GenomeNet

Database: RefSeq
Entry: NC_014137
LinkDB: NC_014137
Original site: NC_014137 
LOCUS       NC_014137               9505 bp ss-RNA     linear   VRL 13-AUG-2018
DEFINITION  Slow bee paralysis virus, complete genome.
ACCESSION   NC_014137
VERSION     NC_014137.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Slow bee paralysis virus
  ORGANISM  Slow bee paralysis virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Picornavirales; Iflaviridae; Iflavirus.
REFERENCE   1  (bases 1 to 9505)
  AUTHORS   de Miranda,J.R., Dainat,B., Locke,B., Cordoni,G., Berthoud,H.,
            Gauthier,L., Neumann,P., Budge,G.E., Ball,B.V. and Stoltz,D.B.
  TITLE     Genetic characterization of slow bee paralysis virus of the
            honeybee (Apis mellifera L.)
  JOURNAL   J. Gen. Virol. 91 (PT 10), 2524-2530 (2010)
   PUBMED   20519455
REFERENCE   2  (bases 1 to 9505)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-MAY-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 9505)
  AUTHORS   de Miranda,J.R., Ball,B.V., Stoltz,D.B. and Paxton,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JUL-2007) Biological Sciences, Queens University
            Belfast, 97 Lisburn Road, Belfast, Antrim BT9 7BL, Northern Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to EU035616.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9505
                     /organism="Slow bee paralysis virus"
                     /mol_type="genomic RNA"
                     /strain="Rothamsted"
                     /db_xref="taxon:458132"
                     /country="United Kingdom"
                     /collection_date="1986"
                     /type="major"
     5'UTR           <1..316
     gene            317..9211
                     /locus_tag="HBSPV_gp1"
                     /db_xref="GeneID:9121914"
     CDS             317..9211
                     /locus_tag="HBSPV_gp1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="YP_003622540.1"
                     /db_xref="GeneID:9121914"
                     /translation="MEHTPLLSSFPITLLDHCGGNRKIHWTRCYEQKYWLPFSCCKVA
                     SRLPCVNVRRSYMWYSKKQSKWIYLSESDFRACKAGIYKRREEQEKEKLWSELCDICS
                     WECFEYYKFRDQRLLLLLRKKIADKAQCRCRTNCKLVTIKHGYVRRVKTIEPCEAIEL
                     TNAETFGSNLDFAQPEMDRPEGSEERTVQTSNVVLGETNIESQDIASKEYSPTWDRLA
                     SSEVSDEYPMLTDRWLFWKSVKWEVNDSAFGKMLVQEKFPQSWVQMDVNVNNIPRYTN
                     IPNFIPFNIHQYMRADFEVKIYVNPNDFVSGWLIMAFLYQGSEMFDYKLRRNPAALMQ
                     MPHVLVNVGAANEATLKIPYRYVRPFMRCKDILRGDNLITGVTEPLNMGVLFVEVLIP
                     FRTSAASSAPKSLDVSLFVKMTNAKFTGMVDGSIALLSKPIALPEMDRILDNGLGVVS
                     KLLKDVNCDNPPDPTPAKFFVPIPSHSWAHGTNTSEPTNTLRLDGGVVGVGRSDDIGT
                     SDTAISGIIGVYGLLKPFDWNANDTGRNVGGHLLWSMPVHPQVDKDQVIQVMTQSKLT
                     QYYLPPISVVSSLYAYTRGSIKYKFLFGNNPRHNARLLVAYIPGISSDNRLTLERARN
                     SAHVVFSLNEVSEFVFTVPYITDTMWWPRKYGGPQAAGEFVAPSYICMFILNPLVAME
                     SVPSIVTIVPMIAAGDDFEVAVPAQPAVGLSRNIDVIYPKDSIISFKSGYFPVYVGSW
                     HSFFDSTKAILRYGAVSDHIAQLGNIPANVNRKAFWIVVGDTIKFKTKLDKINGTEWF
                     IPEGEYTLGYGVVWRDGAYAYMVPYPLTPLGEKIAQYTASLLASNTAISQIRPYIPDY
                     IVDSAASKDNILWSPIEDRLRAQTEWVMAEPEMERTFTPNVMQPTPLLPTTNDGRVTF
                     GEAFNDLKDLARRYQLYWEGTILEGNLRAIRRNSALVQLPLYPHGLRIQPDVNNPIWN
                     IMRDGHIPVISSGFRYFRGGLRLRIVVEGLNSCVWVQHHPDRPSIFSRPIIGRYIAAK
                     DAYRNHAYAAYVQNMSVNRTIEVEVPFYQPGLYGMLNASDNNTANSFDRLRFTGLGDL
                     LIGIEGEQPIPKEGIEISVYYSIADDFSFNIFCGFPPMVYCDETYSAATPDLAQYFED
                     EVTIAQPEMMMSMCQGFVGSLIGHHLQRATTYGIESAKESIRDVVKDEFKTQIKPELD
                     NLNKVIGEAANSIGASFGDILPQQLIINAMGQLMQVFSNPSPVALAIAIVTFIGSIVT
                     LSMELVSTLSDSLRIFLEKVWYRYFHQATEQQAAGASAMPEGFWDEADDKSLHGILGM
                     IFSAICVSLGLSMAPPKQFPSVMKGVKESLNTANASVTFFRNVVDAIKYMYTYCMGAS
                     DEEMRARIIIEREYPNLKHWCEEVIQLLDPRSRNIVEHDARQASRVFDACIYGAQILQ
                     ENLDKSMPGGKVIYDLYTRIVKLRDDLIELGNHPDVRFEAFPVWIVGSAGIGKSYNTT
                     ELCKRALQSINYRTKESMIYWLALGQKYWNGIRNPPVVARDEAYAVSGQFTEEEISVH
                     LAMCSSCILNPPMAALSEKNKRINPLIYYMNANCAFPSIPEARHIGAIYRRRKILAEF
                     DFTEEIKRTYPNVLDASELPPNARINNNHLRIRVAHDPKNVNTTWSEWMSFDEFSNHF
                     CRKFQEHMEAERVNFRRRMDAAYALDPDYVPGSNLNYVGDYELPLQTLHERYIYEREL
                     AREYLANIENPVNEIEEDGGFWSNVKRLYENLTTGAADTEMDVPGPSTPSEPPSKRVL
                     RQFLVDHCKFKEDAAALLTRGLGVCSEQDVRTFALPPEYQFMKDREFVSAASIYCDTM
                     SCLPNSVCCSYRRIGSAMNPRSKIGSNWFVLPKNYEDLGGKDAIRSYCYWWIRCYQLR
                     SFKKILKKENYVEWADRMLHLIGCEPVNNYEVELRRQLWKIRGASESEIIDMLKELDA
                     EARAHNMSDLMAGKELPRITLMWLLTDLTDNDTSVFCDHCKVFATYMRDLSVLEYVPR
                     YGIIRYPGNFGCMKTIPAECQCEDSIFNNVLFKNAMRILWDHDHVGPEFTEFQDSQTN
                     PFVMQEHNNLRNETRSLLSRIWDWAKDWWKTTVVPFVGAILTFLYEHWAKILSIILGC
                     VVLYATFTSAKSPTDACMAAAKVSVPVMAGAVGTWSSPEGSVYQAGERVFKASNAPKP
                     ANRESVSDQMHITEQKVINNTCFIICKWQDGKDTKFLRARCLAIKGRDIIVIKHYLQE
                     FKSRPNPTYMFSYKINNSMANTYIDSSIIDNAYIYKINNSSAFSNIALIKLPKHVPMF
                     KDISKSIVTQGDHANVGHFCSIVSQQYDEHPVVRSQVPVTWKQHLVIAGDRHVEQIIM
                     DKCYEYNVRGFGMCGSALVSPGVCCGNGGVIGLHVAGEKGSGFSEPIFREMFEPVIEK
                     SDPVVSLPNLRSVSESNVQLDHNLILYGCVDEKMSHKESGKSKIIPSLVHGEIYPVAT
                     EPNPLRPGDPRQPPGSHPLRDGCAKHGLGMVHPFPQEDLEQVNNDARNVLLNEVKNPL
                     CEMRLLTLQEQVCGSTSIPHCESVNWNSSEGFPLCNRRPAGVTGKKWLFDMDETAEGY
                     VLKNIDPQLALMLKTNKDLRNRNIVCPPIYIDCLKDYRLPPEKCCIPGKTRIFSIAPI
                     QTTLEIREYMGLFLSGYKSATVMGQHGIGINPDSYDWTRLANYLHEVGDNIVTGDYAN
                     FGPCVSSQIVYSCIDDIIYWHKINGATEDHCRHLELLLKYSILLPLHLCDNCVYQSLN
                     GIASGSPITAELNSEVGKKYIKLAFLGICRQLNYKYSLNDFNKHCRVVVYGDDLILSV
                     SDAFVSWFNLQSISEYLDNYGIRLTDVTKDGTIVKYRPLADSSFLKRSFKPHPSRSGI
                     YLAPIEPRSYQECTNWCHKQNDEIEATVEVLRASCVLAYGRGPDEYNNHVNKIRRVCA
                     LKGLRFDPLTWAALDKENFG"
     misc_feature    <1172..1591
                     /locus_tag="HBSPV_gp1"
                     /note="Picornavirus capsid protein domain_like.
                     Picornaviruses are non-enveloped plus-strand ssRNA animal
                     viruses with icosahedral capsids composed of 60 copies
                     each of 4 virus encoded proteins; alignment includes
                     picornaviridae, like poliovirus, hepatitis A...; Region:
                     rhv_like; cd00205"
                     /db_xref="CDD:119412"
     misc_feature    order(1193..1195,1199..1201,1205..1207,1253..1255,
                     1328..1330,1397..1399,1460..1462,1547..1549)
                     /locus_tag="HBSPV_gp1"
                     /note="drug-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:119412"
     misc_feature    1985..2440
                     /locus_tag="HBSPV_gp1"
                     /note="Picornavirus capsid protein domain_like.
                     Picornaviruses are non-enveloped plus-strand ssRNA animal
                     viruses with icosahedral capsids composed of 60 copies
                     each of 4 virus encoded proteins; alignment includes
                     picornaviridae, like poliovirus, hepatitis A...; Region:
                     rhv_like; cd00205"
                     /db_xref="CDD:119412"
     misc_feature    order(1997..1999,2075..2077,2081..2083,2087..2089,
                     2135..2137,2198..2200,2267..2269,2306..2308,2396..2398)
                     /locus_tag="HBSPV_gp1"
                     /note="drug-binding pocket [chemical binding]; other site"
                     /db_xref="CDD:119412"
     misc_feature    3053..3703
                     /locus_tag="HBSPV_gp1"
                     /note="CRPV capsid protein like; Region: CRPV_capsid;
                     pfam08762"
                     /db_xref="CDD:255023"
     misc_feature    4751..5074
                     /locus_tag="HBSPV_gp1"
                     /note="RNA helicase; Region: RNA_helicase; pfam00910"
                     /db_xref="CDD:279280"
     misc_feature    8153..9025
                     /locus_tag="HBSPV_gp1"
                     /note="RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp)
                     is an essential protein encoded in the genomes of all RNA
                     containing viruses with no DNA stage. RdRp catalyzes
                     synthesis of the RNA strand complementary to a given RNA
                     template. RdRps of many viruses are...; Region:
                     RNA_dep_RNAP; cd01699"
                     /db_xref="CDD:238843"
     misc_feature    order(8441..8458,8636..8641,8774..8776,8780..8785,
                     8933..8938)
                     /locus_tag="HBSPV_gp1"
                     /note="active site"
                     /db_xref="CDD:238843"
     misc_feature    order(8441..8446,8780..8785)
                     /locus_tag="HBSPV_gp1"
                     /note="metal ion binding site [ion binding]; other site"
                     /db_xref="CDD:238843"
     misc_feature    8639..8641
                     /locus_tag="HBSPV_gp1"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238843"
     3'UTR           9212..9505
ORIGIN      
        1 ttcatcgagc gtgtttagtg cggtgagtct ttgagcctga gaaactcaag gacttacgtg
       61 tacccagttg cccggttata gttatattat tgcttaagtg cttactactc tagcaggtgg
      121 actagtaaga attggagatc acgacctagt atatagggat gttagccaaa cattatctcc
      181 tagcctgtcg atctagcgat ctaggatttt aaatattaat acaattctca gctttttctc
      241 aattttctca tattttctca atttctcaac tctcttttgt acttactcat ttcttgttat
      301 atttaatttt gaaaagatgg aacatacacc attgttgagt tcttttccta ttacattgct
      361 tgatcattgt ggaggtaacc gtaaaataca ttggacaaga tgttatgaac aaaaatattg
      421 gttacctttt agctgttgta aagtagcttc acgtttgcct tgtgttaatg tgcgaagatc
      481 gtatatgtgg tattcgaaga agcaaagtaa atggatatat ctctctgagt cagattttag
      541 agcttgtaag gcaggtatat ataaacgtag ggaagaacaa gagaaagaaa aattgtggag
      601 tgaattatgt gatatttgct cctgggagtg ttttgaatat tataagttta gagatcaacg
      661 tctgcttttg ttattgagaa aaaagatagc tgataaagct caatgtcgat gtcgtactaa
      721 ttgtaaatta gtaacaatta aacatggtta tgttcgaaga gttaagacta tagaaccttg
      781 tgaagctata gaattgacga atgctgagac ttttggtagt aatcttgatt ttgctcagcc
      841 agagatggat agacctgaag gttctgaaga aagaactgtt cagacatcca atgtagtact
      901 tggtgaaact aatatagaaa gtcaagatat tgcatcgaag gaatattcgc caacttggga
      961 tagattagcg tctagtgaag tgagtgatga gtatccgatg ctaactgacc gatggctatt
     1021 ctggaaaagc gtgaagtggg aagtaaatga ttctgcattt ggtaagatgc ttgttcaaga
     1081 aaagtttcca cagagttggg tgcaaatgga cgttaatgtt aataatattc cacgttatac
     1141 taatattcca aattttatac catttaatat acaccagtat atgcgagcag attttgaggt
     1201 aaagatatac gtgaatccca atgattttgt ttcaggatgg ttgataatgg cctttcttta
     1261 tcaaggatcc gagatgtttg attataaact acgtcgtaat cctgccgctc taatgcagat
     1321 gcctcatgtt ttggttaatg taggcgctgc taatgaagca actcttaaaa taccatatag
     1381 atatgttcga ccttttatgc ggtgtaaaga tattttaagg ggtgataatt tgatcactgg
     1441 tgtaacagaa ccattaaata tgggcgtctt atttgtcgaa gtacttatac cttttaggac
     1501 tagtgcagct tcaagcgctc ctaagagttt ggatgttagc ctgtttgtta aaatgaccaa
     1561 tgctaagttt actggaatgg ttgatggtag tattgctctt ttatctaaac ctatagcgtt
     1621 gcctgagatg gatagaatct tagacaacgg attgggtgtt gttagtaaat tattgaaaga
     1681 cgttaattgt gacaatcccc cagatccgac tccagctaag ttctttgttc ctataccttc
     1741 acattcatgg gctcatggaa caaacacgtc agaacctacc aacacattac gtttggatgg
     1801 aggagttgta ggtgtcggta ggagtgatga tataggaact tctgatactg cgattagtgg
     1861 tattattggt gtatatggat tattaaaacc ttttgactgg aatgctaatg atactggtcg
     1921 caatgtaggg ggtcacttgt tgtggagtat gcccgttcat ccacaagtgg ataaagatca
     1981 ggtaatacaa gttatgactc aatcaaaatt aacacaatat tacttaccac ctataagtgt
     2041 tgtttcaagt ctgtatgcat atactcgtgg ttctatcaag tataaatttt tatttggaaa
     2101 taacccaagg cataatgccc gcttactggt tgcatacatt cctggtatat catctgataa
     2161 caggttgacg ttagaaaggg ctagaaatag tgctcacgta gtattttcgt tgaatgaggt
     2221 gagtgaattt gtttttacag ttccatatat tacagataca atgtggtggc cacgtaaata
     2281 tggtggacca caggcagcgg gagaatttgt agccccaagc tatatatgta tgtttatttt
     2341 gaatccatta gtagcaatgg agtcagtgcc tagtattgta acaatagtac ctatgattgc
     2401 ggcaggagat gactttgagg ttgcagttcc agcacaacct gctgtgggtt taagcaggaa
     2461 tattgatgtt atatacccaa aagattctat aatttctttc aaatcgggat attttccggt
     2521 gtatgtgggc agttggcata gtttctttga ttcaactaaa gcgatattgc ggtatggagc
     2581 agtatcagat catattgctc agcttggaaa tattccagct aatgttaatc gtaaagcttt
     2641 ctggatcgta gtaggcgaca ctattaagtt caaaactaag ttagataaaa taaatggtac
     2701 tgaatggttt ataccagaag gcgagtatac tttagggtat ggtgttgtat ggagagatgg
     2761 agcatatgca tatatggttc cttatccact tactccatta ggtgagaaga tagcgcagta
     2821 tactgctagc ttgttggctt cgaatactgc aatatctcaa attcgcccat atataccgga
     2881 ttatattgtc gatagtgctg ctagtaagga taatatacta tggtcaccta tagaagatag
     2941 attaagagct caaacggagt gggttatggc agagcctgaa atggagcgaa cttttacacc
     3001 taatgttatg caacctaccc cactcctccc gaccactaat gatggtcgag taacttttgg
     3061 agaagctttt aatgatttaa aagatttggc cagaagatac caattgtatt gggaagggac
     3121 tattttagaa ggcaatttac gtgctattag gagaaatagc gctttagttc aattgcctct
     3181 ctatccccat ggattaagaa tacagcctga cgttaataat ccaatatgga atattatgcg
     3241 tgatggtcat attcctgtta tttcaagtgg attcaggtat tttagaggag gattacgact
     3301 ccgcatagtt gttgaaggtc ttaatagctg tgtttgggtg caacatcatc ctgatagacc
     3361 tagtatattt tcacgtccta taattggccg atatattgcg gcgaaggatg catatcgaaa
     3421 tcacgcttat gcagcttatg tacagaacat gagcgtcaat cgtactattg aagttgaggt
     3481 gcccttttat cagcctggct tatatggcat gttaaatgca agtgataata atactgcaaa
     3541 tagttttgat cgtttgcgat tcacaggttt gggtgatttg ctgataggta ttgaaggaga
     3601 acagcctatt ccgaaggaag gtattgaaat atcagtatat tattcaatcg ctgatgattt
     3661 ttcttttaat atcttttgcg gctttcctcc catggtgtat tgtgatgaaa cttattcagc
     3721 agcaactccg gatttggccc agtattttga ggatgaagtt acaatagcgc agcctgaaat
     3781 gatgatgtct atgtgtcaag gcttcgttgg gtcattgatt ggtcatcact tgcagagggc
     3841 gacaacatat ggtattgaga gtgctaaaga gagtattagg gatgtagtta aggatgaatt
     3901 taaaactcaa attaaaccag aacttgataa tttgaataaa gttataggtg aggctgctaa
     3961 ttcaatagga gcatcatttg gtgatatatt accacagcaa ttgataataa atgctatggg
     4021 acaactgatg caagtatttt cgaatccatc ccctgttgct ctagctatag caattgtcac
     4081 gtttataggt tctatcgtga cattgtctat ggagcttgtc tcgactctgt cggattcatt
     4141 acgaatattt ctagaaaaag tttggtatag atactttcac caagcgaccg aacagcaagc
     4201 agctggtgcg agcgctatgc cagagggttt ttgggatgaa gcagatgata aaagtttaca
     4261 tggtatttta gggatgattt tctcagcaat atgtgtttca ttaggtttat ccatggctcc
     4321 cccaaaacaa tttccaagcg ttatgaaggg tgttaaagag agtttgaata ctgctaatgc
     4381 cagtgttaca ttctttcgga atgttgttga tgcaataaaa tatatgtaca catattgcat
     4441 gggtgcgtca gatgaagaga tgcgagcacg aataattata gaaagagaat atcccaattt
     4501 aaaacattgg tgtgaagaag ttattcaatt gctggatcct cgcagtcgaa atatagttga
     4561 gcatgatgca cgtcaggcta gtagagtttt tgatgcatgt atttatggag cacaaatttt
     4621 gcaggaaaat ttggataaga gtatgccagg gggtaaagtt atatatgatc tttatacccg
     4681 tatagtcaaa ttgagagatg atttaataga gttaggcaat catccagatg tacgttttga
     4741 agcatttcct gtctggatag ttggaagtgc aggcatagga aaatcgtata atactactga
     4801 gttatgtaag agagctttgc aatctattaa ctatagaact aaggagtcta tgatttattg
     4861 gttagcttta gggcagaaat attggaatgg catccgtaat ccaccagtag ttgctcgtga
     4921 tgaggcatat gctgtatctg gtcaatttac tgaagaggaa atttcagtgc atttggctat
     4981 gtgtagtagt tgtatattga atcctccgat ggctgctttg agcgaaaaga ataagagaat
     5041 taatcctctt atttattata tgaatgctaa ttgtgctttt ccaagtattc ctgaagccag
     5101 acatattgga gctatatacc ggagacggaa aatattagcc gagttcgact ttactgagga
     5161 gattaagcga acatacccta atgttcttga tgctagtgag ttaccaccta atgctagaat
     5221 taataataat catcttcgta ttcgtgtggc acacgatcct aaaaatgtta atacaacatg
     5281 gtctgaatgg atgtcttttg atgagtttag taatcatttt tgtcgaaaat ttcaggaaca
     5341 catggaagca gagagagtta attttaggcg aaggatggat gccgcctatg ccctcgatcc
     5401 cgattatgtc ccaggtagta atcttaatta tgtaggtgat tatgagttgc ctttgcagac
     5461 tttgcatgaa aggtatatat atgaacgaga actagctagg gagtatttgg ctaatataga
     5521 gaatcccgtt aacgaaattg aagaggatgg agggttctgg tccaatgtta agaggcttta
     5581 tgaaaacctc actactggag cagctgatac cgagatggat gttcctggac ctagtacacc
     5641 tagtgaacca ccgtccaaga gagttttgcg tcaatttttg gttgaccatt gtaagtttaa
     5701 ggaagatgca gcagctttgc tgacgcgtgg tttaggcgtt tgcagcgagc aagacgttag
     5761 aacttttgca ttgccaccgg aatatcaatt tatgaaagat agagagtttg taagtgctgc
     5821 atctatatat tgtgacacaa tgtcgtgttt gcctaacagc gtgtgttgtt cttatagacg
     5881 aataggtagt gctatgaatc ctcgcagtaa aattggatct aattggtttg ttttaccaaa
     5941 gaattatgag gatttaggtg gaaaagatgc tataagatca tattgttatt ggtggattcg
     6001 gtgttatcaa cttcgctcct tcaagaagat tttaaagaaa gaaaattatg ttgagtgggc
     6061 tgataggatg ttacatctta ttggttgtga acctgttaac aactacgaag ttgaattgcg
     6121 aagacagttg tggaagatta gaggtgcatc agaatctgag ataattgata tgctaaaaga
     6181 gttggatgct gaagctagag ctcataatat gagcgattta atggctggta aggagcttcc
     6241 acgcataaca ttgatgtggt tgttaacgga tttaacagat aatgatacga gtgtgttttg
     6301 cgaccactgt aaagtattcg ctacctatat gcgagatctg agcgttttag agtacgtacc
     6361 tagatatggt ataataagat atccaggtaa ttttggatgc atgaagacga ttccagctga
     6421 gtgtcagtgt gaagatagta tatttaataa tgtcttattt aagaatgcta tgagaatttt
     6481 atgggatcat gatcatgttg gacccgaatt tactgagttt caggacagcc aaacaaatcc
     6541 atttgttatg caggaacata ataatttgcg taatgaaacc agatcactat tgtcacgtat
     6601 atgggattgg gctaaggatt ggtggaaaac tactgttgta ccctttgtag gggctatatt
     6661 aacgttttta tatgaacatt gggcaaaaat tttaagtatt atattgggat gtgtagtgtt
     6721 atatgctaca tttactagtg caaagagccc aacagatgct tgtatggctg cggcaaaggt
     6781 ctcagtgcca gtgatggctg gcgccgttgg tacatggtca agtcctgagg gcagtgttta
     6841 tcaagctggg gagagagttt ttaaagcttc aaatgcccca aagcctgcta atagggaaag
     6901 tgtgtcagat caaatgcata taacagaaca aaaggttatt aataacacat gtttcataat
     6961 ttgtaagtgg caggatggta aagatactaa atttttacgt gcgcgctgtt tagctataaa
     7021 aggccgagat attatagtta taaagcatta tttgcaagaa tttaagtctc gtccaaatcc
     7081 cacgtatatg ttttcatata agataaataa ctcaatggca aatacgtata tagacagtag
     7141 tattatagat aatgcgtata tttataaaat taataattct tctgcattta gtaatatagc
     7201 attaattaag ttaccgaaac atgtgcctat gtttaaggat attagcaaga gtattgttac
     7261 gcagggtgat catgctaatg tcggccattt ctgttctata gtatcacaac aatatgatga
     7321 gcatccagtt gttcgttctc aggtacctgt tacatggaaa cagcatttgg ttatagctgg
     7381 tgatcgccat gttgaacaga taataatgga taaatgttat gaatataacg tgcgagggtt
     7441 tggcatgtgc gggagtgcgc tcgttagtcc gggtgtttgc tgtggaaacg gcggcgttat
     7501 agggctgcat gttgctggtg aaaagggtag cggttttagt gaaccaatat ttagagaaat
     7561 gtttgaacca gttattgaaa agtctgatcc cgttgtaagt ctccctaatt tacgatcagt
     7621 ttctgagtct aatgttcagc tagatcacaa tttgattttg tatggttgtg tagatgaaaa
     7681 gatgagccat aaggaaagtg gtaagtctaa gatcatacct agtttggttc atggagagat
     7741 ttatcctgtc gctactgagc ctaatccatt gcgtccaggg gatccacgtc aaccaccagg
     7801 atcgcatccc cttagagatg gttgtgcgaa acatggacta ggcatggttc atccatttcc
     7861 tcaagaagat ttggaacaag tcaataatga tgctcggaat gttttactca atgaagttaa
     7921 gaatccattg tgtgaaatga gattgcttac tctccaagag caagtatgcg ggtcaactag
     7981 cattcctcat tgtgagagtg taaattggaa tagtagtgaa ggttttccat tatgtaaccg
     8041 tagaccagct ggagttacag gtaagaaatg gttatttgat atggacgaaa cagctgaagg
     8101 atatgtttta aagaatatag atccgcaatt agctttgatg cttaaaacta ataaagattt
     8161 gcggaatcgt aatattgttt gtcctcctat ttacattgat tgtttaaaag actatcgctt
     8221 gccacctgag aagtgctgca ttccaggtaa aactcgtata ttctctattg ctcctataca
     8281 aactacttta gagattcgtg agtatatggg cttattttta agtggttaca aatcagctac
     8341 agttatgggt cagcatggca taggtattaa tcctgatagc tatgattgga ctcggcttgc
     8401 taattacctg catgaggtgg gagacaacat tgtaactggg gattatgcaa attttggtcc
     8461 ttgtgttagt tcacagatcg tttatagttg tattgacgat ataatatact ggcacaagat
     8521 taatggagcc acagaagatc attgccgtca tcttgaacta cttttgaaat atagtatatt
     8581 gttacctttg cacttgtgcg ataattgcgt gtatcaatca ttaaatggta ttgcttcagg
     8641 tagtcccatt acagcagaat tgaatagcga agtgggtaag aaatatataa aattagcatt
     8701 tcttggtatc tgtaggcaat taaattataa gtatagctta aatgatttta acaagcattg
     8761 tagagtagta gtatatggtg acgacttaat tttaagtgtt agcgatgcat ttgtgtcctg
     8821 gtttaattta caatctatat cagagtactt agataattat ggtataagat taactgatgt
     8881 tacgaaagac ggcactattg ttaaatatag accgttagca gactcgtctt ttctgaaaag
     8941 gagttttaaa ccacatccta gtcgaagtgg tatttattta gctcctattg aaccccgaag
     9001 ttaccaggag tgtactaact ggtgtcataa acagaatgac gagatagaag ccacagtaga
     9061 agtattacgc gcttcttgtg ttttggctta tgggcgtggg cctgatgaat ataataatca
     9121 tgtaaataaa attcgtcgtg tttgcgcttt gaagggatta aggtttgacc cattaacatg
     9181 ggctgcttta gataaggaaa attttggtta gtagtagata gtacctacta ttagaataag
     9241 tcatagtata tgagagtatg atgtaatttg atactcataa gtgattggtg agcactatgg
     9301 tttatcatga gctatacaat aagtcctact agttaaggga ttgtatagaa ttcactctga
     9361 taacataatc taacagagtc actttagtta tattatatag gtttattcgt tttaaaagta
     9421 taggatatat caccactagt tgcgtagcta gtgcttactt ttgtctataa gaattttgtg
     9481 ataaaaaaaa aaaaaaaaaa aaaaa
//
DBGET integrated database retrieval system