translation="MSDNLEDMIYRRTLSCGTIQVIRDQGEVSLDDLFDIAERRNPKR
                     AFLFVSKVLGRHIPVPPSVMRQAYRQLASQFPSTLTGPVLFIGMAETAVGLGAGVFDE
                     VRHQHRESVYLTSTRHPVDGTLLCEFKEEHSHATDHLIYLPDDEEKRRRVTNARTLVL
                     IDDEATTGNTFINLLSALRNTGKLQHIEQVIAVTLTDWSGKALSERSTLPVTSVSLVS
                     GQWGWTTLPDAPVPDMPKVNVTSRGEWDIQGKQSWGRLGMLAPAADLGHEVSVRKGER
                     VLVLGTGEFVWEPFLLAERLEAAGAKAFYGSTTRSPIAVGYAIESAISFTDNYGLGIP
                     NFVYNVAHQQFDRILVCTETPAESIDAQLLKALAEVAPVVEIVTYE"
     gene            complement(149720..150802)
                     /locus_tag="ECL_RS26655"
                     /old_locus_tag="ECL_A207"
     CDS             complement(149720..150802)
                     /locus_tag="ECL_RS26655"
                     /old_locus_tag="ECL_A207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-grasp domain-containing protein"
                     /protein_id="WP_013087241.1"
                     /translation="MAFRIIKKNEQENLVYGRFILPARYYSGGKIICTKNNFAITVFA
                     SHRNERNEILSVADYSLTEPEDPQKRLQFIQETIQTYGIHHIHTGRNSQWFEEHRSDI
                     ESTGATLTTGATSVDWLTLADEKVTFAQFMEQKGLPVVPSWRVNTLAELKTHLASPPF
                     TDSPVCVKPVTGIYGMGFWRFDDSASPMAVFNHPEHRLVSPQQYIAAASAAESFKPLV
                     LMPYLPGPEFSVDILADKGEILAAVGRRKEGAIQYLVNEGSAWELACDCARVMKADGL
                     VNVQTRNDVNGNPVLLETNMRPSGGVGYTLHSGVNLPGLFAAFKLGLMSEDMVRQSAK
                     NTFSPVAVRSITDVIAYPESLSNLLN"
     gene            151099..151680
                     /locus_tag="ECL_RS26660"
                     /old_locus_tag="ECL_A208"
     CDS             151099..151680
                     /locus_tag="ECL_RS26660"
                     /old_locus_tag="ECL_A208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerD family protein"
                     /protein_id="WP_000254136.1"
                     /translation="MVSLVKNQTVSLSKESSALSQLHFGLGWDPVKKKGLLGGLFGGN
                     DSIDLDAGCVLMDSTGKTIDTIWFRKLESTCGAVVHSGDNLTGEGDGDDEVIKVNLSR
                     LPANVEYLAFTVNSFRGQSFNDVENAFCRVVDQTGKELARYKLTEQGSHTGIVISSLR
                     RNNGNWDFTALGHACRGRTIDDMHSDIVSAVIR"
     gene            151680..152837
                     /locus_tag="ECL_RS26665"
                     /old_locus_tag="ECL_A209"
     CDS             151680..152837
                     /locus_tag="ECL_RS26665"
                     /old_locus_tag="ECL_A209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309379.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerD family protein"
                     /protein_id="WP_001054787.1"
                     /translation="MNLTPGGNAPVPAQELRVRITSGGQVDASAFRLYADGKVQGDAD
                     MVFYGQPRNDDGTVSLVSEGQYSTFTVALNRLKPDVQKIAFTVTCDGGQTVSGLRNLS
                     IDVEQGATGLVSGSVELSGRQEAALILGEFYRRNNDWKFRFVAQGFNGGLKPLAEHFG
                     VNIADEPAPAAPTPPVVTPPPVETKISLSKVSLTKEKPAISLTKRDNFGEIRINLNWH
                     RGSGKSGFAGMFGSKGIDLDLGAFVELQDGYKSVIQALGNAFGNYRDEPYVQLKGDDR
                     TGDVSDGEWLHINGREWKHIREVLIYAFIYEGVPSWDKTDGVVTIHVPDQPPIETRLT
                     EGENRRTLCAIARLVNENGAIKVERINQYFKGQDEMDRAFGWGFRWSAGSK"
     gene            152860..153315
                     /locus_tag="ECL_RS26670"
                     /old_locus_tag="ECL_A210"
     CDS             152860..153315
                     /locus_tag="ECL_RS26670"
                     /old_locus_tag="ECL_A210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance TerB family protein"
                     /protein_id="WP_000007448.1"
                     /translation="MSFFDKVKGAINSGRDELTRQVGRFKNKKFMHGTVAVCARIAVS
                     SDGVSSEEKQKMMGFLRSSEELKVFDTNEVIEFFNKLVSSFDFDVEIGKGETMKYILA
                     LKDQPEAAQLALRVGIAVAKSDGNFDQDEKLASREIAIALGFDPAEFGL"
     gene            153338..154378
                     /gene="terC"
                     /locus_tag="ECL_RS26675"
                     /old_locus_tag="ECL_A211"
     CDS             153338..154378
                     /gene="terC"
                     /locus_tag="ECL_RS26675"
                     /old_locus_tag="ECL_A211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance membrane protein TerC"
                     /protein_id="WP_000255079.1"
                     /translation="MVSTHIGFPTETVIVFIALSVGAIFIDLFMHRDDKPISLKSAAL
                     WSVFWVVVAMAFAGFLYIHHGAEVASLFVTGYALEKVLSVDNLFVMMAIFSWFAVPDR
                     YRHRVLYWGIIGAIVFRGIFVAIGTSLLSLGPYVEVVFAIIVAWTAVMMLKSGDDDDE
                     IEDYSQHLAYRMVKRFFPIWPKLRGHAFLLNQKEVDAELAKPENSDVTIGRGKKAALY
                     ATPLFLCVAVVELSDVMFAFDSVPAIIAVSREPLIVYSAMMFAILGLRTLYFVLEALK
                     QYLVHLEKAVIVLLFFIAAKLGLNATDHIWHHGYSIAATTSLYVVLGVLALGILASVM
                     FPGKPESEEKGS"
     gene            154427..155005
                     /gene="terD"
                     /locus_tag="ECL_RS26680"
                     /old_locus_tag="ECL_A212"
     CDS             154427..155005
                     /gene="terD"
                     /locus_tag="ECL_RS26680"
                     /old_locus_tag="ECL_A212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance membrane protein TerD"
                     /protein_id="WP_000116677.1"
                     /translation="MSVSLSKGGNVSLSKAAPSMKNVLVGLGWDARSTDGQDFDLDAS
                     AFLLAANGKVRGDSDFIFYNNLTSSDGSVTHTGDNRTGEGDGDDESLKIKLDAVPSDV
                     DKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL
                     YRHNGEWKFRAVGQGYAGGLASVCAQYGINAS"
     gene            155073..155648
                     /locus_tag="ECL_RS26685"
                     /old_locus_tag="ECL_A213"
     CDS             155073..155648
                     /locus_tag="ECL_RS26685"
                     /old_locus_tag="ECL_A213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerD family protein"
                     /protein_id="WP_000301242.1"
                     /translation="MAVSLVKGGNVSLTKEAPTMNIAMVGLGWDARVTDGQAFDLDAS
                     VFAVGEDGKVLSDAHFIFFNNKTSPDGAVEHQGDNRTGEGDGDDEQVKIDLTKVSADI
                     KKLVFAVTIYDAEARKQNFGMVSNSFMRVYNNDNGTEIARFDLSEDASTETAMVFGEL
                     YRHGAEWKFKAVGQGFAGGLAALASQHGVNI"
     gene            156077..157318
                     /locus_tag="ECL_RS26690"
                     /old_locus_tag="ECL_A215"
     CDS             156077..157318
                     /locus_tag="ECL_RS26690"
                     /old_locus_tag="ECL_A215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001053346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_001053338.1"
                     /translation="MNLQSGQNIPLQQSAIRLNLQYPAKSGFKGEPDTCLFLLNAQGK
                     VTGDSDFIFYNNLSSPEGAVKLVTGSQQSSIEIALDRVPANVSKIAITVVIDGEDTIS
                     GLSLLSIQAPGIADFQAETQGRSEKAIILGEVYRHNGAWKLRALGQGFNGGLEPLAIS
                     FGVDVAQPAPQPAKPARISLEKKLETRSPRLVSLAKKASVSLTKNKLDTLEAAVAFVL
                     DASGSMSGQFSKGNVQSVLDRIAVLAAQFDDDGEMDVWGFGEKHKKYPNVTLDNLDTY
                     IQSIRGSGKRSAWENLPGLGGTNNEPPVMEEIVDYFKDSKIPVYVVFITDGGISKTRA
                     IKDAIRRSANYPIFWKFVGLGGSSYGILKNLDDFTDRRVDNTHFFAMDDFGSISDEKL
                     YDNLLEEFRPWIDETKRLGIL"
     gene            complement(157881..158162)
                     /locus_tag="ECL_RS26695"
                     /old_locus_tag="ECL_A217"
     CDS             complement(157881..158162)
                     /locus_tag="ECL_RS26695"
                     /old_locus_tag="ECL_A217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000077926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000077926.1"
                     /translation="MSQHWYEVKSNQGIVQVMLGWDPPLQWFHMCIDYDINAAEDPLY
                     TNLAEPDPYYVTPEYLQFVLERFEITDIVIKPDTSGLYEELLMDQLLDR"
     gene            complement(158212..158403)
                     /locus_tag="ECL_RS26700"
                     /old_locus_tag="ECL_A218"
     CDS             complement(158212..158403)
                     /locus_tag="ECL_RS26700"
                     /old_locus_tag="ECL_A218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008786869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000398480.1"
                     /translation="MEGIETLSLRLDENETMALAQFVKRLSWSDLRGCAVSDEEAWVM
                     KSAVDKLQQALREEGYAPR"
     gene            complement(158495..158836)
                     /locus_tag="ECL_RS26705"
                     /old_locus_tag="ECL_A219"
     CDS             complement(158495..158836)
                     /locus_tag="ECL_RS26705"
                     /old_locus_tag="ECL_A219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001151572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001151575.1"
                     /translation="MAKVQGLFVGYRKFAVDREWLRQQEEQRYRDRQRQFDEWSRKWV
                     TVTRLKETRLWTDGAIRRWLGEPQQQGKYKVFPVEAVLAAEKLNEFQLWLKPRLEKKR
                     AQHHHFLIPFL"
     gene            159209..159601
                     /locus_tag="ECL_RS26710"
                     /old_locus_tag="ECL_A220"
     CDS             159209..159601
                     /locus_tag="ECL_RS26710"
                     /old_locus_tag="ECL_A220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000341068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000341066.1"
                     /translation="MDDKEQFTNLVAKHASGLTEEQLAGYDACSLDGECVTPSYEVFR
                     GYRTRHTLDEFLEMAISLNAIHPDEYLTDMLLKPHEVIGALADEGDQLNNATPVYFFP
                     DTGVYAAAVSETRVLDAWLCWPCYPANW"
     gene            complement(160290..161294)
                     /locus_tag="ECL_RS26715"
                     /old_locus_tag="ECL_A222"
     CDS             complement(160290..161294)
                     /locus_tag="ECL_RS26715"
                     /old_locus_tag="ECL_A222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110-like element IS4321 family transposase"
                     /protein_id="WP_000427623.1"
                     /translation="MENIALIGIDLGKNSFHIHCQDRRGKAVYRKKFTRPKLIEFLAT
                     CPATTIAMEACGGSHFMARKLEELGHSPKLISPQFVRPFVKSNKNDFVDAEAICEAAS
                     RPSMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISR
                     LSTILEDNSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCV
                     GTLTASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLL
                     VQCARVFIQKLEHQSGKLADWVRDLLCRKSNFVVTCALANKLARIAWALTARQQTYVA
                     "
     gene            complement(161373..161930)
                     /locus_tag="ECL_RS26720"
                     /old_locus_tag="ECL_A223"
     CDS             complement(161373..161930)
                     /locus_tag="ECL_RS26720"
                     /old_locus_tag="ECL_A223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019897068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_003100847.1"
                     /translation="MLIGYARVSTQDQNLELQREALSKAGCKKVFEDKVSGTRADRPG
                     LAKTLEMLREGDTLVVWKLDRLGRSVKQLVDLVGDLHKHGVQFRSLTDSIDTGTPSGR
                     FFFHVMASLAEMERELTVERTRAGLEVAKQLGRKGGRKPKMTDSKIESAKKLLASGVP
                     PKDVAKNLGVSIPTLYRWVPASTHA"
     gene            complement(161924..162295)
                     /locus_tag="ECL_RS26725"
                     /old_locus_tag="ECL_A224"
     CDS             complement(161924..162295)
                     /locus_tag="ECL_RS26725"
                     /old_locus_tag="ECL_A224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003100853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003100853.1"
                     /translation="MSTSTIEALASAWARIAEEAEFPADYEGTATPQAHRASEAIQEQ
                     IRERIVATNDMRLFSLLHLLGQASLRMEQALWPEDYERMTREVEEALRQATDANARSY
                     THEEVMQAMQERIDRARDKPC"
     gene            complement(162292..162753)
                     /locus_tag="ECL_RS26730"
                     /old_locus_tag="ECL_A225"
     CDS             complement(162292..162753)
                     /locus_tag="ECL_RS26730"
                     /old_locus_tag="ECL_A225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003100856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044159268.1"
                     /translation="MKTTPGVFAPVIENAKRPDAGAVMAWGVAIVAVMILFTPLLLRC
                     PPFRRWYGRTDALSERQRQALAERGLRRYYQTAFDDGYVPRVMPYVWRIIWTVGGLMA
                     VTAVLPTNTGRPAFDALVVFSTWYPIGVMLLVFASRPLGRLIRQRAQERRK"
     gene            162885..164564
                     /locus_tag="ECL_RS26735"
     CDS             162885..164564
                     /locus_tag="ECL_RS26735"
                     /function="Transposase and inactivated derivatives"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013124600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DDE-type integrase/transposase/recombinase"
                     /protein_id="WP_003465068.1"
                     /translation="MTSDTPPIAAQGVATLPDEAWAQARHRTEIIGPLAALEVVGHEA
                     ADEAAQALGLSRRQVYVLIRRARQGTGLVTDLTPGRSGGGKGKGRLPEPVERIIRELL
                     QKRFLTKQKRSLAAFHREVAQACKTQKLPVPARNTVAQRIAGLHPAKIARSRGGQDAA
                     RPLQGAGGIPPEVTMPLEQVQIDHTVIDLIVVDERDRQPIGRPYLTLAIDVFTRCVLG
                     MVVTLEAPSAVSVGLCLAHAACDKRPWLEGLNVEMDWPMSGKPRLLYLDNAAEFKSEA
                     LRRGCEQHGIRLDYRPPGQPHYGGIVERIIGTAMQMIHDELPGTTFSNPGQRGEYDSE
                     KMATLTLRELERWLALAVGTYHGSVHNGLLQPPAARWAEAVERVGVPAVVTRPTAFLV
                     DFLPVIRRTLTRTGFVIDHIHYYADALKPWIARRERLPAFLIRRDPRDISRIWVLEPE
                     GQHYLEIHYRTLSHPAVTLWEQRQALAKLRQLGREQVDESALFRMIGQMREIVTTAQK
                     ATRKARRDADRRQHLKTSEPPAKPIPPDVDMADPQADNLPPAKPFDQIEEW"
     gene            164567..165475
                     /locus_tag="ECL_RS26740"
                     /old_locus_tag="ECL_A227"
     CDS             164567..165475
                     /locus_tag="ECL_RS26740"
                     /old_locus_tag="ECL_A227"
                     /function="Uncharacterized ATPase, putative transposase"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003155746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TniB family NTP-binding protein"
                     /protein_id="WP_003465065.1"
                     /translation="MDEYPVIDLSHLLPAAQGLARLPADERIQRIRADRWIGYPRAVE
                     ALNRLETLYAWPNKQRMPNLLLVGPTNNGKSMIVEKFRRAHPVGTDADQEHIPVLVVQ
                     MPSEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAG
                     NSVNRREFLNLLRFLGNELRIPLVGVGTREAYLAIRSDDQLENRFEPMLLPPWEANED
                     CCSLLASFAASLPLRRPSPIATLDMARYLLTRSEGTIGELAHLLVAAAVAAVESGEEA
                     INHRTLSMADYIGPSERRRQFERELM"
     gene            165472..166689
                     /locus_tag="ECL_RS26745"
                     /old_locus_tag="ECL_A228"
     CDS             165472..166689
                     /locus_tag="ECL_RS26745"
                     /old_locus_tag="ECL_A228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011517528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TniQ family protein"
                     /protein_id="WP_013087245.1"
                     /translation="MKSAPRWPLHPAPKEGEALSSWLNRVAACYQMDVHELLAHDLGH
                     SQLDDLDTAPSLSLLTALCQRSGVELERLRSMSLAGWVPWLLDSLDDSVPAALETYTF
                     QCAVLLPKRTRKVRSITRWRAWLPSQTIRRACPQCLNDPTNQAVLLVWQLPLMLSCPQ
                     HGCWLESYWGMPGRYLQWEIADAAPRPADDAIACMDRRTWQALTTGFVELPRRRVHAG
                     LWFRLLRTLLDELNTPLSHCGSCSASIRHVWERCGHPLRAGQSLWRPYEILAPAVQWQ
                     MLEAAATAITLIESKALIPRGEQAALFQTEPYTGFTNGLPAKVPKPEPINHWQRAAQA
                     IDEAIIEARHNPETARLLFTLASYGRRDPESLERLRATFTKEGIPPEFLSHYEPEWPF
                     AGLRLNDGLSDSF"
     gene            166750..167364
                     /locus_tag="ECL_RS26750"
                     /old_locus_tag="ECL_A229"
     CDS             166750..167364
                     /locus_tag="ECL_RS26750"
                     /old_locus_tag="ECL_A229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000904941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_000904941.1"
                     /translation="MLIGYMRVSKADGSQATDLQRDALIAAGVDPVHLYEDQASGMRE
                     DRPGLTSCLKALRTGDTLVVWKLDRLGRDLRHLINTVHDLTGRGIGLKVLTGHGAAID
                     TTTAAGKLVFGIFAALAEFERELIAERTIAGLASARARGRKGGRPFKMTAAKLRLAMA
                     AMGQPETKVGDLCQELGVTRQTLYRHVSPKGELRPDGEKLLSRI"
     gene            complement(167417..167653)
                     /gene="merE"
                     /locus_tag="ECL_RS26755"
                     /old_locus_tag="ECL_A230"
     CDS             complement(167417..167653)
                     /gene="merE"
                     /locus_tag="ECL_RS26755"
                     /old_locus_tag="ECL_A230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="broad-spectrum mercury transporter MerE"
                     /protein_id="WP_001087809.1"
                     /translation="MNSPERLPSETHKPITGYLWGALAVLTCPCHLPILAIVLAGTTA
                     GAFIGEYWGIAALTLTGLFVLSVTRLLRAFKDRS"
     gene            complement(167650..168015)
                     /gene="merD"
                     /locus_tag="ECL_RS26760"
                     /old_locus_tag="ECL_A231"
     CDS             complement(167650..168015)
                     /gene="merD"
                     /locus_tag="ECL_RS26760"
                     /old_locus_tag="ECL_A231"
                     /function="Predicted transcriptional regulators"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001277466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance co-regulator MerD"
                     /protein_id="WP_003465059.1"
                     /translation="MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDD
                     AALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLAVLRQFVERRREALADL
                     EVQLATMPTEPAQHAESLP"
     gene            complement(168032..169678)
                     /locus_tag="ECL_RS26765"
                     /old_locus_tag="ECL_A232"
     CDS             complement(168032..169678)
                     /locus_tag="ECL_RS26765"
                     /old_locus_tag="ECL_A232"
                     /EC_number="1.16.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016240396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury(II) reductase"
                     /protein_id="WP_000136268.1"
                     /translation="MTEITVNGMTCTSCATHVKDALEKIPGVNAAVVSYPESRAQVMA
                     DTAVSHNQLLAAIAALGYQGSIRVGDFKDEPKIRDALEGAGLHIAIIGSGGAAMAAAL
                     KAVEQGATVTLIERGTIGGTCVNIGCVPSKIMIRAAHIAHLRRESPFDGGIAATVPAI
                     DRSKLLAQQQARVDELRHAKYEGILDGNPAITVLHGEARFKDDQSLVVRLNEGGEREV
                     TFDRCLVATGASPAVPPIPGLKESPYWTSTEALVSDTIPARLAVIGSSVVALELAQAF
                     ARLGSQVTILARSTLFFREDPAIGEAVTAAFRAEGIEVLEHTQASQVAHVNGEFVLTT
                     GHGELRADKLLVATGRAPNTRSLALDAAGVTVNAQGAIVIDQGMRTSNPNIYAAGDCT
                     DQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAVVFTDPQVATVGYSEAEAHHDGIE
                     TDSRTLTLDNVPRALANFDTRGFIKLVIEEGSGRLIGVQAVAPEAGELIQTAVLAIRN
                     RMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
     gene            complement(169675..169920)
                     /gene="merF"
                     /locus_tag="ECL_RS26770"
                     /old_locus_tag="ECL_A233"
     CDS             complement(169675..169920)
                     /gene="merF"
                     /locus_tag="ECL_RS26770"
                     /old_locus_tag="ECL_A233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000654684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system transport protein
                     MerF"
                     /protein_id="WP_000654684.1"
                     /translation="MKDPKTLLRVSIIGTTLVALCCFTPVLVILLGVVGLSALTGYLD
                     YVLLPALAIFIGLTIYAIQRKRQADACCTPKFNGVKK"
     gene            complement(169923..170198)
                     /gene="merP"
                     /locus_tag="ECL_RS26775"
                     /old_locus_tag="ECL_A234"
     CDS             complement(169923..170198)
                     /gene="merP"
                     /locus_tag="ECL_RS26775"
                     /old_locus_tag="ECL_A234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011633167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system periplasmic binding
                     protein MerP"
                     /protein_id="WP_000735441.1"
                     /translation="MKKLLSALALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAI
                     SKVDGVSKVDVTFETREAVVTFDDAKTSVQKLTKATEDAGYPSSVKN"
     gene            complement(170214..170564)
                     /gene="merT"
                     /locus_tag="ECL_RS26780"
                     /old_locus_tag="ECL_A235"
     CDS             complement(170214..170564)
                     /gene="merT"
                     /locus_tag="ECL_RS26780"
                     /old_locus_tag="ECL_A235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric ion transporter MerT"
                     /protein_id="WP_001294667.1"
                     /translation="MSEPQNGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNL
                     TVLEPYRPIFIGVALVALFFAWRRIYRPSAACKPGEVCAIPQVRATYKLIFWGVAVLV
                     LVALGFPYVVPFFY"
     gene            170636..171070
                     /gene="merR"
                     /locus_tag="ECL_RS26785"
                     /old_locus_tag="ECL_A236"
     CDS             170636..171070
                     /gene="merR"
                     /locus_tag="ECL_RS26785"
                     /old_locus_tag="ECL_A236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000414383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="WP_000429838.1"
                     /translation="MENNLENLTIGVFARTAGVNVETIRFYQRKGLLPEPDKPYGSIR
                     RYGETDVTRVRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASSLAEHKLKDVRERMAD
                     LARMEAVLSDLVCACHARKGNVSCPLIASLQGKKEPRSADAV"
     gene            171170..172174
                     /locus_tag="ECL_RS26790"
                     /old_locus_tag="ECL_A237"
     CDS             171170..172174
                     /locus_tag="ECL_RS26790"
                     /old_locus_tag="ECL_A237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110-like element IS4321 family transposase"
                     /protein_id="WP_000427623.1"
                     /translation="MENIALIGIDLGKNSFHIHCQDRRGKAVYRKKFTRPKLIEFLAT
                     CPATTIAMEACGGSHFMARKLEELGHSPKLISPQFVRPFVKSNKNDFVDAEAICEAAS
                     RPSMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISR
                     LSTILEDNSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCV
                     GTLTASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLL
                     VQCARVFIQKLEHQSGKLADWVRDLLCRKSNFVVTCALANKLARIAWALTARQQTYVA
                     "
     gene            complement(172356..172532)
                     /locus_tag="ECL_RS26795"
                     /old_locus_tag="ECL_A240"
     CDS             complement(172356..172532)
                     /locus_tag="ECL_RS26795"
                     /old_locus_tag="ECL_A240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001323502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_074422537.1"
                     /translation="MIGAPGVTFRRRQHEISKVDRTVFSDVGVASENGIYGHSRFCNT
                     DFDDKLACLNLSGV"
     gene            complement(172568..172894)
                     /locus_tag="ECL_RS26800"
                     /old_locus_tag="ECL_A241"
     CDS             complement(172568..172894)
                     /locus_tag="ECL_RS26800"
                     /old_locus_tag="ECL_A241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011809177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003100858.1"
                     /translation="MSRSRRKTPIVGHTTCGSEREDKKLWHQRWRTRERTALTSASPE
                     ALSAHLPLLENQASSVWSMGKDGRSYWPVKRQAATADRIANHKGRNPQERASLKKRLL
                     RKWMSK"
     gene            complement(173149..173505)
                     /locus_tag="ECL_RS26805"
                     /old_locus_tag="ECL_A242"
     CDS             complement(173149..173505)
                     /locus_tag="ECL_RS26805"
                     /old_locus_tag="ECL_A242"
                     /function="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003465043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_003465043.1"
                     /translation="MTVESRIFSVAEYVQPSEGEPIRSVVLETRDSIIVVWHVHPGQE
                     IAAHIHPHGQDTWTVLSGMADYFQGNGIVRALREGEIAVARPGQVHGARNTGTEPFVF
                     VSVVASANAGFVLAER"
     gene            173813..>175846
                     /locus_tag="ECL_RS26810"
                     /old_locus_tag="ECL_A243"
                     /pseudo
     CDS             173813..>175846
                     /locus_tag="ECL_RS26810"
                     /old_locus_tag="ECL_A243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014834018.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3 family transposase"
     gene            175911..176615
                     /locus_tag="ECL_RS26815"
                     /old_locus_tag="ECL_A244"
     CDS             175911..176615
                     /locus_tag="ECL_RS26815"
                     /old_locus_tag="ECL_A244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005221000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS26 family transposase"
                     /protein_id="WP_001067858.1"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            complement(176747..177670)
                     /locus_tag="ECL_RS26820"
                     /old_locus_tag="ECL_A245"
     CDS             complement(176747..177670)
                     /locus_tag="ECL_RS26820"
                     /old_locus_tag="ECL_A245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000167917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_000167917.1"
                     /translation="MTKTKGLPRPLTHYAWLSIATAIATIGLKGVAWKMTGSVGLLSD
                     AIESVVNLAGALMALWMLTLAALPADENHAYGHGKAEYFSSAFEGFLILLAAASIAYT
                     AVERMLTPQPLEEIGLGLLVSTVASILNFVTARILLRAGRQHNSITLEADAHHLLTDV
                     WTSVGVIFGVGLVYLTGWFWVDPIVALLVAANIVWTGYQLMSRSAAGLMDVSLPTEEL
                     KKIESLLAGYREQGLDFHALRTRQAGGRAFMTMHILVPGRWTVQYGHDWAERIENDIR
                     TALPFIHITTHVEPLEDPASMNDQTLDISDH"
     gene            complement(177870..178442)
                     /locus_tag="ECL_RS26825"
                     /old_locus_tag="ECL_A246"
     CDS             complement(177870..178442)
                     /locus_tag="ECL_RS26825"
                     /old_locus_tag="ECL_A246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001515348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b/b6 domain-containing protein"
                     /protein_id="WP_001515348.1"
                     /translation="MKLRLWNLLPHDYAPFFRILHIIVAFLILSQIINSNLTETEAIG
                     EHSLEGVITWMHIISGLGLIICGFIMLSWMLTQRGFTYYFSWVGLDFSGIKQDIKTLT
                     SFRLPDAHSGGIASTIQGFGVLALLIVALSGGLWFLLNTMQSNLAETVIHWHKFFTTF
                     IEVYFYAHGAMGVLHILIEKYKSRSVNLSD"
     gene            complement(178865..179562)
                     /locus_tag="ECL_RS26830"
                     /pseudo
     CDS             complement(178865..179562)
                     /locus_tag="ECL_RS26830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            179761..180705
                     /locus_tag="ECL_RS26835"
                     /old_locus_tag="ECL_A250"
     CDS             179761..180705
                     /locus_tag="ECL_RS26835"
                     /old_locus_tag="ECL_A250"
                     /inference="COORDINATES: protein motif:HMM:NF027890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_013087251.1"
                     /translation="MVLSAGFILSHSSGPEILEGIVDTDEINITSKVTARVDSLHVRE
                     GDSIRNGQALVSLYDRQITENSLQAKEALAAAVASQEKAYNGERTEYIESLKANWISA
                     QADEKNIKLSTDRVVKLYDGSKAVSAQERDDAIARYKISRQKTNAAYEQYMQVKRGNR
                     AEDIRIADANVNSAKAAFESADSLVRELSVHSKNDGEIAKRFANPGELVSAGSPIFSM
                     IDLNNLWVTINLREDRFNALKIGDVIEGAIPALKYKNVKFRVFFINPKGNFATWRATR
                     QSSGYDVRTFEVRLHPMNKIEGMRPGMSVIFDWPFDND"
     gene            180773..182959
                     /locus_tag="ECL_RS26840"
                     /old_locus_tag="ECL_A251"
     CDS             180773..182959
                     /locus_tag="ECL_RS26840"
                     /old_locus_tag="ECL_A251"
                     /inference="COORDINATES: protein motif:HMM:NF024110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_158009095.1"
                     /translation="MKILLFIVPVFLLTFVIAIFSSGVPEKIPVALVDYDHSSLSREI
                     IKNIDASKSIELIETTDNISLAQRLMKSMKIYAFIEIPRGASGSTIRQDDNKVVIRYN
                     GQLRTTGNAAFIGLQAAVNDAFNSINNRKSLGVEHKGTGNSMPNIQVISISNPQNSYE
                     RFLTPIAVPVLLSIVLSSAVICAIGRFFEEGNLCDDWIKKKTIYLSVQIASRCLPYIT
                     IIFLWGLIFNVWQVVGRGWPILGNSWLLILAMFMLCLLTASIAIMFISITRNVLTALS
                     ISTVYASAALTYSDGTLSILNANGWAKFWSNFQPFTHYYRIQLEQVNLGSYITTSFSQ
                     FGILSLYIIIPLTISFIILARRNYSQQPVVFQENVKLDGVLQSFISTVKSIRKCQPIF
                     STAVMSLILYSVFYPSAYKAQINLKLPVAVVDFDQSSLSRNLIDNLQTTREIDVTQVD
                     SSLSDALILLRNRKVSAVIAIDNDFKKNLIRGENAGIDVHLSGGYMAVAADLRTAVTN
                     AINATTDVNRLTSKATNNIIPLPLYNPTLGYESFIMPLVFIIILQQTLIFTSSMLIAL
                     RNSIGLTKINSSQFIGTFFGLFMVGFFGAVFVFGWVYYLQGYPNEGSMFLQVLLIVLF
                     SAAVSSMGMLIGSFLDNINRPMQILSATSMVIFYASGASFPTFNMPEWVVKTMVIFPS
                     STMISGFTMLNSQGAGIYELAPVIIKISLLAIILFLLAMYRLVWQK"
     gene            complement(183039..>183287)
                     /gene="tnpA"
                     /locus_tag="ECL_RS26845"
                     /pseudo
     CDS             complement(183039..>183287)
                     /gene="tnpA"
                     /locus_tag="ECL_RS26845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017030086.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family transposase"
     gene            <183291..184173
                     /locus_tag="ECL_RS26850"
                     /pseudo
     CDS             <183291..184173
                     /locus_tag="ECL_RS26850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612086.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(184430..184543)
                     /locus_tag="ECL_RS26855"
                     /old_locus_tag="ECL_A254"
     CDS             complement(184430..184543)
                     /locus_tag="ECL_RS26855"
                     /old_locus_tag="ECL_A254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007772075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087254.1"
                     /translation="MHEPPVQSDRCALSGNYRLESNPERHDLTPLAAAIGN"
     gene            complement(184969..185991)
                     /locus_tag="ECL_RS26860"
                     /old_locus_tag="ECL_A256"
     CDS             complement(184969..185991)
                     /locus_tag="ECL_RS26860"
                     /old_locus_tag="ECL_A256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_001572362.1"
                     /translation="MTITTVGIDLAKNVFAVHCVDQHGKTVLVKPKVSRAALPELIAS
                     LPPCVIGMEACSGAHYWARLFRQYGHEPRLMAAKFVSPYRMAGKSGKNDAADAQAICE
                     AVRRPHMRFVPVKDESQQAMQCLHRIRQGFIEEKTATYNRLRGLISEFGVIAPQSTDA
                     LRHMVSEQKSSLPLQVQQCVNDLLEHIDRIEDNITEYDRILSRMAKTDHRSQRLMELK
                     GIGPTTACALVASIGNAHDFKNGRQLAAWLGLTPSQYSSGGKSKLGRITKAGDSYLRT
                     LLVQGARSVLIGAEKRTDLFSRWVCSLVDRRGYWRAVVAIAAKNARLCWASLHYGDDF
                     RLYSAS"
     gene            186275..186679
                     /locus_tag="ECL_RS26865"
     CDS             186275..186679
                     /locus_tag="ECL_RS26865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000044721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_077257771.1"
                     /translation="MSDLQTDPWKGALDTDRVFLSRRGNGLSRQQAYRIVREAGEKAG
                     MTIEINPKMLRHACGFGLAERGAGTCLIQDFLGHRNARHTKKYTESDDSPFIDLWQDT
                     WGGSDDKTKGCNESVDGEEPCEKGNSWGQTDT"
     gene            186960..187664
                     /locus_tag="ECL_RS26870"
                     /old_locus_tag="ECL_A259"
     CDS             186960..187664
                     /locus_tag="ECL_RS26870"
                     /old_locus_tag="ECL_A259"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005221000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS26 family transposase"
                     /protein_id="WP_001067855.1"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            187991..188491
                     /locus_tag="ECL_RS26875"
                     /old_locus_tag="ECL_A260"
     CDS             187991..188491
                     /locus_tag="ECL_RS26875"
                     /old_locus_tag="ECL_A260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002462980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-heme ferritin-like protein"
                     /protein_id="WP_001752509.1"
                     /translation="MIASGIVQKLNAQMNQEFYTSNLYLQLSQRCSENSLNGTALFLR
                     HQAQNTVTQMMRMYEYIKQSGATPVLQEQHARCGEFSTLEDLFEQTVSDYQKRINALT
                     SLTEDAQAANDKSAINFLKRYRKEEIVDGTLLQIILDEVRSAKKAGINMQQTDHYLVG
                     VIDRYH"
     gene            complement(188527..>189582)
                     /locus_tag="ECL_RS26880"
                     /old_locus_tag="ECL_A261"
                     /pseudo
     CDS             complement(188527..>189582)
                     /locus_tag="ECL_RS26880"
                     /old_locus_tag="ECL_A261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012817690.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(189635..190339)
                     /locus_tag="ECL_RS26885"
                     /old_locus_tag="ECL_A262"
     CDS             complement(189635..190339)
                     /locus_tag="ECL_RS26885"
                     /old_locus_tag="ECL_A262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005221000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS26 family transposase"
                     /protein_id="WP_001067855.1"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            190533..>191123
                     /locus_tag="ECL_RS26890"
                     /old_locus_tag="ECL_A264"
                     /pseudo
     CDS             190533..>191123
                     /locus_tag="ECL_RS26890"
                     /old_locus_tag="ECL_A264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008786710.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system ImpA family N-terminal
                     domain-containing protein"
     gene            191216..192423
                     /locus_tag="ECL_RS26895"
     CDS             join(191216..191537,191537..192423)
                     /locus_tag="ECL_RS26895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611134.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_087776199.1"
                     /translation="MTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSHVARLHGIQP
                     SLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEVEILKEAV
                     EYGQSPKMDSARALVAKGRGIAMVSRTMGVSRAQLSLRINRSADWQDRRCNRRNEEAD
                     AEILSAILNIISDMPSYGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLLLLHHK
                     PERPKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAASTGG
                     YDSSTVQDVMLRSVEKRFGDRLPDTAVQWLTDNGSAYTAHETRRFAKELNLEPCTTAV
                     SSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAAAFTHYNENHPHSALGYHSPR
                     EYRRQRASLT"
     gene            <192457..193230
                     /locus_tag="ECL_RS26900"
                     /old_locus_tag="ECL_A268"
                     /pseudo
     CDS             <192457..193230
                     /locus_tag="ECL_RS26900"
                     /old_locus_tag="ECL_A268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008786710.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ImpA domain-containing protein"
     gene            193510..194657
                     /locus_tag="ECL_RS26905"
                     /old_locus_tag="ECL_A270"
     CDS             join(193510..193747,193747..194657)
                     /locus_tag="ECL_RS26905"
                     /old_locus_tag="ECL_A270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612015.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_139153290.1"
                     /translation="MSGKRYPEEFKTEAVKQVVDRGYSVSSVATRLDITTHSLYAWIK
                     KYGPDSSTNKEQSDAQAEIRRLQKELKRVTDERDIFKKSRGVLRKAVRLRYAFIRDNS
                     CCWPVRLLCRVLDVHPSGFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGYRKIH
                     LDLRDSGQQCGVNRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNPDAPD
                     ERWVTDITYIRTHEGWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWRRNPE
                     KQVLVHSDQGSQYTSHEWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKKK
                     IYGTREEARSDIFDYIEMFYNSKRRHGSSEQMSPTEYENQYYQRLGSV"
     gene            194756..195274
                     /locus_tag="ECL_RS26910"
                     /old_locus_tag="ECL_A271"
     CDS             194756..195274
                     /locus_tag="ECL_RS26910"
                     /old_locus_tag="ECL_A271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008786709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2913 family protein"
                     /protein_id="WP_164928071.1"
                     /translation="MFIMQWLSTAQKRKVFPKSLAPDIIWLQEQGKLKGPSARLYSKV
                     EYIWLASSGELANQSTLFRFTCMIDTLRSMGWQDHLLSDTEWQDGWKCGTDVSAVYTQ
                     KSQLHSSFTESGNLILPLEVRVTGVPDGIFPLLEQCGLKTEKLPVSMGYTVLILQPEI
                     DLSSVKQDIVEY"
     gene            195408..196238
                     /locus_tag="ECL_RS26915"
                     /old_locus_tag="ECL_A272"
     CDS             195408..196238
                     /locus_tag="ECL_RS26915"
                     /old_locus_tag="ECL_A272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008786708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_100135202.1"
                     /translation="MTEDMQPRSIETKFRKLLGTVNPHLILIDVAVKELLCKDESGRI
                     NINRIEDVTKKHKNAKLKVAHLEIYKTSLYVTQSHIAFIYSCLESFLKDYISLSKKIY
                     SDERSFNIDNVDILRRAIHHAHVNKINGKITHPKLNHNELSIYIDELDLKLLDYFRLV
                     RNINAHSRENTNLWEEMFSESDLIKMSKKYKHEVNKEAELTIRDVILYSQVCQQVAHH
                     ICQKMLDIEKIAKSLCIKYKHLTGPRKDNAITKTLINNYLQDKDEVDRLRNAFNGWLA
                     "
     gene            196224..196350
                     /locus_tag="ECL_RS26920"
     tRNA            196224..196350
                     /locus_tag="ECL_RS26920"
                     /product="tRNA-OTHER"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
     gene            196986..197804
                     /locus_tag="ECL_RS26925"
                     /old_locus_tag="ECL_A274"
     CDS             196986..197804
                     /locus_tag="ECL_RS26925"
                     /old_locus_tag="ECL_A274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection family protein"
                     /protein_id="WP_013087268.1"
                     /translation="MNNKIPNNVIGAVSSVLGEHYFSHSTLNSLFMESGAPGEVPPGN
                     CETKCSNWLKACNEDDSVDAISVLGIIIQKYMDLPPNSFSRAGAGSTVESGQKRIIDA
                     LSKNQLVYRLNGFITKSGSTPISKTLEDYLKSGDYSSIENEFLRAVENIQTDPHASVT
                     AACAIIESALKCYIEKFNLPMPQKLNVAPLWAVVQPDLDLNSDPTLAGDQHKILKGIS
                     SLIDGIGAFRSHIGSAHGRGQNPPQIVVAEARLAVNASHTLVVFIMDVIHASKF"
     gene            complement(198171..198656)
                     /locus_tag="ECL_RS26930"
                     /old_locus_tag="ECL_A275"
     CDS             complement(198171..198656)
                     /locus_tag="ECL_RS26930"
                     /old_locus_tag="ECL_A275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013087269.1"
                     /translation="MGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAAR
                     TFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNMPDPIPVIILARLAVDVSYRGQG
                     LGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
                     Q"
     gene            complement(198644..198910)
                     /locus_tag="ECL_RS26935"
                     /old_locus_tag="ECL_A276"
     CDS             complement(198644..198910)
                     /locus_tag="ECL_RS26935"
                     /old_locus_tag="ECL_A276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004213599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1778 domain-containing protein"
                     /protein_id="WP_007869691.1"
                     /translation="MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACQAAEN
                     VILDRRVFNFNDEQYAEFIDMLDAPVSDEAAIDKLLARKPQWDV"
CONTIG      join(CP001919.1:1..199562)
//
DBGET integrated database retrieval system