GenomeNet

Database: RefSeq
Entry: NC_015134
LinkDB: NC_015134
Original site: NC_015134 
LOCUS       NC_015134               1202 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Avian orthoreovirus segment S3, complete genome.
ACCESSION   NC_015134
VERSION     NC_015134.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Avian orthoreovirus
  ORGANISM  Avian orthoreovirus
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Spinareoviridae; Orthoreovirus.
REFERENCE   1
  AUTHORS   Banyai,K., Dandar,E., Dorsey,K.M., Mato,T. and Palya,V.
  TITLE     The genomic constellation of a novel avian orthoreovirus strain
            associated with runting-stunting syndrome in broilers
  JOURNAL   Virus Genes 42 (1), 82-89 (2011)
   PUBMED   21116842
REFERENCE   2  (bases 1 to 1202)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-FEB-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1202)
  AUTHORS   Banyai,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-SEP-2010) Banyai K., Hungarian Academy of Sciences,
            Veterinary Medical Research Institute, Hungaria krt. 21., Budapest,
            H-1143, HUNGARY
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR694199.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1202
                     /organism="Avian orthoreovirus"
                     /mol_type="genomic RNA"
                     /strain="AVS-B"
                     /db_xref="taxon:38170"
                     /segment="S3"
                     /country="USA"
     gene            31..1134
                     /gene="sigma-B"
                     /locus_tag="AOrVS3_gpp1"
                     /db_xref="GeneID:10220433"
     CDS             31..1134
                     /gene="sigma-B"
                     /locus_tag="AOrVS3_gpp1"
                     /codon_start=1
                     /product="sigma-B protein"
                     /protein_id="YP_004226529.1"
                     /db_xref="GeneID:10220433"
                     /translation="MEVRVPNFHSFVEGITSSYLQTPACWNAQTAWDTVTFHVPDVIR
                     VGNAYCCSQCCGVLYYGTLPSDGNYFPHHKCHQQQFRTDTPLLRYVRIGRTTEHLLDQ
                     YAVALESIAEHYDEISQRMVDEPENDEVTPLDIVTRTESIRSDKAVDPDFWTYPLERR
                     SDDSRRDIASACWKMIDASSRSLTLPNCLVSPSVHSRSVFGQMQTTTTIYDVAASGKA
                     VKFSPMVATLAQRDAGPVTLANADPADGVYSFWTSHFAFSPLIGGVGITGQYARESYH
                     HVGHPVIGSGKKASHYRNLFMEAWRGWSKSAFACATGMEPAECESRLRGHARTMLGRS
                     LPNVCDDDVAQQSGAVLASLQKTTKFTVVECGW"
     misc_feature    31..1128
                     /gene="sigma-B"
                     /locus_tag="AOrVS3_gpp1"
                     /note="Reovirus outer capsid protein, Sigma 3; Region:
                     Reovirus_cap; pfam00979"
                     /db_xref="CDD:144537"
ORIGIN      
        1 gctttttgag tccttagcgt gcaagccgca atggaggtac gtgtgccaaa ctttcactcg
       61 ttcgttgaag gaataacatc cagttactta cagactcctg cttgttggaa tgcacaaaca
      121 gcctgggaca ctgtgacctt tcatgtccct gatgtcatta gagtcggtaa cgcgtactgt
      181 tgttctcagt gctgcggtgt actttactac ggaactctgc catccgacgg gaattacttc
      241 cctcatcaca aatgtcatca gcaacagttt aggactgata ccccgctact gcgatacgta
      301 aggatcggca gaacgactga gcatttgctg gatcagtatg ccgtcgcttt ggagtctatc
      361 gccgaacact atgatgagat cagccaacgt atggttgatg agcctgagaa tgatgaagtt
      421 acgccccttg acatcgtaac gcgcaccgag tctatcagaa gtgacaaggc agtggacccg
      481 gacttttgga cctatccact tgagcgacgc tctgatgact ctcgccggga tatcgcctca
      541 gcatgctgga aaatgattga tgcgtcctca cgtagtctga ccctccccaa ctgtcttgtt
      601 tctccatctg tgcattcacg ttccgtcttt ggtcaaatgc aaacgaccac caccatatac
      661 gatgttgctg cgtctggaaa ggcagttaag ttttctccga tggttgctac cctcgctcaa
      721 cgcgatgctg ggcctgtgac gctcgcaaac gctgatccag ctgacggcgt atactcgttt
      781 tggacatcac actttgcctt ttcgccactc attggtggag tcgggattac agggcaatat
      841 gctcgcgagt cataccacca cgtgggtcat ccggtaattg ggagcggtaa gaaggcgtcg
      901 cactacagaa atctgttcat ggaagcgtgg cgtgggtggt cgaagtccgc ttttgcgtgt
      961 gctacaggta tggagcctgc tgaatgtgag tcccgtttga gaggacacgc ccgcaccatg
     1021 ctcggacggt ctctaccaaa tgtctgtgat gatgatgtcg ctcaacagtc tggtgctgtg
     1081 ctagcatctc tgcagaagac taccaaattc actgtggtgg agtgtggttg gtaagtgcct
     1141 ccgggtcaaa atgcacatag gctcccacct atgtgacggt tagcgggact cgcctattca
     1201 tc
//
DBGET integrated database retrieval system