LOCUS       NC_014521                672 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus D chicken/05V0049/DEU/2005 segment 11, complete genome.
ACCESSION   NC_014521
VERSION     NC_014521.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus D chicken/05V0049/DEU/2005
  ORGANISM  Rotavirus D chicken/05V0049/DEU/2005
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            D.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Trojnar,E., Otto,P., Roth,B., Reetz,J. and Johne,R.
  TITLE     The genome segments of a group D rotavirus possess group A-like
            conserved termini but encode group-specific proteins
  JOURNAL   J. Virol. 84 (19), 10254-10265 (2010)
   PUBMED   20631147
REFERENCE   2  (bases 1 to 672)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-SEP-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 672)
  AUTHORS   Trojnar,E., Otto,P., Roth,B., Reetz,J. and Johne,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-FEB-2010) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diederdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence is identical to
            GU733453.
            GenBank Accession Numbers GU733443-GU733453 represent the complete
            genome of Rotavirus D strain 05V0049.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..672
                     /organism="Rotavirus D chicken/05V0049/DEU/2005"
                     /mol_type="genomic RNA"
                     /strain="05V0049"
                     /host="chicken"
                     /db_xref="taxon:884200"
                     /segment="11"
                     /country="Germany"
                     /collection_date="2005"
     gene            30..617
                     /locus_tag="RV-Ds11_gp1"
                     /db_xref="GeneID:9742360"
     CDS             30..617
                     /locus_tag="RV-Ds11_gp1"
                     /codon_start=1
                     /product="NSP5"
                     /protein_id="YP_003896057.1"
                     /db_xref="GeneID:9742360"
                     /translation="MMDDLDFNFESNLPEISLISSRAGTTYTKIDYDEDMLLDDITPS
                     DSASSQDTNQRTFREKSFKSSSMVSQCDEDDIASQEMNKLETIVNSACADEQQNIDDW
                     NEYLEENSGIKIMEGKVSTNEVDLNGVFESKILNRNSIINKDNIDSAVKKKANINKMN
                     MHDTSSDEECNRNCKCCKKLRKLRKRMSILIAESY"
ORIGIN      
        1 ggttttaaat tgctactaga gatacataca tgatggatga tttagacttt aattttgaat
       61 ctaatctacc tgaaatatct ttaatttcgt cacgagctgg aacaacatat acgaaaatag
      121 attatgatga agatatgttg ttagatgata ttactccatc agattcagca tcatcacagg
      181 atactaatca gagaactttt agagaaaaat cttttaaatc ttcatctatg gtttcacagt
      241 gtgatgaaga cgatattgct agtcaagaaa tgaacaaatt agaaaccatc gttaatagcg
      301 catgtgcaga tgaacaacaa aacattgatg attggaacga atatctagag gaaaatagcg
      361 gtattaagat tatggaagga aaagtttcta caaatgaagt tgatttgaat ggtgtgtttg
      421 agtctaagat attaaaccgc aactcaataa ttaataaaga taatattgat agcgctgtca
      481 agaagaaggc aaatattaat aagatgaata tgcatgatac gtcgtctgat gaagaatgca
      541 atcgtaactg caaatgctgt aaaaaattga gaaaattaag aaaacgtatg agtattttaa
      601 ttgctgaaag ttattaraga aaatcattct aatgtatgta ctctagggtg accccgcacc
      661 caccttgtga cc
//