LOCUS       NC_014520                765 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus D chicken/05V0049/DEU/2005 segment 10, complete genome.
ACCESSION   NC_014520
VERSION     NC_014520.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus D chicken/05V0049/DEU/2005
  ORGANISM  Rotavirus D chicken/05V0049/DEU/2005
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            D.
REFERENCE   1  (bases 1 to 765)
  AUTHORS   Trojnar,E., Otto,P., Roth,B., Reetz,J. and Johne,R.
  TITLE     The genome segments of a group D rotavirus possess group A-like
            conserved termini but encode group-specific proteins
  JOURNAL   J. Virol. 84 (19), 10254-10265 (2010)
   PUBMED   20631147
REFERENCE   2  (bases 1 to 765)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-SEP-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 765)
  AUTHORS   Trojnar,E., Otto,P., Roth,B., Reetz,J. and Johne,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-FEB-2010) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diederdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence is identical to
            GU733452.
            GenBank Accession Numbers GU733443-GU733453 represent the complete
            genome of Rotavirus D strain 05V0049.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..765
                     /organism="Rotavirus D chicken/05V0049/DEU/2005"
                     /mol_type="genomic RNA"
                     /strain="05V0049"
                     /host="chicken"
                     /db_xref="taxon:884200"
                     /segment="10"
                     /country="Germany"
                     /collection_date="2005"
     gene            33..416
                     /locus_tag="RV-Ds10_gp1"
                     /db_xref="GeneID:9742363"
     CDS             33..416
                     /locus_tag="RV-Ds10_gp1"
                     /codon_start=1
                     /product="NSP4"
                     /protein_id="YP_003896055.1"
                     /db_xref="GeneID:9742363"
                     /translation="MLSLESLGNINVTEVIAGLNINEIGTQQIWTITVTALLSIISLI
                     KAKAYKILPLLCTFFVTTVKQTIILINDKILRIFGIDVSITDTQVIESHFAYIRDDLN
                     KIRLEIQSLKTIKKLNETIEQNVSG"
     gene            385..666
                     /locus_tag="RV-Ds10_gp2"
                     /db_xref="GeneID:9742362"
     CDS             385..666
                     /locus_tag="RV-Ds10_gp2"
                     /note="ORF2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_003896056.1"
                     /db_xref="GeneID:9742362"
                     /translation="MKQSSKMYQVEIDQIAKHNDAVILTSGNMSFNVLPDETYTLSRI
                     KLLVVNSAVLFVKLIRQSSSGLYNDVVVKDISYNNSNSLTMYVCSPAER"
ORIGIN      
        1 ggttttaaaa tttattagtt gaatccatcg agatgttgtc actggaaagc ctggggaaca
       61 ttaacgttac ggaggttatc gctggtttga acatcaatga aataggtaca caacagattt
      121 ggacaattac agttacggcc ctactgtcta tcatttcact tatcaaagct aaagcctata
      181 aaatactgcc actgttgtgt acgtttttcg taactacagt aaagcaaaca attattctga
      241 taaacgacaa gattctgcgt atttttggaa tagacgtatc aataactgat actcaagtaa
      301 ttgaatcaca tttcgcttat atacgtgacg atctaaataa aattcgacta gaaattcaat
      361 ctcttaaaac tataaaaaag ttgaatgaaa caatcgagca aaatgtatca ggttgaaata
      421 gatcaaattg caaaacataa cgatgcagta atattaacta gtggtaatat gagttttaac
      481 gtactgcctg atgaaactta caccttaagc agaatcaagc tattagtagt aaattcggca
      541 gtcttatttg ttaaattaat tagacaatca agttcagggt tatataatga tgttgtagtt
      601 aaggatatat catataataa ttcaaactct ttaacaatgt acgtatgctc ccccgctgaa
      661 aggtgaccgc ctgtagaagc cagcaggtgt aaaagtctcg aggaccctat cacagctctg
      721 aactgtatat gtttacctgt gcgtggaaac taataaattg tgacc
//