GenomeNet

Database: RefSeq
Entry: NC_014517
LinkDB: NC_014517
Original site: NC_014517 
LOCUS       NC_014517               1242 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus D chicken/05V0049/DEU/2005 segment 7, complete genome.
ACCESSION   NC_014517
VERSION     NC_014517.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus D chicken/05V0049/DEU/2005
  ORGANISM  Rotavirus D chicken/05V0049/DEU/2005
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            D.
REFERENCE   1  (bases 1 to 1242)
  AUTHORS   Trojnar,E., Otto,P., Roth,B., Reetz,J. and Johne,R.
  TITLE     The genome segments of a group D rotavirus possess group A-like
            conserved termini but encode group-specific proteins
  JOURNAL   J. Virol. 84 (19), 10254-10265 (2010)
   PUBMED   20631147
REFERENCE   2  (bases 1 to 1242)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-SEP-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1242)
  AUTHORS   Trojnar,E., Otto,P., Roth,B., Reetz,J. and Johne,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-FEB-2010) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diederdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence is identical to
            GU733449.
            GenBank Accession Numbers GU733443-GU733453 represent the complete
            genome of Rotavirus D strain 05V0049.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1242
                     /organism="Rotavirus D chicken/05V0049/DEU/2005"
                     /mol_type="genomic RNA"
                     /strain="05V0049"
                     /host="chicken"
                     /db_xref="taxon:884200"
                     /segment="7"
                     /country="Germany"
                     /collection_date="2005"
     gene            43..1155
                     /locus_tag="RV-Ds7_gp1"
                     /db_xref="GeneID:9742369"
     CDS             43..1155
                     /locus_tag="RV-Ds7_gp1"
                     /codon_start=1
                     /product="NSP3"
                     /protein_id="YP_003896052.1"
                     /db_xref="GeneID:9742369"
                     /translation="MVQPRKVVNILCFVLLIFDTSAFPLQERKNNNQKIIYKTVLYLK
                     KRQNIESSYYLFDASNYEKVDQDYLCFGNDTVIHEIEIRQKDIFSYRNSELREIKTSQ
                     LCQYDFKFKDGNSGISGSNLEALMFHGAICGRKILRGQGFTPDVKSLHDDIAMKFESM
                     LEESGVKNSVFGRAKTVDEAINGKFFSAQKNRRYMTTIETVKNLESDLYRMRMMLENM
                     DIKRDARVLSSLFQIEKKTGKSGSVILADASVYDKLEKGEIVRVDMGKIESENSCKLR
                     QIIDQKDELISKLKNEITILRATRFDDVDGLKFGFRYQSKNRDISAELSDAASQTDTL
                     STIKEDTVSELEERVENLEKIIAGLASRCGLTVEYV"
     misc_feature    508..864
                     /locus_tag="RV-Ds7_gp1"
                     /note="rotavirus non-structural protein 3 (NSP3); Region:
                     NSP3_rotavirus; cd20714"
                     /db_xref="CDD:411010"
     misc_feature    order(529..534,544..549,556..561,568..570,601..603,
                     610..615,640..642,652..657,661..669,673..678,706..708,
                     715..720,727..729,745..747,754..768,787..789,799..801)
                     /locus_tag="RV-Ds7_gp1"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:411010"
ORIGIN      
        1 ggttttaaaa ttcagaccgt tagctaaaga ctgtcggcct gaatggtgca acccaggaag
       61 gtagttaaca ttctatgctt tgtacttctg attttcgata ctagtgcatt tccattacaa
      121 gagagaaaaa acaataatca gaaaattata tataaaacag tgctgtatct taaaaagaga
      181 cagaatattg aatcatctta ctatttattt gacgcttcaa actacgaaaa agtagatcaa
      241 gattatttat gttttggtaa cgataccgtc attcatgaaa tagaaattag acaaaaagat
      301 atttttagtt ataggaattc tgaattaagg gaaatcaaaa catcacaact gtgtcagtac
      361 gatttcaaat tcaaagatgg caactcaggc atcagtggat ctaatcttga agctctcatg
      421 ttccacggcg caatttgtgg cagaaaaata ttgcgaggac aaggctttac cccagatgtc
      481 aaaagtttgc atgatgacat tgcaatgaag tttgagtcaa tgctggaaga gtctggagtt
      541 aaaaattcgg tatttggtag agctaaaaca gtagatgaag cgattaatgg aaaattcttt
      601 tctgcgcaaa agaataggcg gtatatgact accattgaaa cagtgaagaa tcttgaatca
      661 gatttgtata gaatgagaat gatgctagag aacatggaca taaaacgaga cgctagagtg
      721 ttaagttcat tatttcaaat tgagaagaaa acaggcaaat caggatcagt gattctagct
      781 gatgccagtg tatacgataa attggagaaa ggtgaaattg tgcgagtcga catgggaaag
      841 atagagagtg aaaattcatg caaattgagg caaataatcg accaaaagga tgagttaatc
      901 tctaaactta agaatgaaat caccattctg agagcaacaa ggtttgatga tgttgatgga
      961 ttaaaatttg gatttagata tcaatcaaaa aatagagaca tatcagccga actaagtgat
     1021 gcagcatcac aaactgatac gttgagtaca ataaaggaag ataccgtaag tgaacttgaa
     1081 gaaagagtag aaaatttaga aaaaataatt gcaggattgg cttctagatg tggattgaca
     1141 gtcgaatacg tataaattag agtacaagca tggaatgttc tatcgccctt aaccggatac
     1201 actgggttaa agctggcatt gcaaacaggg caccatgcga cc
//
DBGET integrated database retrieval system