GenomeNet

Database: RefSeq
Entry: NC_016448
LinkDB: NC_016448
Original site: NC_016448 
LOCUS       NC_016448             196691 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Saimiriine herpesvirus 4 strain SqSHV, complete genome.
ACCESSION   NC_016448
VERSION     NC_016448.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Saimiriine betaherpesvirus 4 (Squirrel monkey cytomegalovirus)
  ORGANISM  Saimiriine betaherpesvirus 4
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Cytomegalovirus.
REFERENCE   1  (bases 1 to 196691)
  AUTHORS   Davison,A.J., Holton,M., Dolan,A., Dargan,D.J., Gatherer,D. and
            Hayward,G.S.
  TITLE     Comparative genomics of primate cytomegaloviruses
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 196691)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 196691)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-DEC-2011) MRC-University of Glasgow Centre for Virus
            Research, 8 Church Street, Glasgow G11 5JR, UK
  REMARK    Nucleotide and amino acid sequences updated by submitter
REFERENCE   4  (bases 1 to 196691)
  AUTHORS   Davison,A.J., Holton,M., Dolan,A., Dargan,D.J., Gatherer,D. and
            Hayward,G.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-NOV-2008) MRC-University of Glasgow Centre for Virus
            Research, 8 Church Street, Glasgow G11 5JR, UK
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FJ483967.
            The original gene nomenclature has been retained. Genes presumably
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes), from the common ancestor of beta-
            and gammaherpesviruses (betagamma genes), or from the common
            ancestor of betaherpesviruses (beta genes) are indicated. A
            standard protein nomenclature has been applied so that orthologs
            have the same name in all herpesviruses.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..196691
                     /organism="Saimiriine betaherpesvirus 4"
                     /mol_type="genomic DNA"
                     /strain="SqSHV"
                     /isolation_source="salivary gland tissue culture from
                     squirrel monkey"
                     /host="Saimiri sciureus"
                     /culture_collection="ATCC:VR-1398"
                     /db_xref="taxon:1535247"
                     /lab_host="squirrel monkey lung cells (DSPO 114/74; ATCC
                     CCL-194)"
                     /common="Squirrel monkey cytomegalovirus"
                     /acronym="SaHV-4"
                     /acronym="SMCMV"
                     /note="2 genes are mutated (S10 and UL116)"
     repeat_region   1..1725
                     /note="TRL"
                     /rpt_type=inverted
     misc_feature    1340
                     /note="location of right end in some larger genomes
                     (permuted circularly); putative unpaired G residue at
                     3'-end of upper strand; complementary to unpaired C
                     residue at 3'-end of lower strand"
     misc_feature    1726..156378
                     /note="UL"
     gene            1794..2651
                     /gene="S1"
                     /locus_tag="SaHV-3_gp001"
                     /db_xref="GeneID:11464380"
     CDS             1794..2651
                     /gene="S1"
                     /locus_tag="SaHV-3_gp001"
                     /note="type 1 membrane protein; similar to SLAM proteins;
                     A43 family"
                     /codon_start=1
                     /product="membrane protein S1"
                     /protein_id="YP_004940177.1"
                     /db_xref="GeneID:11464380"
                     /translation="MATWGGGDGTYCLLPGLLLLFRVGPGGPVSQTSSTPLIVNGVLG
                     ESVTLPLEFPAGEKIKSITWHYNGTSIAFIAPSEAKSPQIHLTNPKLGKRLNFTQSYS
                     LQLSNLEMEDTGSYSALMSSETTVNVSSYTLRIFRKLKNIQVSNHSQLSQNRICEIHL
                     TCSVEDPNDNISFKWEALGKTLLREPNLTTSWDPRNSSEQNYTCIAENAVSNLSFTVS
                     AQKLCEVAYMSTEARMLVAALMTCLVIICLLGLFLVWKRRRAGSLLCIQLCFSHLFSR
                     EHQAETLIF"
     misc_feature    1908..2177
                     /gene="S1"
                     /locus_tag="SaHV-3_gp001"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    1914..2201
                     /gene="S1"
                     /locus_tag="SaHV-3_gp001"
                     /note="N-terminal immunoglobulin (Ig)-like domain of the
                     signaling lymphocyte activation molecule (SLAM) family,
                     CD84_like; Region: Ig_SLAM-CD84_like_N; cd05775"
                     /db_xref="CDD:143252"
     misc_feature    order(1974..1976,1980..1982,2142..2144,2148..2150,
                     2154..2156)
                     /gene="S1"
                     /locus_tag="SaHV-3_gp001"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143252"
     misc_feature    <2271..2417
                     /gene="S1"
                     /locus_tag="SaHV-3_gp001"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:290638"
     gene            complement(3378..4508)
                     /gene="S2"
                     /locus_tag="SaHV-3_gp002"
                     /db_xref="GeneID:11464338"
     CDS             complement(3378..4508)
                     /gene="S2"
                     /locus_tag="SaHV-3_gp002"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S2"
                     /protein_id="YP_004940178.1"
                     /db_xref="GeneID:11464338"
                     /translation="MGNLAALGVVIWTVCFGAVKPREQRYECVQVGHQEIHKGLCIDV
                     SGPERPTVEDYKRMCDVLRLPNGGSVPFSKLPDRIMRDCELEKTVTDQERKELLMYCQ
                     HACYEKNKCVVVESRMQCLLKNGRLNLKLELNGDFSYGLKVESVEFYLYNGDAVRIGN
                     GVDCKKMDTKQYVCEENNVAVPLRAREFVVRTATCNVCRWQSHGCVLQESVWDSWLLL
                     NMEDVMRLEIEERWIMVSIGVMWVLLRTGIGVCGGVWLVMRWKWWRAMVFMLVWVMVL
                     LMQLWPSSAGEYLWSLLGGNQSVKDPDFSSVGLVSGNGQLGAVRSGDGKLVGGQVCVG
                     ADGRRGVWWTARRKRGVCWALRHDVGRAAAKRELARRPLRMA"
     gene            4507..5439
                     /gene="S3"
                     /locus_tag="SaHV-3_gp003"
                     /db_xref="GeneID:11464243"
     CDS             4507..5439
                     /gene="S3"
                     /locus_tag="SaHV-3_gp003"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S3"
                     /protein_id="YP_004940179.1"
                     /db_xref="GeneID:11464243"
                     /translation="MFLYKTKVLSLTAHLFTHALFLHPEHNPKLLTTMPPNTDASQIL
                     DLENTASIERQPGTDTFRRTNLSATALRLLTLLVNTTFPFSAANPFNRSASTCEPLPS
                     VQTIDLRCFMRGGTAYVSAAVHGNFLEIRTPLTQTYVYTFFENDANPTISNHLPIYTA
                     NHLYVYHFSIHMLDIEQLQFNFRPCTFCPTKTAVCDLHEHVSWSPLVLYNAKSITHLL
                     LERRYVPAFVVFLLVASRCTLIFLWLFECSKLADWIVDQNWLTFYLIITVLFLSVPLT
                     LSFLSCSTLLSFDYLIPVEYPLSTEELLSSFTLT"
     gene            5515..6420
                     /gene="S4"
                     /locus_tag="SaHV-3_gp004"
                     /db_xref="GeneID:11464239"
     CDS             5515..6420
                     /gene="S4"
                     /locus_tag="SaHV-3_gp004"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S4"
                     /protein_id="YP_004940180.1"
                     /db_xref="GeneID:11464239"
                     /translation="MYLPLLILISCITMTSTYRRKLKTCLPKPYVPSVYLKPTTCSRT
                     FGPNRPTTSEYYSLCNKHLTVNKIVALNSSIRRLITADPALTSKQRKSLIAFCSHICY
                     SRGRCRITRIFSNCTLNHRIHLNADVYGDFTYNLRIIQASLATGRGTINHPTNILNLH
                     RISLDHYQINFTTNLWNAYTTGIELKLSTCAHCDVIKHTCRLPPTDVSLSRYTLLTIV
                     DVARLALEKRYLALCYAGTQLFIRTLIIIHTCRKICSYIFKHRLNYLTFIIITYVTIL
                     TTCTAFLLPYSRLSRKIAQPIYTQT"
     gene            6464..7336
                     /gene="S5"
                     /locus_tag="SaHV-3_gp005"
                     /db_xref="GeneID:11464240"
     CDS             6464..7336
                     /gene="S5"
                     /locus_tag="SaHV-3_gp005"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S5"
                     /protein_id="YP_004940181.1"
                     /db_xref="GeneID:11464240"
                     /translation="MTLRTSIFFVLSIVATSHRIEKQVCQPRSYVPEAYLQKQMSTCA
                     RFHGQQTLAPSEYRRYCDQIRLQNGRLPFDFDIALLLRISTLSSTEHRQVSEYCRHIC
                     LHRGRCQITHISSQCILRRKLYVNVDIYGDFSRGLSLISAYTLIHNTHLSLTNQLSLD
                     KISNSHYRIRSTVPDWHLEMKTLRFKFNTFHDTHHICNVTTDVSLSRYTLLTYTDLLR
                     LLMEQRYGALAYAAIQIFLRILLITYLLSVMLDYVVKEESYNKALVMTAYIVTIIMLC
                     ALYLPFYKKIIREY"
     gene            7520..8416
                     /gene="RL1"
                     /locus_tag="SaHV-3_gp006"
                     /db_xref="GeneID:11464241"
     CDS             7520..8416
                     /gene="RL1"
                     /locus_tag="SaHV-3_gp006"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein RL1"
                     /protein_id="YP_004940182.1"
                     /db_xref="GeneID:11464241"
                     /translation="MASNWNTEHPGLGPLLDTFELSDIAVQCEDSTPSMPKTDENQSE
                     DETDDDSDDSQSKNEEEESRIKSWAWDGSYIPKPSARNAEISARRAEPLSSCWCIWTP
                     RWPLPGRVTRKRREERGAVHLLNSRARDGRADWTFLRVRSLVLADDSSVEHDEEALFL
                     PPWTSEAPPWAEDWPRYRIALLFGGHGAHLMIIRPTFDEAASRGLFPRMACQDKDAPT
                     TLPNGLCIRRGTWIASETFPTPLLRQDLSTPSLLGYRPKPVRIWRSPTVPPLAPREPR
                     RGVDVDITGTETVAEIVELKTS"
     gene            9011..9625
                     /gene="S6"
                     /locus_tag="SaHV-3_gp007"
                     /db_xref="GeneID:11464242"
     CDS             9011..9625
                     /gene="S6"
                     /locus_tag="SaHV-3_gp007"
                     /codon_start=1
                     /product="protein S6"
                     /protein_id="YP_004940183.1"
                     /db_xref="GeneID:11464242"
                     /translation="MPRSGQEPTTTSRPNQRGDAKTRKTTERRHGTATASRPAAATHT
                     AAGPAAVAVSKVPASNNTATPTTSTVPTVSSTTPQNSGVRRGGIRPRTRQPAPTPTPT
                     QTPDGPPKRVTRAPRVARVTPQPPANQHETPTLSGKDPKKTPNRPKAKTEQVENKETK
                     PDKSKSRKVKDGNTTPTVPTVAIPAMEPTCTLLYFSVQLPQPKH"
     gene            9900..10751
                     /gene="UL14"
                     /locus_tag="SaHV-3_gp008"
                     /db_xref="GeneID:11464379"
     CDS             9900..10751
                     /gene="UL14"
                     /locus_tag="SaHV-3_gp008"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; UL14 family"
                     /codon_start=1
                     /product="membrane protein UL14"
                     /protein_id="YP_004940184.1"
                     /db_xref="GeneID:11464379"
                     /translation="MLALIVLLGLPLSISGAKQLHVKDVYSLGPLLAGHGDRISIPCF
                     SPRKHDYQGIYVQFCNEFKVYSIYIYNETVFHDTLASKLLNYTLNYRRGLTEISFTFT
                     EDLVGWYTCYHADDIDCYLTTHYTLIDRITTRHRTHGKKHLGLSRRPDDSTAWTVYPE
                     KVRRRLCLYDHGLQDVFYVHTPMSTVSCKKPSVNRCRIHSKLSKLRKRPSTTLIPLRA
                     NTTQNAQEYVWQMMYEDTLRILANAELALWLAILTFLGGIMILLKSLYTSQSLLRSPY
                     KPLPSLN"
     misc_feature    9987..>10475
                     /gene="UL14"
                     /locus_tag="SaHV-3_gp008"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            complement(10976..11974)
                     /gene="S7"
                     /locus_tag="SaHV-3_gp009"
                     /db_xref="GeneID:11464244"
     CDS             complement(10976..11974)
                     /gene="S7"
                     /locus_tag="SaHV-3_gp009"
                     /note="type 1 membrane protein; MHC family"
                     /codon_start=1
                     /product="membrane protein S7"
                     /protein_id="YP_004940185.1"
                     /db_xref="GeneID:11464244"
                     /translation="MICEYVAKIPLSLSLSLSCVFSHFLTYQNTLVSNSSGKHYFFQV
                     AYVDDVQIMTFNSTVMKSDLKQSVLELEMDGNLETNTQRSKESMEMMIHLLRFLSTQQ
                     SKNLESHTLQWVYGCGYDDKFMRFGYDGVEIFRLGSEGKSWVSTCNESLWMKHILDEC
                     YPAKYTTTYFESTCLQWLRRHSSEVLILLMTKPHTKLIKEAISTNESRLRCWASSFYP
                     AGINITWSKDEVDKINETQSVDTRPDGPGTFQKWSAIVVPSGEEHKYVCSIYHDGFSY
                     PVNLTLELLMSAQFRDVNTHTGLIFGLLLLGGSVIFGVVWKIWRDRVNIPRIRLWR"
     misc_feature    complement(11432..11911)
                     /gene="S7"
                     /locus_tag="SaHV-3_gp009"
                     /note="Class I Histocompatibility antigen, domains alpha 1
                     and 2; Region: MHC_I; cl08246"
                     /db_xref="CDD:298647"
     misc_feature    complement(11156..11401)
                     /gene="S7"
                     /locus_tag="SaHV-3_gp009"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            complement(12214..13239)
                     /gene="S8"
                     /locus_tag="SaHV-3_gp010"
                     /db_xref="GeneID:11464245"
     CDS             complement(12214..13239)
                     /gene="S8"
                     /locus_tag="SaHV-3_gp010"
                     /note="type 1 membrane protein; MHC family"
                     /codon_start=1
                     /product="membrane protein S8"
                     /protein_id="YP_004940186.1"
                     /db_xref="GeneID:11464245"
                     /translation="MVSDVGLYIYTYIFVYMYIYTNIYVYNVAEGHSLEYYHTLVSHV
                     NGTPHFFIQVGYVDDTPIMGFNSSISKSVLKQSFMEQEESTYWSTETERSKTSMAIMT
                     QLLPKMSGKSHTLQLMYGCTKGSNGLLSDSFFKFGYDGKDYFYLGSDQKWIMVLNVSV
                     KIQDECGTGMIHNYFEDECVEWISRYTGNSGGHFIISQPKTKVVKQRLSSTYLLLKCW
                     ASYFYPAKIRMTWFKDGVNRTNETEYVETRPHGDGTFQKWAAIVVSSGDEEKYVCQVD
                     HAGFQQRVNLSVDPLSLAQSAADSNVHFGLITFGVIIGMVLTSYLVWRRWNNSFLPRR
                     FFSNFDV"
     misc_feature    complement(12682..13146)
                     /gene="S8"
                     /locus_tag="SaHV-3_gp010"
                     /note="Class I Histocompatibility antigen, domains alpha 1
                     and 2; Region: MHC_I; cl08246"
                     /db_xref="CDD:298647"
     misc_feature    complement(12403..12645)
                     /gene="S8"
                     /locus_tag="SaHV-3_gp010"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            13605..13916
                     /gene="UL19"
                     /locus_tag="SaHV-3_gp011"
                     /db_xref="GeneID:11464246"
     CDS             13605..13916
                     /gene="UL19"
                     /locus_tag="SaHV-3_gp011"
                     /note="possibly related to UL17"
                     /codon_start=1
                     /product="protein UL19"
                     /protein_id="YP_004940187.1"
                     /db_xref="GeneID:11464246"
                     /translation="MTDTLYSFFERRLPYPPRNVTLFISARLHHGPSCWEHLTSMSAD
                     ERRTLFVFGHGRIRLERYRITEVQCTDVLKMKRVRSPSSWIASESYPDLNLNYHLDQN
                     F"
     gene            complement(13982..15016)
                     /gene="S9"
                     /locus_tag="SaHV-3_gp012"
                     /db_xref="GeneID:11464247"
     CDS             complement(13982..15016)
                     /gene="S9"
                     /locus_tag="SaHV-3_gp012"
                     /note="type 1 membrane protein; MHC family"
                     /codon_start=1
                     /product="membrane protein S9"
                     /protein_id="YP_004940188.1"
                     /db_xref="GeneID:11464247"
                     /translation="MFSTFLLEFLLTSIVIGTKHSMRYFVTAVSRPGRGDPRYLEVGY
                     VDDVQFVRFDSDVSNPKMESRVSWVVENETYWSNETLGCTIDQAQFKKNLETLATYYN
                     QTYNRSHTIQRMYGCDVWENGSFIRGYEQYAYDGKDYFSLNEDLRSWTATDMAAQITK
                     RKWEAANAAEKVQTYLQGACSQWLLRYVVNGTEMLKAIPPKTDVKSESVSSHETTLRC
                     WALGFYPADIKITWYRDGEDQSQDTEQIDTRPAGDGTFQKWVAIVVPSGEETRYTCDV
                     QHEGLPGSVTVIERLESSDSSIPFVGVSVVMIALLGLAVLFFLWRRKRMGGTPPVDDS
                     VTVTLRDDED"
     misc_feature    complement(14432..14959)
                     /gene="S9"
                     /locus_tag="SaHV-3_gp012"
                     /note="Class I Histocompatibility antigen, domains alpha 1
                     and 2; Region: MHC_I; pfam00129"
                     /db_xref="CDD:278555"
     misc_feature    complement(14156..14422)
                     /gene="S9"
                     /locus_tag="SaHV-3_gp012"
                     /note="Class I major histocompatibility complex (MHC)
                     alpha chain immunoglobulin domain; Region:
                     IgC_MHC_I_alpha3; cd07698"
                     /db_xref="CDD:143322"
     misc_feature    complement(order(14240..14242,14246..14248,14264..14272,
                     14276..14281,14360..14362,14366..14368))
                     /gene="S9"
                     /locus_tag="SaHV-3_gp012"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143322"
     misc_feature    complement(order(14180..14182,14255..14257,14339..14347))
                     /gene="S9"
                     /locus_tag="SaHV-3_gp012"
                     /note="MHC binding domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143322"
     misc_feature    complement(15546..16136)
                     /note="similar to S10; truncated by frameshift (C:G
                     tract); MHC family"
     misc_feature    16698..16832
                     /note="vestigial MHC family gene"
     gene            complement(16844..17878)
                     /gene="S11"
                     /locus_tag="SaHV-3_gp014"
                     /db_xref="GeneID:11464249"
     CDS             complement(16844..17878)
                     /gene="S11"
                     /locus_tag="SaHV-3_gp014"
                     /note="type 1 membrane protein; MHC family"
                     /codon_start=1
                     /product="membrane protein S11"
                     /protein_id="YP_004940190.1"
                     /db_xref="GeneID:11464249"
                     /translation="MWIFIVIYFRVLCNFSLSYSLRYFSVSIERDNQEPLYLEAGYVD
                     DIEIVRFDSSDADPKMRPKVSWIQESSSFWDTETEGCVGDRTIFKSNLKVLLRYYNQS
                     GKHIIQRMCGCQGSSNGTLIHGYDQYAYDGKDYIMLTDDLQDWQVTDMYSKLTKDKWD
                     GQNRAQVVRAYLEIDCPEWVQKYVINGTRAGAFQIKAPQVFLTEHHLSDHEVNLKCWA
                     LNFYPADIYMMWMKDGEDQAQDIETIETRPSGDGTYQKWVAIVVSPQERQRYQCEVQH
                     VGQKTSVTSKLQSSADSGYGGSLTGIFVVTVALGVGISVVIWRKKLGSKIIMYRRNVG
                     VRMESVSETA"
     misc_feature    complement(17318..17827)
                     /gene="S11"
                     /locus_tag="SaHV-3_gp014"
                     /note="Class I Histocompatibility antigen, domains alpha 1
                     and 2; Region: MHC_I; cl08246"
                     /db_xref="CDD:298647"
     misc_feature    complement(17045..17293)
                     /gene="S11"
                     /locus_tag="SaHV-3_gp014"
                     /note="Class I major histocompatibility complex (MHC)
                     alpha chain immunoglobulin domain; Region:
                     IgC_MHC_I_alpha3; cd07698"
                     /db_xref="CDD:143322"
     misc_feature    complement(order(17108..17110,17114..17116,17132..17140,
                     17144..17149,17228..17230,17234..17236))
                     /gene="S11"
                     /locus_tag="SaHV-3_gp014"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143322"
     misc_feature    complement(order(17048..17050,17123..17125,17207..17215))
                     /gene="S11"
                     /locus_tag="SaHV-3_gp014"
                     /note="MHC binding domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143322"
     gene            18194..19069
                     /gene="S12"
                     /locus_tag="SaHV-3_gp015"
                     /db_xref="GeneID:11464250"
     CDS             18194..19069
                     /gene="S12"
                     /locus_tag="SaHV-3_gp015"
                     /note="type 1 membrane protein; MHC family"
                     /codon_start=1
                     /product="membrane protein S12"
                     /protein_id="YP_004940191.1"
                     /db_xref="GeneID:11464250"
                     /translation="MILYCISMAFWSFTSGYTYTLEFLYTTDNSAIYAAGFFNNVQFF
                     SYNSNTQNISTIAPWTEDVPNYEHTTELISILIQNYSNVVMHLKYGCRLNETTTELFS
                     PNKINQTLELKNSIDYYLNHSCINQLNRYIDVSHNITFVRSPVTSLVMTYRPNQKLLC
                     RAIDFFPPINIKASWYKDNQLISTTHQIRPSGNGYFQSSISTPFTFGDEHRYTCKITH
                     LSDIFQLHFYWPKDLDSEENDENHDYHSVWLYRILYLLIALFVITFIYCCKTGIQEQL
                     KLHDNTRYQRLDLLT"
     misc_feature    18662..18853
                     /gene="S12"
                     /locus_tag="SaHV-3_gp015"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            complement(19066..19341)
                     /gene="UL21A"
                     /locus_tag="SaHV-3_gp016"
                     /db_xref="GeneID:11464251"
     CDS             complement(19066..19341)
                     /gene="UL21A"
                     /locus_tag="SaHV-3_gp016"
                     /note="facilitates viral DNA synthesis"
                     /codon_start=1
                     /product="protein UL21A"
                     /protein_id="YP_004940192.1"
                     /db_xref="GeneID:11464251"
                     /translation="MGSGVVTTVEPATRNVYLGARIVFPPIQRRLSIRPRVNVSRRPR
                     SRWQFDGRDDESVNDDGFEDSRRPADHAFLSPPGPPRFFIGDEMICV"
     gene            19682..19988
                     /gene="UL22A"
                     /locus_tag="SaHV-3_gp017"
                     /db_xref="GeneID:11464252"
     CDS             join(19682..19776,19850..19988)
                     /gene="UL22A"
                     /locus_tag="SaHV-3_gp017"
                     /note="contains signal peptide; secreted protein; binds CC
                     chemokine RANTES; involved in immune regulation"
                     /codon_start=1
                     /product="glycoprotein UL22A"
                     /protein_id="YP_004940193.1"
                     /db_xref="GeneID:11464252"
                     /translation="MYATRFACLLLVITRVLASEQSTTSLKEQTSTTQDPLMSGGIQS
                     GNGPLTKEEHTSTTVSTQPVSTTLSPSKTPCAN"
     gene            20228..20690
                     /gene="O10"
                     /locus_tag="SaHV-3_gp018"
                     /db_xref="GeneID:11464253"
     CDS             join(20228..20514,20612..20690)
                     /gene="O10"
                     /locus_tag="SaHV-3_gp018"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein O10"
                     /protein_id="YP_004940194.1"
                     /db_xref="GeneID:11464253"
                     /translation="MRLHSTCIVLSIWTLRTIFGRPTPDLSSPANEVAKTAPETWTRF
                     YQHLTGTTETGIEEHDSDGENHDHHITTPEKPEVHTTPSGMKHPHGMDSFAIRCILGY
                     DCDNTKLPPQTFKPSIMVR"
     gene            complement(20906..21787)
                     /gene="UL23"
                     /locus_tag="SaHV-3_gp019"
                     /note="beta gene"
                     /db_xref="GeneID:11464254"
     CDS             complement(20906..21787)
                     /gene="UL23"
                     /locus_tag="SaHV-3_gp019"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL23"
                     /protein_id="YP_004940195.1"
                     /db_xref="GeneID:11464254"
                     /translation="MAWCGCWRLKPRKSVRLAWPRGRFLMLNKRWRSVKDNKTEEMRL
                     AEYLCCPEELCFLGSVCTKAFLKHGESECPSEIYVGLSGRVYMYIDMLYSDALLVVAK
                     DLAAFLKNGLKGCAFINVGSANMPSDFNCVSMTACANLDAFCAWRKSHLGQTMKLGDG
                     TVFSVVSDSVMNWHERRRCTVDTGSFRMEPFGESSIEEEGRPIILFTDEYLRVYAKTL
                     DGTILIASSMFEFVLRGLFRYRYDGIFYGNEKIRRLSRPPLCPNGLRHMCRSSVSSQL
                     SNVSTSDITELPAMYIA"
     misc_feature    complement(21434..21748)
                     /gene="UL23"
                     /locus_tag="SaHV-3_gp019"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(21065..21382)
                     /gene="UL23"
                     /locus_tag="SaHV-3_gp019"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(21902..22810)
                     /gene="UL24"
                     /locus_tag="SaHV-3_gp020"
                     /note="beta gene"
                     /db_xref="GeneID:11464255"
     CDS             complement(21902..22810)
                     /gene="UL24"
                     /locus_tag="SaHV-3_gp020"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL24"
                     /protein_id="YP_004940196.1"
                     /db_xref="GeneID:11464255"
                     /translation="MDTVAVAAQIGPGCLAAYMRLHQGRQLALPWPADWSLVIGSLEN
                     DPEYEPQDIKRWNGYLCCEVTWRFLGRVGCMSIMGLVGETLPILISNEGRVFCYGGKT
                     DDAIYYVAEDMIEFSHIGLHHIERLHRPLYLKMPYVKQMFQPLRRSWNMGFDAVARFV
                     IRNHGKRLPLSYPHSAELRLCNLRCFEASAFSGTMMRLARAFFGLRLIGIGTVDIQQP
                     TCRREPSYYDWPKRVVPVFMVDDGRLFACDAGQAEYVRLADDITSFMCLGLTRYYANR
                     RFGCRQVGCHDRVPDCPKDCEHVVSA"
     misc_feature    complement(21917..22810)
                     /gene="UL24"
                     /locus_tag="SaHV-3_gp020"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     misc_feature    complement(22427..22789)
                     /gene="UL24"
                     /locus_tag="SaHV-3_gp020"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(21983..22366)
                     /gene="UL24"
                     /locus_tag="SaHV-3_gp020"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            22895..24592
                     /gene="UL25"
                     /locus_tag="SaHV-3_gp021"
                     /db_xref="GeneID:11464256"
     CDS             22895..24592
                     /gene="UL25"
                     /locus_tag="SaHV-3_gp021"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL25"
                     /protein_id="YP_004940197.1"
                     /db_xref="GeneID:11464256"
                     /translation="MSLSRDCRPTRPSIRGFEDDTESIEEVFLVRSTPTPSRDIEQGL
                     DDDWESFNGRSYPASSRNTPVSSFEIINEANVDLRPSRLHVSSEHRPICEPSRHSRHQ
                     PVSQDHNPSSDEEDLGHFTFSTSDIEDYETPPINRYLNFDLNVLSLEDIALIENSIYE
                     VSLEQLSRINECKPMPTFILTNLIEPIFRPAAAGEKDLARPILIYTVLLNYYYKAKIK
                     CRNMKRVLDHTVNGPTLRGITSHLQSNRNPSRTVSLALHFLLTRRRVTEPQLLSCLSH
                     LDDELRKRLVNDTPRKNEIYRTVSEHNALFRVSVYTTREALYLYESNLKKLNTECTHT
                     MKLLCDHTISHLSILNDLSFLISTRLMILTFQRNIRILAAYLKHHLHNLSLLTYLAYL
                     QFPAQLREPYLQVAESLHKSVMSDDDAYMYRSETDLFNFWRALKRLDTIVCTNLVSCA
                     LRQAALGTDHGQTMAEYITRNPLFREPHDVPFQVRKLVTRNLCIPQFCHLPTYQHTPV
                     EFYFPPMTMLQKLFGITQRSENDLEYTHMSSMLKNFIVTQSVYLEDRSPNHEIVHHF"
     misc_feature    <23150..24571
                     /gene="UL25"
                     /locus_tag="SaHV-3_gp021"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03249"
                     /db_xref="CDD:223023"
     gene            complement(24589..25170)
                     /gene="UL26"
                     /locus_tag="SaHV-3_gp022"
                     /db_xref="GeneID:11464257"
     CDS             complement(24589..25170)
                     /gene="UL26"
                     /locus_tag="SaHV-3_gp022"
                     /note="transcriptional activator of major immediate early
                     promoter; involved in gene regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein UL26"
                     /protein_id="YP_004940198.1"
                     /db_xref="GeneID:11464257"
                     /translation="MDETGYAVMIGGQTIPDFVNENCDREFELPWPSGYTLLICNLQD
                     TILTPRDYQFWRSLPQMEGDLQIIGTVGHKDHLAWDRKIAGINAQGKVFLYEIREQNY
                     VVFAAESLEVLFQQGLRKDYFQDVARVIRQREHDLHIRQTRRSAESSEEGLQVTRVER
                     GVVRRLDLKDAEVTEQMFVDGNMPSSLPSYLPR"
     misc_feature    complement(24802..25140)
                     /gene="UL26"
                     /locus_tag="SaHV-3_gp022"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(25242..26915)
                     /gene="UL27"
                     /locus_tag="SaHV-3_gp023"
                     /note="beta gene"
                     /db_xref="GeneID:11464258"
     CDS             complement(25242..26915)
                     /gene="UL27"
                     /locus_tag="SaHV-3_gp023"
                     /codon_start=1
                     /product="protein UL27"
                     /protein_id="YP_004940199.1"
                     /db_xref="GeneID:11464258"
                     /translation="MDEALFQDPLVLYRYVRDCEDTDGFVEEFVSTYLVPVTNKEQAL
                     KAGFFVVRLYEGIVPSFRDGSLVTSTVRHTIITLRRSVLKNSKYTTAHGKYEIRGLKL
                     EWDLAVWAVLRSVSLASISNPLLNKNIRTFRYFLQQAQFLPHTSRFARTACISMATAQ
                     YLMCTLINYKECGSLTHYMRQLCSMTGEIYDRLAGTLPLFDDPETKNVIRKFFIDDLC
                     QEAGLDYRVLRNAVFFKTEFQQACERALAALYAHLCICGDCNETVEPNVPCRLESVPL
                     VLANYRDLGSFRLPALRHLTQSEQRRVRHAVSCDLAFALWNQTTSEPRYLLPSGLSCG
                     EVRRNYVMYLASNIVFNLKLIRMLHRVIQREFMDGVRFLSSDRDLLVGMLRQRYVMHE
                     KALVKNPRHQKVASECLQQIVELRDLDFSNTGKRSFVESVCDLQDVLKRVPDYQISLR
                     EKQQMFLLHHLRLRRFYTESSSETKLGENLIWYYLKRGNEVSGRDMLLRLNTRLTEDE
                     LCNETNRCRRQSWLHLPITPVPVKCKITLKKYHNIYIRRFKDGEVGGSL"
     misc_feature    complement(25248..26699)
                     /gene="UL27"
                     /locus_tag="SaHV-3_gp023"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03166"
                     /db_xref="CDD:177548"
     gene            complement(26927..27937)
                     /gene="A20"
                     /locus_tag="SaHV-3_gp024"
                     /db_xref="GeneID:11464259"
     CDS             complement(26927..27937)
                     /gene="A20"
                     /locus_tag="SaHV-3_gp024"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein A20"
                     /protein_id="YP_004940200.1"
                     /db_xref="GeneID:11464259"
                     /translation="MMVNACRHLAAASGFVTCLTDLLDEVYRSSREQFQETLMTFLHS
                     RCDGFVPVYWPPEAVYLVGREDVFGIDLKQKNFFNRFEILQSRRWIIFGGVIRMSETW
                     YQHREVWVLFTSAREMMTYDPIDRVLWRIDSWRTGVLYLSNMSCFYDKRFAKRSSEEI
                     LYGLRPTRVERGFLRLDFNHSQCLLSYVAQNVGFVFNHGDGCSFSVGTVTHADTVRNV
                     SSAVLRCLLEAGYEVIGRSQLYERLIVVDVHCNVYALLPGSCLFTLANSFRAFLRIGL
                     KFLLKGRRCCFAEIGSHFVPVGKRVRFPCDIRYSLPGDEELIRHLNPVLQSVRQRRPL
                     RG"
     gene            complement(27929..30045)
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="beta gene"
                     /db_xref="GeneID:11464260"
     CDS             complement(join(27934..28969,29045..30045))
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="interacts with components of the NuRD complex,
                     promoting accumulation of immediate early RNA; US22 family
                     (2 domains)"
                     /codon_start=1
                     /product="protein UL29"
                     /protein_id="YP_004940201.1"
                     /db_xref="GeneID:11464260"
                     /translation="MRRVRRKRVSAPSTVFSVQELLELSDGRHAGELRYFLERFEGSC
                     VSLGWPPQSVYTACSSLEFCDLTDLDLEHCQVSFFGEFRRLQLLGVACYATTRYPLFL
                     DDYGTIYCYDVKDDCMYDLASDMESFLSKGLIRCDPVHETINQKVCVDNVLPMSSEQK
                     RDVNENCRSSERERYLYALTGFGELLRCEDVEARNAYIQSHLNVTIPLMWPEKHVLVL
                     CSAKQLDLSPSLLRRLQKSTALKEPINVLGFVEASSSTVKTLFRHIRMFYDDGGAVYA
                     GIPGHDKLTKLARSLKDFVRVGLAPLIGDHRYESIGTFDASRLKEMYPDATLPLKKRR
                     ILVGHFESMNCLYVRGQPKFSAAWRGLRDVWTFRCRRPRMWKDGMQLQRFVRMHAGRW
                     LPLSWPPLTGVMMGDSYHFGAIFDRKTYRRFSCLRDCNRLYCIGFVSGYDCLPDIQVG
                     PQVIVSEQGHVFAYAPREDRVYLLGLSFNEFFEHGLSAMYSYYERPFVDETTENNWFR
                     HNFTGMSELSDHLDDRRQTVRYCHLNAGCKIRLGGPQYCLFTFGSWHISDFDEPNQFI
                     AQVLEKAGYTVIGWLEPVNKAVFLDADGAVYVSLHGTVLVKLGETLRGFIRHGSFWLR
                     CPRRFCFLPVGSTIKPVSGRVIVSCDWPEESDVQEKAEEVLSTSVNSESSIVEV"
     misc_feature    complement(join(28969,29045..30042))
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="single-stranded binding protein UL29; Provisional;
                     Region: PHA03222"
                     /db_xref="CDD:165485"
     misc_feature    complement(29626..29964)
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(29149..29487)
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(28492..28848)
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(28090..28413)
                     /gene="UL29"
                     /locus_tag="SaHV-3_gp025"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(30340..30642)
                     /gene="UL30A"
                     /locus_tag="SaHV-3_gp026"
                     /db_xref="GeneID:11464261"
     CDS             complement(30340..30642)
                     /gene="UL30A"
                     /locus_tag="SaHV-3_gp026"
                     /note="UL30 family"
                     /codon_start=1
                     /product="protein UL30A"
                     /protein_id="YP_004940202.1"
                     /db_xref="GeneID:11464261"
                     /translation="MAEQNDSDVEQSTLECHEEEEEVEKLIEWARYIHLRVEWNLKCS
                     IAVSDCKKFLKFYDMLTPERQQAFEAEVDRVTRQTKLQRFKISYRRRVVTRMCQGA"
     gene            30702..32468
                     /gene="UL31"
                     /locus_tag="SaHV-3_gp027"
                     /note="beta gene"
                     /db_xref="GeneID:11464262"
     CDS             30702..32468
                     /gene="UL31"
                     /locus_tag="SaHV-3_gp027"
                     /note="DURP family"
                     /codon_start=1
                     /product="protein UL31"
                     /protein_id="YP_004940203.1"
                     /db_xref="GeneID:11464262"
                     /translation="MELSLYAAFDTVSEEEYLFTPDMEMNDESQLVPASPDTNVTNDT
                     APQLAQTTLNLTDLTTINSAFYVNEFNVTPTDIATGFETPRNITAEAKPAKRARRVPD
                     QMSFAADSLEQDYLLPDANVIQNWISELRIADKENIGRCVRHTYVPHTSYYLSAYETY
                     LFTVIEEYNNNCTTPHKATFVHGCIFFSCSVIFSLQTEQPYSWTNLIVPKSGIRELFF
                     LLCSTNGSSLTCQPLITKGGLCSSLLVHLEPLPSDQGFGLAQVQLVLIPMVPYRWSRH
                     AIPFIIIQDEESNRQETPNTSGQPTLLDENASPFGQATITRQNNTVLFTVKQLSWTSK
                     RMLSGRRKRVVHYVSQFKGSWYHEFDPNHDAWISSKNIEYEFMSLPFTINVDTLVIDI
                     SNHTFIGTLSTSHCHRILDKLTARNMPRSLAFYITLIQSKHVDLQFSRNPCIFFSGDV
                     LNLPFTSEPNPFSAVIHAPYDIQLTSPATQTVKLDIIYTESTGRCFLVANVPNNDSFY
                     TGLRLWKNGELKITIWPLTKCLFIPQGAPIAVLYQINDTTGDIDHNGRIVFKHQFEDE
                     QISFYLGDLKLPEINFLASYYY"
     misc_feature    31080..32333
                     /gene="UL31"
                     /locus_tag="SaHV-3_gp027"
                     /note="Protein of unknown function (DUF570); Region:
                     DUF570; pfam04489"
                     /db_xref="CDD:282358"
     gene            complement(32477..33934)
                     /gene="UL32"
                     /locus_tag="SaHV-3_gp028"
                     /note="beta gene"
                     /db_xref="GeneID:11464263"
     CDS             complement(32477..33934)
                     /gene="UL32"
                     /locus_tag="SaHV-3_gp028"
                     /note="major tegument protein; binds to capsids"
                     /codon_start=1
                     /product="tegument protein pp150"
                     /protein_id="YP_004940204.1"
                     /db_xref="GeneID:11464263"
                     /translation="MANLVFIGLPRRNVVTLNQFVKTVIKRDDVDLTHHKKILKKCGY
                     KFLNRRTAAYNELILWLGYYRELRNHRPDVSPLRTEFHRLCCSICQHVKGHSALDMTR
                     VDVKATVSVLEHEQKNLLQDLSRGAIVLIMEAITSLCRMIVYGKLSSGCSFEFVNMRG
                     KDMALLEENIGYAERNMFQIQPLRLDLDNKRNPHIVNSGNKMMYIGRLILAVLESWEA
                     LETKCLSSISGLCQSLRSELREIGTFDCQYINNILKTRVNDGVACDDLLNLLTEDFHL
                     YETAFPLPLDRSKFSFQQTEPETTENAFGSWYRSSLPESLLADLKDPAVRYKVFDIRE
                     PTERHKAFEILSDDDEKPDYSQKKRDRDSWWEVDSTDDSTKKASALDSSGLLDLEKQL
                     EKLDVGGVPTQAFVFEPPFKPTETVSQPFAPVSEQGDLKTSLTPETEEVASVEKEKKE
                     NEEGEDEDDEESIETIDVADKVKQIVDAIKDNEES"
     misc_feature    complement(<32975..33241)
                     /gene="UL32"
                     /locus_tag="SaHV-3_gp028"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            34008..35323
                     /gene="UL33"
                     /locus_tag="SaHV-3_gp029"
                     /note="beta gene"
                     /db_xref="GeneID:11464264"
     CDS             join(34008..34043,34124..35323)
                     /gene="UL33"
                     /locus_tag="SaHV-3_gp029"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; involved in intracellular
                     signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein UL33"
                     /protein_id="YP_004940205.1"
                     /db_xref="GeneID:11464264"
                     /translation="MEILLETPNNTAVYTEDYLHINDSCGTTASLQMARYAEALINTF
                     IILIGAPLNCIVLITQMLSNRVHGYSTPALYMTNLSSANLITLMVLPFIVLGNRGYLP
                     GTVQTCKFISLAYYSSCTVGFATVALIAADRYRVLHRKTHRRSSYTKTYVILATTWMI
                     SLICAAPASLYTTVVVHDDKIGIGEQTCVLFFEQDQIYTILLCFKILITLIWGITPIA
                     MMTWFYTFFYTTLKRASYHKRNRTVTFISLLLLSFLFIQTPYVIIMLFDGIAMMHWPL
                     ECQYLSHRKVIATMAKLVPNFHCLINPILYAFLGNNFLQRLKQCVRGELFDRRAFLRS
                     RQNSAARASNPTRRPSASPLVPTGTPPSNGTENASPRDTETVPNFSSQAAALLSSPPP
                     PPKPSTKPRNLIKETPPET"
     misc_feature    34244..35005
                     /gene="UL33"
                     /locus_tag="SaHV-3_gp029"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            35507..36334
                     /gene="UL34"
                     /locus_tag="SaHV-3_gp030"
                     /db_xref="GeneID:11464265"
     CDS             35507..36334
                     /gene="UL34"
                     /locus_tag="SaHV-3_gp030"
                     /note="represses US3 transcription; involved in gene
                     regulation"
                     /codon_start=1
                     /product="protein UL34"
                     /protein_id="YP_004940206.1"
                     /db_xref="GeneID:11464265"
                     /translation="MNITITTRDFSNTEEDSQSSFSEDFNLTTSVSRTYRSILRAEGK
                     KKYLLEQLPPQPGGLRRNSNLFLYCTDKDHRRLTHAISQLKYPELITEAAEIHTIVNN
                     VRCRLRRINADEANHLQNLIYGVCTFFNQLVFVAQVRHYCDKNERALWFSREELSKRC
                     GEKSVLGSYIQRLVNVIDNAQHRELCCVLIGLLYQTPHMWARSIRLLAKIKAYLERCF
                     LTLLLDSGISIDTAFESAYHNDAYKTLFYMDKTDPCKQVTTENLQTSIELDPSVITT"
     misc_feature    35507..>36265
                     /gene="UL34"
                     /locus_tag="SaHV-3_gp030"
                     /note="nuclear-egress-membrane-like protein; Provisional;
                     Region: PHA03325"
                     /db_xref="CDD:223044"
     gene            36419..38125
                     /gene="UL35"
                     /locus_tag="SaHV-3_gp031"
                     /note="beta gene"
                     /db_xref="GeneID:11464266"
     CDS             36419..38125
                     /gene="UL35"
                     /locus_tag="SaHV-3_gp031"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL35"
                     /protein_id="YP_004940207.1"
                     /db_xref="GeneID:11464266"
                     /translation="MAMPRPPHPYSFPSLPVNESLNFRADLFCDEHRHFLKELVTVGC
                     GGYVGLLCYGMPSPTYVLETMMDFQIRPEFTRVKLIAAPILAIAIMANHYHNSYNILQ
                     ETKQRLHNLYVGPMKEKLTRSFRKLCQRLPVAVNAEVIIQCMETEDVTFGTLKQCLSQ
                     LNELRDAADLSPSEDTRSHYGLLTLYNLLYVPPKFITSRGVNIYSENLGDVTRRVHAP
                     MRSLIMEQRPRTAAIILDDVSFILSLQHLCVTHKIELQMLRSWIWAKCNELMNELYFV
                     YLQAPELKNAFQDVMSSMQLTRNDPRTLAFQNLLRDLLTFLRKVHLTDIYTVPGYIRF
                     CAFNLISYLKQAVASTSEDEPHSSDSSSSEDITFDVDPSLARGDTIYITKNPFGCSAL
                     FKVPSNLSRFIKKRQFIRRTPMYHVYVMDSGRMITRSQPLRNLYNLMLEGGSRQTGTT
                     AKELSQVAERTSNGREVVIQETLDLFADVERRDAPSTSSSTSVSSRESLLERPPRQRR
                     YISVAAFAPYSVARHRRTQRKIRLPRGPAHNSRTGPDTAPESSEADPDPRDELSDQMS
                     LL"
     misc_feature    36419..38113
                     /gene="UL35"
                     /locus_tag="SaHV-3_gp031"
                     /note="UL35; Provisional; Region: PHA03250"
                     /db_xref="CDD:165509"
     gene            complement(38374..39830)
                     /gene="UL36"
                     /locus_tag="SaHV-3_gp032"
                     /note="beta gene"
                     /db_xref="GeneID:11464267"
     CDS             complement(join(38374..39542,39623..39830))
                     /gene="UL36"
                     /locus_tag="SaHV-3_gp032"
                     /note="inhibitor of caspase-8-induced apoptosis; involved
                     in apoptosis; US22 family"
                     /codon_start=1
                     /product="tegument protein vICA"
                     /protein_id="YP_004940208.1"
                     /db_xref="GeneID:11464267"
                     /translation="MLCVRMAAATEEYRRIASFRGDFEALQRYLETESGSRILVSWPP
                     GCFIQLRNLSGLGYFESRFEDVCNKGLYVCCGEKLYPFGFVCHRTKQWRYRFIVLLGE
                     TGSVYCYDYDEDGVFLVARDVEMLVSEGLRNVDGFYGFSDLVLPAIQCDEYIARLVEV
                     QHNLQAFSRVVEDVGCRMYKVTGHSVIDTHFAIYSTEGMTIQMLTDSTSDRDRLYMYV
                     MSKSAAQIACICDIIGVLGSVSTENVFVVRLFILIDCFGVVYGYNDVFNSVSRLADSF
                     EMFIRILGAKATRNYRYSSRKSAVMRLEKPPICFHLLQNILPESLLDAVDKVFDLKES
                     ELCEADRFASFVSFKEVVERHNVYEAIYKINCVIHENATSRYFWAQELMALAESSVLV
                     KCVRDHVAARQYFLSLTDPSFELLCTKMENEESEDETLAEFIFDKPCLKCVFRKRWRV
                     FRAGRKEL"
     misc_feature    complement(join(38377..39542,39623..39794))
                     /gene="UL36"
                     /locus_tag="SaHV-3_gp032"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03244"
                     /db_xref="CDD:177567"
     misc_feature    complement(join(39337..39542,39623..39773))
                     /gene="UL36"
                     /locus_tag="SaHV-3_gp032"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(38875..>39057)
                     /gene="UL36"
                     /locus_tag="SaHV-3_gp032"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(39879..42344)
                     /gene="UL37"
                     /locus_tag="SaHV-3_gp033"
                     /note="beta gene"
                     /db_xref="GeneID:11464268"
     CDS             complement(join(39936..40859,42171..42344))
                     /gene="UL37"
                     /locus_tag="SaHV-3_gp033"
                     /note="type 1 membrane protein; involved in apoptosis;
                     involved in gene regulation; splicing tentative"
                     /codon_start=1
                     /product="envelope glycoprotein UL37"
                     /protein_id="YP_004940209.1"
                     /db_xref="GeneID:11464268"
                     /translation="MSRGNLPVKLIDCLGVAGLALFCYASYKWIDWKSKRDPYPWLTR
                     FKREVERRNRYTLAGMFVFHLLIPIMCVTLDCELRTCLQRTGYLTTSGCVLDCVFNHS
                     LVYRGPCDEVFQIMRWNISFPRKDTRDIQSTILNLGLRYYLEGHVLAHVTANLHLKSS
                     KLSVVEHLVCTKDEDGMVNGTMSLNWGLQGIYNFSSVTNRTYDTNKDVWTSPSKNRQK
                     THNTIVSFLNQEAENDFEFLKEVCHRLVNKRMKKYIVVIGRRVNRLKNEQVCRMRSIP
                     VDWHVPWINWTKFTVIPKMRWTVLVDTELVRNRVILTTIGMCILGSGMFLMLGMFFMV
                     ILWRRHDLISDLRKPPVTKSPIFFTKASGDV"
     misc_feature    complement(39993..>40820)
                     /gene="UL37"
                     /locus_tag="SaHV-3_gp033"
                     /note="UL37 tegument protein; Provisional; Region:
                     PHA03171"
                     /db_xref="CDD:165442"
     gene            complement(41134..42015)
                     /gene="UL38"
                     /locus_tag="SaHV-3_gp034"
                     /note="beta gene"
                     /db_xref="GeneID:11464269"
     CDS             complement(41134..42015)
                     /gene="UL38"
                     /locus_tag="SaHV-3_gp034"
                     /note="involved in apoptosis"
                     /codon_start=1
                     /product="protein UL38"
                     /protein_id="YP_004940210.1"
                     /db_xref="GeneID:11464269"
                     /translation="MDCESQESWQSSSTDIGRLIQASVLGKTALNAQIRRLMKSQTVL
                     LHDSGLQISICDLTYELLIINQAKKTWLERSCFSVVGQELIVFGVAEEWNSASKYPSG
                     QLVFMITTKWDVFVYHGGLLFYLAPTMSDFWHCAIVMEYWNAVFPRPLYVHVKPHCRS
                     VDELIKMYHVFELERQVLLARKDKCEKTGKKTYAKSVNGIIRSIVESYKNIESGKIPC
                     LFVERSALYANANVLFFRYYLRSKGRLEENETAESESERRVDEVPTEAFQTPLTDSKV
                     LTNSTEHAEKVCAHDIC"
     misc_feature    complement(41617..41922)
                     /gene="UL38"
                     /locus_tag="SaHV-3_gp034"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(42546..43205)
                     /gene="UL40"
                     /locus_tag="SaHV-3_gp035"
                     /db_xref="GeneID:11464270"
     CDS             complement(42546..43205)
                     /gene="UL40"
                     /locus_tag="SaHV-3_gp035"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane glycoprotein UL40"
                     /protein_id="YP_004940211.1"
                     /db_xref="GeneID:11464270"
                     /translation="MLLVLVMAPRTLLLLCSIIFGLVVVQSERCFKALGPANVNFTYC
                     WSYNHRETHSVGMEKNETVVLDFKCCYENVTGNSSDCMFVVNIERMNSSRENLTGVIT
                     LDADCVRRRLLFGGAHSMLNVLVYGNVTNPWVDEMADYTRVIRSSSDYTVYMMGARQE
                     DMRLVGNVTYEYTAGNLILDCLESPFFQETLTNNWMYLILMAVVSFLIFGETLYRPST
                     V"
     gene            43412..43678
                     /gene="A20A"
                     /locus_tag="SaHV-3_gp036"
                     /db_xref="GeneID:11464271"
     CDS             43412..43678
                     /gene="A20A"
                     /locus_tag="SaHV-3_gp036"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein A20A"
                     /protein_id="YP_004940212.1"
                     /db_xref="GeneID:11464271"
                     /translation="MWLTVAIIATAFTTIASAFFGFNSIFQILLFLIVVISVAVFTLN
                     LVALLIYDFVIDTMNELFLFKNQDDIQNEKTEVSDTMIIIFMET"
     gene            complement(43679..43891)
                     /gene="UL41A"
                     /locus_tag="SaHV-3_gp037"
                     /db_xref="GeneID:11464378"
     CDS             complement(43679..43891)
                     /gene="UL41A"
                     /locus_tag="SaHV-3_gp037"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL41A"
                     /protein_id="YP_004940213.1"
                     /db_xref="GeneID:11464378"
                     /translation="MSGNSTWTGRRFDDCRWLVGVGVFLAGLFLVACGVLTKILWKRR
                     RDRDLVRTGSEEVVYERLSLQSDTDF"
     gene            complement(44005..44364)
                     /gene="UL42"
                     /locus_tag="SaHV-3_gp038"
                     /db_xref="GeneID:11464272"
     CDS             complement(44005..44364)
                     /gene="UL42"
                     /locus_tag="SaHV-3_gp038"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL42"
                     /protein_id="YP_004940214.1"
                     /db_xref="GeneID:11464272"
                     /translation="MAAPLQCPVLVGMEDPDLPPPSYEEAMCSGNVTLTALPMSAMAL
                     PPPYEEQCLSTSLEMDPISERDSNCPGRPTSNMENLLLSDNFYSGLKWTLALFIMAVV
                     GLIFIAIIFAVVISRRH"
     misc_feature    complement(<44011..44142)
                     /gene="UL42"
                     /locus_tag="SaHV-3_gp038"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpA;
                     COG1175"
                     /db_xref="CDD:224096"
     gene            complement(44379..45338)
                     /gene="UL43"
                     /locus_tag="SaHV-3_gp039"
                     /note="beta gene"
                     /db_xref="GeneID:11464273"
     CDS             complement(44379..45338)
                     /gene="UL43"
                     /locus_tag="SaHV-3_gp039"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL43"
                     /protein_id="YP_004940215.1"
                     /db_xref="GeneID:11464273"
                     /translation="MEPEEASCDLIRLTFQLSVENGAPRNLLSLVRMHHGTKLSLPWP
                     VQWYFTYYDFQRKGSHRALSIKGIFKNYLCCDKFAVPVGVVGPDEGVESASLVVIIGE
                     KGCLYVYSYQEDAIYLVSRQGFCHLIEVGLYQYPPLRDELSPDITLSDSSLSEFLTAS
                     DLVSCWRLCRKYEGHVYAWNCEGRTVSLTVCGDHAAEDRVLHNEWLQETGSVNVINIF
                     EATTWINHAWLHVPILVNESGVVFGVDVENSRTYYLAPNLATFFKVAFLRFRNTYRFT
                     NGCFGKTVRSLSALAPTECPRGLFCRRLKKTVKRSWFSRNSSS"
     misc_feature    complement(44943..45275)
                     /gene="UL43"
                     /locus_tag="SaHV-3_gp039"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(44445..45248)
                     /gene="UL43"
                     /locus_tag="SaHV-3_gp039"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     misc_feature    complement(44520..44864)
                     /gene="UL43"
                     /locus_tag="SaHV-3_gp039"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(45594..46748)
                     /gene="UL44"
                     /locus_tag="SaHV-3_gp040"
                     /note="core gene"
                     /db_xref="GeneID:11464274"
     CDS             complement(45594..46748)
                     /gene="UL44"
                     /locus_tag="SaHV-3_gp040"
                     /note="dsDNA-binding protein; involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="YP_004940216.1"
                     /db_xref="GeneID:11464274"
                     /translation="MERKVRSPEPPTLALRLKPYKTAIQQLRSIIRTLKENTTVTFLP
                     TPALVLQTVRNYCVAKITFNSSCLYITDKTFQPKTINNVTPLLGNFMYLTSSKDLTKF
                     YIQDMSDLSAKICMCAPDFNMEFSSACVHGQDIIRESENSSVHVDFDFGVVTDLVKWL
                     APHTRVKRNVKKSPSSAGTVQILVHASPPVIKFVLSSGNELEFTANNRVCFHGVKNIR
                     LNVQIKNLYQALMNCAVTKLPCTLRIMTEHDTMLYVASKNGLFCVENFLTEEPFQRND
                     LNTFEKNYKRQMANNVSLHEDGMETEAPPEMVPSKKHDRASRKSVEADHSAKEKYDQH
                     KITNYMTSKSGGAGSSDRGPGYFGDAKEESDSDESVTFEFVPNAKKQKCT"
     misc_feature    complement(45600..46403)
                     /gene="UL44"
                     /locus_tag="SaHV-3_gp040"
                     /note="Herpesvirus polymerase accessory protein; Region:
                     Herpes_PAP; pfam03325"
                     /db_xref="CDD:281337"
     gene            complement(46982..49465)
                     /gene="UL45"
                     /locus_tag="SaHV-3_gp041"
                     /note="core gene"
                     /db_xref="GeneID:11464275"
     CDS             complement(46982..49465)
                     /gene="UL45"
                     /locus_tag="SaHV-3_gp041"
                     /note="enzymatically inactive; tegument protein"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="YP_004940217.1"
                     /db_xref="GeneID:11464275"
                     /translation="MLHRDSWARSRGEDFALWETTMEPTVIQIGNGLGTVVVCNRYAS
                     EGKTSQKSEFSRTKTSDVGGVDAPSSNGVRREYLRKCFCHGRSGARRFCRSRPGSVNV
                     YGVKNAWGEIEEAVKSADFKPAELHQLIVKYAAGLIKLKPRLDLLLGRYYYETNRNHE
                     HTSLDIYCRCDEIDGMVRDFFCRHRDYLSSVLELVQKITKGITCKGLVSAIIYLDQIS
                     RPMEGKEEMVAGIFLRIVVYLVSLVQSNFYSGLYRRAFHVEGELDLFEKLLRWFQDGV
                     VSLSVLASSDAGFFGSPGCDAVLISDQVHENDWSVIQRLGQSLARRTSVSVNVTRMDS
                     DAISLIRCLSAQRDVVCEKDVVKPTVCIYFDAWDLACVEILDFIIKDDAVGLHFVLNI
                     PDVIMKRRVLGEEEFGIWGRNVSRRLSRLGNEEIFEKEYRRLENSNRHVTVCLPLFFE
                     KLNTCLLLGNTGVVFCHHVVRYSIMDYNVPIPPCLGPDLASCNFTNYHIPVQRVVVNL
                     SKCVHVCRQQSVSRKCYGEVFLGNNDQCFNFQILREVVRDAVLLANVRLDALCDKSDG
                     KTQSAIEKFRSLSLGVVGLQTTLTMMGMTLHENLDFVERIFENLYYNALRTSVNLCIA
                     GFSRFEWFQRTIYSKGKFVYQKYPECRLTISSQDWDSLRQDILKYGLRNAHFWALGPD
                     DDVAQLLNVTPSVWPAANNVSDVRTVLHDVPADEFLRIPKLEKYCLRMPIVNRVMLKY
                     SDEEVEKILVHDPILMEKKQFEPFLYSALKLEHHLYRMCSRGLCKFVDQCIALPIRRN
                     YALSITAPLDRLTELYYFGMKVGVYKCCK"
     misc_feature    complement(47000..48388)
                     /gene="UL45"
                     /locus_tag="SaHV-3_gp041"
                     /note="Ribonucleotide reductase, barrel domain; Region:
                     Ribonuc_red_lgC; pfam02867"
                     /db_xref="CDD:280942"
     misc_feature    complement(47441..>47869)
                     /gene="UL45"
                     /locus_tag="SaHV-3_gp041"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:299130"
     gene            complement(49479..50357)
                     /gene="UL46"
                     /locus_tag="SaHV-3_gp042"
                     /note="core gene"
                     /db_xref="GeneID:11464276"
     CDS             complement(49479..50357)
                     /gene="UL46"
                     /locus_tag="SaHV-3_gp042"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="YP_004940218.1"
                     /db_xref="GeneID:11464276"
                     /translation="MASEVKKTAVKRTYDDRDTDFRKLIRPEKDVNSIWPRYIYGADH
                     QAVVGRFFVPEALVEFESQSGVLMFVLDTGVESPRTVYVSLFLLATKASNLSANTRCL
                     IVGMYSSSMATMAMTWLDGCLQTLHRRIQTLGCVQSVSLGTTSLVTCVMQGYVYNMLK
                     TDIFALVFPKELYLALDEDSKSGIQYAYLIIVYNWGEVESKPAMYVATTSIFHLPTLI
                     DVLRQRFMRERFEFLNRRVTRPGHFVTCTGVVQKLGWCLREDIHAGVLIRKEVKLSVM
                     RLEHFNVEIGSFKEFV"
     misc_feature    complement(49482..50267)
                     /gene="UL46"
                     /locus_tag="SaHV-3_gp042"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03262"
                     /db_xref="CDD:223027"
     gene            50356..53256
                     /gene="UL47"
                     /locus_tag="SaHV-3_gp043"
                     /note="core gene"
                     /db_xref="GeneID:11464277"
     CDS             50356..53256
                     /gene="UL47"
                     /locus_tag="SaHV-3_gp043"
                     /note="complexed with large tegument protein; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="YP_004940219.1"
                     /db_xref="GeneID:11464277"
                     /translation="MSRRLVDLNKITEELRTKNLDAQGALTTISKIEIAAIDVREITA
                     SKIRQFLQYIPNKGYHFNFIQKNVVYYLLSHATLSRNSDPLTLVADLVSELEKYVQRN
                     SGNSPYEWLNNQKTLEQFKTFIAEILKIQESFSSNKFLKATLDDKASKKDLSDNGTQY
                     LIRNVLTQVTKTVTEIRALINCRLVAELVDYLYRTTTNWFRETLQYTTFRKNNDQDLD
                     TVLKMIYFYTYHRRANSFLETAFNEFTNEGRQRFKIFTISNLDGDQQTGAEYIRDTSF
                     KMFNACLSDKDSSGLLFPIISTQLSVLNFMSIENLFFHPGLVYRLINGVIATRIGDKL
                     DVLSKFLTATTDRVFRSTVSTKSNGLKDITENISKLTELGLNYETSRLYIQMCLTKQT
                     PEKNDQITPYLLDQVKELSNQICLIVYNAYLFFLCLNVYSPTFLFNHRRRILLEQQKS
                     LLVGSRTDLDSIWKNVVMNVNYYFPAWFTEDEFDVCTKGSTPIEKEYLYRDLINKWGD
                     VLFTLKYRHSSEPAQIEQSTQTITITDIIERCAMVNLSDVPYESLLPLSSHPNFAEKF
                     VNLVIVPEFTQTLNIPYAQFKTVGAPRLMQIIQACRLLMPGQMTLYHKLVALYNLTNF
                     VSKIDGGVFRTIYDLIVEITAILENLCQESLSLNVDLIAELMAESLSNNLRDDVNPII
                     DEVIRNSSSSMQQYVEHTRLCYAIAMTDGRLVTKENSPDTVLIILASKTILTMSLRNF
                     VTAADHLVKQAKNLNDNLTLTQNRMKRIWRRVNQILDDMTCAGQCAQTHPIYGEMIKS
                     LRKTLKTLKGIEHRLSQALEQSEKSNKLVTSSLSRIIKTCSVLGNNNIFEHGLSNCIT
                     EAVGTIKSHRTFSRLPISSYSEHLPNAEELLHKFFQPYRNTSSTSQIIDMSSVTDVSN
                     EFQYQDVFENRYSPLDNLDKLLNWYVNTKEQAQEDICASLRPTLTKCVETPS"
     misc_feature    50377..52929
                     /gene="UL47"
                     /locus_tag="SaHV-3_gp043"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            53263..59592
                     /gene="UL48"
                     /locus_tag="SaHV-3_gp044"
                     /note="core gene"
                     /db_xref="GeneID:11464278"
     CDS             53263..59592
                     /gene="UL48"
                     /locus_tag="SaHV-3_gp044"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); involved
                     in capsid transport"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="YP_004940220.1"
                     /db_xref="GeneID:11464278"
                     /translation="MQIYQASCDQASRRFGPRAGSQCVCNCLLYIHTLHIKGAHYTLN
                     KDALDLILQEGSRLDTITEQELLKKNIKPHVYRLGEEVSRTIQTSFGRTAHALSRPFN
                     GTAETRNLDGYVCLGIFDFLLYAYNKPKPVYILVTVDALARAIVFTDHDIFVFDPHAS
                     DRCPNAAVYQCRSLDDVVTILTSFGLILGSFYYDALIIYMIDLSIFPIPASEIDRTII
                     SLYRDPDISLPIPIPPGSPTTPIKPPPTSVPALEPVPSPSTPIPTSKKTKAEKRKSDT
                     PHKTSKKNPRKTTHQTYNCTEALPSLTRYEHLVEQIEKELTLHTLKAPPTSGWTLYSQ
                     TSGLPFDESFLTERVHQLTAQTIDNLAMMRYFVNPSDDTVRDRTRATLQTHLRQLWGF
                     SQATDTFLAILVKQDLNLVRLYNVYLSRRKAPWTTLERLLGSKIYVVFTHWGENHGPR
                     VKQWTQNLIRHIEKTDIHELEVKIRTYLWSNPLSVQERFVCLKGEDRDTVSSLVATRQ
                     SVNSEQLAKQQNSYRHMSECIAHIDINRLDQLSPQILNKNLSEMSKVDHVTKSQLKKQ
                     TENQLRDLYNDLNTNFQKILADKNNQILSGSLPGPELTQLQKQVNQALTLCQTLKNLN
                     LYDTNIDEQLHKLTEYITFILTGNASTSISYPENLTALRKEFSEVIKQKEYNETKINE
                     LLNNIEFILKDPTSRSSNISMSMLRAQLQELSNLDIKKVSGAETRFQAISKLINSLKQ
                     EEDLTRQFVASISYSNMPNNQTLKRQLRLKDLLRDDEDLRKQYISHLAEILNTVVDKL
                     VTQEFWPPATFELLKELINQLPPNNLTRDLRVSTSIFAQLSKKIETVSKATDKKNIPL
                     LEDMTQFFLSHGESFSALMSSGIGLNLKTIYEKYKAQLEAKYLQQAEDTWKTKARELK
                     ITSPNTVEAFLRTAPSHTAASAVTPLLEEKLKAYIEEESKKIQQENQQRLTESQNRID
                     LELTRVVDALRSETPSLVLAVDLESVKNILSALGPNTQAILEKFNRNVLSALSKIDKQ
                     IDRSADKKIYELLAGKPAKITGAYSGDPNILKTALSHLRHLDAYLTQETKTILNHMYR
                     QLLFITTELSDRPAATFTETEYESRFLQYQECQRELLSNFETAKSSIIREANDLQGAV
                     KKQQSTKATEKPPTLNRQVVSQLSYPLTPDLKDTAFHQVLEEHLDSARQSLTKEIDLL
                     DIQLKSITELQQAKTSSLIARWQDLVTRHKVDSLEIPTPEAKLLLSDPVTALTETVQK
                     AATDLPYLISEKTLKWVLMFIQDAIQEISQSTDHPQNGHLVSYHALQQKAQQHLTTVT
                     TDISNNASCENFVAHQDTITITEDIIQQAEAAWRSLQPKRVAGGEARYRQIQSDLNKM
                     RHSLSDLALKESLATEYFELLNGLHSFSYGLDFTTQLQKIRQLQMRFTELSKKEKTSS
                     NDSSFPVYQKNLTASIPTSSFLRGLVALEKRVLDGYKYLSDLVNKQFLINKRLEDVPS
                     LILPAKSDQASTDRLSRLQFSRDTQLYEIIDVFGDHQIVTPNGTPISLTPTYGNVIFK
                     YLALHRSQHTASKRHARLKNIVTSRYKAIMVSVAIAGTLKSFWKPISDYDLRPLLTND
                     EIETFSRETNTLVNLKIFAYVVTTAWTLQSQDITETGSRTKLSIAELCMILTTLYPEY
                     IYTILKHSIQSSVTSLLHTLKQDIVNEALNTTQNPPPWEIDELKGFCIEQSLWSTATI
                     SRILWDNDFMRQLCQDVGPYKMKSGKLLQYILAVSILPQDVLQCLWLELKPQYAEQYV
                     SLYDFVQALFDIFSYPYDVTVGTPANDPQLTSGEKILQSISLRKKCTQEEEEMSKIFI
                     ETETVLDYALGSLVFGVPVCCAIRVADISGGRTLLARHLEYTPNDQDFKRILRSRDLN
                     FGYLISQTWTNTPIEQCWFQSQAKKIRDYLQHPVKLDFTPLVIYGSLTRYTESVLKPP
                     LTDHKPNSRIVIDNPFPIIPLEQTPTPEPLSFQRVPVSIDFLQDTPPRLAETHSEHSE
                     TVEPATAGDSVASNSFSEPVFRQNDTADTILSKDDVTTVSPSAATASFGQQPITNLTH
                     NIQKALHIIKMVRTDLRALTESIIETTRRLDFLYL"
     misc_feature    53281..53805
                     /gene="UL48"
                     /locus_tag="SaHV-3_gp044"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:282670"
     misc_feature    <54865..56145
                     /gene="UL48"
                     /locus_tag="SaHV-3_gp044"
                     /note="helix-rich Mycoplasma protein; Region:
                     Mplasa_alph_rch; TIGR04523"
                     /db_xref="CDD:275316"
     gene            complement(59587..59817)
                     /gene="UL48A"
                     /locus_tag="SaHV-3_gp045"
                     /note="core gene"
                     /db_xref="GeneID:11464279"
     CDS             complement(59587..59817)
                     /gene="UL48A"
                     /locus_tag="SaHV-3_gp045"
                     /note="located externally on capsid hexons; involved in
                     capsid morphogenesis; possibly involved in capsid
                     transport"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="YP_004940221.1"
                     /db_xref="GeneID:11464279"
                     /translation="MSSGSGSNSGAGKKDEDKKRHVGIQVLELKAEYLERPVINTMLS
                     KYARMSSMFSDKNAFKLDLLRMMAMAAGARRS"
     misc_feature    complement(59596..59778)
                     /gene="UL48A"
                     /locus_tag="SaHV-3_gp045"
                     /note="Small capsid protein of Herpesviridae; Region:
                     HV_small_capsid; pfam17086"
                     /db_xref="CDD:293691"
     gene            complement(59810..61285)
                     /gene="UL49"
                     /locus_tag="SaHV-3_gp046"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464280"
     CDS             complement(59810..61285)
                     /gene="UL49"
                     /locus_tag="SaHV-3_gp046"
                     /codon_start=1
                     /product="protein UL49"
                     /protein_id="YP_004940222.1"
                     /db_xref="GeneID:11464280"
                     /translation="MAVMYRDLLMELFVPLCVHDDRFHLQLAVGGTVRGEELMDCVLT
                     MFITDKRFLPRELSDRFYQRFLVLWSSCSLQQREALNFTFKRIVMTKQYFLFLSYIYL
                     LYCLHEISGVVSFLRFEQYDAFHIHQNLSLYPGDKLNTLLENVNFTSLNDLHRFLFRT
                     DLRLPISTQISSPCLSLLRSKKYDTSLDIIVYQDNVWQRRQKSRTQSVEDLISALRRR
                     AGQVPCGNPVYVVAKYAVENFCVRCPRYLVPLRGLSLNDDGTRMQRSESHAEPSKIVM
                     HGLSIALRRGLIGSVLELPVWCFCVLKCERYLSVNSLVAVVCRYCGHCLNLGKEKLQC
                     DQNFPLNSMFYYRDRQEKSVIYDTNAELIHCSLCGSQRLTKERVYEASLEDVYGFRCL
                     RVQWKAVVGLNAACAVYDREAVLDVIVPCSSRTCDSTTILRLCTAARLLKLVTHGSAF
                     LCQRCQAAVEPKDTCLDDETCENRCLACAVVARLPCQRRYV"
     misc_feature    complement(59918..60664)
                     /gene="UL49"
                     /locus_tag="SaHV-3_gp046"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     gene            complement(61266..62087)
                     /gene="UL50"
                     /locus_tag="SaHV-3_gp047"
                     /note="core gene"
                     /db_xref="GeneID:11464281"
     CDS             complement(61266..62087)
                     /gene="UL50"
                     /locus_tag="SaHV-3_gp047"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="YP_004940223.1"
                     /db_xref="GeneID:11464281"
                     /translation="MDLDKALHHDLVSATRRILKLGPNELRVTDSSLICKNPNYSVCD
                     AMLRTDTVYCVEYLLSYWESRTDHIPCFVFKNTGCAVSLCCFIRAPTKLVSSRHVGEF
                     NVLRVNDQIVITLKDIEDLKPSAYGVLTKCVVRKSNAASVFNIELIAFGPENEREYEI
                     LLRELYQKKSVISGTEKTASKVAGVRSPSRMAKKTVPPPPPPPPFRGCGCQSFRKRFE
                     KSSPSPDLPSNEVQSSSKYGCLVRLKELRVETVIAVLVCSLGLMYVLLRYGGYVP"
     misc_feature    complement(<61563..62087)
                     /gene="UL50"
                     /locus_tag="SaHV-3_gp047"
                     /note="nuclear egress membrane protein; Provisional;
                     Region: PHA03326"
                     /db_xref="CDD:223045"
     gene            complement(62118..62408)
                     /gene="UL51"
                     /locus_tag="SaHV-3_gp048"
                     /note="core gene"
                     /db_xref="GeneID:11464282"
     CDS             complement(62118..62408)
                     /gene="UL51"
                     /locus_tag="SaHV-3_gp048"
                     /note="interacts with DNA packaging terminase subunit 2;
                     involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="YP_004940224.1"
                     /db_xref="GeneID:11464282"
                     /translation="MTETVDGDLELEDSYIKFEPMLPKVYELLLPSLDARLNFVNAGQ
                     KYAAFFKYVYGQSPSCSHAEILCDKTKLLTAIVTKLMDINGILEEKEESSSK"
     misc_feature    complement(62145..62363)
                     /gene="UL51"
                     /locus_tag="SaHV-3_gp048"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            62447..63994
                     /gene="UL52"
                     /locus_tag="SaHV-3_gp049"
                     /note="core gene"
                     /db_xref="GeneID:11464283"
     CDS             62447..63994
                     /gene="UL52"
                     /locus_tag="SaHV-3_gp049"
                     /note="involved in DNA encapsidation; possibly involved in
                     capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="YP_004940225.1"
                     /db_xref="GeneID:11464283"
                     /translation="MHRMYFGWSAEHNSPHSPLINELLLQAHPRKLPSTPSDQSVTNS
                     THGNSERENETQSTGIPDLIGTACDLDAELAQFELVDAERLKKLCTPLDIDTRCNLCA
                     IISICLKRDHDQTWLLNYSLLCFKCNYAPRTSLSVMIVMSEFLQLLNHHFPDIQFGQL
                     FRQNVLTVFDFHLHFFINRCFEKQNGDAMENENVTLSHLAVVKSLVLGEETVPYSKQR
                     RFSHHKQKIVIKIPEEAKETLDTFLQHSTPGPDRFTHLLCYMWAGTQVMPNTPLSSLT
                     EAKHQQLDSLNDADEPEYEKTTGPIYLSPIPVLQWKNQTNTVCLLCELMSCSHYDNVL
                     LKSLHHRITSYCQNNVKMMDRTQLVLAEVLRECAFAPPESHEDLSQHAMQSDSAPSLE
                     LTPDLLFCTILKQAGVTGIYKHFFCDPQCAGNMRIVNENVLFARIHPNHFQEVKLSIC
                     HDNNYISRLPRRVWLYIHIFKAFQIVKRNFKAKTQLSDFLREFTQILEACEIKLVDPS
                     FVVDKYV"
     misc_feature    62447..63991
                     /gene="UL52"
                     /locus_tag="SaHV-3_gp049"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03233"
                     /db_xref="CDD:223016"
     gene            63987..64820
                     /gene="UL53"
                     /locus_tag="SaHV-3_gp050"
                     /note="core gene"
                     /db_xref="GeneID:11464284"
     CDS             63987..64820
                     /gene="UL53"
                     /locus_tag="SaHV-3_gp050"
                     /note="interacts with nuclear egress membrane protein;
                     involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="YP_004940226.1"
                     /db_xref="GeneID:11464284"
                     /translation="MYKNKIRSTARRSTLRSLSKHRKSLSRSGSSPLSDTPLSHTKLT
                     LHDLHDVFREYPDLELKYLNMMKMAITGKESICLPFNFQSHRQHTCLDISPYGNEQVS
                     RIACTNCNDSQVSPTASDAMVAFINQSSNVMKNRHFYYGFCKDAELLRMSTNQPTLFQ
                     IYYILHSSNHDIVPFMYARNGRVHMHVIFENQDVHIPCECISQILSATKGDYSITLDI
                     VRGHVVISATCHAITAHSVKIDLGTLQRKIDEMDIPNDISELFERYKNLLQELCNFHQ
                     T"
     misc_feature    64041..64793
                     /gene="UL53"
                     /locus_tag="SaHV-3_gp050"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     pfam02718"
                     /db_xref="CDD:280816"
     gene            complement(64811..67885)
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="core gene"
                     /db_xref="GeneID:11464285"
     CDS             complement(64811..67885)
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /EC_number="2.7.7.7"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="YP_004940227.1"
                     /db_xref="GeneID:11464285"
                     /translation="MFYNPYLGGGRRTGVPKRSNDPSFLQIVPRGVMYDGQTGLIKRN
                     TSRKPIMFFNNNKYTLCDDMAWPSLSGAGSLAPIRGEVRFHTYDQCDSVLTIETNENV
                     PPRYRRHIVPSGNVIRFFGVVESGQSICVNVFGQQSYFYCEHPDTDRLREVIHSIAEL
                     VPEPRHPCAVTVLPANKMSIYGYGTSFVPNLHRVSISNWMMARKIGQYMLDHGFSVYE
                     IRVDPLTRLVVDKKLTTFGWCFLDQYEVRTQGRVSTCDVELDCEVSELFCRPEDTSWP
                     LYRCLSFDIECLSAGGGFPTPENVDDIVIQISCVCYATGKDDADVSFGRSGKHLFTIG
                     SCAPIDNVDVYEFPSEYELLLGFFMFFKRYGACIVTGYNINSFDFRYLLARLENVYKV
                     NVSRFGKLSRDGKFFVQSSQGKTYISTSQTKVVISGTVVIDMYPVCMAKTSAQNYKLN
                     TMAELYLKQQKDDLSYKDIPVKFLANEVGRAVVGKYCVQDALLVKDLFNVINFHYEAG
                     AVARLAKIAMRRVVSDGQQVRIYTSLLDECSCRNLILPTYKNSGLGDDVTYQGATVFE
                     PEVGYYNDPVLVFDFASLYPSIIMAHNLCYSTLIMDNGECPEADKIYEVKFENGTVYR
                     FVKPEVRPSVLSELLTKWVAQRKAVREAMKDCADPLKRTLLDKEQLALKVTCNSFYGF
                     TGVANGMLPCLPVAASITRIGRGMLQDTARFIHDNFASPDFLKTFFNEEDYVEGGVEA
                     KVIYGDTDSVFVCYRGLKASALKASAERVARHVTSCLFTHPVKLEFEKVFISLMMICK
                     KRYIGKIEGTTGLSMKGVDLVRKTSCEFVKKVIKDVLALLFDDPEVSQAAVNLHRYSM
                     EVLKKQGPPAGFLKIIERLHEARDQLQTGRVCVDELVLSSVLSKDISLYKQPNLPHLS
                     VIKRLAARSEELPSVGDRVFYVLTAAPVDSRRKMNNYELAEDPIFVKENQVPIHADKY
                     FEQVLKAITNVLSPVFPYDLDKKDRFLLALMPARMYLAKPFLSYAVKDISYV"
     misc_feature    complement(65618..67060)
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="DNA polymerase type-B family; Region: POLBc;
                     smart00486"
                     /db_xref="CDD:214691"
     misc_feature    complement(66377..67060)
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:299142"
     misc_feature    complement(order(66416..66418,66752..66760,66767..66772,
                     67025..67036))
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="active site"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(66416..66418,66752..66754,67028..67030,
                     67034..67036))
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(66416..66418,66755..66760,66767..66772,
                     67025..67033))
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176647"
     misc_feature    complement(64898..66313)
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:278562"
     misc_feature    complement(64925..66214)
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both synthetic...; Region: POLBc;
                     cl10023"
                     /db_xref="CDD:271693"
     misc_feature    complement(order(65642..65644,65855..65857,65867..65869,
                     65948..65950,66131..66139,66146..66148))
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(65639..65644,65648..65650))
                     /gene="UL54"
                     /locus_tag="SaHV-3_gp051"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            complement(67895..70546)
                     /gene="UL55"
                     /locus_tag="SaHV-3_gp052"
                     /note="core gene"
                     /db_xref="GeneID:11464286"
     CDS             complement(67895..70546)
                     /gene="UL55"
                     /locus_tag="SaHV-3_gp052"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     binds cell surface heparan sulphate; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="YP_004940228.1"
                     /db_xref="GeneID:11464286"
                     /translation="MWKVFLYLSVFINFRYGVSSNTTSAPVSESSNRSTSSVMTSGTS
                     RVSRSSGSVSASSSSVAANVTSTPIPKTIFNTTLRENEVLSVNTSKYPYRICSMAQGT
                     DIVRFAKNIKCTPFNPNTDFEEGIMVVYKRNIVTHTFKVILYQKVMTFQRSYRYVYST
                     YLLGNTVERVAVPMWEVHYVDRASRCYTSYTRVMNGNTYVLYHQDNHQNDTMWLVEDD
                     YSNSHNRRYVTVKEVWTTYGSAWMYKETCSLNCVVTITMARSRYPYDFFVLTSGDIVD
                     ISPFYDGTNGKSFKENADKFYIRRNYTKLTYYGDSNAPWETYDKVAFFQRSDVSMSWV
                     ITDENKTVCQYKFWDSSDRTIRTEGSDTYHFSSQELTATFVASKNDVSENGQKSEYQC
                     IQDEARQKLERIYNQTYNSTYEKKGNVTMHITTGGLIVFWQGVTQKSIASLERLINNA
                     SEANSSTTSRRKRSADSSNSSSSDSERSLLYSQVQFTYDTLKNYINNALGHLVEAWCI
                     DQRRTLEVFAELSKVNPTRIMSAIYDKPVAAKFMGDVIGIAKCVLINQTSVKVLRDMH
                     VLDGPMKGQCYARPVLLYTFVNSSHVQYGQLGEDNEVLVGRHRTELCEYPSVKVFIVG
                     DVGYKYVDYYFKGLINLDSIEIVDTMIRLNIEPLENTDFRMLELYSKDELRSANVFDL
                     EEIMREFNSYKQRMRFVEDKVADNIPPYLRGLDDFMSGLGEAGKHLGVAIGAVGGAVA
                     SVMEGIGSFLKNPFGSFTVLLFLLAVLGVIFLIYQRQKRTYEKPLEVLFPYTSQMIKE
                     APPPYSPPPYTDVSKPSSKNQLSSEEDDKYSPEDAKAILKALMKYDEQERRNLKRVSE
                     EGSEGGTGILDALRYRSRGYNRLVSED"
     misc_feature    complement(67898..70351)
                     /gene="UL55"
                     /locus_tag="SaHV-3_gp052"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     gene            complement(70509..72806)
                     /gene="UL56"
                     /locus_tag="SaHV-3_gp053"
                     /note="core gene"
                     /db_xref="GeneID:11464287"
     CDS             complement(70509..72806)
                     /gene="UL56"
                     /locus_tag="SaHV-3_gp053"
                     /note="involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="YP_004940229.1"
                     /db_xref="GeneID:11464287"
                     /translation="MNLLQKLCVVCSKCNEYAMELECLKYCDPSILLAESSPFKRNAL
                     AITRLYRRIYPELVKQNHVQTSLLTLYMEVSLKALYEDTEMLDQALMKYSQKPDRMEY
                     YRTILRLDRCERHHVVELKFTDDVKFSVPLGTLNEVERFLCKMNCVYAVMSPDHGLEI
                     CCQLLRLLRSLCGISPVACPEVYADGITCAQCYEELTVVPNQGRSLNKRLQGLLCNHI
                     AVHRPCTQSGTNMQTVEQDLSEYVHRIPKLGGLVSTIKALFSSSSVSHSYIHEAEETL
                     KEYNLFTDIPERIYSLSDFTYWSRTSEILVKRVDTTINQLNVYHSLCRLLMNEISRYM
                     YGEEVEDIFVLGEKILSGEERLFVGSVFAAPNRIIDLITSMSIQAFEENPAFNRLHEN
                     NEMYSKIKSLLEEIRRPSEDEAVERPVRSGSEVETVGATGAAEAACNQALECGDPRVN
                     MHNITREVNLRKRAYLQKVSEVGYNKVMRCIKNQEKLTNKLIDVNLVGTTCLDLISKM
                     MNGFIDRNKFKDDATVIDVCEDLSYDEHLYVVNNLIHKKLPVESLPTLGQQIYRLCNG
                     PLFTHCQDRYPMSHNVDMAYACDNAGVLPHVKDDLVKYAEGTVHPHEWMVVKYLCFFN
                     FTKCDDLNALQKEMWAHVRELVLSVALYNEAFGKDLSILQVRECTLETDGIILTYNRD
                     WPLILKSEERLYKSKDLYLLLYRHLVQPGETPTIFREPERPISSIEYSSSERRRLRKR
                     HRDGSFLLDLVREDVEGVFVPKCLY"
     misc_feature    complement(70893..72797)
                     /gene="UL56"
                     /locus_tag="SaHV-3_gp053"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            complement(72971..76441)
                     /gene="UL57"
                     /locus_tag="SaHV-3_gp054"
                     /note="core gene"
                     /db_xref="GeneID:11464288"
     CDS             complement(72971..76441)
                     /gene="UL57"
                     /locus_tag="SaHV-3_gp054"
                     /note="contains zinc-finger; involved in DNA replication;
                     possibly involved in gene regulation"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_004940230.1"
                     /db_xref="GeneID:11464288"
                     /translation="MGDSELSAISPVGAAAYLYFMKIDERVNEILSVLSLCNKSSSVV
                     IAPLLVDLTVDHDFSASVRTPVIRYDGGVLTKVTSFCPFAIYFHNTEGIRSFCEDHGN
                     VEELCHETRQRYGVESFQSDAERTSTDINALCSLMGLDANEVTVHVVVGHGLKEFLYA
                     GQLIPCPEECVTVRIGDCEGVRVPLYPSTLFTASETDKDVNDVSLISTNAFVLDRGLY
                     VPSVSEVLFYYLYTSWGQALRFSETTILIESALKQFVHDSQQSVKLTPHKKYFGYMSQ
                     KLSNLEKDHLMLSDAVISELGFSFSSVFFDSAYSLSPSMIYSDWPLVMNAKNHQELMQ
                     SLIDLKLHFSTHVGALIFSGNSILYQNRLVFFAPSKGSVGGASGSSQDALLRAIQFSN
                     GLVGLCEDSYNDSRRIVKCQGLISKEDRYTPKHLALVCGTCPQLFSAVVWYLNRMSMY
                     NTGTNGADALYNHIVACSSKMCSACGGRCCHTCYGTAFIRVQSRLPTIPKQPKKEPYV
                     VTMFSRFMNDVDILGTFGRRYPSDAKESAGEGKSDDAMTVSNRSTSVDRIYYLTKILE
                     YCKKARLVDPVTGEDVFNIQTKSDFVSVVSALNTFIDDQAMSFVSEVRMKSSRDEVMG
                     STQAFNLDLNPYALSFNPIFVYEYYRAVLAIIQNVALITATSYIVDNPLTVSSVSRWV
                     NQHFQSIYGAFSTASARKGFLFVRDIKSSKTVDHDRLMDFDSYRHGRYTVIPTEVKLC
                     RLSVYALNMFRVKNRPICRASKGMPGHVFFRRDGTVKRNPAKGCLGFLLYKYHERLFP
                     ECPLSCLQFWQRVCANAVPKNISIGDMGEFNNFIKFLLGVTSDYSEHDLTDVQPDSFL
                     SYVENRFHNKFLFYYGFKDYITTLHGLTTRLTCQNHAQFPYLLGATPDFESVVQYMAR
                     IKDLKCENGVPAPRAATVARESLMRTIFEQRSLVTVAFSIEKYTGSNSSKDIFQFGQI
                     GYFVGSGVERSLNTSAMGSGDYKFMRQRCVLATKLVDVLIRKPRRDNVLFDADLIKNR
                     VMTALDSDNLEHDPELVAMAEIMSSREDLPERDDVLFFVDGVEAVADSMMSKFTVVSD
                     RGVVDFSLESLEKVFSTGVESVSEEGVHDLSSVFVNNVRDAARGSSSEQVAAGPLLDD
                     GLVPAKRSRL"
     misc_feature    complement(72974..76441)
                     /gene="UL57"
                     /locus_tag="SaHV-3_gp054"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     gene            complement(78728..80311)
                     /gene="UL69"
                     /locus_tag="SaHV-3_gp055"
                     /note="core gene"
                     /db_xref="GeneID:11464289"
     CDS             complement(78728..80311)
                     /gene="UL69"
                     /locus_tag="SaHV-3_gp055"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     involved in gene regulation; involved in RNA metabolism
                     and transport"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="YP_004940231.1"
                     /db_xref="GeneID:11464289"
                     /translation="MDYPRSRYATSLSTLDEYERKARRARRFALDYELDNKRPRREPA
                     PRRYDVDPDVIYNRCRPRSRRSPCHSRPAVDTYYHRRRRTYTSATTPHASGTPATTRE
                     NPFSQVLDAELSAMSEQELDHLSELIQQKRIQRQKKDAEELTAPSSTSPPYDLQRYTA
                     ESLGLIPYRDDVRKPVAFPDYNDSGRILLSHDELMQTDYIFDIRRQFDWLKPTTLQKL
                     VIERKFSVNNASSLHTLVAMIDETLSYLKFHYVHEIPVNPYDPYVSTVHSMRQLLFNK
                     LNNVDLACIMKEKEWGPNCSLLKQLARKPVRANHSVDNTYDVQRRPVTDFTHPLHQAM
                     SFVTSFARSVALLKRRAEHSNTPMFLSRFDDNHAIEAYRCGMIADLTIGAFRRHECDN
                     ELCATKLHIALQSYRVMLSFCPFDEHCVLDLSPLIPEHGEEGCNDTPTAPDAPATFSD
                     TEAPANTTANTWNPSPEPVHEAAPERTWNVSSTEIPMQTTTSETTVPDLSTTDPMTMQ
                     SLTPDYDNMLCYSDMEDDY"
     misc_feature    complement(79070..79744)
                     /gene="UL69"
                     /locus_tag="SaHV-3_gp055"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; pfam05459"
                     /db_xref="CDD:283185"
     gene            complement(80440..83109)
                     /gene="UL70"
                     /locus_tag="SaHV-3_gp056"
                     /note="core gene"
                     /db_xref="GeneID:11464290"
     CDS             complement(80440..83109)
                     /gene="UL70"
                     /locus_tag="SaHV-3_gp056"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="YP_004940232.1"
                     /db_xref="GeneID:11464290"
                     /translation="MTLVLFATEYDSANIVANILLKASSNHYVYPLLVKHKASQLVHF
                     CLQTQKCHNSQRIATVFICNAERLNLMSYLTSRTPISTSTLIENLNEEETKLIYQHLF
                     RTITTPVLGGEVREFKHLVYFHHQAILRYLNETFLTPTSPSWFLSIFGHTEGLLLLTM
                     YYYLFEQQYSTIPTVEEYVRSFTTNTGQIIPTHTSMNDFMTLLLSSNFKTRIPQFVDY
                     AIKRNQRDYIELTNVDTQINSFRDRARLPDTICVHYIYLAYRTALCKNRLLKYRQVVA
                     YDPEASTQCTSQPLFLGQHLVDDLLHVMNKYFSLDNFLNEYVEVHTLDTKHQLNLMGY
                     QINDCENFVRFCGNITTVTRTIDKINTLTESVFSPIERSLGGLLRICASTRSACRYLT
                     QNETENTFQKQYLFSSTLPCHDPIPVYRIQLPGNKHLFCAVRQESWSQTLFPPDFLRH
                     LPKNCQLSDEALTDALWLHDDGIADMRPEVQFYHTRHEIFNERLPVFNFIGDFDLRLR
                     ETVTNLSKTEVFDLCRGLRRVFVTVWKTLFPETNEANYPIYFFKSACRHLAFSEGRDN
                     HDEHNLHPNSQVYCHCTEKLGMRIIAPFPQNTVVTQTSVLHAICQILNHAICLDPSLH
                     QHLDTISHPENSLDAGIYHHGRSIRLPYMYKMMDDQGYLMQCRLLPLFIVPEAFRYDP
                     LIFIRAQLDLHNLLHHCPPRFPGQEVSTESPQRNTGTRILMDVRDKLCPKPGSNFIDT
                     RSLDVTRYRRRALSEVIAHHIGTDETTPDLLQNLISRRVWPPILHHLTQHYPPDISAQ
                     FLQDEIVFDLSNLQCISVKKQQGHRLKDFRCLNRVHRNPQETVQVFIDLKPDRCYSLW
                     TTLWSRCFTNKCHSNAKNVHISVKLKPPTDTEQ"
     misc_feature    complement(80467..83109)
                     /gene="UL70"
                     /locus_tag="SaHV-3_gp056"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03139"
                     /db_xref="CDD:165411"
     misc_feature    complement(80497..83037)
                     /gene="UL70"
                     /locus_tag="SaHV-3_gp056"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03119"
                     /db_xref="CDD:222991"
     gene            83162..83827
                     /gene="UL71"
                     /locus_tag="SaHV-3_gp058"
                     /note="core gene"
                     /db_xref="GeneID:11467423"
     CDS             83162..83827
                     /gene="UL71"
                     /locus_tag="SaHV-3_gp058"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="YP_004940233.1"
                     /db_xref="GeneID:11467423"
                     /translation="MECFRRFCQILWCARKVDPRADYVLLKPSEDVELQELQEFLQQH
                     FDQLGVTNGDMSNYARDKSVVEHLLKLMPIYKQCQTKCTFLKSYLSEHCRPHMRPSAE
                     VECRKSQRIMEALDVVILKLIIGEFTMSEDESLEMLLDKFSADQATLCEVQKVMGLVD
                     MDREKSSSMLTTSSEVAEIDLGTVDDAVVSMIKNSPEVPLQPLMEVKVKKKEKTLLAV
                     PGS"
     misc_feature    83162..83758
                     /gene="UL71"
                     /locus_tag="SaHV-3_gp058"
                     /note="tegument protein; Provisional; Region: PHA03373"
                     /db_xref="CDD:223062"
     gene            complement(83866..84846)
                     /gene="UL72"
                     /locus_tag="SaHV-3_gp059"
                     /note="core gene"
                     /db_xref="GeneID:11464292"
     CDS             complement(83866..84846)
                     /gene="UL72"
                     /locus_tag="SaHV-3_gp059"
                     /note="enzymatically inactive; DURP family"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="YP_004940234.1"
                     /db_xref="GeneID:11464292"
                     /translation="MAPILTDRIGQHLVLSPPRESRFQSFFDSPLIKDEAETKTEEEK
                     YFNLNFCLRSTQEHILIYYSPINMLYEHQRKIPYKWTPSSFFVKQCQNRLTFFNKHIV
                     WLAEERSTTLPLGIDVYIPAGYFGITFYKCLDLNFICMADLVEPGLQTPRVQIVNLTE
                     NFQAISPGAIEGDICVFPYFLPEPWQVMNLPQPNDKKFYLIKLHAPLILSPGQVRTIL
                     LDIAYLYSFGACALIFGTRHFNRSGVLIRPTIWLPGTVASVSIVNISDQPVRLTVHAP
                     IFKIIFTTYHFAYLIVNTHPIKQLIVPPISDTGFTHTPDSVFLKQLSSPK"
     misc_feature    complement(83872..84846)
                     /gene="UL72"
                     /locus_tag="SaHV-3_gp059"
                     /note="dUTPase; Provisional; Region: PHA03128"
                     /db_xref="CDD:165400"
     gene            84880..85140
                     /gene="UL73"
                     /locus_tag="SaHV-3_gp060"
                     /note="core gene"
                     /db_xref="GeneID:11464293"
     CDS             84880..85140
                     /gene="UL73"
                     /locus_tag="SaHV-3_gp060"
                     /note="type 1 membrane protein; complexed with envelope
                     glycoprotein M; involved in virion morphogenesis; involved
                     in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="YP_004940235.1"
                     /db_xref="GeneID:11464293"
                     /translation="MWTKTVLFLVFLWTVALALGSTPTADTNHKSTFYDVGCTSHTYE
                     LSMQSFAAIWLCCNIVVLLCSFGVVLKHFCFQTFTVSTTKGY"
     misc_feature    84946..85128
                     /gene="UL73"
                     /locus_tag="SaHV-3_gp060"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            complement(85112..86134)
                     /gene="UL74"
                     /locus_tag="SaHV-3_gp061"
                     /note="beta gene"
                     /db_xref="GeneID:11464294"
     CDS             complement(85112..86134)
                     /gene="UL74"
                     /locus_tag="SaHV-3_gp061"
                     /note="contains signal peptide; associated with envelope
                     glycoprotein H and envelope glycoprotein L; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="envelope glycoprotein O"
                     /protein_id="YP_004940236.1"
                     /db_xref="GeneID:11464294"
                     /translation="MEKQIIITVIIIVSATLASQIYIQTPPLKLPPESIQAGPFHLNN
                     TSYFWMKLIQQNRKNLPKNFSIYKNKYLFIKYNPQPSNKTMLEPLTTEPCGYIPSSGC
                     FHEILNVSVKNYTGEKYCNLTTYNPMLYNIPRWNSKIRLPGNITYHTDSQSLYFFGLT
                     TLITKVTLKTNCSNSFNLLNAMSTTFFRLRTNDFNRTRSLFRRLKRKQTSGSTNIHNS
                     SNYNDTFTNPVSSNNLKKYATWMYLDLNRRLPMWCNSKRNYSAQIVTNSTVYTPYGNL
                     DLSELYTPSYNTTNITTFKKQYSSELIQEYLDALFFIKQIDHNITVHSRFENSMFFSN
                     LSWWTP"
     misc_feature    complement(85187..86050)
                     /gene="UL74"
                     /locus_tag="SaHV-3_gp061"
                     /note="Herpes UL74 glycoproteins; Region: Herpes_UL74;
                     pfam07982"
                     /db_xref="CDD:285256"
     gene            <86143..86320
                     /gene="UL74A"
                     /locus_tag="SaHV-3_gp062"
                     /note="beta gene"
                     /db_xref="GeneID:11464295"
     CDS             <86143..86320
                     /gene="UL74A"
                     /locus_tag="SaHV-3_gp062"
                     /note="type 2 membrane protein; upstream exons
                     unidentified"
                     /codon_start=2
                     /product="envelope glycoprotein 24"
                     /protein_id="YP_004940237.1"
                     /db_xref="GeneID:11464295"
                     /translation="KTDTAFLEVCWVSFVNVLVLMAICLLIYRCIVGFQDDIVIRTLD
                     VLIQCRNISDCRSV"
     gene            complement(86369..88462)
                     /gene="UL75"
                     /locus_tag="SaHV-3_gp063"
                     /note="core gene"
                     /db_xref="GeneID:11464296"
     CDS             complement(86369..88462)
                     /gene="UL75"
                     /locus_tag="SaHV-3_gp063"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     complexed with envelope glycoprotein L; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="YP_004940238.1"
                     /db_xref="GeneID:11464296"
                     /translation="MVTKLKTRKWINLTIKMMILFQLGSSTHYIVNVPYPVIRYLRET
                     NITQCANGTFRNTSTIRDDAITFNFYNAKENNKMQVFQVPRCLFTSKLAEELMDKVDL
                     FESFESYKRKLDVYATVPTDIPYLHYNHILVKEAPTTTSDSSYNVNISDFRSLDTSSC
                     TLFEKHDVIFTIHTSCAEQTLSDQHSEINITFTSSFILTKMKLHNHSLILLFGDLNNI
                     TFKAPFEKDNFIFRQTQQHDVIILIRKDAMATYPFLKKTDFPSVLKTNYENVSEIFKV
                     FNQQAVNNLMENTCTGIHEKTIDLLFTYTTLVFSTIRNTHRDLRTTIEELTGIMEATN
                     YIFTCIPHQKSSQHLMYNASSTYHTLLNNDHWLRSNVDVNTHLIYVAIKQDATSSITE
                     KAMNTLTESSLKIHKKNIASFISRHDRRELGLMAFIIHSTSSYNKQRRQIFATLTGLC
                     SMPEANHWSNIVTKGADLGLADLYTPCSGGGRRDHTLERIAKLFPAMTPKSTSTQTLF
                     RVLTFFRPSINRFPEISCLNTEDTFTTVTLPRHTFLFTNEHTIAGTSFPVTSTIVGVN
                     IIITVIPSNATCQRSNQMHTTLPIVMAKNITLTSECNFCESALIEYHDEAGLVNLMYL
                     HDTEDLKFTLDDKNKIFVNYPRTHYIMALRNGTVIEVTDVVLDIKDTSLLVLTLYTTA
                     ALFGLFLLYRIFRLC"
     misc_feature    complement(86372..88363)
                     /gene="UL75"
                     /locus_tag="SaHV-3_gp063"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03295"
                     /db_xref="CDD:223036"
     gene            88594..89343
                     /gene="UL76"
                     /locus_tag="SaHV-3_gp064"
                     /note="core gene"
                     /db_xref="GeneID:11464297"
     CDS             88594..89343
                     /gene="UL76"
                     /locus_tag="SaHV-3_gp064"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="YP_004940239.1"
                     /db_xref="GeneID:11464297"
                     /translation="MSSSGQKCRSLCDLPKYRAVVGKRKHFLLYRQIVRSLKSFQRFN
                     CTLGGVFPPELATCRRSVFFEVTLLRRIPDCIVLFNIGKLDRKIVCYVFEFKTTQSSA
                     DAVSVRKHCTHYLQYVQGLRQLKDTVEDLKEFAIGGVEGDIWEVIPVIAFYQQNEMSP
                     SFCRTFRVTTLRFRSESVVRALCRGQDESLRNVLSLTRAEDRARSRASSRARVRRRRL
                     RAARGQRAVGTRARAAASAGRHRNRVKTKTG"
     misc_feature    88633..89166
                     /gene="UL76"
                     /locus_tag="SaHV-3_gp064"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; pfam01646"
                     /db_xref="CDD:279917"
     gene            89153..90976
                     /gene="UL77"
                     /locus_tag="SaHV-3_gp065"
                     /note="core gene"
                     /db_xref="GeneID:11464298"
     CDS             89153..90976
                     /gene="UL77"
                     /locus_tag="SaHV-3_gp065"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; involved in
                     DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="YP_004940240.1"
                     /db_xref="GeneID:11464298"
                     /translation="MNRLETFYHLPVPKIALGPVPVAVPVSVVAAFEPHVDNVLWAPE
                     RVLRRLRDATGIELRQRRDEAVIDRIKKRYLKEELRQFRDAVANQCLGLEGRLSEAEM
                     LLRQQVTDLPVSSSPRSSPVRIEGEAAPSEGAVDLGKGQKTGAVTWAAFCHDDRHALH
                     VGITQNDPTICFHRDFRGELIGTMFENSSTWTFSFGVWYYRLKRSLYTQPRWKRVFRL
                     MQMESFSISQELLVATVGALENVTVYPAYDCALSDLEAAACLLAAYGHQVWEGRDAPD
                     SVIGVLQNLPYILNRLSEEIHREMANWKESVTTNFYSYQDSPDMRYYVPMSGGRRYAS
                     GTFGRHILVRIFTHRNVLQRLAGSEAQVSAVVQERISGQAVDESTLTMWTRKLLSHRL
                     GREVPIFLHEQQYLRSGLTCIETLLLLWKIVNSESVFVSRKRRFSLTDIIGSDLGAPK
                     ATVDPGYTGSNVRNFEYLVEQYIIPWYQWDPTVTASQLFPGVVLLAITESVRSGWDPL
                     QREDVKTMDGGAITVQATKINPIADFMFAQSSKQYSALKRLELHDTLLFHYENGVGKV
                     LSVSLPRHRVFCLGSSLFNVNDIYECIYFFVLGFLPAVAVT"
     misc_feature    89153..90973
                     /gene="UL77"
                     /locus_tag="SaHV-3_gp065"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03252"
                     /db_xref="CDD:223024"
     gene            91100..92101
                     /gene="UL78"
                     /locus_tag="SaHV-3_gp066"
                     /note="beta gene"
                     /db_xref="GeneID:11464299"
     CDS             91100..92101
                     /gene="UL78"
                     /locus_tag="SaHV-3_gp066"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein UL78"
                     /protein_id="YP_004940241.1"
                     /db_xref="GeneID:11464299"
                     /translation="MFSLRTEMLLHGAMMGMFVAAAMLILLAVAMCFVAAKRRCVPYA
                     VNIFAGNLLVSQLLTIVAMMFSQGFMYDPPFNPSYCRISMFFEDVGTYATSALFLFLI
                     MDRMAALANGRAEWKHQTQQNVSTAIFASIFAWALSAVVSLPTFVTSDSAHRFPFSCE
                     TPLGYSAMTMSLHVWFALAAPLIVVVSYVLGACYEEERDNLWPYVARVWTFYTTCLLF
                     FVPYYGIRIIRSFFGLPGMFPEVMDYVEVVCHMVFLFRVVILPLFVLNLSSPAPMVEM
                     DHAFESMMKVGFCQETMLAVWKKFREVCRRNPSGDKLKLMDDFERGPVFVADLPSKS"
     misc_feature    91193..>91669
                     /gene="UL78"
                     /locus_tag="SaHV-3_gp066"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            complement(92135..92935)
                     /gene="UL79"
                     /locus_tag="SaHV-3_gp067"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464300"
     CDS             complement(92135..92935)
                     /gene="UL79"
                     /locus_tag="SaHV-3_gp067"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL79"
                     /protein_id="YP_004940242.1"
                     /db_xref="GeneID:11464300"
                     /translation="MEPSTETHVRTGRFSFTCTHNLIIQITTKLASGQPLTSFQLEEL
                     KIIKLSCLMLFHRGLELLLLRETLNNLGISDNTVLSRKAPLDYWFHLAEELKHIFPEL
                     DLNRIFNEHEAAEISRHLTIKPMAADLLLTKFIQRHTQLLLKLPPDLARNGNILFSLG
                     TLYGHRLFRLASFFNRYWGTDSHEPLIRIICQKMWYFYLIATGKMLITPNALEIQRTR
                     HEYGIFNFIIDDYKTFTGTTQLYQEQPLSPSVISDTHQYLSVPEIQFE"
     misc_feature    complement(92222..92911)
                     /gene="UL79"
                     /locus_tag="SaHV-3_gp067"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03364"
                     /db_xref="CDD:223057"
     gene            92952..94646
                     /gene="UL80"
                     /locus_tag="SaHV-3_gp068"
                     /note="core gene"
                     /db_xref="GeneID:11464301"
     CDS             92952..94646
                     /gene="UL80"
                     /locus_tag="SaHV-3_gp068"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="YP_004940243.1"
                     /db_xref="GeneID:11464301"
                     /translation="MAPVYVGGFLVRYQEAPEEDELVLPRHVVEEWMENEKVEGIPLN
                     VNHDENAVVGTVLGFQNVPAGLFCLACVDSPRFLEIVEKTAEKSEVVASGPRGELTPD
                     PVLEFLSGSYSGLSLSSLRCSVNAAESVGPLSSDDGRYFKHVALCSVGRRRGTLAIYG
                     RQVNWILSRFPDLDEETCQVIRDSVRTSSEKRSQEVEDRFHSDSYGLLANSVDALYIR
                     ERLSKLRYDKKLLGLEGQSTYIKAGEPTSVPAVCDIKEQDAEEEAESDHPASVMAHAL
                     PSAGPGSAVAPVASVPGAMSLANDGVYLPKDAFISLLNLNAGTHGVSGGAALDSSIPR
                     RLAQSVPASYPPSFPYSSPLLPTGYDDVRYGPYHYGPMVGHRPYDMRQDYHLDRDRYG
                     HMMELGYHPYYHAARGRFQGRKRKKGEVSSDEEDEMSFPGDSDYSKPRKRLRPEKEHS
                     TCGFDCEQRHGRYEEIKDALSEIRRDLAAARSAMQMSAAPMSTSLSPTSSATSSCQDQ
                     NLVTEKKSAEKAPVASTSAMPTVNASCGPLIPPKERPQNMLDLNRRLFVAALNKME"
     misc_feature    92952..>94265
                     /gene="UL80"
                     /locus_tag="SaHV-3_gp068"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03160"
                     /db_xref="CDD:165431"
     misc_feature    93012..94025
                     /gene="UL80"
                     /locus_tag="SaHV-3_gp068"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     gene            93765..94646
                     /gene="UL80.5"
                     /locus_tag="SaHV-3_gp069"
                     /note="core gene"
                     /db_xref="GeneID:11464302"
     CDS             93765..94646
                     /gene="UL80.5"
                     /locus_tag="SaHV-3_gp069"
                     /note="clipped near C terminus; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="YP_004940244.1"
                     /db_xref="GeneID:11464302"
                     /translation="MAHALPSAGPGSAVAPVASVPGAMSLANDGVYLPKDAFISLLNL
                     NAGTHGVSGGAALDSSIPRRLAQSVPASYPPSFPYSSPLLPTGYDDVRYGPYHYGPMV
                     GHRPYDMRQDYHLDRDRYGHMMELGYHPYYHAARGRFQGRKRKKGEVSSDEEDEMSFP
                     GDSDYSKPRKRLRPEKEHSTCGFDCEQRHGRYEEIKDALSEIRRDLAAARSAMQMSAA
                     PMSTSLSPTSSATSSCQDQNLVTEKKSAEKAPVASTSAMPTVNASCGPLIPPKERPQN
                     MLDLNRRLFVAALNKME"
     misc_feature    <93765..94025
                     /gene="UL80.5"
                     /locus_tag="SaHV-3_gp069"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     gene            complement(94705..96303)
                     /gene="UL82"
                     /locus_tag="SaHV-3_gp070"
                     /note="beta gene"
                     /db_xref="GeneID:11464303"
     CDS             complement(94705..96303)
                     /gene="UL82"
                     /locus_tag="SaHV-3_gp070"
                     /note="upper matrix protein; involved in gene regulation;
                     transcriptional activator; targeted to ND10; targets Rb
                     proteins for ubiquitin-independent proteosomal
                     degradation; DURP family"
                     /codon_start=1
                     /product="tegument protein pp71"
                     /protein_id="YP_004940245.1"
                     /db_xref="GeneID:11464303"
                     /translation="MSTATVSTAARRTPRNFNTLEHFSCQALRLIVTNPCHLPANEGK
                     SVNTHLMVRVPKACVLCCAQEISSVHDAIQLRDLNIKGLTISQPPSTEDSTDEISLEL
                     YNFTKKKASPGQPLSVCVFAIPLARVPITGLHIFKTRQDENVSTAVTRAQTRAHIKRA
                     TFFWNVKINLKDIIWTRRQSPRLPRGQVFLTNFYFNTGQIPLTLVDAVDLLATSDNST
                     YIQKTETVGRGPLMKIYLQNFSAHPPTELFLHISVYSHQGEVVTRHNPEPFLSRHPEN
                     GFIVRSPQNVTLADTQTVTLHIDNAFESNHRYDAVFFPKDYAGLSMEGGFFPDRTAIQ
                     IKVTNLTLSEYHIDYLQDLGTIHLFPRGFFFPLPGKDKTRLCHLRLRAGIVPRQTVVS
                     GLVSEFKPQSDSEEEESDDSLPTPTVLKEAKYFAASESEEEEEDAGEGPSSITRTTMT
                     PSAEAITVVIPSWNVFMAVTNLPPMTCSISAPGIKATSYLKSDYSDVRTAADIRGTCD
                     TIPEPPQAPPVIRTAPTSRSTARI"
     misc_feature    complement(95212..96234)
                     /gene="UL82"
                     /locus_tag="SaHV-3_gp070"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(96423..98000)
                     /gene="UL83"
                     /locus_tag="SaHV-3_gp071"
                     /note="beta gene"
                     /db_xref="GeneID:11464304"
     CDS             complement(96423..98000)
                     /gene="UL83"
                     /locus_tag="SaHV-3_gp071"
                     /note="lower matrix protein; involved in immune
                     regulation; suppresses interferon response; inhibits NK
                     cell cytotoxicity; binds NKp30; DURP family"
                     /codon_start=1
                     /product="tegument protein pp65"
                     /protein_id="YP_004940246.1"
                     /db_xref="GeneID:11464304"
                     /translation="METRLTRRRHQAGDLVNKIGPISGHVIKCIFNGTDTKLQARETR
                     MLSTGVHVRVNVPAIIFATHFTADSERDHDWRGLKSQHTAFYSTEIQNIQVAVTNTSD
                     RVQSTNTDPFSIYVYALPLKVVTISGLHVYRPSSEKKTRSSIPEADVIVQRVASHWSV
                     RMTVTQLIWTSNRNDDTEQRHSSCFILDPHGIPFEDFDSVTDLVCSDEAVILTKVQAL
                     TSEKKLRIYLECPKEEDQLPTRLFCHLLLENKNPDIIMNRNPKPFLRPYGTNGFVIMA
                     PRNIIVKPGKTSHVCLDMTFRCLGIDYIGLIVPKSLPNLSISSNFLRSSQHLFLEIQT
                     TGETAVEIPKGEDIAALHFFESHIFLHKNDQFYTFTGQYDVECKLEYDHVWDDIQDAI
                     HTSAVSAVTGPEDSGDESDDPFKSATTGEKPRHDSDEDNSDEEDTGASKNAVLTWPCW
                     KAGTYTCHLPPLIARAYGPNLKKHDFYWSENPTYRIFFGLSGEWGPPISGKRRRPTAE
                     SSSLTVVPSTSKKRHRF"
     misc_feature    complement(96921..97943)
                     /gene="UL83"
                     /locus_tag="SaHV-3_gp071"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(98197..99513)
                     /gene="UL84"
                     /locus_tag="SaHV-3_gp072"
                     /note="beta gene"
                     /db_xref="GeneID:11464305"
     CDS             complement(98197..99513)
                     /gene="UL84"
                     /locus_tag="SaHV-3_gp072"
                     /note="involved in gene regulation; involved in DNA
                     replication; DURP family"
                     /codon_start=1
                     /product="protein UL84"
                     /protein_id="YP_004940247.1"
                     /db_xref="GeneID:11464305"
                     /translation="MSHPEKQLGKDPPLSRLSTIMHSTENILTLNEKWSLSQTMTEGT
                     YKLIQLNLDLRPDDLHKDFNILLSEAIHIEPVLQQPQEAMICAVANADSDLKAAFSIF
                     PGHPGCKIIRSIIDRDIDRLAIIRLSLNIFALRVVRPLMEQLPVKRPSEHYNPTTLHD
                     CINLQEEQVTIRVENECHRITIGIVDTILCWHVIEGGISGPRGLTSRIALHLPKLPTL
                     PQPVFSRLLSSSCPLTLSSLSHSADNTLKFNVTATQGVEMNTPISFELQLFQDTVQQP
                     YFSRTPSPYFTPNREEYLDVRLPYDLTVKQAYTLRLYRRFYGPFLGLFVPKPNLPVKM
                     PVTIWLPKTWLEITIVGRNVSLQRDLVIGELYFIASDYITNRGCSSAFTHQVKSSLHL
                     NNKHSCVSVLGTSIRLEDLLSLNIRPRETIQSPDTKTTLAMILKNT"
     misc_feature    complement(98224..99447)
                     /gene="UL84"
                     /locus_tag="SaHV-3_gp072"
                     /note="Cytomegalovirus UL84 protein; Region:
                     Cytomega_UL84; pfam06284"
                     /db_xref="CDD:283854"
     gene            complement(99543..100454)
                     /gene="UL85"
                     /locus_tag="SaHV-3_gp073"
                     /note="core gene"
                     /db_xref="GeneID:11464306"
     CDS             complement(99543..100454)
                     /gene="UL85"
                     /locus_tag="SaHV-3_gp073"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="YP_004940248.1"
                     /db_xref="GeneID:11464306"
                     /translation="MDVTVFCTFEHKLTITDISKLGRLVGAVIPIPHRHHLIKHQNLG
                     LHQFLDKNRGYTRIRSLLRNMTPTVLRRVEGNQLTLNVMKHGQCYTVLNTGPVLWEKG
                     DTLCCIPPFNGNITAQNTTSSSPLTIKIHDWELVTPWIVPASLAAEINQRLLVTALFS
                     LDRSYDEVKAATQHLRTITFRNTTFLIPDPVVDGHLLLDIKNACISMSMVANLASELL
                     NTYIRKLALEDSSMLLVKCQELLMRLERDRPESRLHHIAPEDEVSRLSALFVMLRQLS
                     DLINEQPMFTVCDVSSDNKSATCIFKG"
     misc_feature    complement(99546..100454)
                     /gene="UL85"
                     /locus_tag="SaHV-3_gp073"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03259"
                     /db_xref="CDD:165517"
     gene            complement(100533..104576)
                     /gene="UL86"
                     /locus_tag="SaHV-3_gp074"
                     /note="core gene"
                     /db_xref="GeneID:11464307"
     CDS             complement(100533..104576)
                     /gene="UL86"
                     /locus_tag="SaHV-3_gp074"
                     /note="6 copies form hexons, 5 copies form pentons;
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="YP_004940249.1"
                     /db_xref="GeneID:11464307"
                     /translation="MENWSALELLPKLGLSNDFLMHVKTSAGEEMFDSLRMYYGDDPD
                     RYNINFEAIFGTFCNRIEWVQFLSTSLALAAHAIRFDDLNKMTTGKMLFHIQVPRVAS
                     GAGMPTSRQTTIMVTKYSEKAPITIPFELSAACLTHLKETFEETILDQVLNIEAIHTV
                     LKALKNTADAMERGLIHNFLQTLLRKAPPYFIVQTLVENATLCRQTVNRVQRANIIRS
                     FKNKLVTSTFVLNRTRDRDFITRFLLRMVEAATESILDNPQTYVTSSGKRLSGVLIST
                     ANVMQNLTSMLNQLITKENVTAPATYGNFVLNRDNAVTAIAHHAIMADFNQYTAHLAT
                     DKQDELTETALGRSATQQMTQLQMDVIKLGEHNVALENCRRVYKNTDTRDPLETHINL
                     TFFFPMGLYVSDDRSYTTVESKLKLSDTMQNTLPTAVYFLNRDRHIQKIEYADTLKTI
                     CHPVFFDPAPCLQAFIENGPPADRSLCQCQFQHEHMGSIARRAIHFYRVRREVCRTTN
                     EIKQDHSNEEFFKTSNPSLYTELHPFFDFTHHMENGDVAALCTPRIMVGNLPQGTAPS
                     GFHDSRARQAMEIMKTRPPPDYEGTLQLLTVTLTNPNYPELFYLLDLLIHGNLDAFLI
                     LRNLIARCIVTTFNTRHLLAFAHSFPIIKLIAEHLADGLIPTQIHTHYQNILAIVRFV
                     ARVTSLSSPNVKLADEPLHTYVSALHDPRLFPPFLTHLPQTRDHIRIIADRQPLANAN
                     IEIRHHGVSDVPRLAAMDADEPLFIDEDRISDEDCVLHKVYYFCIIPALTNNRACGLG
                     LNLKILLVDLFYRDAFFPPASREEREDLAAHPGEMLIQLVRDVATNHNVGILETCREM
                     FLALQFVPENAKVLEVQTQLDPAQNHGNMTFTSYQHVLYNGFCATTAPKILAEYTIAI
                     PFHRFYSYPGIAMAVSDDIKNFIGDFPHYHRNDGGFPLPTAFAHEYHNWHRSPFSIYS
                     ASCPPNLQSIMTLGTMHHKLSPVSFILQSKVRLHPGFALTGVRTDTFQGDTLLYSGKS
                     STSLIINNPIVTKEERDICTTYHVTQHVNNIDMGLGYTCNTCLAWLHQVRSDMGATVQ
                     DLFQVYPMHVHRDPEVDQWIRQTIGAERIQMLDTDTMAALTFGKIPTKQDVCNLHGQR
                     ATCELLLTPVTTPVNYFKNPNTPRGRTSCTLGVDPYDETAAQHTLYNHQEPDAQTFAA
                     TNNPWSSLPGSINDILYNQRHRERLGFNSRIYSPCTQFFNTEDIINANKTLFKTIDEY
                     MVRAKDCLHGDTDIQYVCMEGTDELIENPCRFLQEAYPLLTTTTQGLLENRMKNPNSY
                     NEAAETHFGNYAIGEIIPLQLQIMYNS"
     misc_feature    complement(100557..104525)
                     /gene="UL86"
                     /locus_tag="SaHV-3_gp074"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     gene            104595..107102
                     /gene="UL87"
                     /locus_tag="SaHV-3_gp075"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464308"
     CDS             104595..107102
                     /gene="UL87"
                     /locus_tag="SaHV-3_gp075"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL87"
                     /protein_id="YP_004940250.1"
                     /db_xref="GeneID:11464308"
                     /translation="MASSDSICSREGESALIVESFRQRYVLNVPVHVNSYNLTQELSM
                     EEDARFARSVRVDVERVRAVFRTLCEACPLHVTTERDRVRIVLCRLLLGPVAVPCYCD
                     EWDTNEYMVEYTHFCSGPLLYVHRRCRCRTPAGQGLAFSVMRGHQTTHLFRGLLSLAE
                     WNQHLPRMFCACMTFTSDRYVMACLPSALSLHLDDYPYLMGEIGHFLTITEIDECVQA
                     MVRHLGQQVSNRVQIHYKLLFGVHLRPQAPLARSGTEHFFALELQKLWLNVEYHNGVT
                     FDFFGCIFRQFYIRRAQTMLALRTPEQTACVLSAFSLSRFKQQVLYFKISVNYGKHKL
                     GSGRNLLRYRRLHILFSDADAVWRNLFFIYYEQANADQVESVATGKEAAGSSAASSVR
                     AETSSSGTSRLLRQTVTATDLCRRRYIRIVTRLLFARYRRRCETVMSHETPQAILDFT
                     GSFWSVSYLAQVQETRRATQRYAMQLRKLIGGREFSEVTSVTLDRIAVNAFNTNRVIN
                     MKATLSARPRSRGHFPRNMTHSFVMYKHTFKEPACTVSTFVSNDAVYTNSLNVNIRGS
                     YLEFLYALGVYRLYVNIDHFFLPAAVCNSNSSLDVHGLEDQAVIRSERSKVYWTTNFP
                     CMISNTDNVNVGWFKAATAIVPRVFGADLEGIMLKELTCLRGMSDMCIDYGLHRVFTE
                     LEYRNSYQIPFLSKQLILFIRGCLLKLHGGDKRLYLDRFMFEVVKSGVFDYSKNITGH
                     TKIKHTCALIGSRLANNIPKILIRNKKIKLDYLGRNANVLTVCRHVEPGRTSVGRLKV
                     LLEVLRALYAVSNAPHTKNVIRQTVARLGGRLEHVGE"
     misc_feature    104619..107081
                     /gene="UL87"
                     /locus_tag="SaHV-3_gp075"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03375"
                     /db_xref="CDD:223064"
     misc_feature    104637..105254
                     /gene="UL87"
                     /locus_tag="SaHV-3_gp075"
                     /note="Protein of unknown function (DUF587); Region:
                     DUF587; pfam04532"
                     /db_xref="CDD:282400"
     misc_feature    105261..107012
                     /gene="UL87"
                     /locus_tag="SaHV-3_gp075"
                     /note="Herpesvirus UL87 family; Region: Herpes_UL87;
                     pfam03043"
                     /db_xref="CDD:281093"
     gene            107105..108241
                     /gene="UL88"
                     /locus_tag="SaHV-3_gp076"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464309"
     CDS             107105..108241
                     /gene="UL88"
                     /locus_tag="SaHV-3_gp076"
                     /codon_start=1
                     /product="tegument protein UL88"
                     /protein_id="YP_004940251.1"
                     /db_xref="GeneID:11464309"
                     /translation="MEGWLDAALVLPKSGLVLDHMLENEGVSDFVRRMLPAPEDVKEN
                     CVFASELAFIASGRHGRRTSMFSIYWHLHSELIYALTGITYCVKIVIECGQIQYRDAR
                     DAYAIPGIYMIRPSLSDSGAISSRNVSWPSAGIRWPGDVRIWLVQRKVETFEKFQELL
                     NRLSESRIEKWCPMDLGEKIDPTLESLSLGGTEFACRVSVAYDHLRAGDLPRTAQQLL
                     DHCVTLAAAKIMLWLDVPRLDNFFLCQVCLYELGEDEVGEELIGLLHTKNKVSNPDFN
                     LHRRAMKSVACLAFLLNCLLRHQNMIPELEERLNENDLYVIATRRYYRSSGGVERRTI
                     AAGSRLLSEYADTLSVSDSWRRLNLPVPLDASFTREQLVGLLRT"
     misc_feature    107111..108235
                     /gene="UL88"
                     /locus_tag="SaHV-3_gp076"
                     /note="Herpesvirus U59 protein; Region: Herpes_U59;
                     pfam04529"
                     /db_xref="CDD:282397"
     gene            complement(108238..113704)
                     /gene="UL89"
                     /locus_tag="SaHV-3_gp077"
                     /note="core gene"
                     /db_xref="GeneID:11464310"
     CDS             complement(join(108238..109368,112817..113704))
                     /gene="UL89"
                     /locus_tag="SaHV-3_gp077"
                     /note="contains ATPase domain; involved in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="YP_004940252.1"
                     /db_xref="GeneID:11464310"
                     /translation="MLRGESLTQIQRRYEELKKKKKSPASYISTCFPNVAALYRKRFQ
                     MMHPELGLAHACNETFLPLVTFCGRYRDYNSPEDEKRPHLLFSETLKNAIDQVTFWPC
                     PDHQRDAYQKIDALTELYRDPQFTQINNFMIDFKKWLDGGFTPADQEHTRIHLEPFQK
                     NLLIHVIFFIAVTKLPVLANRVLQYLIHAFEIDFLTQPSIDIFKQKATVFLVPRRHGK
                     TWFIIPVISFLLKHIIGISIGYVAHQKHVSQFVLKEVEFRCRYTFATEYAVENKDNVI
                     SIDHQTAKSTALFASCYNTNSIRGQNFNLLLVDEAHFIKKEAFNTILGFLAQNTTKII
                     FISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHCFNEKGDATACPCYRLHKPT
                     FISLNSQVRRTANMFMPGSFMDEIIGGTNKIVENSALITDQSREEFDIFRYSTMNKNA
                     YNHFGTKLYVYLDPAFTTNRHASGTGIAAIGTYRNQYLIYGLEHFFLKDLSESSEVAI
                     AECAAHMLISVISLHPFLEEIRIAIEGNSNQAAAVRIACLIKQNILCNHRIPVLFYHT
                     PDQNNIEQPFYLMGRDKRLAVEEFITKFNSGYVKASQELVSYTIKLSYDPIEYLLEQI
                     RNIHRVTLTELNSTYSAKKNRQADDLIIALIMSIYMCDEIRSYRFKPI"
     misc_feature    complement(join(108241..109368,112817..113704))
                     /gene="UL89"
                     /locus_tag="SaHV-3_gp077"
                     /note="DNA packaging terminase subunit 1; Provisional;
                     Region: PHA03372"
                     /db_xref="CDD:177609"
     misc_feature    complement(join(109360..109368,112817..113581))
                     /gene="UL89"
                     /locus_tag="SaHV-3_gp077"
                     /note="Probable DNA packing protein, N-terminus; Region:
                     DNA_pack_N; pfam02500"
                     /db_xref="CDD:280634"
     misc_feature    complement(108250..109281)
                     /gene="UL89"
                     /locus_tag="SaHV-3_gp077"
                     /note="Probable DNA packing protein, C-terminus; Region:
                     DNA_pack_C; pfam02499"
                     /db_xref="CDD:280633"
     gene            109542..109784
                     /gene="UL91"
                     /locus_tag="SaHV-3_gp078"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464312"
     CDS             109542..109784
                     /gene="UL91"
                     /locus_tag="SaHV-3_gp078"
                     /codon_start=1
                     /product="protein UL91"
                     /protein_id="YP_004940253.1"
                     /db_xref="GeneID:11464312"
                     /translation="MNSLLAELNRLGVPHDRSEDLLVFADTLFQKFSFVFQDQESNPR
                     KVDLLSSLFEHLTIECVNEMLDLCANNNEAVEKLSE"
     gene            109788..110426
                     /gene="UL92"
                     /locus_tag="SaHV-3_gp079"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464313"
     CDS             109788..110426
                     /gene="UL92"
                     /locus_tag="SaHV-3_gp079"
                     /codon_start=1
                     /product="protein UL92"
                     /protein_id="YP_004940254.1"
                     /db_xref="GeneID:11464313"
                     /translation="MVMADMVRPLECSPCEALGGCEMHQVCNALTEEIQLRCFYVCVN
                     CYKTHVCDLSEGCALVSTLEGSVCLKTGLVYESLCPATRVNVLEPTGETSVDDVNVVG
                     VIMASVYNYLMAHATRYADVIKEVVDDGRLKKQVEDAVYFTFNRVFRSVQNVQRISLP
                     VISQLFTQLIIGIHAKNTKYDSSVIKVSRRKREDALLKQMRFEYGNAPVFGS"
     misc_feature    109848..110408
                     /gene="UL92"
                     /locus_tag="SaHV-3_gp079"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            110398..111840
                     /gene="UL93"
                     /locus_tag="SaHV-3_gp080"
                     /note="core gene"
                     /db_xref="GeneID:11464314"
     CDS             110398..111840
                     /gene="UL93"
                     /locus_tag="SaHV-3_gp080"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="YP_004940255.1"
                     /db_xref="GeneID:11464314"
                     /translation="METHLFSDLDFQYRFDSLAQVPIHLVFDETVLTLEKLSQLVGVY
                     FKTEWGQDWQRALFTVVPRRWCLRQYLDQRGLKSPDVKIVCQHAVFTTIGVSCVDRVI
                     LGGRLVYVRFVLNHRQSSVAAENRRSFVDCEFFVRDLLKGRHFRSQEEASSDRLVLPV
                     NDRPFFEIPHGDARSKIVGQQLLLRSGVTEQYTGGALEPPSKIRGYELSKRPEVENPD
                     ILYAFGENEGRIIPWTEEWESGGVVGIQTVWDVSAQVRVHVLWYQRSFWNSLKIDYRD
                     EEVDIRQSLETYRRHLVVGSSVFENIYRELRVNVAERRAVRQLFDCFVSADLDPSFLW
                     EMACASLDLWIYRVEKESCIIKALTTCLQQSRDVQGFRQYRVVGQGGRREAWADVIYN
                     ASGRVDLGLQVSLEVCSSSGLWRTKDRHGYVLDWVANPEVCVIYATSHLDIYWILPGG
                     FGTVLPIPVHGVDLGLLYERFKTPEVLFTT"
     misc_feature    110398..111753
                     /gene="UL93"
                     /locus_tag="SaHV-3_gp080"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:282425"
     gene            111776..112798
                     /gene="UL94"
                     /locus_tag="SaHV-3_gp081"
                     /note="core gene"
                     /db_xref="GeneID:11464315"
     CDS             111776..112798
                     /gene="UL94"
                     /locus_tag="SaHV-3_gp081"
                     /note="possibly involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="YP_004940256.1"
                     /db_xref="GeneID:11464315"
                     /translation="MASTSVCCTRDLRLLKYFLQRECVWRRVGASSKHREYVAIASKS
                     ATFDMDGQDSRCLLCRIIVLSKDGVNVVCLSINTTYMGSYSTKLHRVKHDVGGVETFY
                     SFKIDDELCPKTVPFAPTFTPVRSTVSFNGMSAEFFYDVCSLPSAEELKSIMVKGGEQ
                     SNKKAIRLGGPGAWAVKTSLGVDLYFYLLEYDLYTTCTGKDFLPSLARIVSATTCCGE
                     MSCPFCKDHGTHVDCTGKYVGPVPDKGMCFCYMLCKMPTAPITNDRYMPFLCDSEEAT
                     HISVSGAGKSKVTLEDPLESYITVYNSAGKALPLKSGCWKLVKLSHPASPLLLCACPV
                     LKGVVL"
     misc_feature    111779..112795
                     /gene="UL94"
                     /locus_tag="SaHV-3_gp081"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03352"
                     /db_xref="CDD:223053"
     gene            113703..114818
                     /gene="UL95"
                     /locus_tag="SaHV-3_gp082"
                     /note="betagamma gene"
                     /db_xref="GeneID:11464316"
     CDS             113703..114818
                     /gene="UL95"
                     /locus_tag="SaHV-3_gp082"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL95"
                     /protein_id="YP_004940257.1"
                     /db_xref="GeneID:11464316"
                     /translation="MSSEAGSSGAVSTALCSVERLVELSARSDPVLGVSEVLKFDEAV
                     EMALVACEAASPHDRYRLIETPSENFLLVTNVIPKEMATCSGESEAGEKKAVNQDLLG
                     CLYGEAFSPPVVSSRDYVLKNLRHTANYHGELLYGSYLMYNKEHIGLSLSINKASHVE
                     SILRDVFAPGLLEHHNVCDIEALLWLLYSGPRSFCARDACFGREQLGYHMPFPALLPT
                     LFYEPVVDYVTYMNLAELYVYVWYRGYEFASTRDDFRVSLNSVTLDRLQEVLKAVRAR
                     FSDREVPCWPVSSRTCVFCALYSQNRLCLDVARNGIGAVFYSPILLQDCPAVVTDVTL
                     SHILPGQGAVTLFPVYHIGKLLDAVRYAENGVARLEL"
     misc_feature    113763..114776
                     /gene="UL95"
                     /locus_tag="SaHV-3_gp082"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            114818..115198
                     /gene="UL96"
                     /locus_tag="SaHV-3_gp083"
                     /note="core gene"
                     /db_xref="GeneID:11464311"
     CDS             114818..115198
                     /gene="UL96"
                     /locus_tag="SaHV-3_gp083"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="YP_004940258.1"
                     /db_xref="GeneID:11464311"
                     /translation="MTSTNKELLKEAMRTQLEKTHHQFLKRAYGEKHHLTHHQVLRVM
                     RAALQQEQRRDALAVQEISACLLRDQPRVQQELGKAKELQRLQVDERLDSLTELKDTV
                     EDSYSALVDSVSTVCEIDLEEERC"
     misc_feature    114854..115120
                     /gene="UL96"
                     /locus_tag="SaHV-3_gp083"
                     /note="Protein of unknown function (DUF2664); Region:
                     DUF2664; pfam10867"
                     /db_xref="CDD:287800"
     gene            115217..116908
                     /gene="UL97"
                     /locus_tag="SaHV-3_gp084"
                     /note="core gene"
                     /db_xref="GeneID:11464317"
     CDS             115217..116908
                     /gene="UL97"
                     /locus_tag="SaHV-3_gp084"
                     /EC_number="2.7.11.1"
                     /note="involved in protein phosphorylation"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="YP_004940259.1"
                     /db_xref="GeneID:11464317"
                     /translation="MSSEEIPTSPDSAESSPTSCPPAPKKTRRRRRICRRGCSSVKRT
                     LKYPKLSESMTGSDVNEMTSHSTASSGSGSPTERFLRCEERIEKSGRSSSENMSCPIC
                     RRSEELPLTSSVVYSGSEDEAVEREECGHTYSNEHRIVTSVRGLTCDPNVFCQLTAPQ
                     LYETTGASTHVVVYAPKSLDFCESVCQAVNLDDENRRLGQGSFGEIWPLDQDRVVKIA
                     KRHSETILTVWISGMIRSRAGGVSDQGDGVFRGLLTSVGCCLLHNVTVSARFQTDMYH
                     HDAWGLESLNSYGMAFKVLADAVRFLNHDCHVCHFDITPMNVLIDVNPQKPSEIVRVA
                     LCDYSLCEPYPALNRRCAVIFQETQSARILPSCRHRLRECYHPAFRPIPLQKLVTLNA
                     HARFPIGSSQRFCAAEMTALTNVLMFCLARILDRRGFETVRAESEFLLFKHASAACRA
                     LDLGDVVECSKACLLILAAQASYLNYILGDVAVPAVCRLHRFVESRFDRRQVAVFKRY
                     YGECGKVMDHGNVRKNLDQMLNTRCGLYLYDAVRRAGRFTSVEDLECDCRIIFPE"
     misc_feature    115802..>116191
                     /gene="UL97"
                     /locus_tag="SaHV-3_gp084"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:304357"
     misc_feature    order(115808..115819,115826..115828,115832..115834,
                     115853..115855,115964..115966,116024..116035,
                     116150..116152,116162..116167,116171..116173)
                     /gene="UL97"
                     /locus_tag="SaHV-3_gp084"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    116165..116704
                     /gene="UL97"
                     /locus_tag="SaHV-3_gp084"
                     /note="Region: UL97; pfam06734"
                     /db_xref="CDD:284210"
     gene            116963..118573
                     /gene="UL98"
                     /locus_tag="SaHV-3_gp085"
                     /note="core gene"
                     /db_xref="GeneID:11464318"
     CDS             116963..118573
                     /gene="UL98"
                     /locus_tag="SaHV-3_gp085"
                     /note="involved in DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="YP_004940260.1"
                     /db_xref="GeneID:11464318"
                     /translation="MDVDDLACVVTILDDEPLNLFLMNSFLLHQDGLRNIPFNVLRLV
                     YFYHIFVKVRRLHAISIADDFVSRMSSLVKDDWLREILSNRYRESRDELIGALDSLVS
                     NDYENTAYVWLSRLLSLVPDYKQIELYQILEKESRGQAESVVWHAIRTDTVSATRFYE
                     AFVNGNAFIPVEARKPWSSPAMTFGFHHEGVVKTLIEFHIMCGREPVRDGLGLLIDPT
                     SGLFGASLDLCFGVSKHPETGTLAIHPGARVYEIKCRYKYLRKKEDPFVQNVLKRHDL
                     QAVVQFIVSHPIPGVEYRPDCETPSAKEYLLSYDAIFRHTLKRHRPVKAPEALRSHVD
                     DLLYLNKNQTSEVVIFDAKIVSDETFSENGKKDTFSSTSVDAGWGSENDENTPELVNR
                     LDVFEISRFSLPAFVNPRHHYYFQTLIQQYVLSQYYIKKHPDPERIDCRDLPTVFLVS
                     AIFRERDSEELGRELCVGGRVFHCDHVPLFIIVTPVVLDPRFTRHAVSTVLDNWNRSL
                     SRQTNLPIWVPNAAQEYVVSSVPRPPTP"
     misc_feature    116987..118528
                     /gene="UL98"
                     /locus_tag="SaHV-3_gp085"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     cl09232"
                     /db_xref="CDD:298855"
     gene            118510..118800
                     /gene="UL99"
                     /locus_tag="SaHV-3_gp086"
                     /note="core gene"
                     /db_xref="GeneID:11464319"
     CDS             118510..118800
                     /gene="UL99"
                     /locus_tag="SaHV-3_gp086"
                     /note="envelope-associated; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="YP_004940261.1"
                     /db_xref="GeneID:11464319"
                     /translation="MGSQCSSGICSQFCPTTANPLTDVLGRRVDLGVYDVISSSEEED
                     DLKNDDGSDEERPPPKKPITAVVQLKPPRTKDKKTLLRPPTPKSKRKSLRLI"
     gene            complement(118926..119969)
                     /gene="UL100"
                     /locus_tag="SaHV-3_gp087"
                     /note="core gene"
                     /db_xref="GeneID:11464320"
     CDS             complement(118926..119969)
                     /gene="UL100"
                     /locus_tag="SaHV-3_gp087"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; involved in virion
                     morphogenesis; involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="YP_004940262.1"
                     /db_xref="GeneID:11464320"
                     /translation="MGSHVDNINSRTWSISVLCLLLTFVNVTIHLIAMNFPDIGYPCV
                     YNHIIDFTQLNLTSYNVMHVFNPQLYMDNIQITVYVIFTQFIFLIVTLYYLICWFKIC
                     LRKEPGLNLNQGSRDISYMGDSVSCFLFVLCMDTFQLFTLTMSFRLPSMIAFMAFIHY
                     ICLTTYTITLITHYQSLKRNKFLLSRIHPELRGTVQLKTVVVNLVQTNLGFNTMVVSV
                     SLCLAFGNNFFVTSGHMVMVVFALFAVLSILCYLIIESILHKYMKVLFGYHFGTLCGL
                     LGLVYPVLKYETLYASAYAREINVSLGILFVIWAIFTLCRFIRFFRRSSRSYKELTSI
                     DEIAALKGEDDEA"
     misc_feature    complement(118974..119966)
                     /gene="UL100"
                     /locus_tag="SaHV-3_gp087"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     pfam01528"
                     /db_xref="CDD:279822"
     gene            120243..122348
                     /gene="UL102"
                     /locus_tag="SaHV-3_gp088"
                     /note="core gene"
                     /db_xref="GeneID:11464321"
     CDS             120243..122348
                     /gene="UL102"
                     /locus_tag="SaHV-3_gp088"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="YP_004940263.1"
                     /db_xref="GeneID:11464321"
                     /translation="METDSSCLLGVSCHLGVYGVVGCVPVLRCLFLELGTSEPQLRSL
                     LLRGERLSDSEARVLGRFTYASLAVGATEAEERRVALNRRSALLAKTFNSSSAARMLS
                     RLFTVVRVQLDGQRVEVLAVEAAFSSENRRRLEEVLSLYHVAKLVVIGSYPSEPYGPG
                     SSLKKDPGEDSRETLVEYGTHANKKFKRGYCASDLALSFRVGARKYVWEQSDCESVRL
                     EDLFQVSDVRFLRTDMRLVTPRNFVAVAVTDEQCFVLLKTAWRWIYDLCFSGFHGMRP
                     LFDYLGPDLYDQGGPRSMFFPGFPGLSVYAVEGLSVLLKETAIDAMGEIVSCCGLPDI
                     VGTVGKFSVCLRSDVPVLVPPEDLSVFSGENKPLRINGTSFSVRSRDDFQCYLHLKPA
                     PLHRFTLQGLIEGVLARCVRVEDLDTDFPYNHRITRDEVCCRFLENLRHQALDAFLHI
                     QSLLGYLLQHLTSACTSAGLEWVMVKHHREVYAYDNLAAHCAMVSAEVCVRTVLSCYW
                     RKLFGDLAVDEFRCVHTDSAPGILVLLEEQQQRVVGAFHRSGEMTWLDVVGQVLTRVL
                     DLTVSSDASHVRDLYREVLFRFVSYRNDVSFWVSTYYPGDVVRAHVGVIDCAPFPGVL
                     SLQGEVLVQSRDAALETDIGYGRYLKQAFSILGFCVNLQLERQAQISGGSALLTEDMV
                     EEIGSTVLTDGLHFFQLNN"
     misc_feature    120891..121148
                     /gene="UL102"
                     /locus_tag="SaHV-3_gp088"
                     /note="Herpesvirus DNA helicase/primase complex associated
                     protein; Region: Herpes_HEPA; pfam03324"
                     /db_xref="CDD:281336"
     gene            complement(122356..123099)
                     /gene="UL103"
                     /locus_tag="SaHV-3_gp089"
                     /note="core gene"
                     /db_xref="GeneID:11464322"
     CDS             complement(122356..123099)
                     /gene="UL103"
                     /locus_tag="SaHV-3_gp089"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="YP_004940264.1"
                     /db_xref="GeneID:11464322"
                     /translation="MDALMIRGVMEVHCEDRETVYCMQPEIIDITHRDHRLWVHTDHG
                     TLISMHEYYEECQCRGSWLGYSAIFLLDTEDTLSRVKLSAIRIKHRCAVIRPSNLKQF
                     TLCIVLSCVENLALTKRCLQDLRLFIREISVNDPLDVLLLNSCRRLICTALYLFFDHP
                     EEELKAHVPRIFVLYLETRTSYVETIARLFLRLASLKEDENASLCLMNRTTNDDMLVS
                     TALHEVLNESYPNFYKHFVNGLHPHNITP"
     misc_feature    complement(122410..123078)
                     /gene="UL103"
                     /locus_tag="SaHV-3_gp089"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7;
                     pfam01677"
                     /db_xref="CDD:279943"
     gene            complement(122999..125005)
                     /gene="UL104"
                     /locus_tag="SaHV-3_gp090"
                     /note="core gene"
                     /db_xref="GeneID:11464323"
     CDS             complement(122999..125005)
                     /gene="UL104"
                     /locus_tag="SaHV-3_gp090"
                     /note="dodecamer located at one capsid vertex in place of
                     penton; involved in DNA encapsidation"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="YP_004940265.1"
                     /db_xref="GeneID:11464323"
                     /translation="MNLYHWDGKSSFSKHSPANDLTLSTIRSILAADERLRIKESSYF
                     RDRNSTSSSPVIDIFPTPKTLSYIKFLHGFVGACRGKSIHQILRDPCVLRKQLLYGIC
                     KTIFNTVTVKHIADEWKHHAQLFPYHAVNPEDFDQYLELWASSVGQSVRTGILGAVRD
                     ILYRYADDDNYGLYIDWLVTVGIVPIATVKQNPRDEQLQEQFVRAAIQKATESHPLAR
                     ELLQHNLPLLLRIIHNLNAVSISNSSDIYIYKRGDPGKIEAKDRNRPLEIQIVAEPLS
                     YERDRLIYTTPVAHLYEEIIRYDSLCRHQKVCQLLNTFPVKAITASQHEMNCKKIIDM
                     MEKHDRAGDAKKAIIKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQTRLLPPRATG
                     AAPSGNVNVPADRDIRDLFKKQMIKCLEEQIQSQIDEIQDLKTINQSWEQHVRELKSL
                     LSRQEHQHRTQTAMMPDAELNHLSIIEAVKKAQEVSFCPFSVDDNRTVANSFFSQFVP
                     HTEQLEALLSDLWQNEYFRTFRLRRTVTAQGDEDAILYSNYTVERVVVPYLFNILSLS
                     TLEPIPEAYLDLSFNEILAAAYDESKLIQYVRFVCNREKARWEHVEKQWRKPTSTFTE
                     TITKHPTTRFGNGRPDDSRRDGSPLRRPRDSLLYATRDHRYHTP"
     misc_feature    complement(123194..124810)
                     /gene="UL104"
                     /locus_tag="SaHV-3_gp090"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            124833..127430
                     /gene="UL105"
                     /locus_tag="SaHV-3_gp091"
                     /note="core gene"
                     /db_xref="GeneID:11464324"
     CDS             124833..127430
                     /gene="UL105"
                     /locus_tag="SaHV-3_gp091"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="YP_004940266.1"
                     /db_xref="GeneID:11464324"
                     /translation="MSITGDDEVEFRSRKYEDSLILNLSSAAKIERIVDKVKSLAGEC
                     FEKEDFPSQWYRFISQSVRQEAIGEDGEEEIRVPCVDKIPFFPFRVLLITGTAGAGKT
                     SSIQVLAANLDCVITGTTVIAAQNLSSVLNRTRSAQIKTIYRTFGFNSKHVHLSDSVG
                     AWSQRYRVCDPSDEDTIQKLQLNDLVMYWPVIADIVDRHLNMLDKKASLDGVSELCDS
                     NIIVIDECGVLLRHMLQTVVFFYYFYNAIADTRLYRERRIPCLVCVGSPTQTEALESC
                     YDYQRQNKNVRRGVDVLSALICNEVLMRYCDIASNWIMFINNKRCTDLDFSDLLKYME
                     FGIPLKEEHISYADRFVQPPNLIRNPSYASDMTRLFLSHAEVQAYFKRLHDQIRVSER
                     HRLFDLPVYCVVNNRNYEELCELTDPLSVPPRIDVWFRNNLARIINYSQFVDHNLSNE
                     ITTEVLRGSTARTGEGEEEDEGDTGGSEEQIETLLTLRITYIKGSSIGVNSKVKACVV
                     GYHGTFESFVEILRKDTFIERTPCEQAGHAYSLISGLLFSAMYLFYTSSFATEEILRE
                     ISRIELPDISSLCGGVEEVSTMPENVVEDVYDIPCLSSEDGYHDEVSDTDLLTNTDLY
                     TDPFFLKYTKPPVTGLLSFEETVHIYTTFRQIFIRRYQVMQRQTGGEFAKSTMIAYNR
                     RNVVTKGNCQIVSQTGSFVGMLSNVSPAQTYTLEGYTNDNVLSLPGERYRLHPTVVTR
                     GLSRLVVKDVLGFIYILDVNVSRFVESAHGKSLHICTTVDYGITSRTAMTIAKSQGLS
                     LEKVAIDFGDRPNNLKMSHIYVAMSRVTDPEHLIMNVNPMRLSYERNALITPYICRAL
                     KDQKTMLIF"
     misc_feature    124866..127427
                     /gene="UL105"
                     /locus_tag="SaHV-3_gp091"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     misc_feature    124875..127427
                     /gene="UL105"
                     /locus_tag="SaHV-3_gp091"
                     /note="Helicase; Region: Herpes_Helicase; pfam02689"
                     /db_xref="CDD:280797"
     gene            129906..130696
                     /gene="UL111A"
                     /locus_tag="SaHV-3_gp092"
                     /db_xref="GeneID:11464325"
     CDS             join(129906..130061,130148..130372,130455..130517,
                     130594..130686)
                     /gene="UL111A"
                     /locus_tag="SaHV-3_gp092"
                     /note="contains signal peptide; involved in immune
                     regulation"
                     /codon_start=1
                     /product="interleukin-10"
                     /protein_id="YP_004940267.1"
                     /db_xref="GeneID:11464325"
                     /translation="MSALRSYCLLWCLVVISSSKIRKKVDCSFRTGPFSGMLQSLRHD
                     YSKVKTVLHDHDTVHTTSLLTGDLLDEMLGPRGCQTTVQLMEKYLSEWLPKADRLYLY
                     DNQTIRTLDRLGGTLNGLMKDMVQCPMLICGAPSSAMMGLQSRENKLPGNAGVYKGLA
                     EIDLLGNYLELYMSKFRR"
     misc_feature    join(130005..130061,130148..130372,130455..130517,
                     130594..130671)
                     /gene="UL111A"
                     /locus_tag="SaHV-3_gp092"
                     /note="Interleukin 10; Region: IL10; cl02501"
                     /db_xref="CDD:295330"
     gene            130895..132339
                     /gene="UL112"
                     /locus_tag="SaHV-3_gp093"
                     /note="beta gene"
                     /db_xref="GeneID:11464326"
     CDS             join(130895..131480,131567..132339)
                     /gene="UL112"
                     /locus_tag="SaHV-3_gp093"
                     /note="involved in gene regulation; involved in DNA
                     replication"
                     /codon_start=1
                     /product="protein UL112"
                     /protein_id="YP_004940268.1"
                     /db_xref="GeneID:11464326"
                     /translation="MEADQATSIRKYITFNSPNRILHQNVSQVMDVRQFIFESAKIVD
                     CVNGEGHVSTLGKGWLCATMVQTGESSSSSKSQQGFMSIDITEDNVLRDSLFLRGGVV
                     FNKSVSSVVGSGEAGPALLTMISESGSLQLTYVRHFTNRPATLPVEQHVERRSVEEER
                     RKKPSSSSTVDANGFALRDPRLLNRSKERKRESEGGSPRGDKRQKTHHESRNESEARP
                     PPEPGTDAVAFLNYTNAALADAVDGALSSSMNVDVPGDSGETRSSIVENRATEDMGDS
                     GLGEAAETRNSDDGGVEGSSNPVPPPNSQDLVPHSPRFDDIIKSLKKLFSDCKDKRLC
                     PTVARLPLDFKPSDSDDEVPGTSSATAPTPPPSRPSRPVCEIKPSVRPVEERIERSDR
                     RGRGRSTRSGNNRTRQPRRPRRRDREPDLTWRPPSFLEDGLEIVDEDEAAIAAAAIEG
                     LM"
     misc_feature    join(130922..131480,131567..131655)
                     /gene="UL112"
                     /locus_tag="SaHV-3_gp093"
                     /note="HSV U79 / HCMV P34; Region: U79_P34; pfam03064"
                     /db_xref="CDD:281109"
     gene            complement(132390..133136)
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /note="core gene"
                     /db_xref="GeneID:11464327"
     CDS             complement(132390..133136)
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /EC_number="3.2.2.3"
                     /note="involved in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="YP_004940269.1"
                     /db_xref="GeneID:11464327"
                     /translation="MALKQWMLKHIPDNQPSSLSPDEQSRLFGIHPSWITFLDLFEHE
                     TALLKSVVDTVRLARQTETIYPAPEHVHRWSHLNEPQSVRVIIVGQDPYHDGSASGVA
                     FGTFPGRQTPASLINVFRELSRTIMNFQPPNHGCLDAWCRQGVLLLNTVFTVVRNKPG
                     SHRHLGWQQLSERIIRQLSETREHLVFMLWGAEAQTREYLIDKTKHLVLKSCHPSPRN
                     TQKSFVGNDHFTLTNNYLQEHGQHTIDWNL"
     misc_feature    complement(132393..133136)
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /note="Uracil-DNA glycosylases (UDG) and related enzymes;
                     Region: UDG_like; cl00483"
                     /db_xref="CDD:294330"
     misc_feature    complement(order(132498..132500,132690..132692,
                     132795..132797,132828..132833,132858..132872))
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(132483..132494,132498..132503,
                     132561..132566,132795..132803,132855..132860,
                     132864..132869))
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(132486..132494,132498..132500,
                     132561..132566,132660..132665,132795..132803,
                     132852..132860,132867..132869))
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(132498..132500,132864..132866))
                     /gene="UL114"
                     /locus_tag="SaHV-3_gp094"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(133072..133851)
                     /gene="UL115"
                     /locus_tag="SaHV-3_gp095"
                     /note="core gene"
                     /db_xref="GeneID:11464328"
     CDS             complement(133072..133851)
                     /gene="UL115"
                     /locus_tag="SaHV-3_gp095"
                     /note="contains signal peptide; complexed with envelope
                     glycoprotein H; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="YP_004940270.1"
                     /db_xref="GeneID:11464328"
                     /translation="MLFLFSVLLTLASADNETCVTLVRQCVAGDSVLNGTQNGTSEPL
                     VKPPSDDAMLSQLIRYNHSGITTITSKIPIDDTFIDHLALLHNNTKQLRILLAILRSD
                     TAPAWMKAMSGYGVCGQEAAIYTCYADVCRAYDLTKLTYVNTIFTENVLGFELLPHFK
                     FAVLLGARNEDSKMGRPIRIPIPKTGIGLFYAIWNVIKGFFTQNELQSPLIARLEKYY
                     QDLDAEYKLLPKKNVLFFRSHGTQAVDAQTYTGQPAVIVKS"
     misc_feature    complement(133150..133848)
                     /gene="UL115"
                     /locus_tag="SaHV-3_gp095"
                     /note="envelope glycoprotein L; Provisional; Region:
                     PHA03302"
                     /db_xref="CDD:223038"
     gene            complement(133851..134729)
                     /gene="UL116"
                     /locus_tag="SaHV-3_gp096"
                     /db_xref="GeneID:11464329"
     CDS             complement(133851..134729)
                     /gene="UL116"
                     /locus_tag="SaHV-3_gp096"
                     /note="contains signal peptide; truncated by frameshift in
                     majority of genomes"
                     /codon_start=1
                     /product="protein UL116"
                     /protein_id="YP_004940271.1"
                     /db_xref="GeneID:11464329"
                     /translation="MRSFILLLCVAHGAFASTATATTHISANTTSTSSVSEIRSSNTG
                     TNSSSTHASTPMTTTTASSTGKTSSNMTTLSAPMTSTSSTITTTTSTPTTTSNSTTVT
                     STTVSATTESISVSTNTTGSSGTTNVTVNSTRVPTNTTMSTTVLTNTTENTIESFSTV
                     SPPDDCLRVSENLYYTSEDEIGSGDEETQRNTHPLYIATECTRNLTDNISCVFTPRNF
                     SWQSVDSVTFSPTSCEDGVAVFHVDNTTFSTNPYASSFFMTTLYKLLHLDEVTLDINA
                     HLNRYRQYPVNNRPIS"
     variation       134079
                     /gene="UL116"
                     /locus_tag="SaHV-3_gp096"
                     /note="present in approximately 75% of genomes, causing
                     frameshift in UL116"
                     /replace="aa"
     gene            complement(134726..135484)
                     /gene="UL117"
                     /locus_tag="SaHV-3_gp097"
                     /note="beta gene"
                     /db_xref="GeneID:11464330"
     CDS             complement(134726..135484)
                     /gene="UL117"
                     /locus_tag="SaHV-3_gp097"
                     /codon_start=1
                     /product="protein UL117"
                     /protein_id="YP_004940272.1"
                     /db_xref="GeneID:11464330"
                     /translation="MFSKLEIVRVNEPIQLSLTPANKRKRHRTMVISPKNGFVKIPPD
                     DKNVSMVKIIATPATPVQKSPPRPRNDTSNYPYGTSLIRRRRLPQPHPMVSKYGHVFE
                     ELGKLLQTHDSTHVQIQVNASCGNSFQYLKSAIVKLHNLTILAGMQIASQCLPHDSQT
                     ISNFKRHEDRGDLLRNVTDVVPRSACYADSGLHQLYISGATKKDLMDAMTLCLSVIDQ
                     YPNIFNVNIIKLSYPSLASFHLSTYSEFTNTSAV"
     misc_feature    complement(134744..135208)
                     /gene="UL117"
                     /locus_tag="SaHV-3_gp097"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(135502..136809)
                     /gene="UL119"
                     /locus_tag="SaHV-3_gp098"
                     /note="beta gene"
                     /db_xref="GeneID:11464331"
     CDS             complement(join(135502..136070,136557..136809))
                     /gene="UL119"
                     /locus_tag="SaHV-3_gp098"
                     /note="type 1 membrane protein; IgG Fc-binding; similar to
                     OX-2; involved in immune regulation; possibly related to
                     UL120 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL119"
                     /protein_id="YP_004940273.1"
                     /db_xref="GeneID:11464331"
                     /translation="MRSCILLLCILPLSLAHSNFSVSCHQHHDYEKHVMNSTCKVNYN
                     HSLDAPDLMAIECFKKNVSTHDGRRMVGRVDVKGGNATDPDVQIFYNNTEQALHLNSH
                     AHHTTMYECDFIAVNRNITSKWIFHGSPVLSTYIKGTQENYTFHVLMIPDVNFTVTLL
                     VGDQTMQPCFCGDSNRTEGKEFCFLFNHTVKHVTLKATSSNFNYTVTYTLVWAEDDAA
                     YVALIYTVTLLFTLMLTLLSYVIYRCLYYLPLIKYHRLLSEEKPDPCVKKVGIKV"
     gene            136083..136583
                     /gene="A21"
                     /locus_tag="SaHV-3_gp099"
                     /db_xref="GeneID:11464333"
     CDS             136083..136583
                     /gene="A21"
                     /locus_tag="SaHV-3_gp099"
                     /note="type 1 membrane protein; similar to TNFR; possibly
                     involved in immune regulation"
                     /codon_start=1
                     /product="membrane protein A21"
                     /protein_id="YP_004940274.1"
                     /db_xref="GeneID:11464333"
                     /translation="MKTVMCGMLMVAGFAYQTCKPDEYTTSVGSCCPVCQSGYMATSE
                     CSEYTGTVCTPCRVCNGSGMTTIQNCSVTQNAICMCMDGYNCSKEVNNSCVECLRSLE
                     TSGSDINHDQNNDMSFSSLEIQYFAIPLILLMSLMILIIAVIFRYRNVLRLMILTYLD
                     RSRFHP"
     misc_feature    136137..136373
                     /gene="A21"
                     /locus_tag="SaHV-3_gp099"
                     /note="Tumor necrosis factor receptor superfamily
                     (TNFRSF); Region: TNFRSF; cl22855"
                     /db_xref="CDD:304602"
     gene            complement(137031..137522)
                     /gene="UL121"
                     /locus_tag="SaHV-3_gp100"
                     /db_xref="GeneID:11464332"
     CDS             complement(137031..137522)
                     /gene="UL121"
                     /locus_tag="SaHV-3_gp100"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL121"
                     /protein_id="YP_004940275.1"
                     /db_xref="GeneID:11464332"
                     /translation="MRLLVFFVTASWFSGVWGTVMHICQLPNGDVRVTCKSDVKPHVA
                     SVYWNIDQDHFPLSLHQTEFVTKQVTIYLHSQNSEYQSRLETLPPKHNITFNVRLTEH
                     HHFRNESLCIARPQNFRAAPICQLDLNILNLYLTGIIFTLSIVAIGMLKGFYGRSYKE
                     AAA"
     gene            complement(137643..140554)
                     /gene="UL122"
                     /locus_tag="SaHV-3_gp101"
                     /note="beta gene; immediate early gene"
                     /db_xref="GeneID:11464334"
     CDS             complement(join(137643..138889,140225..140367,
                     140457..140554))
                     /gene="UL122"
                     /locus_tag="SaHV-3_gp101"
                     /note="interacts with basal transcriptional machinery and
                     cellular transcription factors; specific DNA-binding
                     protein; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE2"
                     /protein_id="YP_004940276.1"
                     /db_xref="GeneID:11464334"
                     /translation="MAANPPPKRPHDDDDPGEGTSSGPSPPKQPKIFQPEDPVTIARR
                     FIQKTLNEEVKTQLSLGDPLFPVADNTDDDPFKECLGGIDILAEAASMAGILDSSSTN
                     TPGIIKSSSSIINPIHSTPSPDAPYTPSPPFPEDQSPRKRPRKSTPMKMPPEWLPMKV
                     EYNPQPITTPTSSCIVISDSDEEHEDSGDVNAPVCTESVECHSESLVVGKPQSPCTSS
                     SSSSSSSESDSDTSESKNSPTAPPATKKKRPGKKQQPSFEPAKVRSILKTRMAFDKPT
                     GPAKRGRVKMSDISRMFRATTRSLEYKNLPFKPTPMNEVLESAIAKCKTMNTTRAMFM
                     IHYTRTYNVKSAIEDVRAQLGMICNLSISSPFTLEHTAPMVHSPSTVRNVSKACEDGV
                     KGVWDLKEDHTHQLCPRSSDYRTIMVHAATPADYLQAIKVCLPLLHKYPRQVCIRTAD
                     LNKGENMLPIYDDCSSAYVVGQFQTGNDDMDTLNQAVQKAIEDLE"
     misc_feature    complement(join(<140226..140367,140457..140533))
                     /gene="UL122"
                     /locus_tag="SaHV-3_gp101"
                     /note="Cytomegalovirus IE1 protein; Region: Herpes_IE1;
                     pfam07340"
                     /db_xref="CDD:284701"
     misc_feature    complement(137733..138215)
                     /gene="UL122"
                     /locus_tag="SaHV-3_gp101"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(139062..140554)
                     /gene="UL123"
                     /locus_tag="SaHV-3_gp102"
                     /note="beta gene; immediate early gene"
                     /db_xref="GeneID:11464335"
     CDS             complement(join(139062..140143,140225..140367,
                     140457..140554))
                     /gene="UL123"
                     /locus_tag="SaHV-3_gp102"
                     /note="enhances activation by IE2; interacts with basal
                     transcriptional machinery and cellular transcription
                     factor; disrupts ND10; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE1"
                     /protein_id="YP_004940277.1"
                     /db_xref="GeneID:11464335"
                     /translation="MAANPPPKRPHDDDDPGEGTSSGPSPPKQPKIFQPEDPVTIARR
                     FIQKTLNEEVKTQLSLGDPLFPVADNTDDDPFKECLEQLKLQLHISRQELGEQNISRY
                     NESKRVIIKNADDIWDALKKGMKLVNETVEQLSAEPDNLTRMCYLLKDRYVITPGMQE
                     IWESFLAQTCNVAGLHMERCIKAAKIKVQQLVEGPEDKCKFVFLKHIEMMMKTLCMPR
                     ITETQSQAVSLLTNSEYLPKDLVTENAKILIETLKSEQETIFPQLDAVAVKVTDETAK
                     NVNDESKVILDSLLMKAYDIITQSQEMLKTLCLYILEETVKVINAKQNNFNLDQELID
                     METKLRRISNSCLAAITCGVIHHRRRPDVDTYRVIAGDVETPVRMETVVVHGAGESDD
                     EEEVKREEELKSETPESPEEKTLEEKKEPEDEGKPRNIHPMVTRSKQC"
     misc_feature    complement(join(139275..140143,140225..140367,
                     140457..140533))
                     /gene="UL123"
                     /locus_tag="SaHV-3_gp102"
                     /note="Cytomegalovirus IE1 protein; Region: Herpes_IE1;
                     pfam07340"
                     /db_xref="CDD:284701"
     gene            140568..141071
                     /gene="UL124"
                     /locus_tag="SaHV-3_gp103"
                     /note="beta gene"
                     /db_xref="GeneID:11464336"
     CDS             join(140613..140667,140746..141071)
                     /gene="UL124"
                     /locus_tag="SaHV-3_gp103"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL124"
                     /protein_id="YP_004940278.1"
                     /db_xref="GeneID:11464336"
                     /translation="MYGSLMIISHAINVMGNTNHSAVNTTSVTLTFSESTTSEDSGRT
                     YSSTHRWMRPLSTLGALLGMFGLVFVVLMCSFCSTDKNLEDVVQEIVETTDRQTRDTA
                     VIVMPECETKKQMKIFVCTDSSCK"
     gene            complement(143236..143928)
                     /gene="UL128"
                     /locus_tag="SaHV-3_gp104"
                     /db_xref="GeneID:11464337"
     CDS             complement(join(143236..143470,143551..143685,
                     143770..143927))
                     /gene="UL128"
                     /locus_tag="SaHV-3_gp104"
                     /note="contains signal peptide; similar to CC chemokines;
                     complexed with envelope glycoproteins H and L; essential
                     in non-fibroblast cells; involved in cell entry"
                     /codon_start=1
                     /product="envelope protein UL128"
                     /protein_id="YP_004940279.1"
                     /db_xref="GeneID:11464337"
                     /translation="MSRLRRRYFFIFTVFATACYAITYKETCCTHIALREQLEDCYDF
                     KKCDLYTISFLCRVGRLCMSPRNFSKMNNLILSIKQNITKFALHRHVPYCNYNPAHVM
                     NVGELRCALYTDFDDTPGRMIGLVDRLETTWMTPSYHVKILDLDTYLIMLNNTYNSTS
                     KTMDTKMACNKTWLN"
     gene            complement(143929..144563)
                     /gene="UL130"
                     /locus_tag="SaHV-3_gp105"
                     /db_xref="GeneID:11464339"
     CDS             complement(join(143929..144256,144337..144563))
                     /gene="UL130"
                     /locus_tag="SaHV-3_gp105"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope glycoprotein UL130"
                     /protein_id="YP_004940280.1"
                     /db_xref="GeneID:11464339"
                     /translation="MKTTIGLMFWIHLVHGYFKGCPIHPLPLMHANLFVSYTNYTAIN
                     CTQKLFALHTLNNKTLIVNDSKWTRQVIAYIDGKDLLMFRLLRNISACNNMTLSLSQD
                     EKTLAKRIFPHPVSKQIPLGYRVRDGSRWTNCIFHIQTVVLMKSENNIQFQFKIELRH
                     AYSTQGVVSTMCTHPYFSTIKRTK"
     misc_feature    complement(join(143959..144256,144337..144503))
                     /gene="UL130"
                     /locus_tag="SaHV-3_gp105"
                     /note="HCMV glycoprotein pUL130; Region: Gp_UL130;
                     pfam11668"
                     /db_xref="CDD:288512"
     gene            complement(144565..144995)
                     /gene="UL131A"
                     /locus_tag="SaHV-3_gp106"
                     /db_xref="GeneID:11464340"
     CDS             complement(join(144565..144730,144799..144995))
                     /gene="UL131A"
                     /locus_tag="SaHV-3_gp106"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope protein UL131A"
                     /protein_id="YP_004940281.1"
                     /db_xref="GeneID:11464340"
                     /translation="MNSCRFLLICMCVQIVYVSCNVSTAIGYWDKSAPIINYTQRENY
                     LHRIFNIASQYFGTEDPRIIQKINITEVILLTNAFGLEPYNKTYQLNSTAKVNVTGSS
                     IITPAKKILSAIFEIQWD"
     gene            complement(145043..145663)
                     /gene="UL132"
                     /locus_tag="SaHV-3_gp107"
                     /db_xref="GeneID:11464341"
     CDS             complement(145043..145663)
                     /gene="UL132"
                     /locus_tag="SaHV-3_gp107"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein UL132"
                     /protein_id="YP_004940282.1"
                     /db_xref="GeneID:11464341"
                     /translation="MNTTMATNVTAAAVNGTICNTGTSLIDAVLKVAPFIIYCVTAFS
                     LLTLIVVTASALYSSCRTNRSDYDPDLSENPFDEECANLIKVPQRSRSTPVMSAKYQR
                     LKDDDSDHEPESPTVILFNENYEHFDSEKKELRTATGVAKIEPLIDAANGAIRYYMST
                     YEDFKRAHEVTLPIKINVDLADDENSSSSYGTKILEEVKLRDPEHD"
     misc_feature    complement(145049..145585)
                     /gene="UL132"
                     /locus_tag="SaHV-3_gp107"
                     /note="Glycoprotein UL132; Region: gpUL132; pfam11359"
                     /db_xref="CDD:288251"
     gene            complement(145769..146818)
                     /gene="UL148"
                     /locus_tag="SaHV-3_gp108"
                     /db_xref="GeneID:11464349"
     CDS             complement(145769..146818)
                     /gene="UL148"
                     /locus_tag="SaHV-3_gp108"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL148"
                     /protein_id="YP_004940283.1"
                     /db_xref="GeneID:11464349"
                     /translation="MLLLTVITSHQKLLVRIVLLYLISKQIINSYADTVKVDYVYTGG
                     HALFHMNISVRDYVVRKVGWMACRTGPLDNCVNLWILGIKEDEECAIPDKKESLCAAA
                     TCLPNKIVELAWGKNNHPLITHTTDCHDRLETYYSNLTLEMPGIPDNVGYFTPFFKLK
                     KTVPNKDGSYHTESMIGQFALILRTDTTLQCLCTEMDAHFMTYNVTLQPELTATFIVT
                     ISPPEKRYTIVWKSPEHNGLYLAHGDIPGVDVTIIAVQNAIGVAFQIRIIDADNSKTV
                     HVEYNLHFIDHHRAHEHATCQPLQKPNTPLPHVEQKTAESHSDPPFDLTTCEWITLII
                     VLLVFVFMKYLPRNR"
     gene            complement(147876..148898)
                     /gene="A22"
                     /locus_tag="SaHV-3_gp109"
                     /db_xref="GeneID:11464350"
     CDS             complement(147876..148898)
                     /gene="A22"
                     /locus_tag="SaHV-3_gp109"
                     /note="type 1 membrane protein; A22 family"
                     /codon_start=1
                     /product="membrane protein A22"
                     /protein_id="YP_004940284.1"
                     /db_xref="GeneID:11464350"
                     /translation="MLKANILNIVSFNLLCYVTIISAECQFQHYYLDDLGGNADFSLT
                     VLTEEILFEVGWLRCNAVSMENCTVKERFVSEDARGLSLRNISETTCPAVKTRLKSTE
                     IKSRLGSEKATLSLYVNPDASLPHQKNIRSHLHLHFPASPTTIGFNTLYGIIQNTDFK
                     DDQVPFKTIYKSFPVFLSTFGEGTCRVNGFLGNVTTANITLSKRLKIRLQLNTTAYGN
                     HQVEWTALKHRQNKTYYQRDVRIDLLARNSGNHIVLDITVTHPIETPTVAVLTYKLFK
                     KNVEAANLMIRCRAKCKSRTCSPNIKSRDYTWPFLWTVFASICEWICLLLCIFFIIIV
                     SRTQFF"
     gene            complement(149120..150358)
                     /gene="A23"
                     /locus_tag="SaHV-3_gp110"
                     /db_xref="GeneID:11464342"
     CDS             complement(149120..150358)
                     /gene="A23"
                     /locus_tag="SaHV-3_gp110"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein A23"
                     /protein_id="YP_004940285.1"
                     /db_xref="GeneID:11464342"
                     /translation="MISISKTALGVFVCLIITCFISEANQTTSASSGSTNTTLSPTSL
                     QINSTSTTLSASTPDTSYSSSVVSTTAVTTPSITTVIPTTNSTSNTDISTTSQQTNAT
                     TVVTTAIQTSSITKSNSSTTVITTTNASTIASPTTTSVSTSSSNTSTPTNSPNTTNTS
                     TTTNSPNTTNTSTTTNSPNTTNTSTTINSPNTTNTSATTNSPNTTNTSTPTNPSSTTN
                     TSTATNSPNTTNVMSTSILISTSSLSNVTTKLSTTASQNTTIPETTISTSTSTNSLIS
                     SSFTSQTVLSNSTPTSPLSSTSHQKSSNSSTEISTKNTQAINSSANTFKVTTLTTSVT
                     TFTTDFKNHSNPNIKAARRNKASGYFIGLLLAILIVLVVIYIYRYQIKTLFCPKKRRR
                     RYLTEVLGEPTELLIEMKEL"
     gene            complement(150676..150990)
                     /gene="UL146K"
                     /locus_tag="SaHV-3_gp111"
                     /db_xref="GeneID:11464343"
     CDS             complement(150676..150990)
                     /gene="UL146K"
                     /locus_tag="SaHV-3_gp111"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL14"
                     /protein_id="YP_004940286.1"
                     /db_xref="GeneID:11464343"
                     /translation="MNNISFTRLITISCVIFTVSFTSATIQELRCRCTGNLMTKIPLK
                     SQYIIRHLPTAGCPKVEAIAVMDNHHKVCLNYHILEPQLFKMRHKLTKDGDTIFIKRR
                     HP"
     misc_feature    complement(<150766..150909)
                     /gene="UL146K"
                     /locus_tag="SaHV-3_gp111"
                     /note="Chemokine: small cytokines, including a number of
                     secreted growth factors and interferons involved in
                     mitogenic, chemotactic, and inflammatory activity;
                     distinguished from other cytokines by their receptors,
                     which are G-protein coupled receptors; divided...; Region:
                     Chemokine; cl00134"
                     /db_xref="CDD:294091"
     misc_feature    complement(order(150856..150870,150883..150891))
                     /gene="UL146K"
                     /locus_tag="SaHV-3_gp111"
                     /note="N-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(150781..150783,150787..150789,
                     150856..150864))
                     /gene="UL146K"
                     /locus_tag="SaHV-3_gp111"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(150787..150789,150793..150795))
                     /gene="UL146K"
                     /locus_tag="SaHV-3_gp111"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238098"
     gene            complement(151057..151539)
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /db_xref="GeneID:11464344"
     CDS             complement(151057..151539)
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL15"
                     /protein_id="YP_004940287.1"
                     /db_xref="GeneID:11464344"
                     /translation="MRVSIPYFKLLCLWNVLMIVTTSAHKNANRCVCGTSNLIKNVTH
                     IKTQIKYIQPINANYHCKNRQVITTLLNNTKVCIDPEAVYIKRLLFMLMLKVNIQKKM
                     VLDVYKTKVDFPGWGIQEIYKNLMLAKRRRRPLRRKVLDLNTARLPRRKPRSHDVTII
                     "
     misc_feature    complement(151273..151452)
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="Chemokine: small cytokines, including a number of
                     secreted growth factors and interferons involved in
                     mitogenic, chemotactic, and inflammatory activity;
                     distinguished from other cytokines by their receptors,
                     which are G-protein coupled receptors; divided...; Region:
                     Chemokine; cl00134"
                     /db_xref="CDD:294091"
     misc_feature    complement(order(151273..151290,151393..151398,
                     151402..151413,151426..151434,151441..151446))
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="putative receptor binding site; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(151396..151398,151402..151413,
                     151426..151434))
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="N-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(151318..151320,151324..151326,
                     151396..151398,151402..151407))
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(151279..151284,151291..151293,
                     151297..151299,151351..151353,151378..151380))
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(151351..151353,151375..151377))
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(151324..151326,151330..151332))
                     /gene="UL146L"
                     /locus_tag="SaHV-3_gp112"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238098"
     gene            complement(151631..152602)
                     /gene="A25"
                     /locus_tag="SaHV-3_gp113"
                     /db_xref="GeneID:11464345"
     CDS             complement(151631..152602)
                     /gene="A25"
                     /locus_tag="SaHV-3_gp113"
                     /note="type 1 membrane protein; A25 family"
                     /codon_start=1
                     /product="membrane protein A25"
                     /protein_id="YP_004940288.1"
                     /db_xref="GeneID:11464345"
                     /translation="MTCFTTCLLFSFIIFTLTAGSTSNNISRLCAYNNNVKSRYLQTG
                     QNVSISCLFPDTENFIFTFALRLYKDPEFGIRLYRILYYKYSNETGFVMRKTTFAAKG
                     IEVFKTTRSNYTTITLQFKMNDNLTGLYTCYYENPPDEFIQVETMISDYYIASSNDIR
                     YAIFTWKKYSYSNKGPLACYPYGRPDQICKNSTSTIMAASCGFLSINKNRVCGDALGN
                     TWIPPIEDRSGQVPECLETYIMKRLNPVKKLPVLPLLPSQNATSNSIQQRIAFIHIWV
                     WIDTGTLLLIWVLLTVLQWQLLRKDPSCCVYPLKSTRYFLLPKTFKR"
     misc_feature    complement(152207..152479)
                     /gene="A25"
                     /locus_tag="SaHV-3_gp113"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            complement(152643..153005)
                     /gene="UL145"
                     /locus_tag="SaHV-3_gp114"
                     /db_xref="GeneID:11464346"
     CDS             complement(152643..153005)
                     /gene="UL145"
                     /locus_tag="SaHV-3_gp114"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein UL145"
                     /protein_id="YP_004940289.1"
                     /db_xref="GeneID:11464346"
                     /translation="MTTRRRLLPHNTTDLLCKRPRDGPGRWERLIDHVSLIQDSSLSA
                     TLVAGSDNCFILLEREGAFAAFHKGLIPEKTRAKLKGSEWIPGAWIVAETFPDDRVYI
                     CTFPETSSCSTSSEIHRE"
     gene            153410..154606
                     /gene="A26"
                     /locus_tag="SaHV-3_gp115"
                     /db_xref="GeneID:11464347"
     CDS             153410..154606
                     /gene="A26"
                     /locus_tag="SaHV-3_gp115"
                     /note="type 1 membrane protein; US29 family"
                     /codon_start=1
                     /product="protein A26"
                     /protein_id="YP_004940290.1"
                     /db_xref="GeneID:11464347"
                     /translation="MWLLLLLSILTVGVTTDAKQHDAWPGLILDWLEAWLGWIQSASV
                     SVSISVSGEMMSHDSVSAVTEASHNGRSQTSTVVSNTTAITTERSNITTVSTNISAVT
                     INATSAAIKSTAVINSTVVTTPNVSVFTTEELNNSMTTVAVSAVSKKPQSAVQIIDVN
                     KINWTAVQIEINLQYVSTWDSYLPVCKPRFSSCIGEKTWLVNVDLERCETVRPKVKHL
                     GIRVENTTSGTRVVVIVEGVCCKVNDQWSFVIKFKDMLARVRHRNAVKVDYSKCTWPR
                     VWAEIDPVMSTLGLLMDRFVGEAERRSRCKAEHIYYYGLQKAQELAFDSLGNARLNVL
                     PNTFDVDVSNGTEYLMYVLCGIVSLLFLVVLIRLGIRLWRRRSMQKLRSRLEIWSVES
                     SEDVHE"
     misc_feature    <154454..>154564
                     /gene="A26"
                     /locus_tag="SaHV-3_gp115"
                     /note="4TM region of DNA translocase FtsK/SpoIIIE; Region:
                     FtsK_4TM; pfam13491"
                     /db_xref="CDD:290226"
     repeat_region   156379..158103
                     /note="IRL"
                     /rpt_type=inverted
     repeat_region   158104..161559
                     /note="IRS"
                     /rpt_type=inverted
     gene            158939..161008
                     /gene="IRS1"
                     /locus_tag="SaHV-3_gp116"
                     /note="immediate early gene"
                     /db_xref="GeneID:11464348"
     CDS             158939..161008
                     /gene="IRS1"
                     /locus_tag="SaHV-3_gp116"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein IRS1"
                     /protein_id="YP_004940291.1"
                     /db_xref="GeneID:11464348"
                     /translation="MSGGAEPGRLSAGAAAPSAPSAASLVSTPPSPRPELTEDEFRAL
                     ASAWAGAFLANTTARATRRWCQREQGGVLPLGRPHGFFAVVTPRSQMPGVGATDLRQM
                     SPSDEWIVLVATVVHAVPSAAQDRAHAARLEARSPWTSDGWCRTDGLYLGVGPRFRVF
                     LLDLARLTLHLAARDADEFFRFGLGGVSRLYACDLLPRSTTEPARLSEALAAASRAAH
                     AAHAVAEAHAGHELQLVTPGRPAQTAVLWPRWSDLRNVWPFCSHARPAELVEAARRHV
                     TQRLCCAWYPLAVVLSNLPKESIARVPLVALLDELCAVWAYCTLDGQLYPLADDLGHL
                     LRAGTLSLLHLGRTASSSETETAFRLLPPVDREFWETPRADALFLHPRAHQQLRDPGS
                     QLRFLTRSDRFQGLAAGAGAVGGGRSGERDAGLRARDAELLGLPGLCQRSPPRSPAAA
                     LSHALRHDRDRWRPTRAPDPRTAFADPDPQEYPRGASRPEDVAARRLSKFRARDSREL
                     LRPLPRPPLETTPEPPIAAAPSTSSAAAAAESPAGSGAEAGDDADDAAASRGEGAGGE
                     VRGHAGGQGGQGGGGGGHGAQDSQQPAGGGPCGAALAGPCCCDCSCHPARGPPAAVQS
                     ARQLGAAWRTLSREARQAREARQAAAGGGAGGPGAGAGAGAGGGGLCGGVQRMALSLP
                     GRECQTR"
     misc_feature    159098..159511
                     /gene="IRS1"
                     /locus_tag="SaHV-3_gp116"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    159632..159952
                     /gene="IRS1"
                     /locus_tag="SaHV-3_gp116"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    161560..193236
                     /note="US"
     gene            complement(162077..162919)
                     /gene="S13"
                     /locus_tag="SaHV-3_gp117"
                     /db_xref="GeneID:11464351"
     CDS             complement(162077..162919)
                     /gene="S13"
                     /locus_tag="SaHV-3_gp117"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S13"
                     /protein_id="YP_004940292.1"
                     /db_xref="GeneID:11464351"
                     /translation="MKMTSRDITIWVTLALIYRIQSLPLPTSVKEAFGPQRPTYEEYL
                     QICSTSSDKVLRSALTRLSIEDDTLDREQRNEIRQTCGSSCFGRCGQDLMETQCTISG
                     NDMVARFWFRGVSDVFVTSAYIQMGGGRNVRDLRKRLRKQQIQEDMYVLEMDDVIEDL
                     SDITVSFVYIEVQMCFGCEQWYKCQLSTKVSWWPFDYNVKDVLRLWMEGRYVAYVWTY
                     MFLLSRILLFTYVLANLYNIVDWLLRRSKVFVLFVGGVFFLLFFLFICPLYEMRLVND
                     WLSV"
     misc_feature    complement(162221..>162628)
                     /gene="S13"
                     /locus_tag="SaHV-3_gp117"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(163332..164150)
                     /gene="S14"
                     /locus_tag="SaHV-3_gp118"
                     /db_xref="GeneID:11464354"
     CDS             complement(163332..164150)
                     /gene="S14"
                     /locus_tag="SaHV-3_gp118"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S14"
                     /protein_id="YP_004940293.1"
                     /db_xref="GeneID:11464354"
                     /translation="MGCEPVIKTRSKQPCRPSRSRPQSVAIRIENRSNRPRERFDGWP
                     CWAVRLLFEWRELCLLRRVFGLTCLALLSCFALCFTWSWLRIGKPWWTQKIDHEIGLS
                     LILEVSSLTVWIWLKHWRNILLRLWFFGTMITLKVTSVNFNSHSIDTLSLPICVSIIL
                     AYFFIVTGFETFGGILRRDLPKMDQDTMWRWTIGISIVDFGVICAQNHLPSDWYTVCQ
                     CVLMMVWNAFVYQEVCWLLCIMDKTDPAMDLVISGNLCMYSLNMYMCNTNFWSR"
     gene            complement(164276..165097)
                     /gene="S15"
                     /locus_tag="SaHV-3_gp119"
                     /db_xref="GeneID:11464355"
     CDS             complement(164276..165097)
                     /gene="S15"
                     /locus_tag="SaHV-3_gp119"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S15"
                     /protein_id="YP_004940294.1"
                     /db_xref="GeneID:11464355"
                     /translation="MTVTVCLNNHPEKSSKPITEESSPVNKEPTKHTTTSKWFIGSVN
                     GNSRPFIISFRDLSFVSRIYSLVALLITSCAIFGVLWSNVQCWRALAVDNLIVALSFE
                     AMAVGAWCLIKREKRPDISILLLSSLAVFKATSVTAGMESSGFFINLYSGILTIKILI
                     ITNLIIYKSTLTNNPVLSKRRYGLITSLLIVWISWFDLPSNLRLGLLCCLLAIVYYLI
                     ISDTRFMLATVINSNSVLEFVIVANLFMFYVDTYVCVSCIMKTICQSGCLFGFCF"
     gene            complement(165323..166162)
                     /gene="S16"
                     /locus_tag="SaHV-3_gp120"
                     /db_xref="GeneID:11464356"
     CDS             complement(165323..166162)
                     /gene="S16"
                     /locus_tag="SaHV-3_gp120"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S16"
                     /protein_id="YP_004940295.1"
                     /db_xref="GeneID:11464356"
                     /translation="MTVPSSIQTAPEKPSEKHHATIRKHQTTMVAMWEQSLSYLDQDL
                     WRRLILLWPSCSPGLVAHVYLLFGTSIICSLVIGALWIYWDSEQLTVLGDLSTAMSHE
                     ILALVSWFLVIQAKSGTMSSFFLGGLTVCKTTSVIATVNNFKLYTLIFPATMVLTVFI
                     MLIPCSRVIPSIRPITFSNRPCVAALSVLVSVALGLDLIPKSLRVVLAICPPILLNIF
                     IMQDHYALWKKSSEPDSEPVNVGAVVGTFYMAVMDSYLCAYYLWFVTISSLSWIWGLS
                     IPQ"
     gene            complement(166366..167130)
                     /gene="S17"
                     /locus_tag="SaHV-3_gp121"
                     /db_xref="GeneID:11464357"
     CDS             complement(166366..167130)
                     /gene="S17"
                     /locus_tag="SaHV-3_gp121"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S17"
                     /protein_id="YP_004940296.1"
                     /db_xref="GeneID:11464357"
                     /translation="MTIPVEVTVLKTETVEKSVTEERTSVQSRSNTTIWQERITSMLT
                     AYRNLCKERSQLYLPRVYSRLLLFMFIYPAVSFLMRQVSVQVNYRYSITAVLSQLGII
                     FWLCTFQCRNAILSHVCLVLMVACKNTCVVFSQNIDLKMSGIVSLGTGLVCFVVICIS
                     RFTPRSENLAPIPRTCILLMSSSLSISVTCLSQISVDVSHALTMILLGMVSIFGICDV
                     KCLHEKKPETSLNEEVMITTTLYLYITDVQLGLRSL"
     gene            complement(167358..168173)
                     /gene="S18"
                     /locus_tag="SaHV-3_gp122"
                     /db_xref="GeneID:11464358"
     CDS             complement(167358..168173)
                     /gene="S18"
                     /locus_tag="SaHV-3_gp122"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S18"
                     /protein_id="YP_004940297.1"
                     /db_xref="GeneID:11464358"
                     /translation="MSIITDIPSKNTDCSKSEADDVRATRLQFQMINVQEKLISQWNR
                     LMSQRPGVIILLRMYTGISFMVWTSFICSGVLNYNEYTVITAHKTTVIIISEVIAVSN
                     CLFLTRCHLTPLRIGCVIILTISKIVSLSLLTEICWQALLPWILGLGICIIGLVILIY
                     YFDHLSSGIPSLVKSGHLMLISLTITICAAINDKNSIMQVIMSLCLLMTYMGGMVEHY
                     DVWTKTTAPNETEQLNIIVSSFLYLLDAYITQYTIWHSLRYTQCLFGWCSFFP"
     gene            complement(168259..169044)
                     /gene="S19"
                     /locus_tag="SaHV-3_gp123"
                     /db_xref="GeneID:11464359"
     CDS             complement(168259..169044)
                     /gene="S19"
                     /locus_tag="SaHV-3_gp123"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S19"
                     /protein_id="YP_004940298.1"
                     /db_xref="GeneID:11464359"
                     /translation="MTVSSLKIDMGLETSWQRDIFKTWLLYQRMLWLRFDFIIFLRSY
                     YITTMMLAVYVIIDQESIASGQTIIFRKCVAITFEITAGINCFLMLRAHDRVQMALTF
                     CALTLSKILSVTMLTRISPLILGEYMGVGIVLVATFICNNWVPVREDLTIIEVACATV
                     ISAAVTIYSITDDYFSPEVQIVVLAIFEFSIYFGIFWEQCRLLLMHSQLKLLQQGLLI
                     AKMFLYLMTLHVAISMTDQVVFLNPCTFGFCKMVTLPAPEDHF"
     gene            complement(169179..170174)
                     /gene="A32"
                     /locus_tag="SaHV-3_gp124"
                     /db_xref="GeneID:11464360"
     CDS             complement(169179..170174)
                     /gene="A32"
                     /locus_tag="SaHV-3_gp124"
                     /note="type 1 membrane protein; US29 family"
                     /codon_start=1
                     /product="membrane protein A32"
                     /protein_id="YP_004940299.1"
                     /db_xref="GeneID:11464360"
                     /translation="MSIPTIFLSALVTSLFLPVFANTTSTSSNNSTVTPNVTTPVAVT
                     NLTTNVTVNSTISTVVTTPFTSTSTDEGSGDETATPSSNNSSDECEAQKWIDLLYNTT
                     VNLTGCVLNQTWLERPHISYCDKYDVPWMVLGRDDRPLPSGKTVPLAYEGLCCVIEGQ
                     ANFVFLIRHWYGGMTHHNALRVDYNCSWHTRLMPIYPMLTNFSIMAENYMATMRKHRG
                     TSPCKGKRVYYYGLQHPDEIGFDALGHVELRIKETTFPWPKKQTSGPFEAPDKDDTPL
                     LVYVTEFIILCGLASLFLYLILKAISGYNGIWSNFRSPQKPWEPPTRRKKRFNKR"
     gene            complement(170277..171962)
                     /gene="US22"
                     /locus_tag="SaHV-3_gp125"
                     /note="putative beta gene"
                     /db_xref="GeneID:11464352"
     CDS             complement(170277..171962)
                     /gene="US22"
                     /locus_tag="SaHV-3_gp125"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US22"
                     /protein_id="YP_004940300.1"
                     /db_xref="GeneID:11464352"
                     /translation="MPLTSKSTCVAWTQYLKSHDDRPEHVVRCDFGVAYTRRSVFQQM
                     MLMLHGLFIRMHDHSALRDYVQKNQGVAICLRNPGTWFLVLRDSSDIAPVRGRRLDRE
                     YLCCDENLMTVGVLAVRASGGEDKILSETTCVMLLGATGAVYVYDWKVDALFQVAQNL
                     EDLAENGLMWCDSVYKHPSTPYSTVEPRYHVDRLLSADCRDVKALAEIALDLKGLNLV
                     ITTPGENTREPLLLLGDVNQLRKSKPFVAMSDEAFEEMCRRITCRLCCQWHVLGVTGY
                     YMKVGTFATMAVVILDRFGAVYALKSEDGDLHRLADDIQMFFRIGYLKLKGSYRFDRG
                     CRGEALLETKPHCSHWCSRDAMPAYKQYPITQEEMESCFDWLTRPTLMREELQFDDVL
                     GRTDMVPTGTLMENQNWTFPVGSIQTLPENEDGAWQEDDIITTAFDGKRCFRAPRSFG
                     PEEDEDEDSCHDAIVHDIGSEPNDEHRSPEKVPLSPPSPSASESSEISSTSKIHPELQ
                     KHDTANWEEVTLEKEAWKHRVIRAQLMWRYQCPVPKVSFPNYFEFPWGSPSLM"
     misc_feature    complement(171438..171797)
                     /gene="US22"
                     /locus_tag="SaHV-3_gp125"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(170922..171782)
                     /gene="US22"
                     /locus_tag="SaHV-3_gp125"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     misc_feature    complement(170988..171368)
                     /gene="US22"
                     /locus_tag="SaHV-3_gp125"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(172132..173763)
                     /gene="US23"
                     /locus_tag="SaHV-3_gp126"
                     /db_xref="GeneID:11464361"
     CDS             complement(172132..173763)
                     /gene="US23"
                     /locus_tag="SaHV-3_gp126"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US23"
                     /protein_id="YP_004940301.1"
                     /db_xref="GeneID:11464361"
                     /translation="MWRTRWDKSSGLPRGHAESILYCHTKRSVFLKVMEDFKDIFIHQ
                     ERFSVIREFVRSNVDRRLSLGIPHNWYLQLQPEEVLPELNDRFFDDVLCCEEPLMILG
                     QCIITKGEGEEEYEHTGIFMLLGDKGRLYLYHQEDEVINMVAENADELARFGLLGCEM
                     IYRQPSMPYATAVPDDLVQGLLARAHDPQAVNAYVSVHQERDVSLHTPGRRAKVLKLL
                     PHFGVLHDYWPFEAVDTCRLIACHVVITLRLKCRWHLLGVIGSYRCNGVFLVSKLIIL
                     DRFGRVYVVTIRNGTFRTWSYKQSGEVYRVAGNLHEFFKAGFVKLYFRRRHEHYLRRV
                     AQLERRPKCIHTPVITLPQRTFLQLGLGHDMEKQFRWLCREGRFKPEMLMTWDTWDAF
                     ALWQDRISNGPPMASPRPERRQSIQRYGDNNNEERSDDDDDEGEAPRRQGGRNRHADD
                     MDEEDETDSDEDEWEDLGFDVTEDIIFEDYEDADRDLDAEVLEWWFQQKKISDDYMKE
                     ESVSEAEVEARRINTMDEPQPPEFRRVFDFREFYE"
     misc_feature    complement(172138..173763)
                     /gene="US23"
                     /locus_tag="SaHV-3_gp126"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     misc_feature    complement(173278..173637)
                     /gene="US23"
                     /locus_tag="SaHV-3_gp126"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(172789..173214)
                     /gene="US23"
                     /locus_tag="SaHV-3_gp126"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(173851..175302)
                     /gene="US24"
                     /locus_tag="SaHV-3_gp127"
                     /db_xref="GeneID:11464362"
     CDS             complement(173851..175302)
                     /gene="US24"
                     /locus_tag="SaHV-3_gp127"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US24"
                     /protein_id="YP_004940302.1"
                     /db_xref="GeneID:11464362"
                     /translation="MSVFGESDERFALELQQKVLRDFRGLFLSVTPLEVMEYVRINHG
                     KFLCLGRPGKWYVILNSNACTVDVKNSALRRLCCAEPLCLLGSAVVMLEENPSHDPKD
                     YIVTQFLIFWGSCSRVYAYDTYQECLLLVAHHLDELARYGVSQSEIAYRDTVHQALRR
                     ATGTSYGPPKSGKSMHILFMNSTTTEGTYATAERFQGNDVKLQTPGYGPVILRLCKTV
                     TRLRNMWPFCTLTDEESERWWQNMKANLATPWYILGAVGTPRAGRPFHVDLLLFLDWF
                     GAVYLLQIEDPNHYIRRIADSLTEVFRMGLLKYVFHNRRFDEENNMKTRLEFAPICPH
                     NEERGVRRMREILFNKNKLNSHDQQRRQRRVLRQHYEWMCLKDRFDPHQGVWEKLDKN
                     TLVIQRFDCNSDTYVVDPDVTGLAEAERQASSSQDSGPRIHCLIASRFATRDSRRRVI
                     PGLVSQSRYITYSNPFPLKPLAGLRDPSLQFDN"
     misc_feature    complement(174853..175212)
                     /gene="US24"
                     /locus_tag="SaHV-3_gp127"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(174304..175191)
                     /gene="US24"
                     /locus_tag="SaHV-3_gp127"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     misc_feature    complement(174367..174753)
                     /gene="US24"
                     /locus_tag="SaHV-3_gp127"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(175622..177169)
                     /gene="US26"
                     /locus_tag="SaHV-3_gp128"
                     /note="putative beta gene"
                     /db_xref="GeneID:11464353"
     CDS             complement(175622..177169)
                     /gene="US26"
                     /locus_tag="SaHV-3_gp128"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US26"
                     /protein_id="YP_004940303.1"
                     /db_xref="GeneID:11464353"
                     /translation="MALQSSYRYVSAQAVRRTLRSFRDFILSQDSRYKIRNLVYERYE
                     ERRSTAIPAPLGWRLCYTPFEVIFGTNGDDNSPLPWESFLCCDNPLEVLGILRYIKPV
                     SDTFNSSDSEDEDFEAIESNSDTETSSAPVLLMGRYETIWCFDRVDTVLFLVATSFDS
                     LARKGLLHLDILYRHPFMPSFTESHSQMVTELIQASKSLPELRRVLSKYRWQMIPLRT
                     PGEQTRVLQLCSSPFDIQAFWPFLCMDAESLEELFTILAEQLCCRGVVIGVIGECLPS
                     GVFHGDYLILADEIGCVYYFSLFVSEMWKLADNLTMFFRIGLMKLYTKGRRFSTARRD
                     AEELEVPGQCPHTMHHFWDRYSHIEYLSGSRNYQPRYRWLTRPDRFEENRTINGQFHV
                     GEAAVGAADGSWDPRHRYDLPQEAEVKVALDNWQRYTRSGLSLPYPPKTLNYAIGIDE
                     TLETEMQRYHKTTETASSTFFDVDEDPLLPRDILLRRVARTIIQNGKSPVYPPIPKPG
                     SYLPPWL"
     misc_feature    complement(176651..177085)
                     /gene="US26"
                     /locus_tag="SaHV-3_gp128"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(176201..176587)
                     /gene="US26"
                     /locus_tag="SaHV-3_gp128"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            178537..179301
                     /gene="S20"
                     /locus_tag="SaHV-3_gp129"
                     /db_xref="GeneID:11464363"
     CDS             178537..179301
                     /gene="S20"
                     /locus_tag="SaHV-3_gp129"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S20"
                     /protein_id="YP_004940304.1"
                     /db_xref="GeneID:11464363"
                     /translation="MEYNSNLNYPEDSTIICARCKKKICSKCGRAWPLVSTREMEATI
                     RLEHLHRIIWFLGYQFIWIVLVTGLLTCIPSWYKLVYQNDGMIVLYTLLNIILLFNMD
                     HMHDHLSNFILLTWSAVLIGILITGVTLFHSWTEIKEAFMLTVIIVIALATYVHRRER
                     DLNRVLDYLSIGLCAITVLGIIWLLRPWASGKLILSSLCGILTCLITVYELHVERWFP
                     IGKQRSAMLRSATLGMHIFVFTCSILVIRHLVFRST"
     misc_feature    178639..179172
                     /gene="S20"
                     /locus_tag="SaHV-3_gp129"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:294323"
     gene            179449..180246
                     /gene="S21"
                     /locus_tag="SaHV-3_gp130"
                     /db_xref="GeneID:11464364"
     CDS             179449..180246
                     /gene="S21"
                     /locus_tag="SaHV-3_gp130"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S21"
                     /protein_id="YP_004940305.1"
                     /db_xref="GeneID:11464364"
                     /translation="MKLQTVGDTLVKSKTEDTECVTVEISTTILETASVQTEHLPAKN
                     SERTEEQRPEHLRQIYSLLIILIWATVLIICALCSPGVYEYLTGSKVAVYVACVLAGL
                     SYGFIGVYEPRYPWNKIAISACFIITSNMSIVTIKLFCGSTINIAIIVSGCALVIDLL
                     AFYIAYSKKDFNVTIPRVATYGIPLLSLLIVLWILRGIQVIPLISLTFTILIFLSMTH
                     EMYNERYGPMKKQRSPMSHALTLYLYVLVTHYSVLLLPYYLECINKI"
     gene            180399..181112
                     /gene="S22"
                     /locus_tag="SaHV-3_gp131"
                     /db_xref="GeneID:11464365"
     CDS             180399..181112
                     /gene="S22"
                     /locus_tag="SaHV-3_gp131"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S22"
                     /protein_id="YP_004940306.1"
                     /db_xref="GeneID:11464365"
                     /translation="MIKHSSLDMKNKTSIKHQKFTGADHTLLEKRRQRLSFIYLLCAI
                     QFGISFLTGALIRTTSILYRYLQTENWIVYIGAVWAWCVHSWIVHSNHQISWSSSSTW
                     LYFSLGIDAGFLTIRFVPYYDLGDVIWSYVATTIMFLLSWYTATSKSDLKLFGYVSRT
                     QPWIMALLYAMEVVWGSQVMFIIATLLIFYLFCNMTYELYFQWSTVLPPDSPVRHAAT
                     LYFQLFLTQHCFLLSLNYL"
     gene            181260..182090
                     /gene="S23"
                     /locus_tag="SaHV-3_gp132"
                     /db_xref="GeneID:11464366"
     CDS             181260..182090
                     /gene="S23"
                     /locus_tag="SaHV-3_gp132"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S23"
                     /protein_id="YP_004940307.1"
                     /db_xref="GeneID:11464366"
                     /translation="MDLTKGPLLQDNKKYPETEAAALHLESRTDPMEKVSTDEESQNT
                     PRNSRESRCRRLRSIYSLVAVQCLLAFIIGLIIYYNSNIYCYVESWDEIFYIGPSSAI
                     ITHVVMTKLPRQRVWSNVVLRSAFFAIGLETSLVMVRILSDLTMQFVMVAYIITLSVF
                     LLAFWVSVTRSRYVKLTKFIATTGALIIIVLYLFSSWNDYILVVGCIFLIYYVFNLMV
                     NEIDSQWSRSEFTEPSIHHATKVYLQWTALCYAVIATMVWFTVWGKSKFARFVFKTRT
                     "
     misc_feature    181401..>181742
                     /gene="S23"
                     /locus_tag="SaHV-3_gp132"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:294323"
     gene            182143..182916
                     /gene="S24"
                     /locus_tag="SaHV-3_gp133"
                     /db_xref="GeneID:11464367"
     CDS             182143..182916
                     /gene="S24"
                     /locus_tag="SaHV-3_gp133"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S24"
                     /protein_id="YP_004940308.1"
                     /db_xref="GeneID:11464367"
                     /translation="MRRRDTSAAATGSALCGNILCGDRLRCRKCRYRSEELSTPNQHR
                     HQLCEIYTLALLELGINVLTGFVIDVSGFHHYVQTYNNHFLFLGTFLTMAAYLSIAVY
                     DPVYPWSTKMRLTFFSIGMSSSLICMSKVYTSYALRIIMIDYVHAFLIYWSTIWIVNI
                     KKLHQKLMLKIILTLAVGNVIFLVVCLTWKPMLYAFHVIAIAFIYVATVNEMLLQWSQ
                     RMPCSQMLHAANSYILFVVLSGLVHSLRYYSSLSWLFLQ"
     gene            183044..183673
                     /gene="S25"
                     /locus_tag="SaHV-3_gp134"
                     /db_xref="GeneID:11464368"
     CDS             183044..183673
                     /gene="S25"
                     /locus_tag="SaHV-3_gp134"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S25"
                     /protein_id="YP_004940309.1"
                     /db_xref="GeneID:11464368"
                     /translation="MRPWFNSRQVKSQTCRLLTMKVAITLITGFLSYALNLIDDVESA
                     NTFITIGSILTAIGYVFIVLSNPSYPWSPCSLLCFSMISIGITLITVSMYASYGIGFN
                     LAGYLYTSLLSILAFYMSPKKFSRISVIFIVTIGTSLQATVVMMIYYGSWLSVNICNV
                     IILYTVLMYMCSFQKSESTVSCMTKTTLFYLTFNGLLYTVNSLRLLVHF"
     gene            183923..184708
                     /gene="S26"
                     /locus_tag="SaHV-3_gp135"
                     /db_xref="GeneID:11464369"
     CDS             183923..184708
                     /gene="S26"
                     /locus_tag="SaHV-3_gp135"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S26"
                     /protein_id="YP_004940310.1"
                     /db_xref="GeneID:11464369"
                     /translation="MKYQTKPGLMEKGEALLVEPTSKIPRLWKLMADLFVRPSYEDPN
                     HRRQDRLNIILKWLFVTTWISLITMEVLYIPVIYDAIIMRHHCILLITSMVIAILIHV
                     ILDWYKAKYPWPMWVTILNTMMSILMGSAITILTSFFTMMDALFSSLMTMTLCTLLYR
                     YVAVTKHNLGYVKIANYVFIPVYFFIPLLWYLYGIRMLKIVGLMIAMGSILMTTYELD
                     QQQHLLPPEFDSLLKHAHNLYFGGMSMYYGILLLKYGWQHPVN"
     gene            184899..185648
                     /gene="S27"
                     /locus_tag="SaHV-3_gp136"
                     /db_xref="GeneID:11464370"
     CDS             184899..185648
                     /gene="S27"
                     /locus_tag="SaHV-3_gp136"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S27"
                     /protein_id="YP_004940311.1"
                     /db_xref="GeneID:11464370"
                     /translation="MMPECSLDECQAVVTTNTKLAAAPSEERVMSPQLSKQHKRHLCL
                     VYLLFLAELWTTIITVCVWQIPVLHTIMSKSLIPVSCHFALTFLMFIVITVRNPEYPW
                     SLTTSAIFVGMGIGIGGTTASFIRDYADSLSAIYSGTVLICLLSFCVVLHVQHNLLYF
                     TLPAMLTAVPVIIIIGSFAEFWNIPSLRGFACMIGVISLCFSITSELYIQWRIPVQKQ
                     KSSMTQAARFYLTVHSLSYAIMFTDKYLTLK"
     gene            186036..186536
                     /gene="S28"
                     /locus_tag="SaHV-3_gp137"
                     /db_xref="GeneID:11464371"
     CDS             186036..186536
                     /gene="S28"
                     /locus_tag="SaHV-3_gp137"
                     /codon_start=1
                     /product="protein S28"
                     /protein_id="YP_004940312.1"
                     /db_xref="GeneID:11464371"
                     /translation="MIIASNLITMTVLGFKAARIAYDDRKQSDLKHILVTCPKTWIGF
                     GNKCFYFSEDTRNWTFSEVYCAGINDTLAQFTTMEELNFLKRYKGPSEHWVGLRRQSS
                     NHTWKWIDETEHNNTFPIRGVGEYAYLNDNGVGSASVYTDRKWICSRMFNTTVACHTS
                     QDSSVR"
     misc_feature    186144..186482
                     /gene="S28"
                     /locus_tag="SaHV-3_gp137"
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in natural killer cell receptors (NKRs); Region:
                     CLECT_NK_receptors_like; cd03593"
                     /db_xref="CDD:153063"
     misc_feature    order(186309..186311,186390..186392,186432..186434,
                     186438..186443)
                     /gene="S28"
                     /locus_tag="SaHV-3_gp137"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153063"
     gene            186503..187306
                     /gene="S29"
                     /locus_tag="SaHV-3_gp138"
                     /db_xref="GeneID:11464372"
     CDS             186503..187306
                     /gene="S29"
                     /locus_tag="SaHV-3_gp138"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     US12 family"
                     /codon_start=1
                     /product="membrane protein S29"
                     /protein_id="YP_004940313.1"
                     /db_xref="GeneID:11464372"
                     /translation="MSHKSRFFSSLDLEDHLTFIRSMHNGKIAFVTMDFEKTASKSTI
                     TQTSKAYRWKDVLHTLHVHYDTSSFDLFFWIAFYVVFTVLISLMVLHVPTFNMLNSWR
                     YSVFLLIVVVILYILLDNWDLGLLWTHVLMTTCSTLAGITTAGLLLFETESSTHFCYI
                     MLHVTITLQVYRTEQYLYPLNNRQRLCTCAVFCMGLIWLIRRPWAVQKLTSTMSCVIT
                     MYVSMMDDAYYRQRARFRTPYVLRRVADWYIDLLMYGYTAIMIQNIERE"
     gene            complement(187372..188109)
                     /gene="S30"
                     /locus_tag="SaHV-3_gp139"
                     /db_xref="GeneID:11464373"
     CDS             complement(187372..188109)
                     /gene="S30"
                     /locus_tag="SaHV-3_gp139"
                     /note="type 1 membrane protein; similar to CD48; A43
                     family"
                     /codon_start=1
                     /product="membrane protein S30"
                     /protein_id="YP_004940314.1"
                     /db_xref="GeneID:11464373"
                     /translation="MWNWIWTWIVLSMSLADESIYIVNAYSGRNLTLSIPGRVTETLD
                     DITWLCTDTQKIAEWEGSTGSTYYSSFQNRTHLNGTGILYVSRVYPNDSNLYIVQITN
                     TTQHSRRWSFNLQVFDPILQPPNITFNVTRRAKGCNVRLFCSGINTYNTTFVNYTWYS
                     LSSDDLTVISRNESYIRNVTTDGCYTCQIQNPIERSNSTYCTSSCNVPLSQRYFKKWS
                     PSSIITLLSLSVLLFSFLILHVYRKRL"
     misc_feature    complement(187762..188028)
                     /gene="S30"
                     /locus_tag="SaHV-3_gp139"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            complement(188144..189220)
                     /gene="S31"
                     /locus_tag="SaHV-3_gp140"
                     /db_xref="GeneID:11464374"
     CDS             complement(188144..189220)
                     /gene="S31"
                     /locus_tag="SaHV-3_gp140"
                     /note="type 1 membrane protein; similar to CD48; A43
                     family"
                     /codon_start=1
                     /product="membrane protein S31"
                     /protein_id="YP_004940315.1"
                     /db_xref="GeneID:11464374"
                     /translation="MRCLYLLFLSTVVFAIFTSQDPDDYRFAREGGNVTLPIPKVPTE
                     KPTRIVWSFYNVTNKIVERDGVMLRYYGTYLQRFRLNATTGSLMIRNVTKRDAGTYYV
                     RTVTSRSDQTRSVVLIVYFNLLTGPNVTMTAKNINGRCEFTGYCSYNGSCHPPHTNCS
                     WHVLSNGTYRPLSGNNPITVSIALQNSTRCYMCNVSTPYQHRNSTICLSSCSSSSLLL
                     SLHQEPRTTKRPTTTRTTTRTTTKSVTRSSRTTKPTSKPTTKTSRDPRTTGKSKDFSS
                     GPGLPTDTLESTPFPSLEDSTPCTTCNVSFEARAARWHWGIGFFFMMLLIIIIIILFL
                     IYRRRISARYNVAQATIRGMLRRS"
     misc_feature    complement(188864..189139)
                     /gene="S31"
                     /locus_tag="SaHV-3_gp140"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    complement(188864..189130)
                     /gene="S31"
                     /locus_tag="SaHV-3_gp140"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            190384..191307
                     /gene="S32"
                     /locus_tag="SaHV-3_gp141"
                     /db_xref="GeneID:11464375"
     CDS             190384..191307
                     /gene="S32"
                     /locus_tag="SaHV-3_gp141"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S32"
                     /protein_id="YP_004940316.1"
                     /db_xref="GeneID:11464375"
                     /translation="MDPKIYLIFSLLIISCSSMTMKEEMPFFGNEDDNNSDVGSGTSD
                     DVIFTSPSASTNLQPTPSQYKELCDTGKKQGIDWQNNPLRTLLLSSELSETDIYDIEI
                     YCSSICVGDWENCKITNVSGKCNVKDSMLNIKIEVKGIFMENLLINYVALHYYKSPIM
                     NLRDLIVLTRIDKNTYWLQYDNITLLDPKALQLVMSPCYLCERKDFVCTISTEVTVLP
                     LDCSLIDFVHIYLEERYLLALWVYILLCVRIFLVARLLESYQCFTLESSSGWKLFAKL
                     MGVMIVSVITVCIATGDIYAIYKFLLQNGVS"
     gene            191849..192802
                     /gene="S33"
                     /locus_tag="SaHV-3_gp142"
                     /db_xref="GeneID:11464376"
     CDS             191849..192802
                     /gene="S33"
                     /locus_tag="SaHV-3_gp142"
                     /note="type 1 membrane protein; US6 family"
                     /codon_start=1
                     /product="membrane protein S33"
                     /protein_id="YP_004940317.1"
                     /db_xref="GeneID:11464376"
                     /translation="MKWAIVIIHILFGALCCRGVVPGYFFHEWMLEFFSPDQITSTEK
                     TQSSESPGSKPHAETKSGPKIPTPEEFKKFCDSGKHNLTDWLTSPLRKLLLTRYATNI
                     HFEVDEYCKHPCVGGDDGCYIQKVEGECKLKDGDFSVTVVYTGNFYLNLTITYFVMQD
                     YVGNAKDLQDSAFLERLTDNKYMLTYESPVRIVHVKEIHLEVCPCEVCRRQYFTCIVS
                     TKVTISPFEYYGLGDVIHLWLESRYWEFAWVYILIMIRLSLCCMFLGDIFGILDRMQG
                     WSPLKIVLYIWGQLVFWVILLYLVSGELDALWYYMLPKGQW"
     repeat_region   193237..196691
                     /note="TRS"
                     /rpt_type=inverted
     gene            complement(193786..195855)
                     /gene="TRS1"
                     /locus_tag="SaHV-3_gp143"
                     /note="putative beta gene; immediate early gene"
                     /db_xref="GeneID:11464377"
     CDS             complement(193786..195855)
                     /gene="TRS1"
                     /locus_tag="SaHV-3_gp143"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein TRS1"
                     /protein_id="YP_004940318.1"
                     /db_xref="GeneID:11464377"
                     /translation="MSGGAEPGRLSAGAAAPSAPSAASLVSTPPSPRPELTEDEFRAL
                     ASAWAGAFLANTTARATRRWCQREQGGVLPLGRPHGFFAVVTPRSQMPGVGATDLRQM
                     SPSDEWIVLVATVVHAVPSAAQDRAHAARLEARSPWTSDGWCRTDGLYLGVGPRFRVF
                     LLDLARLTLHLAARDADEFFRFGLGGVSRLYACDLLPRSTTEPARLSEALAAASRAAH
                     AAHAVAEAHAGHELQLVTPGRPAQTAVLWPRWSDLRNVWPFCSHARPAELVEAARRHV
                     TQRLCCAWYPLAVVLSNLPKESIARVPLVALLDELCAVWAYCTLDGQLYPLADDLGHL
                     LRAGTLSLLHLGRTASSSETETAFRLLPPVDREFWETPRADALFLHPRAHQQLRDPGS
                     QLRFLTRSDRFQGLAAGAGAVGGGRSGERDAGLRARDAELLGLPGLCQRSPPRSPAAA
                     LSHALRHDRDRWRPTRAPDPRTAFADPDPQEYPRGASRPEDVAARRLSKFRARDSREL
                     LRPLPRPPLETTPEPPIAAAPSTSSAAAAAESPAGSGAEAGDDADDAAASRGEGAGGE
                     VRGHAGGQGGQGGGGGGHGAQDSQQPAGGGPCGAALAGPCCCDCSCHPARGPPAAVQS
                     ARQLGAAWRTLSREARQAREARQAAAGGGAGGPGAGAGAGAGGGGLCGGVQRMALSLP
                     GRECQTR"
     misc_feature    complement(195283..195696)
                     /gene="TRS1"
                     /locus_tag="SaHV-3_gp143"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(194842..195162)
                     /gene="TRS1"
                     /locus_tag="SaHV-3_gp143"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    196691
                     /note="unpaired G residue at 3'-end of upper strand;
                     complementary to unpaired C residue at 3'-end of lower
                     strand"
ORIGIN      
        1 ccctccgggt gttttctcgt gtcttcttcc ccccgggggt gtgtttgagg ggggggcttt
       61 gtggtagggt tgtgtggttg tgggtggtgt gggaggtgtg ggtggtggtg tgggtgaggg
      121 tcggcgtgtt ggcgggcagg gtgggtgtga ggccggaggc tgtcgggggg agagcttggc
      181 cgagtgccag gtgtgcgggc gttgcgggtg gagccgtgag ttggccggca gccagagcgg
      241 cgtgggcagc ggtgtgggcg gccggagcgt gcgcggcgag ttcggcgtcg gcgggcggag
      301 ggtcgaggac gacggcggcg cgggcgacgt ggccggcggc gaggctggcg ccgttggcgc
      361 cgttggcggc ggggggaatg agctgcacga gcttgatgag cgtgggcgcg gcgggcgcgg
      421 ggagctgcgg gagctgcggg agctgctgcg ggagctgctg cgggagctgc tgcgggagct
      481 ggggcagcgg ctgcgagatg tgggcgagcg gcggcggggc ggcgttgagg ccgggcgcgg
      541 cggcgtcgct gggcttgagg cccagccagg agcaccaggc ggcggcgttg gcggcggtgg
      601 cgggggccgc ggcgaggccc ggcgccggca ggcccggcgg gagccccagg ggggggccgc
      661 tttcgggccc gggggtgtcg gcgcgaggcg gcgccggcgg cgctggcggc gctgacgccc
      721 ccgaggcccc tgaggccggc gagccggggg ccgcgtcgcc catgctcccc gggcggctgt
      781 ccgggcggct gtccgggcgg ctgtcgacgg cgcctcgggc tcgcctcggc ctccggcggc
      841 gtctcgcggc cgtctcgaga gcggcggcgg cggcgcgcgc gagctcccga gcgccgaaag
      901 gcccgccgcg ccgcctcaca cgcacaaaac gccaggcgag gcggcgccac gcgcttccgg
      961 gggggagcgg cgagcgcccg gggcgttaaa gcggcccgcg cggccctgcg ctcgcaccgc
     1021 cagccccgac gcgcgctgcg aaaccgcggc cgggccccgc cggccgcccc ggcgcggctc
     1081 gctcgcccgg cccggccgcc accacacagc gcgctcgccc ggcccggccg ccaccacaca
     1141 gcgcgctcgg ccgcccggcc gtcaccacac acctcgctcg cccgcccggc cgccaccaca
     1201 cacctcgctc gcccgcccaa ccgccaccac acacctcgct cgcccgccca accgccacca
     1261 cacacctcgc tcggccggtc cgaccgacaa agtccgcctc cgttttcacc cccgcacaag
     1321 gcccgctgag agccggcccg aaaccggaag tcgggcccga aagcgcgccc gaaagcgggc
     1381 ccgaaagcgg gaatcgggcc cgaaagcgcg cccgacagcg ggcctcgggc ccgaaagcga
     1441 gcgcgaagcc gcccgaaagc gaggccgaca gcgggcctcg ggcccgaaag cgggccagac
     1501 cccggaaagc gggcccgaca ccgagagagc gagagagaga gcgagagaga gagcgagaga
     1561 gagagcgaga gagagagcgg ctagggaggg agcggggagg gagcggggag ggagcgggga
     1621 gggagcgggg agggagcggg gagggagccg ggaggggggt gtgaggagcg ggagtgtgag
     1681 gagcgctgag gggagcggtc aggggagcgc ggaggagggg agcgcggagg ggacctctga
     1741 cgagaggagt gctgtttgga gagcggaggg gaggggagcg cggaggagag ggcatggcca
     1801 cgtggggggg gggcgatggc acctactgcc tgctcccggg gctcctgctg ctcttccgcg
     1861 tgggcccagg cggtcccgtc tcccaaacca gctccacccc gctgatcgtg aatggggtgc
     1921 tcggggagtc cgtaacactg cccctggaat ttcccgcggg cgagaagatc aagtccatca
     1981 cctggcacta caacggcacc tccatcgcct ttattgcccc ctcggaggcc aagagccccc
     2041 agatccacct aaccaatccg aaactgggca agcgactcaa cttcacgcag tcctactccc
     2101 tacaactgag caacctagag atggaagaca ccgggtccta cagtgccctg atgtcctccg
     2161 agaccacagt taacgtttcc agctacacgc tgaggatctt ccggaaactg aagaacattc
     2221 aggtgagcaa tcacagtcaa ctgtctcaga atcggatctg cgagatccat ctgacctgtt
     2281 ctgtcgagga tcccaatgac aacatctcct tcaaatggga ggccttgggc aagacgcttc
     2341 tacgcgagcc caacctcacg acctcctggg accccaggaa cagcagtgag cagaactaca
     2401 cgtgcatcgc cgaaaacgct gtgagcaatc tctctttcac ggtctcggcc cagaagctgt
     2461 gtgaggtggc ctatatgtct acagaggcca gaatgttggt tgcggcactg atgacctgcc
     2521 tcgtcatcat ctgcctcctc gggctgttcc ttgtgtggaa gcgaagaaga gcaggttccc
     2581 ttttgtgtat tcagctatgc ttcagtcact tgttcagcag agaacatcaa gcagaaacct
     2641 tgattttctg agaagattat cacctcagac caaaacatgc taaacataac acaccagcag
     2701 actgactctt tgataaataa gctaatggaa ttatggttga cccaggcgcg gcgacacgac
     2761 acgctgccgg ggggagggac agcaacgcca gggcgttaaa tcgggccgcg cctccctgcg
     2821 ctcacaccgc tcgccccgac tcacgctcgg aaagcactag cggagaccgc cgccgggagc
     2881 ggtttcggca ggactaagcg gagctgagca gcactgagcg aggctgagcg gcgaagatcc
     2941 atgcagtccc cagggtcccg aggaggagaa gagccggcgc ctcgcttccc tggctttcag
     3001 gtgcgaggtg cggaggccga gctgcggctg tccgggctga cggggcggct ggcgggactg
     3061 cagtttcggg gagcttcgct ggcgctgcgg ctgtgggact ggagcgtgca ggagggcggc
     3121 gaggagggcg gggggagcgg ctggcagggt gccaccggcg aggaggagtg gcaaagagcc
     3181 cgggaaagtc cggtgagaaa cccgggcgga gtatcccggg ggagccccgc aggcccgccg
     3241 tccgcgacga accccgtctg ccaccgcggg tgccgcctga gttgcgccac ctgccaggcc
     3301 gcctgcccgg ctgttcgcca agaaccgaag ctgtgggtcc ctgaggtatc tgctacctcg
     3361 ccgcatccca ccacgcctca cgccattcgc aaaggccgcc gagccaactc ccgcttagcc
     3421 gccgcccgcc ccacgtcgtg tcgcaacgcc caacagaccc cgcgcttacg ccttgcggtc
     3481 caccacacgc cacgtcgacc atccgcaccg acgcaaacct gccccccgac tagctttccg
     3541 tcaccacttc gcaccgcgcc cagctgccca tttccagaca ccaagcccac cgagctaaaa
     3601 tcaggatcct taaccgactg attaccgccc aacaggctcc acaaatactc gccagctgat
     3661 gatggccaca actgcatcaa cagcaccatt acccacacca acatgaacac cattgcccgc
     3721 caccacttcc acctcatcac cagccacaca cctccacaca ccccaattcc cgtccgaagc
     3781 aacacccaca taacaccaat agataccata atccaccttt cctctatctc cagccgcatt
     3841 acatcttcca tattgagcaa caaccaactg tcccacacag actcctgcag tacacaacca
     3901 tgagactgcc accgacacac attacaggtt gctgtgcgaa ccacaaactc tcgagccctt
     3961 aacggcaccg ctacattgtt ctcttcacag acgtattgct ttgtatccat cttcttgcaa
     4021 tccacaccgt taccgatcct gactgcgtcc ccattatata aataaaactc cacactctcc
     4081 acctttaaac cataactaaa gtcgccattt aactccaact tcagatttaa gcgtccattt
     4141 tttaacaggc actgcatcct gctctccacc accacacact tgtttttttc atagcacgca
     4201 tgctggcagt acatcaggag ctcctttctc tcttggtctg ttaccgtttt ttccaactca
     4261 caatcccgca taatacgatc aggtaacttc gaaaacggaa cactgcctcc gtttggaagc
     4321 cttagcacat cacacatccg cttgtaatct tctaccgttg gtctttctgg ccctgacacg
     4381 tcgatacata gacctttgtg aatttcctga tgaccgactt gaacacactc atatctctgc
     4441 tcccggggct tcacggctcc gaaacacaca gtccatatga ccactccgag cgcagccaaa
     4501 tttcccatgt ttctgtataa aaccaaagtt ttatccttga cagcacacct attcacacac
     4561 gctctctttt tacacccaga acacaacccg aagctgctca ccacgatgcc acccaacacg
     4621 gacgcttcac aaatccttga tcttgaaaat acagcatcta tagaacgaca gcccggtact
     4681 gacacctttc gtcggacgaa tctcagtgcc accgcgcttc gcctcctcac actgctcgtc
     4741 aacacgacct ttccgttctc agccgctaat ccctttaacc gatccgcttc gacgtgcgaa
     4801 ccactaccct ccgtacagac aatcgactta cgctgtttca tgcgtggagg cacggcttac
     4861 gtctccgcag ccgtgcacgg caattttcta gaaatacgaa ctcctttaac acagacgtat
     4921 gtgtacacct tttttgaaaa cgacgccaat cccacgattt ctaaccattt gcccatttat
     4981 accgctaatc atctctatgt ttaccacttt tcgatacaca tgctggacat tgagcagtta
     5041 cagtttaatt tccgtccatg tactttttgc ccaactaaaa cagccgtctg tgatcttcac
     5101 gaacacgtct cctggtctcc gctggttctg tacaacgcta aatccatcac acatcttctt
     5161 ctagaacgcc gctacgttcc agcgttcgtc gtgtttctcc tcgttgcctc acgctgcact
     5221 ttgatatttt tgtggctttt cgaatgttcc aaactcgctg actggatcgt tgaccagaac
     5281 tggctcactt tctatttgat tattaccgtt ctttttcttt cggtaccatt gactctctct
     5341 tttttgtcat gttccactct cctcagtttt gattacctta ttccagttga gtaccctcta
     5401 agtactgaag aacttctgtc ctcattcacc ctgacatagc catatcccct ccacctacaa
     5461 acctgtcgaa acacctggtc ggttgattat tgtaacacac cctttccaca tctgatgtac
     5521 cttcccttac tcatcctaat ctcctgtatt accatgacga gtacataccg acgtaaacta
     5581 aaaacatgcc tcccaaagcc ttatgttccc agcgtttatc ttaaacctac cacgtgtagt
     5641 cgcacattcg gtccaaacag acccaccaca tctgaatatt atagcctctg caacaagcat
     5701 ttaactgtaa acaaaatagt ggctctcaac tctagcattc gccgccttat cacagcggat
     5761 cccgccctaa cgtccaaaca acgtaaatct ctaatcgcct tctgttcaca tatttgttac
     5821 tccaggggaa gatgtcgaat cacacgtatt ttttcgaact gtactctcaa tcaccgaatc
     5881 cacctaaacg cggacgttta cggagatttt acttacaacc taagaattat tcaagcttct
     5941 ttggccacag gacgtggaac tattaaccac ccgaccaata tattaaacct tcacagaatt
     6001 tctttagatc attatcaaat taatttcacc acgaatctat ggaacgcata tactaccgga
     6061 atcgagctaa aactatctac atgtgcacac tgtgacgtta ttaagcatac ctgtcgacta
     6121 ccgcccacag acgtatctct gtcacgttac actctgctaa caatcgtaga tgtagccaga
     6181 cttgcattag aaaagagata ccttgcttta tgctatgcag gaactcaact tttcatccga
     6241 acccttataa tcattcacac gtgtagaaaa atctgtagtt acatttttaa acaccgtctc
     6301 aattatctga catttataat catcacgtat gtgaccatat tgactacttg cacggctttt
     6361 ttacttcctt attccagatt gtcacgaaaa attgcacagc ctatatatac gcagacttga
     6421 agattagctt cacacgtaac tagaaagcca ggagaactgc atcatgacgc tgcgaacgtc
     6481 catcttcttt gtgctctcta tcgtcgctac gtctcacagg atagaaaaac aagtctgtca
     6541 accaagatcc tacgtccccg aagcctactt acaaaaacag atgtcaacgt gcgctcggtt
     6601 ccacggtcaa cagacactgg ccccatcgga atatagaagg tactgtgacc aaatccgact
     6661 acaaaacggc cgtttaccct ttgattttga cattgctctg cttctacgta tatctacgtt
     6721 gtcttccaca gaacacagac aggtatccga atattgtcgc cacatctgtt tacaccgagg
     6781 aagatgccag attacgcaca tctcatcgca gtgtattttg aggcgtaaac tctatgttaa
     6841 cgtggacatc tatggagatt ttagccgagg tttatcactc atctccgctt acacgctaat
     6901 acataatact catctttctc tcaccaacca actttctttg gacaagatct cgaactcaca
     6961 ttacagaata agatcaaccg ttcctgactg gcacttagaa atgaagacac ttcgttttaa
     7021 attcaacacc ttccatgata cacatcacat ttgtaacgtg accacagatg tgtctttatc
     7081 gcgctatact ctgctgacat acaccgatct cttaagattg ctaatggagc aaagatatgg
     7141 ggctttggca tatgctgcga tccaaatctt cctacggatt cttctgatca catatctact
     7201 gtccgttatg ttggattatg tcgtcaaaga ggaatcgtac aacaaagcac tcgtgatgac
     7261 agcttatatc gtcaccataa taatgttatg tgctctttac ctgccttttt acaaaaagat
     7321 cattcgagaa tactaaggag agatcttcgg tcaggcgtat ttttttaaca tgatggcaac
     7381 cacgccccga aagtgctctt tttccagata tatctttcca gccgcattca gagtcagcat
     7441 ttctgacagt acttaagacc cctcacaact tctaacgtgt aggctttttt ctgaatgact
     7501 gctatctcgc caaagtacaa tggcctcgaa ctggaacacg gagcaccccg gtctcgggcc
     7561 actcctagac acttttgaat tgtctgacat agctgtacaa tgcgaggact caaccccgtc
     7621 gatgccaaaa acagatgaga accaatcgga agatgagacc gatgatgact ccgacgattc
     7681 acagagtaag aacgaagaag aggaatcacg tatcaaatcg tgggcctggg acggcagtta
     7741 catacccaaa ccttctgcac gtaacgctga gataagcgct aggcgcgcag aacctctgtc
     7801 ttcctgttgg tgtatctgga caccacgttg gccacttccc ggacgcgtta ctcggaaacg
     7861 tcgcgaagaa cgcggagctg tgcaccttct caacagccgc gcacgcgatg gtcgagccga
     7921 ctggacgttt ctacgagtcc gttccctagt gttagcagac gattcctctg tagaacacga
     7981 cgaggaagcc ctctttctcc ccccctggac ttcagaggca cccccttggg ccgaggattg
     8041 gccacgctat cgcatagctc tcctcttcgg aggacacggt gcccacttga tgatcatcag
     8101 acccactttt gacgaagcag cttcacgcgg cctgtttccc cgcatggcat gtcaagacaa
     8161 agacgcgccc accacgttac cgaacggttt atgtattcga cgcggaacgt ggatcgcttc
     8221 ggaaaccttt ccgacgccgt tgctacgaca agatttgagt actccttctc ttctaggcta
     8281 ccgtccaaaa cccgttcgca tctggcgctc acccactgtg cccccgttgg ctccgcgaga
     8341 acctcgacgc ggcgtcgatg tcgacatcac aggcacagag accgtggccg aaatcgtaga
     8401 attaaaaact tcataagacg atcgaatttc accattacgt ggtttaaaat aatttattca
     8461 aaaatcaaaa tagcgctcct cccccctcag cgaagacagt tgcacggcgc taacggcgcg
     8521 gcgccaactt acggattccc gcccggagaa atcccgcgca aaaagaattc gcgccacacg
     8581 ttttaatcgc tgtgattttc tcccgccaaa tcacgcaaac tcccgcgctt gtcgtgaatc
     8641 gatccgaaca gcgccggtct gtcccgcgtc gctgcgcatg ccggcagcag gacacagaca
     8701 cagaccgacg ccgtccgacc gcacccgagt caccgatctc tcgacggaat tccccgcctc
     8761 ctattgaata gacaccaccc accgcccacg cccaaagctt tttttccata aaaactgtag
     8821 actatcccaa agctcattcg tgccgcctca ggcatcgaaa catcactatc agctaaaaaa
     8881 agaaccgccg ggaccggtta atctcttgac cacagacatc caagcgcatg ccaccaccgc
     8941 atccactgaa acgcgccctg acggtgcccg aatttttcgc acccaacgaa gattccagcg
     9001 gccaggacaa atgcccagat ccggacaaga acccaccacc acgtctagac caaaccagcg
     9061 aggagacgcc aagacccgaa aaaccaccga aagaaggcat gggaccgcca ctgcttcgcg
     9121 accagctgcc gccacccaca cggcagccgg acccgcagca gtcgcggtct ccaaagtgcc
     9181 agcgtccaac aacaccgcca cccccaccac ctctaccgtc cctaccgttt cttccaccac
     9241 cccgcagaac tccggcgtcc gaagaggagg aatccgaccc cgaacgagac agcccgcccc
     9301 cacccccact cccacccaaa cgcctgacgg gccgcctaag agagtaacac gcgctcccag
     9361 agtggcccgt gtgacacccc aaccccccgc taaccaacac gaaaccccaa cgctctcagg
     9421 gaaagatcct aaaaagaccc caaatcgacc taaagctaag accgaacaag tagaaaataa
     9481 agaaaccaaa ccggataaaa gtaagagcag gaaggtcaag gacggcaaca ctaccccgac
     9541 cgttccaaca gttgcaattc ctgctatgga accgacctgc acactactgt actttagtgt
     9601 tcagttacca cagcctaaac actagcgtgc agttgtgtac agacgacttc caagaacggc
     9661 actcggagct cgatccgacg gaaagccagc ttgtctatcg gcagatgttt atgtttgacc
     9721 accgtataga catttgccaa tagcatgctc gccaatccgt actatcatcg gtcttcgtca
     9781 ccacccattt cggtgtaata aagcgtcgat ccgttcctca tcttctgcct ctttattttt
     9841 cctccgcgct atattacact cagacatcac cgcacttgac atccgactga gacactacca
     9901 tgctcgcttt aattgttctt ctcggactac cgttatctat atcgggtgcg aaacaattac
     9961 atgtaaaaga tgtctactcc ctgggaccgc tgttagccgg tcacggagac cgcatttcta
    10021 ttccatgctt ctctccacga aaacatgact accaaggaat atatgtccaa ttctgtaacg
    10081 aattcaaagt atattcgatc tatatttaca acgaaaccgt tttccacgat actctagctt
    10141 ccaaacttct aaactatacg ctcaattaca gaagagggtt aactgagatt tctttcactt
    10201 ttaccgaaga cctagtaggt tggtacacct gctaccatgc tgacgacatt gactgttatc
    10261 tcaccactca ctataccttg atcgacagaa tcacgacacg acatcgaaca cacggcaaaa
    10321 aacatttggg attatcacgc cgtcctgatg actctaccgc ttggaccgtc tacccggaaa
    10381 aagtacgccg tcgtttatgt ctgtacgatc acggtctaca agacgttttt tatgtacaca
    10441 ctccaatgtc aacggtatct tgcaaaaaac cttcggtcaa caggtgtcga atccactcca
    10501 aactttcaaa actgagaaaa agaccatcaa caactctcat tcctctgaga gctaatacca
    10561 cccagaatgc tcaagaatac gtttggcaga tgatgtatga agacacgcta cgcatactag
    10621 ctaatgcgga gcttgctctc tggttagcca ttctaacatt cctcggagga attatgatct
    10681 tgttgaagtc actctacacg tcacaatctt tactgagatc accttacaaa ccgctaccgt
    10741 cattaaactg aagacagtga cgggattgta cccttcagat gtcgacatca aaatctacac
    10801 ttcagatgag acagatgtgt gcaccatgtt catcgccaac atcatgaatc tactgaagct
    10861 ttatatcatg attaacaacg tcaattcatt gtacacactt catggtttca taacatgtca
    10921 ataaacgatt taaaaaacaa aaactcgtgt tattacttaa tttgtaaaac tttatttaac
    10981 gccataaacg aattctagga atattaacac gatccctcca tattttccaa acaactccaa
    11041 atattactga accacccaat aaaagaagac caaatataag tcccgtatga gtattcacat
    11101 ccctgaactg tgccgacatc aataattcta acgttagatt aacaggataa ctgaatccgt
    11161 catgatatat actgcagaca tatttatgtt cttctccaga aggaacaaca attgcagacc
    11221 atttttgaaa agtgccgggt ccatcgggtc tcgtatccac agattgagtt tcattaatct
    11281 tgtcaacttc atctttagac cacgttatgt ttatcccagc gggataaaaa cttgaagccc
    11341 aacatcttaa tcgactttca ttcgtagaaa tagcttcttt aatcagtttg gtgtgaggtt
    11401 tagtcatcaa gagtatcaaa acctcagatg aatgacgccg aagccactgt aaacacgtac
    11461 tttcaaagta tgttgtcgta tactttgcag gataacactc atccaaaata tgtttcatcc
    11521 atagagactc attacatgtt gaaacccaac tcttcccttc agaacctaaa cgaaatattt
    11581 cgacgccatc gtagccaaat ctcataaatt tgtcgtcata accacaacca tatacccatt
    11641 gtaacgtatg cgattccaga tttttgctct gttgtgtaga cagaaacctt aaaagatgaa
    11701 tcatcatctc catactttct ttagaccttt gtgtattcgt ctccaaatta ccatccatct
    11761 ccaattctaa aacactctgt ttaagatcac tcttcatcac ggtcgaatta aacgtcataa
    11821 tttgaacatc atctacatac gccacttgaa aaaaataatg ttttccacta ctgttcgaga
    11881 ccagcgtatt ctggtaagtc aaaaagtgag agaagacaca tgagagagag agagagagag
    11941 agagagggat cttagcgaca tattcacaga tcattatagt ctaaatccag caagcaccta
    12001 aatcttaacc agaatatata agacgacatc tgattcaaaa acaactgcaa tcacacattc
    12061 ttatttacat tatggctttc cgatctacat catcatgttg gctgatttat ttgttcttcg
    12121 gccttctgac tcacctcaca atggcacaac aatttgatcc aaattcattg cgaaactgct
    12181 taaaaatttc tcaatgaaca cgcagataat catctacaca tcaaaattcg agaagaatcg
    12241 acgtggtaaa aaactgttgt tccatctcct ccacactaga tacgacgtca ataccattcc
    12301 gattataaca ccaaacgtga ttaaaccgaa atgaacattg gaatctgcag cagattgtgc
    12361 taacgacaaa ggatccacag acaagttgac acgttgctgg aatccagcat gatctacttg
    12421 acacacgtac ttttcttcat ctccagatga gacgacaata gcagcccact tttgaaaggt
    12481 accgtctcca tgaggtctcg tttcgacata ttcagtttca tttgttcggt tgactccgtc
    12541 tttaaaccac gtcatacgaa tcttggcagg ataaaaatat gaagcccaac attttaataa
    12601 aagatatgtg ctggaaagtc tttgtttaac tactttggtt ttaggttgac taattataaa
    12661 atgtcctcca ctgttaccag tataacgtga aatccattct acacattcat cctcaaagta
    12721 attatgtatc attcctgtac cgcattcatc ctgaattttc acagatacat ttaataccat
    12781 tatccacttt tgatcactac ccaaataaaa atagtccttt ccatcgtaac caaatttaaa
    12841 aaagctgtca gataacagac cgttagaccc tttcgtacaa ccgtacatta attgtaacgt
    12901 atgtgatttt ccgctcattt ttggtaataa ctgtgtcatt atagccatac tagtcttaga
    12961 ccgttctgtt tcagtactcc aatacgttga ctcctcttgt tccataaaac tttgtttcaa
    13021 cacgctcttc gatatactcg aattaaatcc cattattgga gtatcatcca cataaccaac
    13081 ttgaatgaaa aaatgcgggg tcccgttaac atggctgact aatgtgtgat aatactctaa
    13141 tgagtgacct tccgctacat tatatacata tatatttgta tatatataca tatatacaaa
    13201 tatatatgta tatatgtata gccccacatc actaaccata atgtactcag tacggcaccg
    13261 actactatta aatacaaaaa ttgtgccact cgattttaaa cctgcggtat ggatgacgtc
    13321 atgtcacatg tattgcttaa agcaactgat ctaatcatct agaatcttta ttcaagatga
    13381 cttttcgtca attcgcacca ttctttttag tcctcttgct attcaatcta atagatatca
    13441 tcatggcaag ccagttcgac acacaatctc taaaacagtg tctcacaaac aactagagca
    13501 aaaaataacc tgacgtctac attattaccg ttaacaacat caatgcggcc acaacagccc
    13561 agacggcgaa tttgccagat acatcatcac ccgaaaaact cattatgacc gatactctat
    13621 actccttttt cgaacgtcgt ctaccatatc caccacgtaa cgttacgctt tttatcagtg
    13681 ctcgactcca tcacgggcct agctgctggg aacatttaac ctcgatgtcc gcggatgaaa
    13741 gaagaacgtt gtttgtcttc ggacatggac gcattcgatt agaacgatac agaattacag
    13801 aagtacaatg tacggacgtc ttgaaaatga aacgagttcg atcaccaagt tcatggattg
    13861 catcagaatc ttatcccgat ctgaatttaa attatcatct agaccaaaat ttctaaataa
    13921 acgacactgt gaaactgtga aactgtgtac atttgtactt tattagaaat tatgaaaaca
    13981 cttaatcttc atcatcacgt aaagtcactg taacagaatc atccactgga ggagttcctc
    14041 ccatcctctt tctgcgccac agaaaaaaca acacagccag ccctagcaga gctatcataa
    14101 ctactgacac acctacaaaa ggtatcgaag aatccgatga ttctaatctt tcaatcacag
    14161 taacacttcc gggtaagcct tcatgttgaa cgtcacatgt gtatctagtc tcttctccag
    14221 aagggacgac gatagctacc catttttgaa acgtcccatc tccagctgga cgtgtatcta
    14281 tctgctctgt atcttgactt tgatcttctc cgtctcgata ccacgtaatt tttatatcag
    14341 ccggataaaa acccaaagcc cagcaccgta aagtagtctc gtgactagaa acactctcac
    14401 ttttgacgtc tgtcttggga ggaatagctt ttaacatttc tgtgccatta actacgtatc
    14461 ttaaaagcca ttgcgaacac gcaccttgca aatacgtctg aactttttca gcagcgttcg
    14521 cagcttccca cttccttttt gttatttgtg cggccatatc tgtcgcagtc caagaccgta
    14581 gatcttcatt tagactgaaa taatctttac cgtcgtaagc gtactgctca taaccacgaa
    14641 tgaaacttcc attttcccag acatcacagc catacattcg ctgaatcgtg tgagacctat
    14701 tataggtttg attgtagtac gtagccaaag tctcaagatt ttttttgaac tgcgcttgat
    14761 ctatagtaca gcctaaagtt tcattactcc aatacgtttc gttttcaact acccatgaaa
    14821 cgcgcgactc catcttcgga ttgctcacat cactatcgaa tctaacaaat tgaacatcat
    14881 cgacatatcc aacttccaga tatcgaggat ctccacgacc aggcctggaa actgcagtca
    14941 caaagtatct catagaatgt ttcgttccaa taacaatact agtaagcaga aactctaaaa
    15001 gaaatgtaga gaacatgtta aaaaataatc ctacaaaaag acacgacggg actacttata
    15061 tagctaaata cgcgcctcca cgatctcatc ctccacagaa tcgttttcgg acaatcgttc
    15121 cattacacgt cgagactgct cattccggtt ccgtagatat atgagaactt tagatcccaa
    15181 accctttttc caaagcaaga gaactatacc aattcctaca atcagaatgc acattaaaac
    15241 gccgaccgtc gaagcctcaa cttcgacacc atgtaacttc aacgtggtag gcaaaatctg
    15301 tccagcgtga tggacttcac aatgatattg gcctctctca ctccacggca ctagtatgga
    15361 agcccatttt tgatacgttc catcccccga aggtcgagtt tcaatcatct ccgtatcctg
    15421 aagctgaacc tctccatttt ttttccattc gatggttatt tccggagggt agaaacttaa
    15481 agcccagcaa cgcaacacga ccttaccaga aaaaggaaat tgagccacca aaactcgagg
    15541 aggcttcact tcaaacgctc ccttcccccc ccccccccat gttctatata tcttaaaagc
    15601 cagtttacac agtcgccacg tgcatattca agaactgact ttccataatc cgctgcttcc
    15661 cattttcgtt tcgtgatctg agcctcagta gtcattgcag tccaagatcc atcttcgtta
    15721 aacacaatat aatcttgacc atcataagaa tgttgataat aaccacggat aaaggtaccg
    15781 ttcggccaga cgtcacatcc caacattccc tgaaaagtat gacttccagc ctcgctctga
    15841 ttataataac ccaacagaat tcttaaattt accttgttca cctgaactgc ctgttgatac
    15901 aattttgttt gattattcca ataatctgga ccctcagact ccatccacga tactcgaggc
    15961 tggaatcggg gtattgtagc atcactgtca aattcagcaa ttctaatatc attaacatta
    16021 caaacgcttt gaaaccgagg ccttggtcct gaagagcaag tatccaaaat ccttaaacta
    16081 tacatttgct cactgaaatt aaaaaacatt tgtaatagca ctacgattaa aaacatctcg
    16141 acatagactg aaaactctaa cgcaatgatg tggagcgaaa gacaaactgt attttatgct
    16201 ttgcttataa cattttttca cataattatt ggatataggc caaaagaagc atttatggtc
    16261 taactatgtg aaacggagaa ctaccacagt caacatgcca cgaatctgga agtcaattat
    16321 aacatgtaca tcctcccaaa ttacatatat aaaagcgtta atcttaagaa acactcagct
    16381 cttcaaatac caatgaatca taccgtgcac atactaatct atatcgtaat gtatatttca
    16441 atcgtatgta gtaaaagatt caaaacgcca tcagcattat aaaacgattc tagtccgatg
    16501 attggtactt atacaccaac caattcatta tgttaacatt ggacgatgaa aaacagaact
    16561 gatatcgcta cgatgacctc gtctcgacac gaaaatgatt aatatcaact aaattttcca
    16621 caagacgaat gccacccctg atgttaacag aatcattgca ataacaatga cgggactagt
    16681 cactgaaacg tttgaatgtt ctttaaacaa atacaacatg taatcttgtg aacagtatga
    16741 gtttcacttt aattataata accgacaaga gccgtataat tcatctcact ttgtatttgc
    16801 gaatattcac ataacctcgt ttcatcactc caattgacat caatcacgct gtttccgaaa
    16861 cagactccat gcgaactcca acattccgtc tgtacatgat aattttagat cccaactttt
    16921 ttctccaaat cacgacagat ataccgaccc ctaaagcgac ggtaacaacg aatataccag
    16981 ttaaagatcc accgtatcca gaatctgcag acgattgcaa ttttgacgtc acagacgttt
    17041 tctgtccaac atgttgaact tcacactgat aacgttgacg ttcttgagga gatacaacga
    17101 tagccaccca tttttgatac gttccgtcac cagaaggccg tgtttcgatt gtctcgatgt
    17161 cttgagcctg atcctctcca tctttcatcc acatcatata aatatcagca gggtaaaaat
    17221 tcaaagccca gcactttaaa ttcacttcat gatcggaaag atgatgttca gtcagaaaaa
    17281 cctgaggagc cttgatttga aacgctcctg ccctagttcc gtttatcaca tatttttgaa
    17341 cccattccgg acaatcaatc tcaagatatg cacggacgac ttgagctcta ttttgaccat
    17401 cccatttatc cttagtcaat ttactataca tatcagtaac ttgccaatct tgtaagtcat
    17461 ctgtcaacat aatatagtct ttgccatcgt aagcatactg atcataacca tgaattaacg
    17521 taccatttga acttccctga caaccacaca ttctttgtat tatatgctta ccgctttgat
    17581 tgtaatatct aagaagaacc tttagattac ttttaaaaat agtccgatct cctacacacc
    17641 cctccgtttc agtatcccaa aacgaagaac tttcttgaat ccacgaaact ttaggtcgca
    17701 tctttggatc cgcatcacta ctatcaaacc tgacaatttc gatatcgtct acatagccag
    17761 cctccagata taatggctcc tgattatctc tctctataga cactgaaaaa tacctcaaag
    17821 aataagatag actaaaattg cacaaaactc ggaaataaat gactataaag atccacatcg
    17881 tagaactacc atctgaaaat tattttatga ccggctatat acataaccca ttcgcatcac
    17941 acagacgtca ccctggaaca taaattacta tgtattccaa accatcttta ctaagaacgc
    18001 acaaaatgca tagacttacc aggctgaata gcgttttcta ctatccacta ttctatctac
    18061 ttctttatct cccaaccatc cttagcaaaa gaccaaaaga cacagcgtcg aatatgtaac
    18121 taatcattta gacacaagaa caatagtgtg taacaaatca tcagcgatat actttgctaa
    18181 tcatctcaag acaatgatac tatattgtat ctcaatggca ttctggtctt ttacctccgg
    18241 gtacacatat acgttggaat ttctatatac tactgacaat tcagctatat atgctgctgg
    18301 attttttaac aacgtgcaat ttttcagcta caactcgaat actcaaaata tctcaacaat
    18361 cgcgccatgg actgaagacg ttccaaatta tgaacatact acagagctga tctccatttt
    18421 aatccaaaac tattccaacg ttgttatgca tttaaaatac ggttgccggc taaatgagac
    18481 gacgactgaa ctcttctctc caaacaagat caaccaaaca ctagaattga aaaacagtat
    18541 tgactactac cttaaccaca gttgtatcaa ccagctaaat cgatatatag acgttagtca
    18601 taacatcacg ttcgttcggt caccagtaac ctccctcgtg atgacataca gacctaatca
    18661 aaaactatta tgccgagcga tagatttttt tccacctatc aacataaaag cctcttggta
    18721 taaagataac cagttaatta gcacgacaca ccaaatcaga cctagcggta atggttattt
    18781 tcaatcctcg atctcgacac ccttcacatt cggagatgaa catcgctata catgcaaaat
    18841 aactcatctg agcgatattt ttcaattaca tttttattgg ccgaaagatc tagactctga
    18901 agagaatgac gaaaaccatg attatcactc tgtgtggtta tatcgaatct tatatctcct
    18961 aattgctttg tttgtcatca ctttcatata ttgttgtaaa accggtatac aagaacagtt
    19021 gaaactacat gacaacacaa gatatcagag actagattta ttaacctaga cacagatcat
    19081 ctcatcacca ataaagaatc gcggaggtcc aggcggggac aaaaacgcat gatccgctgg
    19141 cctccgagaa tcctcaaacc catcgtcatt tacactctca tcgtcacgac catcaaattg
    19201 ccatctggaa cgaggacgcc tagatacatt tacacgagga cgtatggata accgtctttg
    19261 aatcggtgga aaaacgattc tagctcccaa ataaacattc cgtgtagctg gctctacagt
    19321 ggtgaccacc cctgaaccca tactgaaaga tgttgatctg gagatcttca ataattttta
    19381 aaacgctaaa atctcaaaag aatgtaaagc acgttttaaa aacagtcgcc gacttctttt
    19441 cactaagacc ccatctgtca caatggctga agaatcgaag tgagactgaa ttttatcaac
    19501 ataaccttga tttacaacta acatctctga accctgagtg tagtccggaa ctattcacgc
    19561 tctcttatcg aactccacaa tatttaactt cctggatttt gcaatcatta taatcagcta
    19621 agtatataag agcctgccag agcactttgc cgttcccttc cacacaaacg ctaccaccgc
    19681 catgtatgcc acacgctttg catgcctact cctagtgatc acgcgtgtct tggccagcga
    19741 acaatcgacg acatcactca aagaacagac atcaacgtaa gtaccgatca tctcgatata
    19801 atcccaaact tcaccaaatg ttcaataacc agctttattc caaccatagt actcaagacc
    19861 cactgatgag cggaggaatt caatccggta atggaccgct gacaaaggaa gaacatacct
    19921 caacaactgt ttcgactcaa cctgtatcga ctacgctatc accttcaaaa acgccttgtg
    19981 ccaactaacg atcgcaccgt gatcactgac taccctatta atcacacttg tacccccatc
    20041 taatcaataa aattgattta tgaccaatct cttgtgaaat ttcatttttg cgatcataaa
    20101 aacgaactct gaaacgcttc ctgaacacgt ttccttaaca cgtttcctga actcacatcc
    20161 gttcaaaaga tgttaaaacg acggcgttca gagcaacact cagttcagcc actgctaaac
    20221 tgtcatcatg agactccatt caacgtgcat tgtcctatcc atctggactc ttcgaacgat
    20281 cttcggaaga cctaccccgg atctctcatc acccgccaac gaggtggcca agacggctcc
    20341 agagacatgg acccgcttct accaacatct aaccggtacg acggagactg gtatagaaga
    20401 acatgatagt gacggcgaaa accacgatca tcacataact acgcccgaaa aaccagaagt
    20461 tcacactaca ccatcgggca tgaaacaccc tcacgggatg gattcttttg caatgtaagt
    20521 aaatcttaat atctaaaaaa aaatcagact agacagatcc tagattgcat tcacataact
    20581 aaatctgacc gtcgtttttt tttatggaca gaaggtgcat cctaggctac gactgcgata
    20641 ataccaaact ccctcctcag acgtttaaac catctatcat ggtaagataa caattctgaa
    20701 ttctagaatc tatgaaaaaa attatctaaa gaggtacatt tttctaatcc gtctttattt
    20761 aattcacaga ctccaaccca tgaacgtcat aagaggaaat ggtgataaca ctccgtcccc
    20821 ttacccccat gagctacttt tgaataaact gtcgaaacca ctatctgtat acgctttttt
    20881 ttattcgcga tcacgaaaaa tatgttcagg caatatacat agcgggaagc tccgtaatat
    20941 cagaagtaga tacattagaa agttgagaag agacagatga acgacacata tgtctcaagc
    21001 cgttaggaca taagggaggt ctggagagac gacgaatctt ctcattccca taaaagatac
    21061 cgtcataacg atatcggaac agaccacgaa gcacaaattc aaacatactg ctggcaatca
    21121 aaatcgttcc gtccagcgtt ttcgcataaa cccgaagata ttcatccgtg aacaagataa
    21181 taggtcgtcc ttcctcttcg atagaagact ctccgaacgg ctccatccgg aaacttccgg
    21241 tatccaccgt acaacggcga cgttcatgcc aattcatcac cgaatccgaa accaccgaga
    21301 aaacggtacc atcacccagt ttcatggtct gtccaagatg acttttccgc caggcacaga
    21361 aagcatccag attagcacat gcggtcatgc taacgcaatt aaaatctgaa ggcatgttag
    21421 ccgagccaac atttataaaa gcacatccct ttaaaccgtt tttgagaaaa gcagccaggt
    21481 ctttagccac aaccaacaga gcatccgaat acaacatatc gatatacata tagacacgtc
    21541 cactcaaacc gacgtagatt tcactcggac attccgattc tccatgcttc agaaacgctt
    21601 tggtgcacac actacccaaa aaacacagtt cttccggaca gcagagatat tccgctaaac
    21661 gcatttcttc tgttttgttg tctttgacgg accgccagcg cttgttcagc atgagaaaac
    21721 ggccccgagg ccaagccaga cgaacactct ttctgggctt cagacgccaa catccacacc
    21781 aggccatgtt gaaatatatg tcacccgtga ccagattttt gtaagcagcg gccagatccg
    21841 ataagcgcat aacctgaagt tgttggacga ctgccattta tgttcgacgg tgacgccata
    21901 gttacgcaga aactacgtgt tcacaatcct tgggacaatc tggtacccga tcgtgacaac
    21961 cgacctgtcg acagccaaat cgtcggttgg cataatagcg agttaggcca agacacatga
    22021 aagaagtgat atcatctgcc aaccgtacat actcagcttg accggcatca caagcgaaaa
    22081 gacgaccgtc atcaaccata aacaccggaa ccacacgttt aggccagtca tagtatgagg
    22141 gttcacgacg acatgtaggc tgctgaatgt ctaccgttcc gatgccaatt aggcgtaatc
    22201 caaagaaagc tcgagctaat ctcatcatgg ttccactgaa agcagaagct tcaaaacaac
    22261 gaagattaca taaccgcaat tctgccgaat gaggatagga caaaggcagc cgtttaccat
    22321 gattccggat gacaaagcgc gctacggcat caaaacccat gttccaagat cttcgaagag
    22381 gctgaaacat ctgtttgaca tacggcatct tgagatacag aggacgatgt aagcgttcga
    22441 tatgatgtaa cccaatgtgg gagaattcga tcatgtcttc ggccacataa taaatggcat
    22501 cgtcagtttt cccgccatag cagaacacac gaccttcgtt agaaattagt attggcaaag
    22561 tttcccccac gagacccata attgacatac aaccgacacg acccagaaat ctccaggtca
    22621 cctcacaaca caaatacccg ttccagcgct tgatatcttg cggctcgtat tcagggtcat
    22681 tctctaaact tccaatgact aagctccaat cagccggcca cggtaaagcc agctgtcgac
    22741 cttgatgtaa gcgcatataa gcagccaagc aaccaggtcc aatctgagcg gcaactgcga
    22801 ccgtatccat cttaggagac cacgcaaagt agactgtgaa cagaaaactt gactatataa
    22861 cagataacac taaaaaaaat ctcttcgtgt gacgatgtca ctcagccgag attgtcgccc
    22921 cactcgcccg tctatcagag gattcgaaga tgacaccgaa agcatcgaag aagtttttct
    22981 cgtcagatcg acaccgaccc caagccgaga tatcgagcaa ggtctggacg acgactggga
    23041 gtcatttaat ggtcgctctt atcctgcctc cagtcggaac actccagttt cttcctttga
    23101 gattatcaac gaagcgaatg tagacctaag accttctcgg cttcacgttt catcggaaca
    23161 ccgtcccatc tgcgagccct cgcgtcattc tcgtcaccaa ccggttagcc aagatcataa
    23221 cccaagcagc gatgaagaag atctgggtca cttcactttt agtacgagcg atattgaaga
    23281 ttatgaaacc ccaccgatca accgatatct taattttgac ctcaacgttt tatctttaga
    23341 agacatagct ctgatcgaaa attctatcta cgaagtcagt ctcgaacagt tatcccgcat
    23401 caacgaatgc aagccgatgc cgactttcat cctcaccaat ctgatcgaac caatctttcg
    23461 ccctgctgct gccggagaga aagacttagc acgtccgatc ctcatttaca ccgtgttact
    23521 caattattat tacaaggcaa aaatcaaatg ccgcaacatg aaacgcgttc tggatcacac
    23581 ggttaacggg cccaccttgc gaggcatcac ctcacatctg caaagcaatc gtaatccctc
    23641 tcgcaccgtc tccctagcgc tacacttttt gttaacgcgt cgacgagtca ctgaacctca
    23701 gctgctcagt tgcctgtcgc acctcgacga tgaacttcgc aaacgtctcg taaatgacac
    23761 gccacgaaag aacgagattt atcgcaccgt cagtgaacac aatgctttat tccgagtttc
    23821 tgtctacacc acccgtgagg ctctttatct ctacgaaagt aatctaaaaa aacttaacac
    23881 cgaatgcacg cacactatga aactcctctg tgaccacacc atatctcatt tgtccatctt
    23941 aaacgatcta tcttttttaa tcagcactcg actcatgata ctgacttttc aacgcaacat
    24001 acgaattctc gccgcgtatc tcaaacatca tcttcataac ctttctcttc tcacgtacct
    24061 cgcttacctg caatttcccg cccagcttcg agaaccctat ctgcaagtcg cagaatctct
    24121 ccacaagagt gtgatgtctg acgacgatgc ttacatgtat cgaagcgaga ctgatctttt
    24181 caatttttgg cgcgcactca aaagattaga cactatcgtc tgtaccaact tagtgagctg
    24241 cgctctccga caggcagcac tgggcaccga ccacggtcaa accatggcgg agtatattac
    24301 ccgaaacccc ctctttagag aaccccatga cgttcctttt caggtgcgaa aactcgtgac
    24361 ccgaaacctc tgtatccccc agttctgcca cctccccacc taccaacata ccccggtcga
    24421 gttttatttc cctcccatga caatgcttca gaaactgttt ggtattaccc agcgatcaga
    24481 aaatgatcta gaatacacac acatgagcag catgttgaaa aactttattg taactcagtc
    24541 ggtatatcta gaagatagga gccctaatca tgaaattgtc catcattttt agcgcggcag
    24601 atacgaaggt aaggacgatg gcatgtttcc atccacaaac atctgctcag tcacctcagc
    24661 gtccttgaga tccaatcgtc tcacaacgcc cctttccaca cgtgtcactt gcaaaccttc
    24721 ttcagacgac tccgccgaac gtcgagtttg ccggatatgc agatcgtgtt ctctctgtcg
    24781 aatgactcga gcaacatctt ggaagtagtc ttttcgaaga ccttgctgga acaacacttc
    24841 caagctctcg gccgcgaaca caacataatt ttgttcgcgg atttcataca gaaacacctt
    24901 gccttgagca ttgatcccgg cgatctttcg atcccaggct agatgatcct tatgccccac
    24961 cgttccaata atctgtagat caccttccat ctgcggcaga cttcgccaaa actggtaatc
    25021 ccgaggggtg agaatagtat cctgtaagtt acaaatcaat aaagtataac cgcttggcca
    25081 cggtaattcg aattcacggt cacagttttc atttacgaag tctggtatag tctgaccgcc
    25141 gatcatcacc gcataccccg tctcgtccat gttgcgcgtc gggctggcag cacacgctcg
    25201 ctgctcataa tgttttaccc gaacgctgat gacgtctcac ttcacaaact tcctcccacc
    25261 tcaccgtctt taaaacgacg gatgtaaatg ttatggtatt ttttaagcgt gattttacac
    25321 ttaacgggta ccggcgtgat aggcagatgg agccaagatt gtcgtcgaca acggttagtc
    25381 tcattacaca gttcatcctc cgttaatcgc gtgttcaaac ggagcaacat gtcacgaccc
    25441 gaaacttcgt ttcctcgttt taggtagtac caaattagat tctctcctag cttggtttcc
    25501 gatgaagact cggtataaaa acgccgcagc ctcaaatgat gtaataaaaa catttgctgt
    25561 ttttcccgca gggagatctg ataatcgggt acgcgtttca gcacatcctg aagatcacag
    25621 accgattcca caaagctccg ttttcccgta ttcgagaaat ccaaatctcg aagctccacg
    25681 atctgttgaa ggcactctga cgcgaccttc tgatgtctcg ggttcttgac caaagctttc
    25741 tcatgcatca cgtaacgttg tcgcaacata ccgactaaaa gatccctgtc tgacgatagg
    25801 aaacgcaccc cgtccataaa ttctcgctga atcacgcggt gtaacatccg aatcagcttg
    25861 agattgaaca caatgtttga agccaagtac ataacatagt tccgacggac ttccccacac
    25921 gaaaggccag aaggaagcag atatcgaggc tccgacgttg tctgattcca caaagcgaag
    25981 gccaaatcac aagacacagc atgacggaca cgcctttgtt cggattgtgt caaatgcctg
    26041 agcgctggaa gccgaaacga tcccaagtcc cgataattcg ccaggaccaa aggtacactt
    26101 tctaaacgac aaggaacgtt tggctccaca gtctcgttac agtccccaca aatacataga
    26161 tgggcataca aggccgccaa agctcgttcg caggcctgtt gaaactccgt cttaaaaaac
    26221 accgcgttcc tcaacacccg ataatctaag ccggcctcct gacacaaatc atcaataaaa
    26281 aactttctga tcacattttt tgtctctggg tcgtcaaaaa gaggcaaagt gcctgctaga
    26341 cggtcgtaga tctctcccgt catagagcat aactgcctca tgtaatgcgt taaactgccg
    26401 cattctttgt aattgattaa agtgcacatg agatattgag ccgtagccat agatatacac
    26461 gcggtccgtg cgaagcgcga ggtgtgcggc aaaaactgag cttgttgcag aaaataacgg
    26521 aaggttcgaa tgtttttatt caaaagagga ttcgatattg aagccaacga caccgatcga
    26581 agaacagccc aaactgccaa atcccattct aatttgagac cgcggatttc gtatttaccg
    26641 tgcgctgtgg tgtatttcga gtttttcaac acacttcttc gaagagtgat aatggtgtgc
    26701 cgcaccgtag aagtcacgag actcccgtcg cgaaacgaag gaacgatgcc ttcgtagagt
    26761 ctcaccacaa aaaaaccagc ctttagcgcc tgttctttat tggtaaccgg gactaaatac
    26821 gtcgagacga attcttccac aaaaccgtca gtgtcttcac aatctcgaac ataacgatac
    26881 agcacaagag gatcctgaaa taaagcctcg tccatctcgt ggggaatcag cctcgtagag
    26941 gacgtctctg ccgcacactt tgcagaacgg ggttcaaatg ccgaatgagc tcctcgtctc
    27001 ccggcagaga atatctgatg tcacaaggaa aacgaactcg tttccccaca ggcacgaagt
    27061 gcgaaccgat ttcggcaaaa cagcacctcc gtcctttcaa taagaacttg agaccgatcc
    27121 gaaggaaggc gcgaaacgaa tttgccagag tgaacaagca agagccgggg agtaaggcat
    27181 agacattaca atgcacatca accacaatca gtctttcata taactgtgaa cgaccaatga
    27241 cttcatatcc ggcttcgaga agacaccgta acacagcaga tgacacatta cgaacggtgt
    27301 ctgcatgtgt caccgtgcct acggaaaaag aacacccatc accgtgatta aaaacgaagc
    27361 ccacattctg tgccacataa gataacaaac actgactgtg gttaaaatcc agacgcaaaa
    27421 aacctctttc aaccctggta ggcctcaaac catacaaaat ctcttcggaa ctacgtttag
    27481 caaaacgttt atcatagaaa caggacatat tggaaagata cagtacgcca gtccgccaac
    27541 tatcaatcct ccacaacact cggtctatgg gatcgtatgt catcatttct ctcgcactag
    27601 taaaaagcac ccacacttct cgatgttgat accacgtctc agacatgcga ataacacccc
    27661 caaaaatgat ccatcgtcgc gactgcaata tctcaaagcg gttgaaaaaa tttttctgct
    27721 tcaggtcgat tccaaaaaca tcttcacggc ccaccaggta aaccgcttcc ggtggccaat
    27781 aaactggtac gaagccatca caacgactat gaagaaaggt catcagagtt tcttgaaatt
    27841 gttcccgcga actgcgatac acttcatcca acagatcagt gagacaagtc acaaagccag
    27901 atgcagccgc cagatgccta cacgcattca ccatcatact tccacaatcg aagactcgct
    27961 gttcacactc gtcgacagaa cttcttcagc tttctcctgc acgtcagact cctcaggcca
    28021 gtcgcaagac acgataacac gaccgctcac gggcttgata gtagatccaa caggtaaaaa
    28081 acaaaatctg cgaggacacc tcaaccaaaa agaaccgtgc cgaatgaaac ctctcaaagt
    28141 ttctccaagc ttaactagta cggttccatg taacgacacg tagacagcac catccgcatc
    28201 cagaaagaca gccttgttca ccggctctaa ccatccaatg acggtataac ctgctttttc
    28261 caacacctgg gcaatgaact ggttaggttc gtcaaagtcc gaaatgtgcc aagagccaaa
    28321 ggtaaacaag cagtattgcg gtccacctaa acgaatctta catccagcat tcaaatgaca
    28381 gtatctaact gtctgacgtc gatcgtccag atgatcggat aactcactca tacccgtaaa
    28441 attatgtcga aaccagttgt tctcagtcgt ctcgtcaaca aaaggtcttt cataataact
    28501 atacatcgcc gaaaggccat gctcaaaaaa ctcattaaaa ctcagaccta acaaatagac
    28561 ccggtcttct cgtggagcat aagcaaacac atgaccctgt tctgaaacga tcacctgcgg
    28621 tcccacctga atatccggta aacagtcata gccactgaca aaaccgatac aatacagacg
    28681 attacaatct cgtagacacg aaaagcggcg ataggtcttt ctgtcgaaaa tcgctccaaa
    28741 atggtacgag tctcccatca tcactccagt taacggaggc cacgacagtg gtaaccacct
    28801 tccggcgtgc atccgaacga aacgttgcag ctgcatgcca tctttccaca tcctgggccg
    28861 acgacatcgg aaagtccaaa catcacgaag acctcgccag gcggcactga actttggttg
    28921 tcctctgaca tacagacaat tcatagattc gaaatgtccc actaagatcc tgccaagacc
    28981 aagaaaaaat gactcagacc tcaatcccca tagacccatc ccgcctctaa atgtacccac
    29041 ctaccttctt tttttcaaag gcagcgtagc atccggatac atctctttca agcgactagc
    29101 atcaaaggta ccgatactct cataacgatg atcaccaatg agaggggcta aaccgacccg
    29161 aacaaaatct ttcaaactcc gggccagctt ggtgagctta tcgtgtccag gtatgccagc
    29221 atacaccgcg ccaccatcat cgtagaacat ccgaatatgt ctaaaaagtg tcttgacagt
    29281 cgacgatgaa gcttccacaa atcctaaaac attgataggt tccttcaagg cagtggattt
    29341 ctgtaaccgt cgtaaaagcg acggcgaaag atctagctgc ttcgcactgc acaacaccaa
    29401 tacatgtttc tcaggccaca tcaaaggaat agttacgttt aagtggctct gaatatacgc
    29461 attcctggct tccacatctt cacatctcag taattctcca aaccccgtga gagcatacag
    29521 atacctttcc ctttcggagg atcgacaatt ttcattgaca tctcgcttct gttctgaaga
    29581 cattggcaac acattatcta cacacacctt ctgattgata gtctcgtgca ccggatcaca
    29641 ccgaatcagt cctttgctca gaaaactctc catgtcacta gccagatcgt acatacaatc
    29701 atctttgaca tcatagcaat agatcgtccc gtaatcatcc aaaaagagtg gataacgagt
    29761 agtagcataa caggccactc ccaagagctg tagacgacga aactcgccaa aaaaactcac
    29821 ttgacaatgt tctagatcga gatcagtcag atcgcaaaac tccaatgatg aacacgcggt
    29881 atacacactc tgtggaggcc aacccagaga cacacaagaa ccttcaaagc gttctagaaa
    29941 atagcgaagt tcaccggcat gtctcccgtc actcaactcc agtaattctt gaaccgaaaa
    30001 aactgtggaa ggcgcagaga cccgttttcg tcgaacacgt ctcatgttca gtcgatagag
    30061 cagttcccgg cttgcctctc cccagtaaat ctccctgatc tctgaattca aagatagaac
    30121 cccaatggcc ttttaacatt gctgccgata ctgaaggtta gccaaaacct gaagtcagat
    30181 ccgctagaaa ctacttccgt tttatagaca ccccgaattt aaacacgcac aaagatacaa
    30241 agtaccaatt tactttatta gtctgtacca tccatctgca gcttgtgttt ttcaatccgt
    30301 agttcgtctt acattctttt ttattttttt caaccgtctt caagcaccct gacacattcg
    30361 agttaccaca cgtcgacggt acgaaatctt aaaacgttgc aatttcgtct gacgcgtcac
    30421 tctatcgact tcggcttcaa aagcttgctg tcgttccggt gttaacatgt cgtagaattt
    30481 caaaaatttc ttacaatcag aaaccgcgat actacatttc aaattccatt cgactcgaag
    30541 atgaatataa cgggcccatt cgatcaattt ttcgacttct tcctcctctt catgacactc
    30601 aagtgtcgac tgctcaacat cagaatcatt ctgttcggcc atcgagctgg aaagatcaga
    30661 tacttgaaca gtcagatttt gcagactctt atagtctacg gatggagcta tcactctacg
    30721 cagccttcga cactgtatcc gaagaagagt atctgttcac tccagatatg gaaatgaacg
    30781 acgaatcaca actggtaccg gcgtcaccgg acaccaacgt tacgaatgac accgcccctc
    30841 aattagctca aaccacgtta aatttaactg acctcactac aatcaatagc gcattctatg
    30901 ttaacgaatt caacgtgaca ccgacagata tcgctaccgg cttcgaaaca cccagaaaca
    30961 tcaccgctga agctaagcca gctaagagag ccagacgtgt cccagatcaa atgtctttcg
    31021 cagccgactc actagaacaa gattatctac tcccagatgc taacgttatt cagaattgga
    31081 tctcggaact ccgaatcgcg gacaaagaaa acatcggacg ctgcgttcga cacacctatg
    31141 ttccacatac atcctactac ctcagcgctt acgaaaccta cctttttacc gtcatcgaag
    31201 aatacaacaa taactgcacg acaccgcata aggccacttt tgtccacggt tgtatatttt
    31261 tttcctgctc tgttatattt tcccttcaaa ccgagcagcc gtacagctgg accaatctca
    31321 tagtccccaa atctggtata cgagaactct tcttcctcct atgctcgact aacggatcta
    31381 gccttacctg tcaacccctg atcactaaag gtggtctttg ctcttcactt ttagttcatc
    31441 ttgaaccgct accctcagac cagggctttg gcttagctca agtccagctg gttctgatac
    31501 ccatggtacc ctaccgctgg tctaggcacg ctattccatt tatcatcatt caagatgaag
    31561 aatcgaatcg acaagagact cccaatactt caggacaacc cactttgcta gacgaaaacg
    31621 catccccgtt cggacaagcc actatcaccc ggcagaacaa caccgtttta ttcaccgtga
    31681 aacaactctc ttggacctcc aaaagaatgc tatcaggtcg tcgaaagaga gttgtccact
    31741 atgtatcgca gttcaaaggc tcttggtatc acgaattcga tccgaatcac gatgcctgga
    31801 tatcttctaa gaatatagaa tatgaattca tgagtctacc attcacgatc aacgtagaca
    31861 cactcgtgat cgacatttcc aaccacacct ttataggaac tctctccacc tcacactgtc
    31921 accgaatctt ggataaactc acagcacgca atatgcccag atctttagcg ttttatatta
    31981 cgttgattca gagtaaacac gtggatctcc agttcagccg gaatccttgc attttcttta
    32041 gcggagacgt tttgaatctt ccatttacca gcgaaccgaa tcctttttca gcagtgatac
    32101 acgctcccta cgatatccaa ttaacctcgc cagccacaca aactgtaaaa ctagatatca
    32161 tctacacgga atcgacagga cgctgctttc tagttgctaa cgtaccaaac aacgattctt
    32221 tctacacagg tttacggtta tggaaaaacg gtgaactgaa aatcactata tggccgttaa
    32281 ccaaatgtct cttcatccca caaggagccc ccatcgccgt gttatatcaa atcaacgaca
    32341 ccacaggaga tatcgaccac aacggcagaa tcgtattcaa acatcaattt gaagatgaac
    32401 agatctcttt ttatttagga gatttgaaat taccagaaat aaattttcta gcctcatatt
    32461 actattaatt aacccgttaa gactcttcat tgtccttgat agcatcaaca atctgtttta
    32521 ctttatctgc gacatcaatc gtctcgatag attcctcatc gtcctcatct tctccttcct
    32581 cattttcctt cttctccttc tccacactag ccacttcttc ggtttccggt gtcaacgacg
    32641 ttttcaaatc accttgttca gacacaggag caaaaggctg actaacagtc tcagtcggtt
    32701 tgaaaggagg ctcgaaaaca aacgcttgtg taggcacgcc acccacatcc aacttttcca
    32761 attgtttctc aagatccaat aaacctgaac tgtccagagc actggctttc ttggtagaat
    32821 catcggtcga atcgacttcc caccaactat cccgatcacg ctttttctga ctataatcag
    32881 gtttctcatc gtcgtcgctc aaaatctcaa aagctttatg acgttcagta ggctcccgga
    32941 tatcaaacac tttataacgc acagcaggat cctttaagtc agcgagaagc gactcaggca
    33001 gagagctacg ataccaagaa ccgaaagcgt tctccgtagt ttcgggttcc gtctgttgaa
    33061 atgaaaactt cgacctatcg agcggtagag gaaaagcggt ctcgtacagg tggaaatctt
    33121 ccgtcaataa gtttaaaagg tcatcgcacg ccacaccgtc attcactctc gtttttagaa
    33181 tattattgat atattgacag tcgaaagtgc caatttctcg taactcagac cgtaaagact
    33241 gacacagacc actgatacta gataaacatt ttgtttccaa cgcttcccaa gattctaaaa
    33301 cagcaagaat caacctaccg atatacatca tcttattacc agaattcaca atgtgaggat
    33361 ttctcttatt atccaaatct agtctcaacg gttgaatctg aaacatattt ctttcagcat
    33421 agccgatgtt ctcttccaat agagccatat ccttgcctcg catattgaca aactcaaaac
    33481 tacatccgct cgacagtttt ccataaacga tcattctaca cagactagtg atagcctcca
    33541 taattaaaac tatggcccct cgactcaaat cttgaagaag attcttctgt tcatgctcca
    33601 gcaccgacac cgtggctttc acatcgaccc gggtcatatc aagtgccgaa tgacccttaa
    33661 cgtgctgaca aatactacaa cataaccgat gaaactccgt acgcagcgga gatacatcag
    33721 gacgatgatt tcgcaactcg cgatagtaac ccaaccagag aattagttca ttataagcag
    33781 ctgtccgtcg attaagaaac ttatacccgc actttttaag aatcttttta tgatgtgtca
    33841 aatccacgtc atctcgcttg atgacagttt tcacaaactg gttcagcgtc acgacgttgc
    33901 gtcttggcaa gccgataaat actaagttcg ccattttcca acgcaatcct ggccaccgtg
    33961 agtttagaag cacctctacg tcgctctgca gtccacttta cctcaaaatg gaaattttac
    34021 tggaaactcc taacaacacc gcggtgagtc ataaaaagca cccatgaact aaaaccaccg
    34081 tgagctgaaa acgcattttt aaataaccca cttttttatc caggtgtaca ccgaagatta
    34141 cttgcacatc aacgactcat gcggtactac ggcttcttta cagatggctc gttacgccga
    34201 agctctcatc aacaccttta tcattctcat cggcgcacca ctcaactgca ttgtcttaat
    34261 tacccagatg ctttccaatc gagtccacgg atactcaacc cccgctcttt acatgacgaa
    34321 tctttcttcg gccaacttaa tcaccctcat ggttctacct ttcatcgtgt tgggaaatcg
    34381 cggatactta cccggtaccg tccaaacctg caaattcatc tctctcgctt actactccag
    34441 ttgcacagtc ggatttgcaa ctgtagccct gatcgccgcc gaccgatatc gcgtcctcca
    34501 ccgaaaaacc cacagacgtt catcatacac caaaacctat gtcattctag ccaccacctg
    34561 gatgatctct ctgatctgcg ccgcacccgc ctcgctttac actaccgtcg tggtccatga
    34621 cgataaaata ggaatcggag agcagacatg cgttcttttt ttcgaacaag atcagatcta
    34681 caccatccta ctgtgtttta aaatcctcat caccctaatc tggggaatca ccccgatcgc
    34741 tatgatgaca tggttctaca cttttttcta cacgaccctg aaaagagcct cctaccacaa
    34801 aagaaaccga acggtcactt tcatcagctt gctgcttcta tcctttctct tcatccagac
    34861 tccctatgtg atcatcatgc tgttcgacgg aatcgccatg atgcattggc ctttggaatg
    34921 tcaatatctg agccacagga aagtcatcgc taccatggca aagttagttc ccaactttca
    34981 ttgtctcatc aaccccatcc tctacgcttt tctcggcaat aactttctcc agaggttaaa
    35041 acaatgcgtt cgaggggaac tgtttgaccg ccgagctttt ttgcgttcta gacaaaactc
    35101 ggccgccaga gctagcaatc caacccgcag accatcggct tcgcctctcg tacccacagg
    35161 cacaccacca tccaacggaa ctgagaacgc atcaccacgc gacaccgaaa ctgttccaaa
    35221 cttctccagc caggcggcag cattactaag ttccccacca ccgccaccca aacccagcac
    35281 caagcctaga aatctcatca aggaaactcc tcctgaaacc taagaatgca tccaccacac
    35341 ctcacggcat aagacacacg caattcctat caagccgcac acaaccaatc cgcggaaggt
    35401 aggagtggca tcaaccgtta taattgaaac accgatgtcc tatgtttcat atctaaccat
    35461 agaaaaactt caggcaccag atcaacccac ggtacgataa acgacgatga acatcaccat
    35521 cacaactaga gacttctcta acaccgaaga ggattcacaa tcatcgtttt cagaagactt
    35581 caacctcacc acctccgtct ctcgaacgta tcgcagcatt ctccgtgccg aaggcaagaa
    35641 gaagtatctg ctcgaacaac ttcctccaca acccggcggt ctacgacgaa acagtaacct
    35701 gtttctctat tgcactgaca aagaccaccg cagactgaca cacgctatct ctcagctaaa
    35761 atatccagaa ttgatcacag aagcagcaga aattcacacg atcgtgaata atgttcgatg
    35821 tcgcctgcga cgaatcaacg cggatgaagc caaccacctg caaaacttaa tttatggtgt
    35881 gtgtacattc ttcaaccagc tagtgtttgt ggctcaagta cgccattact gtgacaagaa
    35941 tgagagagca ctatggttct cccgagaaga actcagcaag agatgtggag agaaatcagt
    36001 tctcggttct tatattcaac gcttggtgaa tgtcatagac aacgctcaac accgcgagct
    36061 ttgctgcgtc ctgatcggac tgctttatca aaccccacac atgtgggccc gctccattcg
    36121 ccttctcgct aaaatcaaag cgtatctaga aagatgtttc ctcaccttac tgttagactc
    36181 agggataagt atagacacgg ctttcgagtc ggcatatcac aatgacgcgt ataaaacttt
    36241 attctacatg gacaaaaccg acccgtgtaa acaagtgacc acggaaaacc tacagacctc
    36301 aatcgagtta gatccctcgg taatcacaac ttgaagaccc cacgattctc acttactgtg
    36361 tatttaaaga gttaataaaa aatgaaacca aaagtgagtc tgaactttta ttttcagcat
    36421 ggcaatgccc agaccccccc acccctattc ctttccgtca cttcccgtaa atgaaagcct
    36481 caatttccga gcagacttat tttgtgacga acaccgacat tttttgaaag aattggtcac
    36541 tgtcggctgt ggaggctacg taggtctttt atgctacggc atgcccagtc cgacgtacgt
    36601 cttggaaact atgatggatt tccagatccg accggaattc acccgagtca aactcatcgc
    36661 cgctccaatt ctggcgattg ccatcatggc aaatcactat cataacagct acaatatcct
    36721 acaggagacc aaacagagat tgcataattt atatgtcggg ccgatgaaag agaagctgac
    36781 tcgcagcttc cgcaaactct gtcaacgctt gccggtcgct gttaacgccg aggtaattat
    36841 ccagtgcatg gaaactgaag acgtgacttt cggcacgtta aaacaatgtc tgtcacagtt
    36901 gaatgagctt cgagatgccg cagacctctc cccgagtgaa gacactagat cacattatgg
    36961 tctactcaca ttgtataacc tactctatgt cccaccgaaa tttatcacgt cccgaggggt
    37021 caacatctac tcagaaaatt taggagacgt cacacgtcgt gtgcacgcac cgatgcgatc
    37081 tctgatcatg gagcaaagac cgcgaacagc agctatcatt ctcgacgacg tctctttcat
    37141 cctttccctc caacacctct gtgtgaccca caaaatagaa ctacaaatgt taagatcctg
    37201 gatctgggcc aaatgtaacg aactgatgaa cgagctgtat tttgtgtatc tgcaagcccc
    37261 agaactaaaa aacgcgtttc aagacgtgat gtctagcatg cagctgacgc ggaacgatcc
    37321 tcggactcta gccttccaaa acctcttgag agatttgctc acatttctcc ggaaagttca
    37381 tttgacagac atttacaccg ttccgggcta tatccgcttc tgtgcattta atttaatttc
    37441 atatctgaaa caggcagtgg cctcaacatc cgaagacgaa ccacactctt cggattcgtc
    37501 atcttccgaa gacattactt tcgacgttga cccctccctt gcccgtggcg acactattta
    37561 tattaccaaa aatcccttcg gatgttcagc gctctttaag gttccatcca acctttccag
    37621 atttatcaaa aaacggcagt tcattcgtcg tactccaatg taccatgttt acgtcatgga
    37681 ctcaggacga atgattacgc gaagccagcc gctgagaaac ctctacaacc tcatgctaga
    37741 aggaggttct cgacaaacgg gaaccactgc caaagaactc tcacaagtgg ctgaaagaac
    37801 atccaacggt agagaggttg tgattcaaga gactctcgac ctctttgccg acgtcgaacg
    37861 ccgagacgcg ccgtccacat cgtcgagtac ctccgtttct tcccgagaaa gtctgttaga
    37921 gcgaccaccg cgacagcgtc gctatatatc agtagccgct tttgctcctt actctgtggc
    37981 cagacatcgt cgaacacaac gtaaaattcg acttccccga ggaccggccc acaattcacg
    38041 cacaggaccc gacaccgcac cagaaagctc ggaagcagat ccagatccac gggacgaatt
    38101 aagtgaccaa atgagcctct tataaagtag caataaacag acttgacact taaccactct
    38161 gactttattt gtttgcgtaa aacggttaga gtgacaccga tgacacacga cagtactgtc
    38221 gcgacctttc cccctcaaaa aaaacacatc gtttcaaaaa acatgtttat ttaggttaga
    38281 taagatacaa aggtaagtga ctacaattta tgacttgttt cgattactca gaattgcgcc
    38341 tcagccccac ttcattggca ctactccata aagttacaac tcttttcggc ccgccctgaa
    38401 aacacgccac ctttttcgaa atacacattt caaacatggt ttgtcaaaaa taaattcagc
    38461 caaagtctcg tcttccgatt cttcgttttc catcttggtg cacaagagtt caaacgaagg
    38521 atcggtgaga gacaaaaaat actgtcgcgc cgccacatga tctctaacac attttaccaa
    38581 taccgaagat tctgccaacg ccattaattc ttgtgcccag aaataacgcg acgtcgcgtt
    38641 ttcatgtatg acacaattga tcttatagat ggcttcatac acattatgac gctccactac
    38701 ctctttgaac gagacaaaag aagcgaatcg atcagcttca cataattcac tctctttcag
    38761 atcgaagact ttatcgacag catctagtaa agactccggc agaatattct gaagcagatg
    38821 aaaacaaata ggtggtttct ccagccgcat cacggcggac ttgcgactag aatatctata
    38881 atttcttgtc gctttagccc ccaagattct gataaacatc tcaaaactat cagccagacg
    38941 cgagacactg ttaaacacgt cgttgtaacc atacacgaca ccaaaacaat ctatgagaat
    39001 gaacaatctg actacaaaga cattttccgt agagacagaa cccaacactc cgatgatgtc
    39061 acagatgcac gcgatttggg ctgcagactt gctcatgaca tacatgtaca acctgtcacg
    39121 atcagaagtc gaatcggtca acatttgaat cgtcataccc tctgtactat aaattgcgaa
    39181 gtgagtgtcg attaccgaat gccctgtaac cttatacatc cgacacccca catcctccac
    39241 cacacgagaa aacgcttgga gattatgctg cacttcaact aaacgtgcaa tatactcatc
    39301 acactggata gcaggcaata ctaaatccga aaaaccgtag aatccatcga cgtttcgaag
    39361 accctcagag accaacattt ccacatctcg agccacgaga aacacaccgt cttcgtcgta
    39421 gtcatagcaa tagacactgc cagtctctcc caggagaacg atgaaacggt acctccactg
    39481 cttagttcgg tgacacacga agccgaaagg atacagtttt tcaccgcagc acacatacaa
    39541 gcctatacaa gacaaacgat tgttacaaat catgaacaaa ctcgctccga cccaaaatgc
    39601 ccaatctggc catgacactc acctttgttg cacacatctt cgaaccttga ttcgaaatat
    39661 cccaagccag aaagattgcg aagctgtatg aagcagccag gaggccaaga caccagaatc
    39721 cgagaaccac tttctgtttc caagtatctt tgaagcgcct caaaatcccc acgaaaactt
    39781 gcaatgcgcc gatactcctc ggtcgctgca gccatcctca cacacaacat aatgactaca
    39841 ctcagagtgc taagatccgt ggtcagtctg tcgagttctt aactatcccc gtcagcatcc
    39901 atctgatata taccccaatc cgcgtgatgc aggtatcaca cgtcaccgga cgctttcgtg
    39961 aagaagattg gagacttagt aacgggcggc ttccggaggt cagaaatcag atcatgccgc
    40021 ctccataaga tcaccatgaa aaacatccct aacattagaa acattccgct accgagaata
    40081 cacatcccta tggtggtcaa gataacgcgg tttcgtacaa gttcggtatc gaccaagacc
    40141 gtccatctca tctttggaat gaccgtaaat ttagtccaat taatccacgg aacgtgccaa
    40201 tcgacgggaa tcgacctcat tcgacacact tgctcattct tcagcctgtt gactcgacga
    40261 ccaatcacca cgatatattt cttcatccgt ttattaacca accggtgaca gacctccttt
    40321 aaaaactcga aatcgttctc cgcctcttga ttcaaaaagg acacaatggt attgtgtgtt
    40381 ttttgacgat ttttcgaagg cgaggtccaa acatccttat tcgtatcgta agtccggttg
    40441 gtcacactac tgaaattata aatcccttgc aatccccagt ttaagctcat cgtaccgtta
    40501 accataccat cttcgtcctt cgtacacacc agatgttcga caacggacaa cttacttgat
    40561 ttcaaatgta gattagccgt tacgtgtgcc agaacatgtc cctccagata atatcgtaac
    40621 cctaaattca atatagtact ctgtatatcc cgtgtatctt tcctaggaaa gctgatattc
    40681 caacgcataa tctgaaacac ttcatcacac ggacctctat agaccaggct gtgattaaac
    40741 acgcagtcca gaacacaacc tgaagtggtc agatatcccg tccgctgtag acaagtccgt
    40801 aactcacagt ccagcgtcac acacataatc gggatcaaaa gatggaaaac gaacatgccc
    40861 tagaataaaa taaataatta caaaaacatt ccccacattc tatcgagaat gtaaacagaa
    40921 accacttccc cttttacctg aaaacaccga gaacacagaa aggtagccat atcgcgacac
    40981 cgattgaaaa aaaaggcaaa gaccacggta actaagatca tcaacgttta ttgaaaatta
    41041 atataggtcc gaaagtgtaa gacgtcacag cccacgacga gtcgtcattt ccgccttctc
    41101 ctccagatat ctgaaaatac gagaattcga acgttaacag atatcatgag cacaaacttt
    41161 ttccgcgtgt tctgtagaat tcgttagcac tttagagtca gtgagaggag tctgaaaagc
    41221 ttcggtcgga acttcgtcta ctctacgttc actctcagat tctgctgtct cattctcttc
    41281 caatctacct ttgctcctca ggtaatagcg aaaaaacaaa acgttggcat tggcgtacag
    41341 agcactacgc tcaacaaata aacaaggtat ctttccagac tcgatgtttt tgtacgactc
    41401 gacaatcgat ctgatgatcc cgttgacact cttcgcatac gtcttcttcc ccgtcttctc
    41461 acatttatct tttctagcca gcaacacctg cctctcgagc tcgaagacat ggtacatttt
    41521 aatcaactca tctacacttc gacaatgcgg tttcacgtgc acatacagcg gtcgtggaaa
    41581 caccgcgttc cagtactcca tcacaatggc acaatgccaa aaatcagaca tagtcggagc
    41641 caggtaaaac aagagccctc catggtagac aaagacatcc cacttagtcg tgatcataaa
    41701 gaccagctgt ccgctggggt actttgaagc tgaattccat tcttcggcca ccccaaaaac
    41761 aatgagctct tggccaacaa cagaaaaaca actccgttcc aaccaagttt tcttagcttg
    41821 gtttataatg agtaattcat acgtcagatc acagatcgaa atctgcaaac ccgaatcgtg
    41881 caacaaaaca gtctgtgatt tcatcaacct tctaatctgg gcatttaaag ccgtctttcc
    41941 gagcacggag gcttgaatca agcgtccgat atccgtgctc gagctctgcc aactttcttg
    42001 ggactcacaa tccatatctt acctcagctc tgaccctttc cagcttcaaa ctcttcggcc
    42061 aaaggcccca atgctgacat taaagcttcg gtcgcctgct gcgtcaggag ccgaaacccc
    42121 ggactctggg tattgatgta cggtgcagac tcttcttcct cagaatccac agcaagagta
    42181 tagcgattcc ttctttccac ctctcgctta aatctggtca gccaaggata agggtctcgc
    42241 ttactcttcc agtcgatcca cttgtagctg gcgtaacaaa aaagcgcaag gccagccact
    42301 ccgaggcaat ctatgagctt cacgggcaag tttccccgag acatgacggc caacagttcg
    42361 ctgtcaaatg cctgggtaga aacaacgtaa cggactactt atatatgctt tcaacggata
    42421 ttgccccacc aacagagtca catgttttca aaccacaccc atggtatctt taacccctca
    42481 aaaatcacac agaagacgtt ataataataa gaaacgttta atacacaaca tacggaaaac
    42541 ttttctcaca ccgtagacgg tcgatacaaa gtctcaccaa aaatcagaaa agaaaccaca
    42601 gccattaata tcaaatacat ccaattgtta gttaacgtct cttggaaaaa cggagactct
    42661 aaacagtcca gtatcaagtt tccagctgta tactcgtaag tcacgttccc gaccagcctc
    42721 atgtcctctt gccgagcgcc catcatgtac acagtgtaat ctgaagacga tctaatcacc
    42781 cgagtataat cagccatttc gtcaacccaa ggattggtga cattcccata caccaaaacg
    42841 ttcagcatag agtgagcacc cccaaacagg agtcttcttc tgacacaatc agcatccaac
    42901 gtgatgacac cagtaagatt ttctcgggaa gaattcatcc tctcgatatt caccacgaac
    42961 atacagtccg acgaattgcc agtgacattc tcatagcaac atttgaaatc caacaccacc
    43021 gtctcgttct tctccatgcc caccgaatgc gtttccctgt gattgtagga ccagcaatac
    43081 gtaaagttca cattagccgg ccccaaagct ttgaagcatc tttccgactg aactactacc
    43141 aagccaaata tgatcgaaca gagcaggagc agcgttctcg gagccatgac gaggaccaac
    43201 aacatgatga tgctgcttct agcgaagtga aaatgcccag tgtgaacctc ttgattttat
    43261 atgccaacgt ctgtcacgtc aacacaattc agagaacgtc ccctcattaa aaaaagagga
    43321 caacactatt tagtcaggaa gactagaatt ttccccccag ccatcgtatt tctcaccgag
    43381 ttctccaaac tccccaaaac ggaaagccag gatgtggctc actgtagcca tcatcgccac
    43441 cgctttcacc accatcgcta gcgcattttt cggtttcaac tcgatctttc agatcctcct
    43501 ctttctgatc gtcgtcatca gcgtcgccgt tttcacctta aacctcgtgg ctctactaat
    43561 ctacgatttc gtcattgaca cgatgaatga actctttctg tttaaaaatc aagacgatat
    43621 acaaaacgaa aagacagaag tctcggacac catgatcatc atcttcatgg aaacctgact
    43681 agaaatcggt gtccgattgt aaagacaaac gctcataaac gacttcttca gaacccgtac
    43741 ggacgagatc cctgtcccgt cgacgtttcc aaagaatttt ggtcaaaacc ccacaggcta
    43801 ccagaaagag ccccgctaaa aatacaccca ctcccaccaa ccatcgacaa tcatcgaacc
    43861 ttcttcccgt ccacgtacta ttgccactca tccccaccca tccaaccttt tacaaacaga
    43921 gagatcacac accgtcttga acaagacact ggacactcga gtcaagtatt caaagtagat
    43981 ttttataaag catgaaaaaa gctttcaatg tctgcgactg ataaccacag caaatataat
    44041 ggcaataaaa attaaaccga caacagccat gataaacaga gccagagtcc atttcaatcc
    44101 gctgtaaaag ttgtctgata acagaagatt ttccatattg ctggtgggac ggccgggaca
    44161 gttactgtct cgctcagaga tcggatccat ttccaatgac gttgacagac attgttcttc
    44221 atatggtggg ggtaaagcca tagccgacat gggaagcgca gttaacgtaa cgttgccaga
    44281 acacatagct tcttcataac tcggaggcgg caaatctgga tcttccattc caactaaaac
    44341 cggacactga agcggtgcag ccatgatctc tgcgacagtt aagacgagct atttctagaa
    44401 aaccacgagc gtttcaccgt cttcttgagt cgacgacaga acagaccgcg cggacattca
    44461 gtgggtgcca aggctgaaag acttctgacc gttttaccga aacacccgtt ggtgaatcga
    44521 tacgtgtttc taaagcgtag gaaagcaacc ttaaaaaaag tagccaaatt aggtgccaaa
    44581 taataagtac gagagttttc cacgtcgact ccgaacacaa cccccgattc gttgaccaga
    44641 atcggaacgt gaagccaagc gtgattaatc cacgtcgtgg cttcaaagat gttaataaca
    44701 ttcaccgagc cagtctcctg caaccattcg ttgtgcaaca cgcgatcttc tgccgcatga
    44761 tccccacaca cggtgagact cactgtccgg ccttcacaat tccaagcgta gacgtgacct
    44821 tcatacttac gacacaaacg ccaacaactg accaagtcac tagccgttag gaattcactc
    44881 aaagaactat cagatagagt aatatccgga ctcaactcgt ctcgcagcgg aggatattgg
    44941 taaagaccga cctcaatgag atggcagaaa ccctgacgac tgaccaaata tatagcatcc
    45001 tcctgataac tgtacacgta gagacatcct ttttctccaa tgatgacgac taaagatgca
    45061 gattccacgc cttcatccgg cccgacaaca cccaccggca ctgcgaactt gtcacagcac
    45121 aagtaattct taaaaattcc tttaatactt agagcacgat gacttccttt ccgttgaaaa
    45181 tcgtaatagg taaagtacca ttgaacaggc caaggtagag aaagcttcgt accatgatgc
    45241 attcgcacca gagacaaaag atttcgggga gctccattct ccaccgataa ctgaaaagtc
    45301 agcctgataa gatcacagct agcttcttca ggttccatgg ctttaaaatc agagcgccca
    45361 acgcattggt ggccaaccga cagttgtcgc tcacaatcac cgtcgtgctt ttattgtcaa
    45421 ccgttcacat ctgacgcatt gaaccgtcat aacgtgacga aagatgtttc aaaagacttc
    45481 tgtatccccc taaacatagc aatctgactg tcattcgcta actaaagcct tcgatcgacc
    45541 actcgaagga gcgaaatcga gtcagatcaa taaagagttc gctgtaagac tccctaagta
    45601 cacttttgtt ttttggcgtt cggcacaaat tcgaaggtca ctgattcatc actatcactc
    45661 tcctctttcg catctccaaa atacccagga ccacgatcac tcgatccggc accgccactt
    45721 ttagacgtca tgtaattcgt aatcttatgt tgatcatatt tttctttagc gctgtggtcc
    45781 gcctccaccg actttctaga agctcgatca tgttttttag aaggcaccat ctccggaggc
    45841 gcttcggttt ccatgccatc ttcgtgcagc gacacgttat tggccatctg tcttttgtaa
    45901 tttttctcga aagtgttcaa atcattccgc tgaaatggct cttcggtcaa aaaattctcc
    45961 acacaaaaaa gaccgttctt gctcgccaca tagagcatgg tatcgtgttc ggtcataatc
    46021 cgcaacgtac acggtaattt agtcaccgca caattcatca aagcctggta cagattctta
    46081 atctgcacat tcaggcggat atttttaacc ccatgaaagc agacacgatt attagccgta
    46141 aactctaact cattcccgct actcaaaacg aacttaatca ccggagggct agcatgcact
    46201 aagatctgca cggttcccgc agatgacggg ctttttttca cattcctttt gaccctggta
    46261 tgaggcgcca accacttcac taaatcggtc acgacaccaa aatcgaaatc cacgtgcact
    46321 gacgaattct cactttcccg aataatgtct tgtccatgaa cacaagcaga actgaattcc
    46381 atattgaaat ctggagcgca catacaaatc ttggcggata agtccgacat gtcctgaatg
    46441 taaaacttgg tgagatcttt actcgaagtc agatacatga aattacccaa aagcggtgtc
    46501 acattattaa tcgttttcgg ttgaaaagtt ttatcggtaa tgtatagaca agagctgttg
    46561 aacgtaatct tggcgacaca atagttgcga acggtctgta agaccaaggc cggggttggc
    46621 aagaaagtca ccgtggtatt ttctttcagt gtgcgaatga tggatcgcag ctgctggatt
    46681 gcggttttat aaggctttaa tctcaaagcc agggttggcg gttcgggaga gcggactttt
    46741 cgctccatct cgaagaaaaa taaaatcgga caccgagttt cttctcaaga actggccgct
    46801 gaccgaacct ctacctctga cggtctctgc acaaatgact ctgagctcct accaccgcga
    46861 tctttataag ctgcttaaag gcgcaccaaa gaataccacg ttagaaagac acgttattca
    46921 gtcgtcggat cacactcgaa gtttaatata caatccaggg agtcagacac catcttaaca
    46981 atcacttaca acacttatat actccgactt tcattccaaa ataatacaat tcagtgagcc
    47041 tatctaacgg agcagtgatg gagagagcat aatttctcct gatgggcaaa gcgatgcact
    47101 gatctacaaa tttacaaaga ccacgagaac acattcgata aagatgatgc tccagtttca
    47161 gcgccgaata caagaagggc tcgaactgtt tcttctccat caaaatcgga tcatgtacga
    47221 gaatcttctc cacttcctcg tcggaatact tcagcatcac acgattaacg atcggcatcc
    47281 gcaaacaata cttttccaac ttgggaatgc gaagaaactc gtccgcaggt acatcgtgta
    47341 acaccgttct cacatcagag acgttattcg cagccggcca cactgacggt gtgacattca
    47401 acagttgcgc cacatcatca tccggtccca aagcccaaaa atgtgcgttc cgcagtccat
    47461 acttgagaat atcctgcctc agagaatccc aatcttgact ggagatcgtc aaacgacact
    47521 ccggatactt ctggtagaca aacttgcctt tgctatagat tgtccgctga aaccattcaa
    47581 accgcgaaaa tcccgctata cacagattga cactagtacg cagagcgtta taataaagat
    47641 tttcaaaaat ccgctccacg aaatcaagat tctcatgcag ggtcatcccc atcatagtga
    47701 gagtcgtctg gagaccgacg acccccaaac taaggctgcg aaacttttca atggcgcttt
    47761 gggttttccc gtcactctta tcacatagcg catccaagcg gacgttagct agcaggacag
    47821 catcccgcac cacctctcgc aaaatctgaa agttaaaaca ttgatcattg ttccctaaaa
    47881 acacctcccc gtaacatttt cgagaaactg actgctgtct acaaacatga acacatttag
    47941 ataagtttac aaccacacgc tggacaggaa tatggtaatt ggtaaaattg caagaggcca
    48001 aatcaggtcc gagacaagga ggaataggca cattataatc catgatggag taccgaacca
    48061 cgtgatgaca gaatactacc ccagtattgc ctaacaaaag gcaggtgttc agcttctcaa
    48121 agaacagtgg tagacacacc gtaacgtggc gattcgaatt ctccaaacga cgatattctt
    48181 tctcaaaaat ctcttcatta cctaaccggc taagcctccg agacacgttc cgaccccaaa
    48241 tgccaaattc ttcttcccca aggactcgcc gcttcataat gacgtcaggg atattcagaa
    48301 caaaatgaag accaaccgca tcgtctttaa tgatgaagtc caaaatttca acacaggcga
    48361 gatcccaagc atcaaagtag atacacactg tcggcttgac cacatccttt tcacagacta
    48421 cgtcacgttg agcagaaaga caacgaatga gactgatggc gtcggaatcc atcctcgtga
    48481 cattgacaga caccgatgtg cgtcgagcca agctctgacc tagacgttga atcaccgacc
    48541 agtcgttttc atgcacctgg tcagaaatca aaacggcatc acaacctgga gaaccaaaaa
    48601 aaccagcatc tgaagaagcc agcacggaaa gagaaacgac tccatcttga aaccatctga
    48661 gcagcttctc gaacaaatct aattctcctt ccacgtgaaa agctcttcga tacaaaccac
    48721 tgtaaaaatt ggactggacc aaagagacca ggtacaccac gatacgtaaa aagatgccgg
    48781 cgaccatttc ctcttttccc tccataggtc tcgaaatctg atccagatag ataatagcag
    48841 acaccaatcc tttacaggtg atacctttgg taattttttg caccaattct aaaaccgacg
    48901 agaggtaatc tcgatggcga caaaaaaaat ctcgcaccat accgtctatc tcatcgcatc
    48961 ggcaatagat atcaagtgaa gtgtgctcgt ggttacggtt cgtttcgtaa taataacgtc
    49021 ccaagagcaa gtccagacgc ggtttaagct tgatcaatcc agcagcatac ttcacaatca
    49081 attgatgtaa ctcggcaggc ttaaaatccg cgcttttcac cgcctcttcg atctcacccc
    49141 aagcgttttt cacaccatag acattgacag atcctggacg cgaccgacaa aaacgccgcg
    49201 caccagatct gccgtgacaa aaacattttc gcagatattc gcgtctcact ccgttagaac
    49261 tcggcgcgtc aacaccacca acatcagacg tcttggtcct tgaaaattca gacttctgtg
    49321 atgtctttcc ttcagaagca tagcgattgc aaaccacaac ggttcccaat ccgttaccga
    49381 tttgaatcac cgtaggttcc attgtagtct cccataaagc aaaatcctcc cctcgacttc
    49441 tggcccaact atctcgatga agcatatccc acaccacgtt agacaaattc cttgaaagac
    49501 ccgatctcta cattgaaatg ttccaatcgc atcaccgaaa gcttcacttc tttgcgaatc
    49561 aagacaccag catgaatatc ttcacggaga caccaaccca gcttttgtac tacaccggta
    49621 cacgtcacaa agtgaccagg gcgcgtcact cgccgattga gaaactcgaa acgctctcgc
    49681 atgaatctct gtctcaaaac atcaatcaaa gtcggcagat gaaaaatcga agtagtcgcc
    49741 acatacatag caggtttcga ttccacctct ccccagttat aaacgataat taaatatgca
    49801 tattgaattc cgctcttaga atcctcatcc agggccaagt acaactcttt tgggaaaacc
    49861 agagcaaaaa tatccgtttt caacatgtta tacacgtaac cctgcatcac acaagtgacc
    49921 agagaagtcg ttcccaaaga aaccgattgc acacaaccta gagtctgaat gcggcgatgt
    49981 aacgtctgta aacaaccatc taaccacgtc atcgccatcg tggccatact ggaagaatac
    50041 atgcccacga tgagacaacg tgtattcgca gacaggttag aagccttagt cgctagtaga
    50101 aacaaactga catacaccgt tctcggagac tcgacgcccg tgtcgagaac aaacatcaaa
    50161 accccggatt gagactcgaa ttcgaccaaa gcctccggga caaaaaaacg acccacgacc
    50221 gcttggtgat cagctccgta gatatatcgc ggccagatac tatttacatc tttttcgggc
    50281 ctgatcagct ttcgaaaatc agtatctcga tcatcataag tccttttcac tgctgttttc
    50341 ttgacttccg aagccatgtc tcgacgactc gtcgacttaa acaaaatcac ggaagaactc
    50401 cgaacgaaaa acctcgacgc tcaaggggct ctaaccacta tcagcaaaat agaaatcgcc
    50461 gcaatcgacg tccgagagat caccgcatct aaaatacgac agtttctcca atacattcca
    50521 aacaaaggtt atcattttaa ttttatccaa aaaaatgtgg tctactatct gctgagtcac
    50581 gccactttaa gccgtaattc agaccccttg actctagtgg ccgatctcgt ttccgaactc
    50641 gaaaaatatg tccaacgcaa ttcaggaaac agtccttatg aatggttgaa taatcaaaaa
    50701 accctcgaac aatttaaaac ttttattgcg gagattctta agatacagga aagtttctcc
    50761 agtaataagt tcttgaaagc caccctggac gacaaagcct cgaaaaaaga cctgagtgac
    50821 aacgggacac agtatctgat cagaaacgtg ttgacacagg tcaccaaaac agtgactgag
    50881 atccgcgcct tgattaactg tcgcttagta gccgaacttg tagattatct ctatcgaaca
    50941 accaccaact ggttccgaga aacgctgcaa tatactacgt ttcgaaaaaa caatgaccaa
    51001 gatctagaca cagttttgaa aatgatttat ttttacacat atcaccgtcg agccaacagt
    51061 tttctcgaaa cagcttttaa tgaattcacc aacgagggtc gacaacgttt caaaattttt
    51121 acgatctcca acttggacgg agatcaacaa accggggcag aatacattcg agacaccagc
    51181 ttcaaaatgt tcaacgcttg tctctctgac aaagatagct ccggtttgct tttcccaatc
    51241 atctcgaccc aattgtcagt cttgaatttc atgtccatcg aaaacctctt ctttcaccca
    51301 ggtctagtct accgtctcat caacggcgtg atagcgacac gcatcggtga taaactggat
    51361 gttctctcga aattcttgac agccaccacg gatcgcgtct tccgatcgac agtcagtacc
    51421 aaatcgaacg gtctgaaaga catcacagaa aacattagca aactgaccga gctgggtctg
    51481 aattacgaaa cttcccgatt gtacattcaa atgtgtttaa cgaaacaaac tcccgagaag
    51541 aacgatcaga tcacaccgta ccttctggat caagtcaagg aactctcgaa ccagatctgc
    51601 ttaatcgtct ataacgccta cttgttcttt ctttgtctca acgtgtatag tccgaccttt
    51661 ctgttcaatc accgtcgtcg aattcttttg gaacaacaga aatccttact ggtaggatct
    51721 cgaaccgacc ttgactccat ctggaaaaat gtcgtaatga acgtgaatta ttattttccc
    51781 gcctggttta ctgaagacga atttgatgtc tgtactaaag gatccacccc tattgagaaa
    51841 gaatacctgt atcgcgactt gatcaataaa tggggagatg tcttattcac cctgaaatat
    51901 cgccactcat ctgagccagc acagattgaa caatcaacac agaccatcac gatcaccgac
    51961 attatcgaac gatgtgccat ggtcaactta tccgacgttc cttatgaatc tttattaccc
    52021 ctgagtagtc accctaactt cgccgaaaag tttgtcaatc tcgtcatcgt cccagaattt
    52081 acacaaacat tgaacattcc gtacgcgcaa ttcaaaacgg tcggagctcc ccgcttgatg
    52141 caaatcattc aagcctgccg actcctcatg cccggacaaa tgacgctata ccacaaacta
    52201 gtcgctctct ataaccttac caactttgta tcaaagatcg acggtggagt attccgaacc
    52261 atttacgacc tcatcgtgga aattaccgcg attctggaga acttatgtca agaaagctta
    52321 tcactcaatg ttgatctgat cgccgagctg atggcggaat cgttatcgaa caatctacgg
    52381 gacgatgtca acccgatcat cgacgaagtc atccgtaata gctcaagcag catgcaacaa
    52441 tatgttgaac ataccaggct atgctacgca atcgctatga ctgacggccg cctcgtgacc
    52501 aaagagaatt ctccagatac ggtgttaatt atcttggcct caaaaaccat tttaaccatg
    52561 tccctccgaa actttgtcac cgcagctgac cacctagtca agcaagccaa aaacctgaac
    52621 gataacttaa cgctgacgca aaatcgcatg aaacgaatat ggaggcgagt caatcagatc
    52681 ctcgatgata tgacttgtgc cggacaatgc gcacagacgc atccgattta cggagagatg
    52741 ataaaatcgt tgcgtaagac cctcaaaacg ctcaaaggga tcgaacatcg gctttcacaa
    52801 gctctcgaac aatccgagaa atcgaacaag ctcgtgactt cctccctcag tcgaataata
    52861 aaaacatgct cagtcctcgg taacaataac atattcgaac acggtctttc caactgcatc
    52921 acggaagccg tgggaaccat caaatctcac cgcactttct cccgccttcc gatctcatct
    52981 tactcggaac acttaccgaa cgccgaagaa ttgctacaca agttttttca accttatcga
    53041 aacacgtcgt caaccagcca gataatcgac atgagttcag taactgacgt ttcgaacgaa
    53101 tttcaatatc aagatgtttt tgaaaaccga tactcgccac tcgataacct tgacaagcta
    53161 ttaaactggt atgtaaacac caaagaacaa gcccaagaag acatctgcgc ttctctccgt
    53221 cccacgctga cgaaatgcgt cgagacccca tcgtgagacg ccatgcagat ctaccaggcc
    53281 agctgcgacc aagccagtcg acgattcggc cctcgagcgg gaagccagtg tgtctgtaac
    53341 tgtctattgt atatccatac tcttcacatt aaaggtgcac attacaccct gaacaaggat
    53401 gccttggact taattcttca agagggatct agattagata caatcaccga gcaagaacta
    53461 cttaaaaaaa acataaaacc tcacgtctac cgcttaggtg aagaggtttc tcgcaccatc
    53521 cagactagtt ttggccggac cgcgcacgcc ctttcccgtc cgtttaacgg cactgccgaa
    53581 acacgaaacc tagacggtta cgtttgcttg gggatctttg atttcctcct gtacgcgtac
    53641 aacaaaccca aacccgtgta catcttagtc accgtcgacg ctctagcccg agccatcgtc
    53701 tttaccgatc atgatatctt tgtctttgat ccacacgctt cagatcgatg tcccaacgcc
    53761 gccgtctatc aatgccgatc ccttgacgac gtggttacga tcttaacttc tttcggccta
    53821 attctaggct ctttttacta tgatgccctg atcatctaca tgatcgacct atctatcttt
    53881 cccattccgg ccagcgaaat cgatcggact atcatctcgt tataccgaga cccagacatc
    53941 tccctaccca tccctatccc accaggttct cctaccacac ccatcaaacc cccacctacc
    54001 tcagtcccag cactggaacc tgtaccctca ccatccacac cgattccaac gtcgaaaaag
    54061 accaaagctg aaaagagaaa gagcgacaca cctcataaga ccagtaaaaa gaatcctcgt
    54121 aaaaccaccc accaaacata caactgtacc gaagcccttc cgtccttaac tcgatacgaa
    54181 catttagtag aacaaataga gaaagagttg acgcttcata cactaaaagc cccaccgacc
    54241 tcaggatgga ccctgtactc acaaacttcg ggtttaccat tcgacgagag cttcttaaca
    54301 gaacgtgttc accagctcac agcccaaacc atcgataatt tggccatgat gagatacttc
    54361 gtcaacccgt cagatgatac cgtaagagac agaactcgag ccactctgca aacacatttg
    54421 agacaattat ggggattttc tcaggccaca gacacgtttc tcgccatcct ggtcaaacaa
    54481 gatctcaacc tagtaagatt atacaacgtc tacctaagtc gtcgaaaagc gccctggacg
    54541 acgctagaga gacttttggg tagcaaaatt tacgtcgtct tcactcactg gggagaaaac
    54601 cacggacctc gcgtcaaaca atggactcaa aacctgatcc ggcacataga aaaaaccgac
    54661 attcacgaac tcgaagtcaa gataagaact tacctttgga gcaaccctct atctgtccaa
    54721 gaacgattcg tctgtcttaa gggtgaagac cgagatacgg tatccagttt ggtggccaca
    54781 cgacaatccg taaactcgga acaactagct aaacaacaaa acagttatcg tcacatgtca
    54841 gagtgcattg ctcatataga catcaataga ctagatcaac tttccccaca gatcttgaat
    54901 aaaaatctat ctgagatgtc caaagtcgat cacgtcacaa aatcacagct aaaaaagcaa
    54961 accgagaatc aactccgaga tctttacaac gatctgaaca caaatttcca aaaaattcta
    55021 gcagacaaaa acaatcaaat tctctctggc tccttaccag gacccgaact cactcaactg
    55081 caaaaacaag tgaaccaagc tttaactctc tgtcaaacct tgaagaacct gaatctgtat
    55141 gacaccaata ttgacgagca attacataaa ctaacagaat acatcacttt tattctaacg
    55201 ggaaatgctt caacatcgat aagctatccc gaaaatctga ccgccctccg aaaagaattc
    55261 tctgaagtca ttaaacaaaa agaatataac gaaactaaaa tcaatgagct gctcaacaac
    55321 atcgaattca tactgaaaga tccaacctcc cgaagctcta acatctcgat gtcaatgttg
    55381 cgagctcaat tacaggagct ctccaaccta gacattaaga aagtctctgg agccgaaact
    55441 cgcttccagg ctatctctaa attaatcaac tctctgaagc aagaagaaga tctgaccaga
    55501 caatttgtgg cctcgatctc gtactctaac atgcctaata atcaaactct gaaaagacaa
    55561 cttcgtttaa aagatctcct ccgtgacgac gaagacttac gtaaacagta cattagtcat
    55621 ctagctgaaa tccttaatac cgtagtcgat aaactagtca cccaagaatt ctggccacct
    55681 gccaccttcg aactactgaa agagctaatt aatcaattac cgccgaacaa tcttaccaga
    55741 gaccttcgcg tctccacctc gatattcgct caattgagca agaagataga aacggtttct
    55801 aaagccacag acaaaaaaaa cattcctctt ttggaagaca tgacacagtt ctttctgagc
    55861 cacggagaat cctttagcgc tctcatgtcc tccgggatag gcttaaacct gaaaacaatc
    55921 tatgaaaaat acaaagccca gctagaggcg aaatacctac aacaagctga agacacttgg
    55981 aaaacaaaag cgcgagaatt aaaaattacc tcccctaaca ctgtcgaagc atttcttcga
    56041 actgcaccca gtcacactgc agcctccgct gtgacaccac ttttggaaga aaaactcaaa
    56101 gcttacattg aagaagagtc caaaaagatt cagcaagaaa atcaacagcg cttgaccgaa
    56161 tcccaaaaca gaatcgatct ggaactcaca cgagtagtcg atgctcttcg ttcggaaacc
    56221 ccttccctcg tcctagctgt agatctagag agcgtaaaaa acatattaag cgcactagga
    56281 cccaacacac aagctatctt ggagaaattc aaccgcaatg tgctttctgc actatcgaag
    56341 atcgacaaac aaatcgatcg ttcggcagat aagaagatct acgagctttt ggccggaaaa
    56401 cccgcaaaga taactggcgc gtactcaggc gatcccaaca tcttaaagac agctctgagt
    56461 cacttacgcc acttagatgc ctaccttact caggaaacca aaacaattct gaaccacatg
    56521 tatcgtcaat tactatttat caccacggaa ctcagtgacc gtccagccgc cacattcacc
    56581 gaaacagaat atgaaagcag atttctacag tatcaagaat gtcaaagaga actcttgagt
    56641 aacttcgaaa ccgcgaagag cagcatcata cgagaagcga acgacctaca gggcgcagtg
    56701 aaaaaacagc aatccacaaa agccaccgaa aaaccaccga cactgaatcg acaagtcgtc
    56761 agccaactgt cctatccatt gaccccagat ttaaaagaca ccgcattcca ccaggtgctc
    56821 gaagaacatc tagattcagc acgccaatct ttgaccaaag aaattgatct tttagacatt
    56881 cagctaaagt ccattactga attacagcaa gctaaaacta gctctctaat cgctcggtgg
    56941 caagacctag tcacgcgtca caaagtagac tccctagaaa tccccacacc agaagctaaa
    57001 ctactgctca gcgatcctgt gaccgcgctc acggaaactg ttcaaaaagc agccacagac
    57061 cttccgtatc tcatctccga aaagacactc aaatgggtac tgatgttcat ccaagatgcc
    57121 attcaagaaa tcagtcaatc taccgatcat cctcaaaatg gtcacctcgt gtcttaccac
    57181 gcccttcaac aaaaagcaca acaacatttg acaactgtca cgacggacat ttcgaacaac
    57241 gcatcttgcg aaaactttgt cgctcatcag gacactatca cgattaccga agatatcatt
    57301 cagcaagccg aagccgcatg gcggtcactc caacccaaac gcgtggccgg tggtgaagcc
    57361 cgttaccgac agatacaatc agatctcaac aagatgcggc attctttgtc cgatctagca
    57421 ctcaaagaat ctttagccac agaatatttt gaactgttga acggtcttca ctcgttcagc
    57481 tacggtttag acttcaccac tcagttgcaa aaaatacgcc aactacagat gcgcttcacc
    57541 gaattatcta aaaaagaaaa aacctcttcg aacgattcaa gttttcccgt gtaccaaaaa
    57601 aatctaaccg cttccattcc cacatcatcc tttctcagag gcctagtagc tttagaaaaa
    57661 agagttttag atggctacaa atacctaagc gacctggtca acaagcaatt tctcatcaat
    57721 aagcggttag aagatgtccc ttcattaatt ttacccgcca agagtgatca ggccagtaca
    57781 gacagactaa gcagattaca gttcagcaga gacactcaac tctacgagat catcgacgtt
    57841 ttcggtgacc accagatagt gacgccaaac ggtaccccca tctctctgac cccgacatat
    57901 ggtaatgtga tttttaaata tctagcgcta caccgtagcc agcacaccgc ttcgaaacgt
    57961 cacgcgcgtc tcaaaaacat cgtcacttcc agatataaag ccatcatggt ctctgtagcg
    58021 atcgctggga ctctgaaaag cttttggaaa ccgatttcgg attacgatct caggccgctt
    58081 ctcacaaacg atgagatcga aaccttttct cgggaaacta acacgttggt caatttgaaa
    58141 atcttcgctt atgtagtcac cactgcttgg acattacaaa gtcaagacat cacagaaacc
    58201 ggttctcgaa ccaagctgtc catcgccgag ctgtgtatga ttttaacgac attatacccc
    58261 gaatatatct acacgatctt aaagcactcg atccagtctt ctgtcacatc tctcctccac
    58321 actctgaaac aggacattgt caacgaggct ttaaacacca cgcaaaaccc acccccctgg
    58381 gaaatcgacg aattaaaagg tttctgcatc gaacagagtt tgtggtcgac agccaccatc
    58441 agccgcatct tgtgggataa cgacttcatg cgacaactct gtcaagatgt cggtccctac
    58501 aaaatgaaat caggcaaatt gttacaatac atcttagccg tctcgatctt accacaggac
    58561 gtgctacaat gtctctggct ggaacttaaa ccacagtacg ctgaacaata cgtgtctcta
    58621 tacgactttg tccaagccct ctttgacatt ttcagttacc cgtacgatgt cacagtcggt
    58681 acaccagcca acgatcctca gttaaccagc ggtgaaaaga tactccaaag catctcattg
    58741 agaaagaagt gtacacaaga agaggaggag atgtcaaaaa tctttattga gacagaaaca
    58801 gtgctagatt atgctttagg ttcgctagtc tttggtgtac cagtctgctg cgcgatccgt
    58861 gtggctgaca tctcaggtgg caggactctt ctggctcgac atttagaata cacccctaac
    58921 gaccaggatt ttaaacgaat cctcaggtcc cgggacttaa attttggcta tctgatcagc
    58981 cagacttgga caaacacgcc gatagaacag tgctggttcc agagtcaggc taagaaaata
    59041 cgggattatc ttcaacaccc ggtaaaactt gactttacac cgttagtcat ctacggttcg
    59101 ctgacccgat atactgagtc agtactcaaa cctcctctga cagatcacaa acccaactcc
    59161 aggatcgtca ttgataaccc atttcccata attcccttag aacagactcc cactcccgaa
    59221 cccttatcct ttcaacgtgt accggtaagt attgatttct tacaggacac acctccacga
    59281 ctggcagaga ctcacagcga acatagcgag acggtggaac ccgccaccgc aggagactct
    59341 gtagcttcca actcattctc cgaacctgtc ttccgacaaa atgataccgc agataccatt
    59401 ttatcgaaag atgatgtcac cactgtttca ccttccgccg ccacggcatc tttcgggcag
    59461 cagcccatca cgaaccttac acacaacatt cagaaagctt tacatatcat aaaaatggta
    59521 aggacagact taagagccct caccgagtcc attatcgaga ctactcgccg tctagatttt
    59581 ctttatttat gaacgccgtg cacccgcagc catggccatc attctcaata aatctagttt
    59641 gaaagcattc ttgtctgaaa acatactaga cattcttgcg tatttcgata acatagtgtt
    59701 aatcactggt cgttctaaat attcagcctt aagttccagg acttgaatcc caacgtggcg
    59761 ctttttatct tcgtcttttt taccggcacc gctgtttgaa ccagacccgc tagacatatc
    59821 gacgctgaca aggaagtcta gccacaacgg cacacgctaa acagcgattc tcgcaagtct
    59881 cgtcgtctaa acacgtatcc ttcggctcga ctgccgcttg acaccgttga caaagaaaag
    59941 cgctaccgtg cgtcactaac ttcaataacc tagccgcggt acagagtcgc agaatcgtag
    60001 tcgagtcaca cgttcgtgaa gaacacggca caatgacgtc taataccgct tcccgatcat
    60061 acacagcaca agcagcgttg agacctacta cagctttcca ctgaacacgc aaacaacgga
    60121 atccatagac gtcttctaaa gacgcttcat agacacgctc cttggtaaga cgttgacttc
    60181 cacaaagaga acaatgaatg agctctgcgt tagtatcgta gataacactc ttctcctgac
    60241 gatccctata atagaacatc gaattcaaag ggaaattctg atcgcactgc aacttttctt
    60301 tacccaaatt caaacagtga ccacagtagc gacacactac agccaccaag gaattcacac
    60361 tcaaataacg ttcgcatttc aggacacaga agcaccacac cggaagctcg agaacgcttc
    60421 cgatcaatcc gcgacgtagt gcaatggaca acccgtgcat aactattttt gaaggttcgg
    60481 cgtgagactc cgaacgttgc attcgggtgc catcatcgtt cagactcaac ccgcgaagcg
    60541 gcaccagata tcgagggcac cggacacaaa aattttccac ggcatacttt gccaccacat
    60601 acacgggatt accacacggt acttgtccag cacgccgacg taaagcactg attagatcct
    60661 ccaccgattg ggtgcgcgac ttctgtctgc gttgccacac gttatcttga taaacgataa
    60721 tgtccagact ggtatcatac tttttggagc gcaaaagcga cagacacgga gaacttatct
    60781 gcgtgctgat gggaagacgc aaatcagtcc tgaacaaaaa ccgatgtaga tcattcaaag
    60841 acgtaaaatt tacattttcc aataacgtat tcagcttatc accaggatac aaagataaat
    60901 tctgatgaat gtgaaaagcg tcatactgtt caaaccgtag gaaagacacc acaccggaga
    60961 tctcgtgtaa gcaatataac agatagatgt aagacaaaaa gagaaaatac tgcttcgtca
    61021 taactatacg tttgaatgtg aaattcaatg cttcccgttg ctgcagtgag caagatgacc
    61081 acagtaccaa aaatcgctga tagaatcgat cactgagctc acggggtaaa aaacgtttat
    61141 ccgtgataaa catagttaga acacagtcca tcaactcttc cccacgcaca gtccctccaa
    61201 cggccaactg cagatgaaac ctgtcatcgt gcacacatag cggaacaaaa agttccatca
    61261 ataaatcacg gtacataacc gccataccta agaagtacgt acattaatcc tagactacaa
    61321 actaatacgg caattaccgt ttctactcgg agttctttca gacgaactaa acagccgtat
    61381 ttggaagaag actgaacctc attactcggt aagtcggggg acggactact tttttcaaat
    61441 ctttttcgaa agctctgaca accacatcct cgaaagggag gaggtggagg cgggggagga
    61501 acagtcttct ttgccattcg cgacggactc cgaactcccg ccacttttga ggccgttttt
    61561 tcagttccac tgatgacgga cttcttttga tacaattcac gtagcagaat ctcgtactcc
    61621 ctttcgttct cgggaccaaa ggcgatcaac tctatgttaa aaaccgacgc cgcatttgac
    61681 tttctgacca cacacttagt taaaacaccg taggctgacg gtttcagatc ctcgatgtcc
    61741 ttcagagtaa tgacgatctg gtcattcact cgcaagacat taaattcccc cacgtgtcgt
    61801 gacgacacaa gtttcgtcgg agcccgaata aaacagcaga gtgacacagc acacccagta
    61861 ttcttaaaaa caaagcaagg aatgtggtcg gtccgacttt cccagtaact caataaatac
    61921 tcgacgcaat aaacagtatc cgttcttaac atggcgtcac acaccgagta gttagggttt
    61981 ttacagatca aactagaatc cgtcacgcgt aactcgttcg gacctagttt cagaatccgc
    62041 cgtgtcgccg aaaccaaatc gtggtgcaga gctttatcga gatccatttt ataaacaatt
    62101 acggcacgaa actcttatta tttactagat gactcctctt tctcctctag aataccgttg
    62161 atatccataa gcttcgttac gatcgccgtt aatagtttcg tcttatcaca taagatttcc
    62221 gcatgagaac aacttggaga ctgtccgtac acgtatttaa agaacgccgc gtacttctgc
    62281 ccagcattca cgaagttcaa cctagcgtcc aacgaaggca atagcaattc gtacaccttc
    62341 ggtaacatcg gctcaaactt gatatacgag tcttccaact ctaagtcccc atcaaccgtc
    62401 tccgtcatcc cgagaccccg gagacctccg cgatcctgtc aacaacatgc atcggatgta
    62461 ctttggctgg tcggcggaac acaactcgcc tcacagtcct ctcatcaacg agcttttatt
    62521 acaagctcac ccgaggaaac ttcccagcac acctagcgat caaagcgtca ccaacagtac
    62581 acacgggaac agcgaaagag aaaacgaaac ccaatcgact ggaattccag acctcatcgg
    62641 cacggcctgc gatctcgacg ccgaactggc acaattcgag ctcgtagatg cagaacgtct
    62701 taaaaaactc tgtacaccac tggacatcga tacccgttgt aacctatgtg cgattatcag
    62761 catctgcctc aagcgcgatc atgaccagac ctggttgcta aactatagtc tgctctgctt
    62821 taaatgtaac tacgcaccca gaacgtcgct cagcgtgatg atagttatgt ctgagtttct
    62881 acaattactc aaccaccatt ttccagatat ccaattcgga cagttatttc gtcaaaatgt
    62941 gctaacagtg ttcgacttcc acctccactt tttcattaac cggtgttttg aaaaacagaa
    63001 cggtgacgcc atggagaacg agaacgtgac attgagtcat ttagccgtag tcaaatcgct
    63061 agttctaggt gaagaaacag taccctacag caaacaacgt aggttcagtc accacaaaca
    63121 gaaaatagtc atcaagatcc ccgaagaagc gaaagaaaca ctcgacactt ttttacaaca
    63181 cagcacacca ggacccgacc gtttcacgca tctcctctgt tatatgtggg ccggtactca
    63241 agtcatgcct aacacgccac tctccagtct aaccgaagcc aaacatcagc agctcgactc
    63301 tttgaatgac gcggatgagc cagaatacga gaagaccaca ggccccatct acctctcccc
    63361 aattcccgtc ttacaatgga aaaatcaaac taacaccgtc tgcctcctat gcgaactaat
    63421 gagctgctcc cattacgaca acgtcttatt gaaatcgctc caccaccgaa tcacatcata
    63481 ttgccaaaac aacgtcaaga tgatggatcg gactcaactc gtgctcgcag aagtcctccg
    63541 agaatgtgcc tttgccccac ctgaaagcca cgaagatttg tcccaacatg ccatgcagag
    63601 cgattcagca ccttcactag aattgactcc agatttattg ttctgtacga tcctaaaaca
    63661 agctggcgtc accggaattt acaaacactt tttctgcgat cctcaatgcg ccggtaatat
    63721 gaggatcgtc aacgaaaacg tcctcttcgc tcgaattcat ccgaaccact ttcaagaagt
    63781 taagctgtcc atctgtcacg ataataacta tataagtagg ctacctagac gcgtttggct
    63841 ctatatccat attttcaaag ccttccagat agtaaaacga aattttaaag ccaaaacgca
    63901 gctctcagac ttcttaagag aatttacaca gatcctagaa gcttgtgaaa taaaactagt
    63961 ggacccgtcc ttcgtagttg acaaatatgt ataagaacaa aattcgctct acggctagac
    64021 gatccactct gcgatcgctg tcaaaacacc gtaaatcact gtcacgcagc ggctcttcac
    64081 cattgagtga caccccttta tcacacacga agctcacact tcacgatctt catgacgttt
    64141 ttcgagaata tcccgaccta gagctaaaat atctcaacat gatgaaaatg gctatcacag
    64201 gtaaagaatc catctgtctt cctttcaact tccagtcaca ccgtcaacac acgtgtctcg
    64261 acatttcacc gtacgggaac gaacaagttt ccagaatcgc ctgcaccaac tgtaacgatt
    64321 cacaggtgtc accaaccgcc tccgatgcaa tggtagcttt catcaaccag agctctaatg
    64381 ttatgaagaa ccgccacttt tattacgggt tttgtaaaga tgccgagtta ctgagaatgt
    64441 cgacaaacca accaacgcta ttccagatct actacatcct tcattcttcg aatcatgaca
    64501 tcgtgccttt tatgtacgcc aggaacggcc gtgtccatat gcacgtcatt tttgagaacc
    64561 aggacgtcca catcccctgc gaatgcattt ctcaaatcct ctccgccacc aaaggagact
    64621 acagcatcac actcgacatc gtcagaggac atgtcgtgat cagtgctacc tgccacgcca
    64681 tcacagcaca cagcgtcaag atcgacctcg gaaccctgca acgcaagatc gacgaaatgg
    64741 acattccaaa cgacatcagc gaactgttcg aaaggtataa aaatttattg caagaactat
    64801 gcaatttcca tcagacataa gatatatctt taaccgcata agacagaaaa ggcttagcca
    64861 aatacatcct ggcaggcatc agcgcgagta aaaacctgtc tttcttatcc aaatcgtacg
    64921 gaaagaccgg agacaggaca ttcgtgatcg cctttaacac ctgctcgaag tacttgtcgg
    64981 catgaatagg tacctgattc tctttgacaa aaatcggatc ctccgccagc tcgtaattat
    65041 tcatctttcg acgagaatca accggagcag ccgtcagaac ataaaagaca cggtcaccta
    65101 cggaaggtaa ctcttccgac ctggcagcca accgttttat gaccgacaga tgcggaagat
    65161 taggctgctt atacagagag atgtccttgg ataagaccga agacaacacc agttcgtcca
    65221 cacaaacgcg acccgtttgt aactggtctc tcgcttcatg caaacgttcg ataattttta
    65281 aaaaccccgc cggtggaccc tgcttcttca aaacttccat agaataccga tgcaaattca
    65341 ccgcagcttg cgaaacctcg ggatcgtcaa acaacaaggc caaaacatct ttgatcacct
    65401 ttttcacaaa ttcacacgag gttttacgga ccagatccac acccttcata cttaaacccg
    65461 tagtaccttc aatctttccg atataccgtt tcttgcagat catcatcaag gaaatgaaga
    65521 ctttctcaaa ctccagcttc accgggtgag taaacagaca agaagtgaca tgacgagcca
    65581 cacgctccgc actggccttc aacgcactgg ctttcagacc ccgatagcac acaaagacgc
    65641 tatccgtgtc accataaatg actttagcct caaccccacc ctccacataa tcttcttcat
    65701 taaagaaagt ttttaaaaaa tccggtgatg caaagttgtc atgaataaaa cgcgcggtgt
    65761 cttgtaacat tcctcgtccg attcgtgtaa tactggccgc cacaggtaag cagggcagca
    65821 tcccattcgc cactccggta aaaccataga aagaattgca cgtcacctta agtgcgagct
    65881 gttccttatc gagtaacgtt ctctttaagg ggtcggcaca atctttcata gcctcacgaa
    65941 cagctttccg ctgcgccacc cacttcgtta gcagctcaga caacacagag ggccgaacct
    66001 caggtttcac aaaccggtaa actgtaccat tctcaaactt gacttcgtaa atcttatccg
    66061 cttctggaca ttcaccgtta tccataataa gcgtagagta acacaagtta tgggccatga
    66121 tgatggacgg atacagacta gcgaaatcaa aaaccaacac cgggtcattg tagtaaccga
    66181 cttcaggctc aaacaccgta gctccttgat aggtgacatc gtcccctaag cccgagtttt
    66241 tgtaagtagg caaaatcaga tttcgacacg aacactcgtc caataacgaa gtatagattc
    66301 tgacttgctg tccgtcagaa actactcttc gcattgcgat cttggctaac ctagccacag
    66361 cgccggcttc gtaatgaaaa ttaatgacat tgaaaagatc ctttaccagt aaagcgtcct
    66421 gaacacaata tttgcctacg accgctcgtc ccacctcgtt agctaaaaat tttacgggaa
    66481 tgtctttata ggaaagatcg tccttctgct gtttaaggta caactcggcc atcgtgttga
    66541 gtttataatt ctgagcactg gttttagcca tacacacagg atacatatcg ataactactg
    66601 taccggaaat caccaccttg gtctgagatg tagaaatata agtcttccct tgactactct
    66661 gaacaaagaa cttgccatca cgactaagct ttccgaaacg gctcacgtta accttgtaga
    66721 cgttttcaag tctagccaat aagtacctga aatcgaaaga attaatgtta taccctgtaa
    66781 cgatacaagc gccatagcgc ttgaagaaca tgaagaaacc caacaacaat tcgtattcag
    66841 aagggaattc gtaaacatcg acattatcga taggcgcaca acttcctatt gtaaacagat
    66901 gctttcctga tctcccaaaa gatacatcag catcatcttt gcccgtagca tagcagacac
    66961 acgatatctg aataacgata tcatctacat tttctggcgt aggaaatcct cctccagcac
    67021 tcaaacactc gatatcgaat gacaagcatc gatataatgg ccaagacgta tcttcgggcc
    67081 tgcagaatag ctcagagact tcacaatcta gctccacgtc acacgtagat actcgacctt
    67141 gtgtacggac ttcatattgg tccaaaaaac accaaccgaa cgttgtcaac ttcttatcga
    67201 ctaccaatct agttagagga tccactctga tctcatagac ggaaaatcca tgatccagca
    67261 tgtattgtcc aatcttccta gccatcatcc aattgctgat agatacacgg tgaagattgg
    67321 gaacaaaact cgtaccgtat ccatagattg acattttatt tgcaggtaaa accgtaacgg
    67381 cacacggatg tctgggttca ggcaccaact cagcaatact atgaatcact tcccgcaggc
    67441 gatcagtatc tggatgttca cagtaaaaat aactctgctg accaaaaacg ttgacacata
    67501 tgctctggcc actctccacg actccaaaaa acctaataac gttgccagaa ggaacaatat
    67561 gcctccgata cctcggtggc acattctcgt tagtctcgat ggttagaacg ctgtcacact
    67621 gatcatacgt atggaaacgg acttcacctc gtattggagc caacgatcct gcaccggaga
    67681 gactcggcca cgccatatcg tcacacagag tatatttatt attgttaaaa aacataattg
    67741 gttttcgact cgtattccgc ttaatcagtc ccgtctgccc atcgtacata acaccccgtg
    67801 gtacaatctg aaggaaactg ggatcattgc tacgtttcgg cacccccgtt cgccgtccac
    67861 ccccgagata cggattgtaa aacatctttc agactcaatc ttcagacact agacggttat
    67921 aacccctaga acgataacga agtgcatcca gaataccagt tccaccttcc gaaccttctt
    67981 cagataccct tttcagattc cgtctctcct gttcatcgta cttcatgaga gcttttagaa
    68041 tagctttagc atcttctgga ctgtatttat catcttcctc tgacgaaagc tgatttttag
    68101 acgaaggctt cgacacatcc gtataaggcg gaggactata cggaggcgga gcctctttga
    68161 tcatctgcga cgtgtaagga aacaatactt ctaacggttt ttcgtaagtg cgtttctgcc
    68221 tctgataaat caaaaatata acgcctaaaa ccgctagtag gaaaagtaat accgtgaacg
    68281 atccaaaagg atttttcaag aacgacccaa taccttccat tacagaggca acggcgccac
    68341 ctaccgcccc tatggcaaca cccaaatgtt tcccagcttc ccctagaccg ctcataaaat
    68401 catccaaccc tcgcagatat ggagggatat tatcagctac cttgtcctca acgaacctca
    68461 tacgttgttt ataagaatta aattctctca taatctcctc cagatcaaag acattagcag
    68521 atcgaagttc atccttagaa tataactcca acatccgaaa atctgtattc tctaaaggct
    68581 cgatgtttaa tcgaatcata gtgtctacta tttctatact atctagattg atcaatccct
    68641 taaaataata atctacatac ttatacccta catcacctac aatgaagact tttacactag
    68701 gatattcaca taattcagtt ctatgcctgc ctaccaggac ttcattatct tcacctaact
    68761 gaccatactg cacgtgagaa ctattgacaa acgtgtataa cagaacaggt ctagcataac
    68821 actgcccttt catcggaccg tctaagacat gcatatctcg taaaacctta acactcgtct
    68881 gattaatcag cacacattta gcaattccta tgacatcacc cataaattta gccgcgacag
    68941 gtttgtcata aatcgccgac ataatccttg taggatttac tttactcaac tcggcaaaaa
    69001 cctccaatgt tcgccgctga tctatacacc aagcctccac aagatgacct aacgcattat
    69061 taatataatt cttcagtgta tcatatgtaa attgaacctg cgaatataaa agactacgct
    69121 ctgaatcaga tgaagacgaa ttcgacgaat ccgcagatcg tttccgacga ctcgtggtgc
    69181 tgctgttagc ttcggaggca ttattgatca acctctccag cgaagcgata gacttctgcg
    69241 taacaccctg ccagaatact atcaatcccc ctgtagttat atgcatcgtc acgttacctt
    69301 ttttctcata cgtactgttg tacgtctgat tatatattct ctccaacttt tgcctggctt
    69361 catcctgaat acattgatac tcgcttttct gcccattttc tgacacatca tttttagaag
    69421 ctacaaacgt cgctgtcaat tcttgcgagg aaaaatgata agtatcagaa ccctccgttc
    69481 taatggttct atctgatgaa tcccaaaact tatactgaca cacagtcttg ttttcatcgg
    69541 tgatgaccca cgacatggaa acatcagacc tttgaaaaaa cgcaactttg tcatatgtct
    69601 cccatggtgc gtttgaatca ccataataag taagtttcgt gtaattccgc ctgatataaa
    69661 atttatccgc attctcttta aaagacttgc cgttcgttcc gtcataaaac ggcgatatgt
    69721 cgacaatatc tccactggtg agaacgaaaa aatcatacgg atatctagac cttgccatcg
    69781 taatagtcac aacacagttt aaactacacg tttccttata catccaagca gacccatacg
    69841 tcgtccagac ctctttcacc gtcacatatc ttcgattatg cgaattcgag taatcatctt
    69901 ctactaacca catggtgtcg ttctgatgat tatcttgatg atataaaaca taggtattac
    69961 cattcataac gcgtgtataa gaagtgtaac accgactcgc acggtctaca taatggacct
    70021 cccacatggg tacagcaaca cgttctacag tgtttcctaa cagatatgta ctatacacat
    70081 atctgtaact tctctggaaa gtcataactt tctgatacaa aattacttta aaagtatgag
    70141 tgacaatatt cctcttatac acaaccataa taccctcctc gaaatcagta tttggattaa
    70201 acggcgtaca cttaatattc ttagcaaatc ttacaatatc agttccctgt gccatagaac
    70261 agatacgata cggatacttg ctagtattaa cagataacac ctcattttct cttaaggtcg
    70321 tgttaaaaat ggttttggga attggcgtcg aagtcacgtt cgctgctaca ctggatgacg
    70381 acgccgaaac ggaaccggac gatctgctaa ctcgactagt tccactagtc ataacagaac
    70441 tggtggaacg atttgatgat tctgaaaccg gcgccgaggt cgtgttagac gacactccat
    70501 atctaaagtt aataaagaca cttaggtaca aaaacacctt ccacatcttc acgaactaaa
    70561 tcgagtaaaa aggaaccatc acgatgtctt ttcctcaaac gtcgtctttc acttgaagaa
    70621 tactcgatcg acgatatagg tctttcgggc tctcgaaaaa tcgtgggcgt ttcaccaggc
    70681 tgtacgagat gtcgatacag caacaagtaa agatctttag atttgtacag ccgttcttca
    70741 gattttaaga ttagtggcca atcacggtta tatgtcagga taatcccatc ggtctccaat
    70801 gtacactcgc gaacctgaag aatagacaaa tcttttccaa aggcttcatt atatagtgcg
    70861 acagacaaca ccagctccct tacgtgcgcc cacatctctt tttgaagcgc gttaagatca
    70921 tcgcacttag taaaattaaa aaagcacaaa tatttcacca ccatccactc gtgaggatga
    70981 acggtccctt cggcatactt gaccagatca tccttcacgt gcggaagaac acccgcatta
    71041 tcacaagcat aagccatgtc cacattatga gacatcggat atctatcttg acagtgagta
    71101 aacaagggtc cgttacacaa gcgataaatc tgctgaccca gcgtaggtaa agactccaca
    71161 ggcaactttt tgtgaatcaa attattgacc acatacagat gctcatcgta agatagatct
    71221 tcacagacgt caatgacagt ggcatcgtcc ttaaacttgt tacgatcaat aaatccattc
    71281 atcattttgg aaataagatc aagacaggta gtcccgacca aattcacatc tatcagttta
    71341 ttagttagct tctcctgatt ttttatacac ctcatgactt tattatatcc tacctcagac
    71401 accttctgca gataagcgcg tttccgaaga ttcacttccc tggtgatatt gtgcatgttg
    71461 accctaggat ctccacactc caacgcttgg ttgcacgcag cctccgccgc gcccgtggcg
    71521 ccgaccgttt ccacctctga ccccgaacga accggccttt cgaccgcctc gtcctctgaa
    71581 gggcgtctga tttcctcgag tagcgacttg atcttgctgt acatctcgtt gttctcgtgg
    71641 agtctgttga aagccggatt ctcctcgaaa gcctgaatac tcatcgaagt gatgagatcg
    71701 atgattctgt tcggggccgc gaacacggat cccacaaaca gacgctcctc tcccgacaga
    71761 attttttctc cgagcacgaa aatgtcctcc acctcctccc cgtacatata ccgactgatc
    71821 tcgttcatga gtagacgaca cagactgtga tacacgttca actggtttat ggtcgtatcc
    71881 acccgtttga ccaggatttc cgaagtacgg gaccagtaag taaagtccga caaagaatag
    71941 attcgttccg gaatatccgt aaacaggttg tattccttca aagtttcctc cgcctcgtgt
    72001 atgtaactgt gggacaccga agaagacgaa aagagggctt tgatggtgct gacgagacca
    72061 cccaacttgg ggattcggtg cacatactcc gacagatcct gctccaccgt ttgcatattg
    72121 gtacccgact gagtgcacgg gcggtgcacc gcaatatggt tgcacagcaa gccctgcaga
    72181 cgcttgttca acgatcggcc ctggttgggg accaccgtca gctcctcgta gcactgcgca
    72241 cacgttattc cgtccgcgta cacctctgga cacgccaccg gagagatacc gcatagggac
    72301 cggaggagac gcagcagttg gcaacagatc tccagaccat gatccggaga catcacggcg
    72361 tagacacaat tcattttgca cagaaacctt tccacctcgt ttaaagttcc gagaggaacg
    72421 ctgaacttga cgtcgtccgt gaacttgagc tccaccacgt ggtgccgctc gcaccgatcc
    72481 agacggagaa tggttctgta gtactccatt cggtcgggct tctgcgagta cttcattaaa
    72541 gcctgatcca gcatttccgt atcctcgtac aaagctttca gactcacttc catatacaga
    72601 gtcagtagcg acgtctgcac atgattctgt ttcaccaact ccggatagat ccgacgatac
    72661 agtcgcgtga tagccaacgc attcctcttg aacggactcg actccgccag caaaatgctt
    72721 ggatcgcaat attttagaca ctccagttcc atggcgtatt cgttgcattt cgaacacacc
    72781 acgcacagtt tctgcaacaa attcattccc cgtcgaatcg taaccagcgt cagaagactc
    72841 agcgttcccc gcaccgtaca ttggaatgac tcgcaaatac ctcactaaca gaccacacgc
    72901 agacccttgt tcttaaaaaa agctttactg atgacgaacg ttaatacaga gcacgtcaca
    72961 aaacacatca ttacaatcta ctcctcttag ccggaaccaa gccgtcgtcc aacaaaggtc
    73021 ccgcagccac ctgttcgctc gatgacccac gcgcagcgtc acgaacatta ttaacgaaca
    73081 cactcgagag atcatggacc ccctcctcgg acacagattc cacaccagtc gagaaaactt
    73141 tctccagact ttccagagaa aaatcaacca caccccggtc tgaaaccacc gtaaatttcg
    73201 acatcatcga gtcagccaca gcttccacac cgtcaacaaa aaacaggacg tcatcacgtt
    73261 ccggaagatc ctcccgcgaa ctcataatct cagccatcgc caccagctcc ggatcatgtt
    73321 ccagattatc cgaatccaga gccgtcatca cacgattctt aatcaagtcc gcatcgaaca
    73381 gcacgttgtc tctccggggt ttccgaatca acacatcgac taacttggta gctaacacgc
    73441 accgctgtct cataaattta taatctccac ttcccatagc actagtgttg agactccgct
    73501 cgactccgct gccgacaaaa tagccgatct gaccaaattg aaaaatatct ttgctgctat
    73561 tgctaccagt gtatttctcg atagaaaacg ctaccgtgac cagtgacctc tgttcaaaaa
    73621 tagttcgcat tagagactct cgagccaccg tagcggctcg gggagccggc acaccattct
    73681 cacacttcaa atccttgatt cgagccatat actgtaccac cgactcgaaa tctggagtag
    73741 cacccaacag ataaggaaac tgagcatgat tctgacaggt aagtctcgtg gtaaggccgt
    73801 gcaaagtagt tatgtaatct ttaaaaccat aataaaataa aaacttgttg tgaaaccgat
    73861 tctctacata actcagaaag ctatccggtt gcacatcagt gaggtcgtgc tcactgtaat
    73921 ccgaagtcac tcccaataaa aacttaataa aattattaaa ctcccccata tctccgatcg
    73981 aaatattttt cggcactgcg ttagcacaga ctcgctgcca aaattgtaaa cacgataaag
    74041 ggcattcagg gaaaagtctc tcatgatact tatacaacag aaaaccgaga catcctttag
    74101 ctggatttct cttcactgtt ccatctcgtc gaaaaaaaac gtgaccgggc attcctttac
    74161 tcgcccgaca gatcggacga ttcttcactc gaaacatgtt taaagcatac accgataaac
    74221 ggcagagttt aacctccgta ggaatcacgg tgtaacgacc gtgtcgataa ctgtcaaaat
    74281 ccatcaagcg atcgtgatct accgtcttcg aggatttgat atctctcaca aaaagaaaac
    74341 ccttcctagc ggaagctgtg gaaaaagcac cataaatcga ctggaaatgt tgattcaccc
    74401 accgagacac cgagctgacg gtcagaggat tatcaacaat atacgacgtc gccgtgatca
    74461 gagcgacgtt ctgaataata gctagaacag ctcgatagta ctcgtacacg aaaataggat
    74521 taaaagacaa agcgtacgga ttcaagtcta aattaaaagc ttgcgtcgaa cccatgactt
    74581 catcgcgact gctcttcatt ctaacttcag agacgaaact catagcttga tcatcaataa
    74641 acgtgttcaa agccgatact accgacacaa aatcagattt cgtttgaatg ttaaaaacat
    74701 cttccccagt cacgggatcc actaacctgg ccttcttgca atactctaaa atcttagtca
    74761 ggtaatagat tcgatccaca ctagtactac ggtttgacac cgtcatagca tcatcagact
    74821 taccctcccc cgccgattcc ttagcatccg aaggataacg acgaccgaaa gtccccaaga
    74881 tatcgacatc attcataaac ctagaaaaca tggtgaccac atatggctcc ttcttcggtt
    74941 gcttaggtat ggtagggaga cgtgactgga cacgaataaa agcagtgccg taacatgtgt
    75001 gacaacagcg ccctccacag gcggagcaca ttttcgacga gcaagccaca atatgattat
    75061 acagagcatc agcgccattc gtacccgtgt tatacatcga catgcgattc aagtaccaca
    75121 ccacagctga gaacaactgt ggacacgtac cgcagaccag agccaagtgt ttgggagtgt
    75181 accggtcctc tttactgatt agaccttgac acttcactat ccgtctcgag tcattataag
    75241 aatcttcaca tagcccaacc agaccgttag agaactgaat cgccctcaac agagcgtctt
    75301 ggctcgatcc actagcacca cctacagacc ctttgctggg agcgaagaat actaaccggt
    75361 tttggtacaa aatcgagttg ccactaaaga tcaaagcacc cacgtgcgtc gaaaaatgca
    75421 gctttagatc gataagagat tgcatcagct cctgatgatt tttggcattc atgaccaaag
    75481 gccaatcgga atagatcatt gaaggtgata aactataagc cgaatcgaaa aacaccgagg
    75541 aaaaactgaa ccccaactcg ctgatgacag catcactgag catcagatga tccttttcca
    75601 gattgcttaa cttctgactc atgtatccaa aatatttttt atgcggagtt aacttcacgg
    75661 actgttgact gtcgtgaaca aactgcttca aagctgattc gatcagaatc gtcgtttctg
    75721 aaaaacgcag cgcttgcccc caggatgtgt acaagtaata gaacaagact tcgctgaccg
    75781 aagggacata caatccacga tctaacacga aggcgtttgt agaaatcaga gacacatcgt
    75841 tgacatcttt atccgtctcc gaagccgtaa acaaggtcga tggatacagt ggaacacgaa
    75901 caccttcaca atcaccaata cgtaccgtaa cacactcctc aggacatgga attaattgtc
    75961 cagcgtacag gaattccttc aggccatgtc cgacaactac atggactgtc acttcgttgg
    76021 cgtccagacc catcaaagaa cataaagcgt taatatctgt tgaagtccgt tcagcatccg
    76081 actggaaaga ttctactccg taccgttggc gtgtctcatg acacaattct tcgacgttcc
    76141 catgatcttc acagaaactc ctgatacctt cggtattgtg gaaatagatc gcaaaaggac
    76201 agaaggaagt cactttcgtc aaaacaccac cgtcgtaccg aatcaccgga gtacgtaccg
    76261 aagcggaaaa atcatggtcg accgtaagat cgaccagtag aggcgcaata accactgaag
    76321 acgacttgtt acacagagac aacactgaca gaatctcatt caccctttcg tcgatcttca
    76381 taaagtatag atacgcagca gctccgaccg gactaatagc actcagctcg ctgtccccca
    76441 tgttgcagac ttcgctaaac acggtccata cttaagtctc cacactcaat gcgctttact
    76501 tatactataa aaaccacgtc ataattgacg tgagcaagat cgaaagcgaa caagaaaacg
    76561 aagacagcaa caatctgtgt tgctgacgca taacaaaaaa tatcaaccaa acctgacagc
    76621 agcttagcaa aaaaacagaa gtagttaacg cgagtgaaga taaaccttta tgtgccccct
    76681 cacaaatccc cccagtacca aaaaccagac ccccaaagcc ggtagttcaa gtcaacgcag
    76741 gctacatgtg ttgaaaaacc cagataaacg gtaaacaaaa cgacgctttg tagcgccggt
    76801 gaacggtgat attaatgccg tttcacgtgt cggggtttgc atacaagaat tacggaatgc
    76861 tcgatatctg tcaccattcc gcagttctta tatacgttcc ccgtaacgct atcatcaacg
    76921 tcgtaacgtc gtttttcagg gcgaagctgt ccgtgtgagc cgcggctcgc gcgcatgcgc
    76981 tcgcgcgcgc gcccgcgcgc gatatgaaga tagcgttatc aataaagccc aatcaacaat
    77041 cgaatgtata gaatcggcat tatcaatacc gcttaatcta tatttcaatg tatagaatct
    77101 atatgttgac gtacgtcatc gattgccaac tgaataaaaa gcccaacttt acattgaaac
    77161 acgatctagc taggtcgaaa gacgagaatc ataacatgac gtatctattg tcgttgcttt
    77221 cgtaacaaat acgtaacaca acatatacat tagtctcttc tgattggtca gatgtagatc
    77281 tatacattaa ggaacaagtt tcattcatac aatgtataga ttctataagt actgacacaa
    77341 cagttctctt ctactgtatg ttcctacgta atctgtcggg gaggggttac tcgtatctaa
    77401 ctggattggc acatgagtga cgcaaacaga ccacgcctct acggtgttaa tgtatagaat
    77461 ctatacatta agcccccata tacatactct ttatattgca ttctattcta gtatatatat
    77521 atttattact gataatgatt atatgtctaa ccccaccccc ccaacccccc ctcccctaaa
    77581 cgccaaaatt ggcaccgttt ttggcacgga cgcgcgcatg cgcactcgtg atctgcccgt
    77641 ttccaaggat ctggccggtg tttcggtgac actttccgtt ttgttgaccg gaatgatcac
    77701 gcgatccgtt tcgtcattgt gggcggggtt tatgtgctta aaaggaggcg ctctgcctcg
    77761 ctcggatcac accgctcggc ggtgtcctcc cggtcaattc ccagtgggaa gccgggcttg
    77821 cacggcgccc tcgccgcagc ttcgatccga ggctgcgcga ggggccctgg ttcaaaggta
    77881 gacctcgtta cccggagggc tcggggctcg gggctccagg cctgcccggg gaagctcttc
    77941 tgggcttcgg ttagcggcca tcttggtgcc cagcagcggc tccaggagcg gacgcaacgt
    78001 tgcttcagga ggtttcttcc gggtaggcat gccctggttc ccggggtacc gtgggttccc
    78061 tgcgctttgg gcacccgggg tactgcgggt tccgggcctg aatctcgggc acaaccacgt
    78121 gcccgcgtgg ttgtgggctc gattcgggtt tcggacctga gtcgcgggca caaccacgtg
    78181 ctcgcgtggt tgtgggctcg attcaggttc caggacagca acctggaacc tgaatcgaag
    78241 cctcggcatg tgtctaagca taaacacgtt agtggggtag atctgtcctg gagccgcgta
    78301 tcaggttcca gggttggatg ttccccacaa cgcagaaatt ggggtgtcac cccatttttt
    78361 gacacacaat atcggggcag tactccattc tcttgacaca caaacatcag gatcagttaa
    78421 caataaaaat gatgtcagtt ttgtgcctcg ttctttccga tgaaaccggt ctaatcaagc
    78481 cagacatttc atcggatcgg acgtgtgctc aagtcgatgt gtaaagatga tgcgtcttgt
    78541 gcgcacgtcc gcgcggcacg aatacctgga gaaccgacgg tgcgcagcag cgtttagctt
    78601 catgcaaata cttctctgaa gctactgcga atgaactttc gggtttttcc cctccgtcgc
    78661 ggtttcacgg aaataaagac aggaacgttt tacgactgct ttttcgactc tttatttaat
    78721 aagcaggtta ataatcatct tccatgtcac tatagcatag catattatca taatcgggtg
    78781 tgagggattg catggtcata gggtcagtgg tactcaggtc gggaaccgtc gtctcggagg
    78841 tggtggtttg catcggaatt tctgtactgg acacgttcca cgttcgttca ggagcagcct
    78901 catgtacggg ttctggggac gggttccaag tattagctgt ggtgttggcg ggagcctcgg
    78961 tatcggaaaa ggtggctggg gcatctggag ctgtcggggt gtcgttgcat ccttcttctc
    79021 catgttccgg gatcaagggg ctcaagtcca gaacgcaatg ttcgtcgaaa gggcagaaag
    79081 aaagcatgac gcggtaggat tgcaaagcga tgtgcagttt ggtggcgcac aattcgttgt
    79141 cacactcgtg tcttctgaaa gcgccgatgg tcaggtcggc gatcatgccg catcgatacg
    79201 cttcgatagc gtggttgtca tcgaatctgg acaaaaacat cggggtgttc gaatgttctg
    79261 ctcttctttt cagtagggcc acggatctgg cgaaggaggt cacgaaggac atagcctggt
    79321 gaagaggatg ggtgaagtca gtgacagggc gtctctggac atcataggtg ttgtctacgc
    79381 tgtggttggc tcgaaccggt ttccgagcga gctgtttcag gaggctgcaa ttgggacccc
    79441 attctttctc tttcatgatg caggcgaggt cgacgttgtt caatttgttg aaaagcagct
    79501 gcctcatgct gtggacggtg gacacgtatg gatcgtaggg gttcacgggg atctcgtgaa
    79561 cgtagtgaaa tttcagatag gacagagtct catcaatcat ggccactagc gtgtgcaggc
    79621 tagaggcatt attcacggag aactttctct cgatgaccag cttttgcaga gtggtgggct
    79681 tcaaccagtc gaattgtctt cgaatatcga agatgtagtc ggtctgcatg agctcgtcgt
    79741 gagacagcag aattcggcca ctgtcattgt agtctggaaa ggccacgggc tttctgacat
    79801 cgtcccggta cggaatcaga ccgagtgact ctgcggtgta tctctggagg tcgtacgggg
    79861 gcgatgttga gctaggtgcg gtgagctctt cggcgtcttt tttctgacgc tgaatacgtt
    79921 tctgttgaat cagttcgctc aagtggtcta gctcttgttc gctcatggcg ctgagttcgg
    79981 cgtccagcac ttgagaaaac gggttttctc tcgtcgtggc cggagtaccg gacgcgtgag
    80041 gtgttgtagc cgaggtatag gttcgccgtc gccggtgata gtaggtgtcg acggcgggtc
    80101 ggctgtgaca ggggcttcga cgggaccggg gtcgacagcg gttgtagatg acatcgggat
    80161 ccacgtcgta tcgccggggt gccggctctc gtctcggacg cttgttgtcg agttcgtagt
    80221 ccaaggcaaa ccgtcgggct cggcgcgctt tgcgctcata ttcgtcgagg gtggacaggg
    80281 atgtggcgta gcgagaccgt ggatagtcca tgtcggttct gcacttcgat ggagtttgag
    80341 ataccgagct gcgtgagcgt cgcgaagctt ggtctgtctc gtatatacag agaacggacg
    80401 ctgaatttat acttctctaa ggtcacatga acttccttct cactgctcgg tgtccgtggg
    80461 aggcttcagc ttaacggaaa tgtggacgtt cttcgcgttc gagtgacatt tgttagtaaa
    80521 acacctgctc cataaggtgg tccacaggct gtagcagcgg tcaggtttca gatcgatgaa
    80581 gacctggaca gtttcctgag ggtttctgtg gacgcggtta aggcaacgga aatctttgag
    80641 gcgatgtcct tgctgtttct tgacgctgat gcattgaaga ttgctcaggt caaagacgat
    80701 ttcatcttgc aagaattgcg cactgatatc cggaggataa tgctgagtca agtgatgaag
    80761 tatgggtggc cagactcgtc gggagatcag gttttgaagc aggtctggtg tggtttcgtc
    80821 cgttccgatg tggtgggcga tgacttcgga aagggctcgg cggcggtatc gagtcacgtc
    80881 tagcgatcga gtgtcgatga aattgctgcc cggtttggga cagagtttgt cacggacgtc
    80941 catcagaatt cgtgtacccg tgtttcgttg gggagactct gtggagacct cttgtcctgg
    81001 aaaacgagga gggcaatggt gcagcagatt atgcagatcg agttgtgcgc ggataaaaat
    81061 cagggggtcg tagcgaaatg cttcaggtac gatgaagagc ggcaagagcc ggcattgcat
    81121 cagatacccc tgatcatcca tcatcttata catgtacggt agccggatcg aacgtccgtg
    81181 gtgatagatc ccagcgtcta ggctgttttc tggatgggaa atggtatcta ggtgttgatg
    81241 aagcgatggg tctaaacaga tagcgtgatt taaaatttga cagatggcgt gtaagacaga
    81301 agtttgagtg accacggtat tctgggggaa aggagcgatg atcctcatgc ctagcttttc
    81361 tgtacaatga caataaacct gcgagttggg atgcagattg tgttcgtcat ggttgtctcg
    81421 tccttccgaa aacgcgaggt ggcggcatgc gctcttgaaa aagtagatcg ggtagttcgc
    81481 ttcattggtt tctggaaaca gggttttcca aaccgtgacg aatacgcgtc gaagtcctcg
    81541 acagaggtca aagacttctg tcttcgatag gttggtcacg gtttcccgta gacgaaggtc
    81601 gaaatctcct atgaagttga ataccgggag tcgttcgttg aaaatctcgt gtctcgtgtg
    81661 gtagaattgg acttctggtc gcatatcggc gataccatca tcgtgtagcc agagggcgtc
    81721 ggttagcgcc tcgtctgaaa gttggcagtt tttcggtagg tggcgcagga agtctggtgg
    81781 aaacaaggtt tgggaccaag attcttgcct gaccgcgcaa aaaagatgtt tattacccgg
    81841 aagttggatc cggtagacag gtatgggatc gtggcagggt agagttgatg aaaagagata
    81901 ttgtttctga aaggtgtttt cggtttcatt ctgagtcaag tagcggcatg ctgaccgagt
    81961 ggaagcgcag attcttaaga gtcctcctag agatcgctcg attggagaaa agactgattc
    82021 ggtcaaggtg ttgattttat cgatcgttct ggttacggtg gtaatattcc cgcagaaacg
    82081 aacgaaattc tcacaatcgt tgatctgata ccccatgaga ttgagttgat gcttggtatc
    82141 taacgtgtga acttcgacgt attcgtttaa gaaattgtct agagaaaagt atttattcat
    82201 aacgtgtagg agatcgtcta ctaggtgttg tcctaaaaag agaggttggg aagtacattg
    82261 tgtgctagct tcggggtcgt aggcgacgac ttgccgatat ttgagcagcc ggtttttaca
    82321 gagggcagtg cggtaagcta ggtaaatgta gtgaacacag atggtgtcag gtaaacgtgc
    82381 tctgtctcga aaactgttga tctgagtgtc aacgtttgtg agttcgatat agtcgcgctg
    82441 gttgcgtttg atggcatagt ccacaaattg aggaatgcga gttttaaaat tagaacttaa
    82501 gagcagggtc atgaagtcat tcatactcgt gtgggtcgga atgatttgac cggtgttggt
    82561 agtaaagctc cgaacatatt cttcgacggt gggtatggtg ctgtactgtt gctcaaaaag
    82621 ataataatac atcgtgagca gtaacagacc ttcggtgtgc ccgaagatac tgagaaacca
    82681 tgacggggag gtgggggtca ggaaggtttc gttcaagtat cgaaggatag cttgatggtg
    82741 aaaatacact agatgcttaa attctcgaac ttctcctcca aggaccgggg tagtgatagt
    82801 gcggaacaga tgttgataga tcagcttcgt ctcttcttcg ttcagattct caatgagggt
    82861 tgacgtggag atgggtgttc gcgacgtgag atacgacatg agatttaatc tctcagcgtt
    82921 acagataaag acggtggcga ttctttggga gttgtggcat ttttgggtct ggaggcagaa
    82981 atggaccagc tgagatgctt tatgtttcac tagtagtgga tagacgtagt ggttggaaga
    83041 agctttcagt aggatgttgg cgactatatt agcggagtcg tactccgtgg cgaacagtac
    83101 taaggtcatt ctaggggcta gaacctcgcg tcgttttgta atcggcgatc tctggaggtc
    83161 tatggagtgt tttcgtcgat tctgtcagat cttgtggtgt gctcgcaaag tcgacccgag
    83221 ggctgattat gttctgttga agccgtctga agatgtagaa ttgcaggagc tgcaagagtt
    83281 cttgcagcaa cattttgatc agttaggagt gacgaatggt gacatgtcga attacgctag
    83341 agataagagt gtggtggagc atcttttaaa attaatgccg atttacaaac agtgtcaaac
    83401 aaagtgtact tttttaaaga gttacctttc ggagcattgt cgtccacata tgcgaccttc
    83461 tgccgaggtg gaatgtcgaa agtcacaacg aattatggag gctctagatg tggtcatttt
    83521 aaagttgatt atcggcgagt ttaccatgtc ggaagatgaa agtttggaga tgttgttaga
    83581 caagttctcg gctgatcaag cgacgctgtg tgaggttcag aaagtgatgg gtttagttga
    83641 tatggatcgg gaaaaaagta gttctatgtt gaccacatct agtgaagtgg ctgagatcga
    83701 tctgggtact gtcgatgacg ctgtagtgag tatgatcaaa aacagtccgg aggttccgct
    83761 gcagccgttg atggaggtga aggtcaagaa gaaggagaaa acactgctgg cagtgcctgg
    83821 atcctgatat ttcaggcgtg agttacaaaa aagtctctgg ctcaatcatt tcggagatga
    83881 gagttgcttt aggaagacgg agtctggggt atgtgtaaag ccggtgtctg agataggtgg
    83941 cacgattaac tgcttgatcg ggtgggtgtt gacgattaag taagcgaagt ggtaggtggt
    84001 gaagataatc ttaaaaatag gagcatgtac cgttagtcgg accggttgat ccgaaatatt
    84061 cacaatagaa acagaagcta cggttccagg caaccagatc gtaggtctga ttagcacacc
    84121 ggaacgattg aaatgacgcg taccgaagat caaagcgcaa gcgccgaaag agtagaggta
    84181 ggctatgtct aagagaattg ttcgtacctg tcctgggctc agaatcagtg gagcatgtag
    84241 cttgatcagg taaaattttt tatcgttggg ttgtggcaga ttcatgactt gccatggctc
    84301 tggtagaaag taaggaaata cgcagatgtc accttcgatg gctccaggac ttatagcttg
    84361 aaagttttca gtcaggttga cgatctggac tctaggtgtt tgaaggccag gttctacgag
    84421 gtcagccatg cagataaagt taagatccaa acatttgtaa aacgtgattc cgaaatatcc
    84481 tgcggggata taaacgtcga tccccaatgg tagagtggtg cttcgttctt cagcaagcca
    84541 gacgatgtgt ttgttgaaga aagttagtct gttctggcat tgtttcacga aaaagctgga
    84601 aggtgtccat ttatatggga ttttcctttg gtgctcgtac agcatgttga tcggagaata
    84661 gtatatcaag atgtgttctt gagtagaacg aaggcaaaag ttcagattga aatacttttc
    84721 ttcttcggtt ttcgtctcgg cttcgtcctt tattaaagga ctatcgaaga atgattggaa
    84781 gcgtgattcg cgaggtgggg ataataccag gtgttgaccg attcgatctg ttagaatcgg
    84841 agccattggt gaagaagtga agtgaagacg gatattacga tgtggacgaa aacagttctt
    84901 tttcttgtgt ttttgtggac cgtggcgctg gctctgggaa gtaccccgac tgctgatacg
    84961 aatcataaat ccacatttta tgacgtcggg tgcacgtcac atacttatga actctcaatg
    85021 caatcttttg ctgcgatttg gttgtgttgt aatatagtcg ttctgctgtg ttcttttgga
    85081 gtcgtcttga aacatttttg tttccaaacg tttacggtgt ccaccacgaa aggttactga
    85141 aaaacatgga gttctcaaat cttgagtgaa cggtaatatt gtggtctatc tgtttgatga
    85201 aaaatagtgc gtctagatat tcttgtataa gttccgatga atactgtttt ttaaatgtag
    85261 tgatattagt agtattgtaa ctgggtgtat ataattctga aaggtctagg tttccatatg
    85321 gtgtgtaaac ggttgagtta gtcacgattt gtgcactgta gttcctttta gagttgcacc
    85381 acattggaag tctgcggttt aggtctagat acatccatgt ggcatatttt ttaagattat
    85441 tactggaaac aggattggta aacgtgtcgt tgtagttgga gctgttgtgt atattggtgg
    85501 atccagaggt ttgttttctt ttgagtcgac ggaacaacga ccttgttcta ttaaaatcat
    85561 tcgtccggag tctgaaaaac gtggtgctca tagcgtttag gagattgaaa ctgtttgaac
    85621 agttagtctt aagggtgact ttagtaatta gagttgttag tccaaagaag tataaagact
    85681 ggctgtcggt atgatatgtt atgttaccgg gtagacgtat tttcgaattc catcggggta
    85741 tgttgtatag cattgggtta taagtagtta agttgcaata tttttccccg gtgtaattct
    85801 ttacagatac attgagtatc tcgtgaaaac atccactgga tggtatgtat ccgcaaggtt
    85861 cagtagtaag aggttctagc atagttttgt tggacggttg tgggttgtat tttatgaaga
    85921 gatatttatt tttgtatatg gagaagtttt taggcaggtt tttacggttt tgttgtatca
    85981 acttcatcca aaagtatgat gtgttgttca gatgaaacgg gcctgcttgt atcgattcgg
    86041 gtggtagttt cagcggagga gtttggatat aaatctggct agctaacgtc gcagatacta
    86101 taataattac agtaattatg atttgttttt ccatttctgt aggaagaccg atacggcgtt
    86161 tttggaagta tgctgggtct ccttcgtgaa tgtcttggtc ttaatggcga tatgtctgct
    86221 gatttatcgt tgcatcgttg gatttcaaga tgatatcgtg attcgtacgt tggacgtgct
    86281 gattcaatgt cggaatattt cggattgtag atcggtgtaa ttctaatgaa taaaagactt
    86341 cattgatgtg gttattgtgt ctttttattc agcagagacg aaatattctg tacagtaaaa
    86401 atagtccaaa cagagcggcg gtagtataca gtgtaagaac taatagactg gtgtctttga
    86461 tatctaaaac tacgtctgtc acttcaataa ctgtgccgtt tcgtagagcc attatatagt
    86521 gggttcgggg ataattaacg aagattttgt tcttgtcatc gagagtgaat ttcagatcct
    86581 cggtatcgtg tagatacatc aggttaacaa gacctgcttc atcgtgatat tcgatcagag
    86641 cgctttcaca aaagttgcat tctgaggtta gagtgatgtt ttttgccatt acaatcggta
    86701 gagtggtgtg catctggtta cttctttgac acgttgcatt actagggatg actgtgatga
    86761 tgatgttaac accaacgata gtactcgtga cgggaaaaga tgtgcctgca atggtgtgtt
    86821 cgttggtaaa taagaacgta tgtctaggta gagtaacagt cgtgaaagtg tcttctgtat
    86881 tgaggcatga gatttctgga aatctattaa tagaaggtct gaaaaatgtt agtacacgga
    86941 acaaggtttg tgtcgatgtg gatttagggg tcattgctgg gaatagtttt gctatgcgtt
    87001 ctagtgtgtg atctcggcgt ccgccacccg aacagggagt gtagagatcg gcgagtccca
    87061 aatcggcacc ttttgtaaca atgttagacc aatggttggc ttctggcata gaacagagtc
    87121 ctgtcaatgt agcaaaaatc tgccttcgtt gtttgttata agatgacgtt gagtgaataa
    87181 tgaaagccat tagaccgagc tctcttctat cgtgtcggga aataaaagat gctatattct
    87241 ttttgtggat ttttaggctg ctttcagtaa gggtgttcat agctttttct gtgattgaag
    87301 aggttgcgtc ttgtttgata gccacataga tcaaatgagt gtttacatct acgttcgatc
    87361 gcaaccaatg gtcgttgttt aggagtgtgt ggtatgtaga tgatgcgttg tacatcaggt
    87421 gttgagatga cttctgatga ggtatgcaag tgaatatgta atttgtagct tccattatgc
    87481 ctgttagttc ttcgatggtt gtacgtaaat ctcgatgcgt gttcctgatg gtagaaaaaa
    87541 ctagagtggt gtaggtgaac agtagatcga ttgttttttc gtgaattccg gtacatgtat
    87601 tttccatcaa attgttcact gcttgttggt tgaagacttt gaagatctca ctgacgtttt
    87661 cgtaattcgt tttcaagact gaaggaaaat ctgttttttt taaaaatgga tacgttgcca
    87721 tggcatcctt tctgattaga attatgacat catgttgttg tgtttgtcgg aagataaagt
    87781 tgtctttttc gaatggtgct ttaaaagtaa tgttgtttaa gtctccaaat aagagtatta
    87841 atgaatggtt gtgtaatttc atttttgtta agatgaagct tgatgtaaac gtaatgttta
    87901 tttcactatg ttggtcgctt agagtttgtt cggcacatga tgtgtgaatt gtgaatatga
    87961 catcgtgttt ctcgaataaa gtgcaagaag aggtgtcaag gctgcgaaag tctgatatgt
    88021 taacattata ggaagagtct gatgttgtgg ttggagcttc tttgactagg atgtgattgt
    88081 aatgcagata agggatgtca gtgggaacgg tggcataaac gtcgagtttt cttttgtaag
    88141 attcaaatga ctcgaagaga tcgactttgt ccatcagctc ttcagcaagt ttactggtga
    88201 acaagcatcg cggaacttga aatacttgca ttttattgtt ttctttagcg ttgtaaaagt
    88261 taaacgtaat cgcgtcgtct ctgatggtgc tggtgtttcg aaatgttcca ttagcacatt
    88321 gtgtgatgtt agtttctctc aggtatcgga tgaccggata tggtacgttg actatgtaat
    88381 gggtggatga acccaattga aataagatca tcattttgat tgtgaggttg atccattttc
    88441 ttgtttttaa tttggtgacc atgacgttaa accggtttcg aatgttcgat gcgagtcacg
    88501 ttcaaaattg aattctgatg tctatttaat atgatgtctt tcgtagagat gatagactga
    88561 gctgtgaaag aagatgggag agcgttattc gtcatgtcat catccggtca gaagtgtcgt
    88621 tctctctgtg atttaccgaa gtatcgcgcg gtagtcggaa aaaggaaaca ttttttactc
    88681 tatcgacaga ttgttcgaag tctgaaatca tttcaacgtt ttaattgtac gttaggtggg
    88741 gtattcccac cagaattagc tacgtgtcgg cgcagtgttt tttttgaagt gactttgctt
    88801 cggaggattc cggactgtat tgtattgttt aatatcggca aactcgatcg gaagattgtg
    88861 tgctatgtgt ttgagtttaa gactactcaa tcgagtgccg acgccgtttc agtcagaaag
    88921 cattgcactc attatcttca gtacgtgcaa ggtttacgac agttaaaaga tactgtggag
    88981 gatctcaaag aatttgctat cggaggagtc gagggggaca tttgggaagt catacctgtg
    89041 attgcttttt accagcaaaa tgagatgtca ccttcgttct gccggacgtt tcgcgtcacg
    89101 acattacgat ttcgttcgga gtctgtagtg cgtgctttgt gtcgtgggca agatgaatcg
    89161 cttagaaacg ttttatcact tacccgtgcc gaagatcgcg ctcggtcccg tgccagtagc
    89221 cgtgcccgtg tccgtcgtcg ccgccttcga gccgcacgtg gacaacgtgc tgtgggcacc
    89281 agagcgcgtg ctgcggcgtc tgcgggacgc caccggaatc gagttaagac aaagacggga
    89341 tgaagcggtt atcgatcgaa ttaaaaaacg ttacctgaaa gaggagcttc gacaatttcg
    89401 ggatgcggtg gcgaatcagt gtctcggtct cgagggtcgt ttatcggagg ccgaaatgct
    89461 cttgagacaa caggtgacag atttaccggt gtcgtcttca cctcgttcgt ctccggtcag
    89521 gatcgaaggt gaggctgcgc catctgaagg tgctgtggac ttggggaagg gccaaaaaac
    89581 aggtgctgtg acgtgggcag ctttctgtca tgatgatcgt catgctttgc atgtggggat
    89641 tactcagaac gatccaacga tctgtttcca tcgcgatttc cgaggtgaat tgatcggtac
    89701 gatgtttgag aactcttcga cttggacctt ttcctttggc gtttggtact atcgtcttaa
    89761 acgcagtttg tatacgcaac ctcggtggaa gcgtgttttt cgcttgatgc agatggagag
    89821 tttttcgatt tctcaagagc ttttagttgc gacggtgggg gccctagaga atgtgactgt
    89881 ttatccggct tacgattgtg ccttatctga cctggaagct gctgcctgtt tgttagcggc
    89941 gtatggtcat caggtctggg aaggtcgaga tgctcctgac tcggtcattg gcgtgctaca
    90001 gaatcttccg tatatcctca atcgattatc tgaagagatt catcgtgaga tggcgaattg
    90061 gaaggagtct gtgactacca atttttatag ctatcaagat tctcccgata tgagatacta
    90121 tgtcccgatg agtggggggc gacgttatgc ttccggaact tttggtcgac atattctggt
    90181 gcggattttt actcatcgca atgtgctaca gagattagct ggatcagagg ctcaagtgtc
    90241 ggcggtggtg caggagcgaa tatcgggaca ggcggtggat gaaagtactc tcacgatgtg
    90301 gactcgaaag cttctctctc accgtctggg tagagaggtg cccatttttc ttcacgagca
    90361 gcaatatctt cggtcgggtt taacatgtat cgagacgtta ttgttgttgt ggaagattgt
    90421 caactccgaa agtgttttcg tgtcgagaaa acgtcgtttc tctctgacgg atattatcgg
    90481 tagcgatctg ggggcgccta aggccacggt tgatcccggt tacacgggta gtaacgtgcg
    90541 gaatttcgaa tatctggtgg agcagtatat tattccgtgg tatcagtggg atcctaccgt
    90601 gacggcttcg cagttgtttc ccggtgtcgt tttactggcg attacggaaa gtgttcgaag
    90661 tggctgggat cctttacaac gtgaggatgt gaagacgatg gatggtggtg cgattaccgt
    90721 ccaagctact aagatcaatc cgattgctga ttttatgttc gctcagtctt ctaagcagta
    90781 cagtgctttg aagcgtcttg aactgcacga cactctcttg tttcattacg agaacggtgt
    90841 aggcaaagtt ttgtcagtct ctctgccccg acatcgagtt ttttgtttag gatcctctct
    90901 ctttaatgtg aacgatattt acgaatgtat ttattttttc gttttgggtt ttcttccggc
    90961 cgttgctgtg acttgataag ggtggtatgc tgctgacgtg atcagaaagc ttaaaaggcg
    91021 gtggacagcg agagactggc tcatatcgac gggtcgtttg ctgtctggac gtggactgga
    91081 gtaacgatcg tgagtcaaga tgttcagttt acgcacggag atgttgcttc acggagcgat
    91141 gatggggatg tttgtggcgg cagcgatgct catcttgttg gccgtcgcga tgtgctttgt
    91201 ggcggcgaag cgcagatgtg ttccctacgc ggtgaacatt tttgccggca atctgctggt
    91261 tagtcaactt cttaccattg tggccatgat gttcagccaa ggttttatgt acgatccgcc
    91321 tttcaatcct tcctactgtc gaatcagcat gttctttgaa gatgtcggca cctacgctac
    91381 atcagcgcta tttttgtttt tgatcatgga tcgaatggct gcgttggcga acggacgcgc
    91441 tgagtggaag catcagacac aacagaatgt gtctacggcg atctttgctt cgatctttgc
    91501 ttgggctttg tctgccgtgg tgtccttacc gacgtttgtg acttcagatt ctgctcatcg
    91561 atttccattc tcatgcgaaa cgcctttggg ttacagcgcc atgaccatga gtctacatgt
    91621 gtggtttgcg ttagctgcac cgttgatcgt ggtggtgtcc tacgttctag gggcatgcta
    91681 cgaagaggag cgcgataatc tttggccgta cgtcgctcgg gtgtggacat tttacaccac
    91741 ctgtttgctt ttcttcgtgc cgtattatgg catccgcatc atccgcagtt ttttcggcct
    91801 accgggaatg tttcctgagg tgatggatta tgtggaggtc gtatgtcaca tggtcttttt
    91861 gttcagggtc gtgattcttc ctctgtttgt gttaaatctc agcagtccgg cgcctatggt
    91921 tgaaatggat cacgcatttg aaagtatgat gaaagtgggc ttttgccaag aaacaatgct
    91981 agccgtgtgg aagaagttca gagaagtttg tcgaagaaat ccatctggag ataagctgaa
    92041 attgatggac gatttcgaaa gaggaccagt ttttgtggcc gatctgccgt ccaagtctta
    92101 aaacttggac catgactttt tatgtattct cttgttattc aaactgaatc tcgggtacac
    92161 ttaagtattg gtgggtgtcg gagatgactg acggggatag gggttgctct tggtagagct
    92221 gtgttgtgcc tgtgaaggtt ttgtaatcat caataataaa gttgaatatt ccgtattcgt
    92281 gccgtgttct ttggatttct aaagcattgg gggtaattag catctttccg gtggcgatca
    92341 gatagaaata ccacattttt tgacagatga tgcgaattag tggttcgtga ctgtctgttc
    92401 cccaataacg attgaagaaa gatgcgagac gaaataaacg atgtccgtaa agagttccca
    92461 gtgaaaagag gatattgcca ttcctggcca gatctggggg cagtttcagc aggagctggg
    92521 tgtgtcgctg gatgaatttg gttaacaaga ggtcggcggc cattggctta attgtcaagt
    92581 gccggctgat ttcagcggct tcatgttcgt taaagattcg attgaggtcg agttccggaa
    92641 agatgtgttt gagctcttct gctaggtgaa accagtagtc caaaggtgct tttcgactca
    92701 gaacagtgtt gtctgagatt cctaagttgt tgagtgtttc tcgaagtaaa aggagttcga
    92761 gtccccggtg aaacaacatc agacaggata attttataat ttttaattct tctaactgga
    92821 aagaggtcag aggctgcccg ctagctaact tcgtggtgat ttgaattatt agattgtgtg
    92881 tacaagtaaa ggagaaacgg ccggtgcgga cgtgtgtctc ggtggatggt tccatcgcat
    92941 ggcctgagta aatggctccg gtgtacgttg ggggttttct tgtgcggtat caagaagcgc
    93001 cggaagaaga tgagctggtt ttaccccgtc atgttgttga agagtggatg gagaacgaaa
    93061 aagtggaggg tattcccctc aacgtcaatc acgacgaaaa tgccgtggtt ggaaccgttt
    93121 tgggctttca gaatgttccg gctgggttat tctgtctagc ttgtgtggat tctccacgtt
    93181 ttttggaaat cgtggagaaa actgcagaaa agtctgaggt ggtggcctca gggccccgtg
    93241 gagagctgac acctgatcct gtattagagt ttttgagtgg cagttattct ggcttgtcac
    93301 tctctagtct tcggtgttcg gtcaacgcgg cggagagtgt tggtcctcta tcgtcggatg
    93361 atgggcgtta ttttaaacac gtggctttgt gtagcgtagg tcgtcgtcgt gggacgctag
    93421 cgatatatgg tcgacaagtt aattggattc tgtctcgttt tccggatttg gatgaagaaa
    93481 cttgccaagt gatccgggat tctgtgcgaa cgtcgtcgga gaagcgaagt caagaggtgg
    93541 aggatcgttt ccactcggat tcttatggtc tgctggctaa tagcgtggat gctctttaca
    93601 ttcgtgaacg tctttccaaa ctccgttacg ataagaaact tttgggttta gaggggcaga
    93661 gtacttatat caaagccggt gaaccgacgt cggtgcctgc tgtctgtgat attaaagaac
    93721 aggatgctga ggaggaagcg gagagtgatc atccggcgtc ggtcatggca catgctctgc
    93781 catctgcggg accgggcagt gcagtggccc ctgtcgcttc cgtccctgga gctatgtcct
    93841 tagcaaacga tggggtatat ttaccgaagg acgctttcat ctcgcttctc aatttgaatg
    93901 ccggaacgca tggagtttcg gggggtgcgg cgttagattc ctcgattccg cgtcggttgg
    93961 cgcagtcggt tcccgcgtcg tatcctccat cttttccgta ttcatctccg ttattgccta
    94021 ccgggtacga cgacgttcgg tacggtccgt atcactacgg accgatggtg ggacatcggc
    94081 cttatgatat gcgtcaagat tatcatctgg atcgcgaccg atatggacac atgatggagt
    94141 tgggttatca tccttattat catgccgcac gcggccgctt tcagggtcgt aagcggaaaa
    94201 agggggaagt ctcgtctgat gaggaggatg aaatgagttt tcctggtgat tctgattaca
    94261 gtaagcctag gaagcgcttg agacctgaga aggagcattc gacttgcggt tttgattgtg
    94321 aacaacggca tgggcgctat gaggagatta aagatgcttt aagtgaaatt cggcgcgatt
    94381 tggcagctgc tcgcagtgct atgcagatgt cggcggcacc tatgtcgaca tctttgtcac
    94441 cgacatcgtc ggccacttcc agttgtcaag atcagaattt agtgactgag aagaagagtg
    94501 ccgaaaaggc tccagtggct tcgacgtcgg ctatgccgac ggtgaatgca tcctgtggac
    94561 cattaatccc cccaaaagaa cgaccacaaa acatgttaga tttgaatcgc cgtttatttg
    94621 tcgcggcttt aaacaaaatg gagtaatctc aaggaaacgg gaataaacaa accttggtag
    94681 atttctgaat tgtggtgtga ttgattaaat ccgagccgta ctgcgactag ttggggcggt
    94741 tcgtatgaca ggtggagctt gtggaggttc cgggatggtg tcacaagtac ctcgaatgtc
    94801 agccgccgtt cttacgtcgc tgtagtcgga tttgagatat gaggtggctt ttatacctgg
    94861 ggcagagata ctgcaggtca tgggtgggag attagtgacg gccatgaaca cgttccatga
    94921 aggaattacc acagtgatgg cttcggcgga aggtgtcatg gtagtgcggg ttatggagga
    94981 tggtccttct ccagcgtctt cctcctcttc ttcggactcc gaagctgcaa aatacttagc
    95041 ctctttgagg actgttggag tgggaagcga gtcatctgat tcttcttctt cagagtctga
    95101 ctggggttta aattcgctga ccagtccgct gacgactgtt tggcgaggca ctatgccagc
    95161 acgtaagcgc agatggcaaa ggcgagtttt gtctttacct ggtagaggaa agaaaaagcc
    95221 tctagggaaa aggtgaatcg tcccgaggtc ttgcaggtaa tcgatatgat attctgataa
    95281 agtcaggtta gtgactttga tctggatggc agtgcgatcg ggaaagaatc caccttccat
    95341 cgataggcct gcataatctt tggggaaaaa aaccgcatcg taacggtgat tgctttcaaa
    95401 tgcattgtct atatggaggg tgaccgtttg cgtgtcagcg agggtgacgt tttgtggcga
    95461 acgcacgata aagccgtttt cgggatgtcg actgagaaat ggttctgggt tgtgacgagt
    95521 gacgacttct ccttggtgac tgtaaacaga aatgtgcaag aaaagttcag ttggggggtg
    95581 ggccgaaaag ttttgaagat aaatcttcat taaaggacct cgtcccaccg tttcggtttt
    95641 ttggatgtag gtggagttat ctgaagtggc caagaggtcg acagcgtcga ccagggtcag
    95701 tggtatttgg cctgtgttaa agtaaaagtt ggttaagaac acctggcctc gggggaggcg
    95761 agggctttgt cttcgagtcc atatgatgtc tttaaggttg attttaacgt tccaaaaaaa
    95821 agtggcgcgc ttgatatggg ctctggtctg ggctcgggtg acagcggtgc ttacgttttc
    95881 atcttgtctg gtcttgaaga tgtgaaggcc ggtgatggga actcttgcta acggtatagc
    95941 aaatacgcag acagacaagg gttgacccgg tgaagctttt ttcttcgtga agttatacag
    96001 ttctaaggag atctcgtcag tgctgtcttc tgtggacgga ggttggctga ttgttagtcc
    96061 tttgatattc agatctcgta attggatcgc atcatgtacg gaagagattt cttgagcaca
    96121 acaaagtacg caggctttgg gtacgcggac catgagatgc gtatttactg atttgccttc
    96181 atttgctggc aggtgacagg gattcgtaac gatcagacgt aaagcttggc agctgaaatg
    96241 ttcgagtgtg ttgaagtttc tgggcgtccg cctggcggcg gttgaaacgg tagctgtgct
    96301 catgatggtg gattcgacac gtttgacgat gatggaaggc agatgacaga gaaaaggtcg
    96361 ggggtttttg agagagcggc tgttatgcgc aaatacatca tctgctttgt gggtgctttt
    96421 gtttagaagc ggtgtcgttt tttactggta gagggaacta cggtcagcga gcttgattcc
    96481 gcggtgggtc gacgtcgttt cccggaaatc ggtgggcccc attctccgga aagaccaaaa
    96541 aaaatccgat atgtcggatt ttcactccaa taaaagtcat gtttttttag attaggtccg
    96601 taggctctgg cgattaaggg tggaaggtgg caagtgtagg ttccggcttt ccagcagggc
    96661 caggtgagta cggcgttttt ggatgctcct gtatcttctt catcggagtt gtcttcatca
    96721 gagtcgtgac gtggcttttc tccggtcgtg gccgacttga agggatcatc ggattcatct
    96781 cctgaatctt ctgggccggt tacggcgctg acggcactag tatggatagc gtcttgaata
    96841 tcgtcccaaa catggtcgta ttctaactta cattcgacat cgtattgacc ggtaaatgta
    96901 tagaattggt catttttgtg gagaaaaata tggctctcaa agaagtggag tgcggcgatg
    96961 tcttcgcctt ttggtatctc gacggcggtc tctccagtcg tttgaatttc tagaaaaaga
    97021 tgctgactac ttcgtaagaa gttgctcgaa atgctgaggt tcggaagcga tttcggtacg
    97081 attaatccga tatagtctat acctaggcat cggaaagtca tgtctagaca tacgtgactg
    97141 gtttttcctg gtttcactat aatgttgcga ggggccatga tcacgaaacc gtttgtgccg
    97201 tagggtcgga gaaagggttt ggggtttcgg ttcatgataa tgtcagggtt tttgttctcg
    97261 agtagcagat ggcagaataa tctggtgggc agttggtctt cttctttggg acattccagg
    97321 tagatgcgaa gtttcttttc agatgtgagg gcttggactt tagtcaagat gaccgcttcg
    97381 tcggaacaga cgagatcggt cacactgtca aagtcttcga aaggaattcc gtgtggatcc
    97441 aaaataaagc atgaactgtg tctttgctct gtgtcgtcat tccggttgct tgtccatatg
    97501 agttgggtga ctgtcattct tacgctccag tgtgaggcga cacgttgaac tatgacatcg
    97561 gcttcgggaa tagaggatcg agtctttttt tcacttgagg gtcgataaac atgtaggccg
    97621 cttatagtga cgaccttgag tgggagagcg tagacgtaaa tggagaaagg gtctgtgttg
    97681 gtggattgga ctcggtcgct ggtattggtg acagctactt ggatattttg tatctctgtg
    97741 ctgtaaaagg ccgtatgttg actcttgagg cctcgccagt cgtgatcacg ttcggaatcg
    97801 gcggtgaagt gggtggcaaa tatgatggcg ggcacgttaa ctctgacgtg tacaccggtg
    97861 cttaacattc tggtttctcg agcttgtaat ttggtgtcgg taccattgaa tatgcatttt
    97921 atcacatgtc cggaaattgg accgatctta ttaactaggt cgccggcttg atgccgtcga
    97981 cgagtgagtc tggtctccat gacgttgaag tggagcggag ccaaaagtgt ctgtggttgt
    98041 attggaaaga aagaggtgtg gttagcggcg ttggttgaaa aacgacccgt agacaagaaa
    98101 gaatggtttt tagtctgttt attaggagta ggaaggtatt agagcgggta ataaataacc
    98161 gaagagagat cgtgctgcga cgttttcttg aagacttcat gtgtttttca atatcatggc
    98221 taaagtggtt ttcgtgtcgg gagattggat ggtttcgcgg ggacgaatgt tgagggaaag
    98281 aagatcttct aaccggatag aggtcccgag gacggagacg cacgagtgtt tgttgtttaa
    98341 gtgcagtgat gattttacct gatgagtgaa agctgacgaa cagccgcggt tagtgatgta
    98401 gtctgatgcg atgaaataca gttctccgat cactagatca cgttggagag agacgtttct
    98461 cccgacgatc gtgatttcca accaggtttt tggcagccag atggtgacgg gcattttcac
    98521 ggggaggttg ggtttgggga cgaaaagtcc caggaatggg ccgtagaagc gacggtacag
    98581 tcttaaggtg taggcttgtt tcacggtgag gtcataaggg agtctgacat cgaggtattc
    98641 ttcgcggttg ggtgtaaagt atggtgacgg agttctggaa aaatatggtt gttggaccgt
    98701 gtcttggaac agttgaagtt cgaagctgat cggagtattc atctctacgc cttgagtggc
    98761 ggtcacgttg aatttcagtg tgttatctgc gctgtgggag aggctagaga gggtgagagg
    98821 gcaggagctg ctcaggaggc ggctgaagac gggttgagga agggtgggga gtttgggaag
    98881 atggagagcg atgcggctgg tgaggcctcg ggggccggag attcctccct cgatcacatg
    98941 ccagcagagg atggtgtcaa caatgccgat ggtgatccga tgacattcgt tctcgacgcg
    99001 gatggtcact tgttcttcct gcaggttaat gcagtcgtga agtgtggttg gattgtagtg
    99061 ttccgagggt cgtttaacgg gaagttgttc catgaggggt cggacgacgc ggagcgcgaa
    99121 gatgttaagt gacagtcgga tgatggctag gcgatcgatg tctctgtcga tgatggaacg
    99181 gataatttta caacctgggt ggcccgggaa gatcgaaaaa gcagctttga ggtctgaatc
    99241 ggcgttggct acagcgcaga tcatggcttc ttgtggttgt tggagaaccg gttcgatgtg
    99301 gatcgcttcg gatagcaaga tgttgaaatc cttatggaga tcatcaggac gcaagtcaag
    99361 attgagctga atgagcttgt aggttccttc tgtcatagtt tgggagaggc tccatttttc
    99421 atttaaagtc aggatattct ctgtggagtg catgatggtg gataatcggg aaagtggcgg
    99481 atccttccca agttgtttct cgggatgcga catgggaatg atctggctga acaactgggg
    99541 cctcagcctt taaatatgca ggttgcagat ttgttatccg aagacacgtc acatactgtg
    99601 aacatcggtt gttcgttgat gaggtcactg agttgccgca gcataacgaa caaagcggat
    99661 agtcgagaga cttcgtcctc gggggcgatg tgatggagcc gggattcggg gcggtctcgt
    99721 tctaaacgca ttaataattc ttggcacttg accagtaaca tcgagctgtc ttcgagggct
    99781 agtttacgaa tgtaggtgtt aaggagttcc gaggctaggt tggctaccat cgacatggag
    99841 atgcaagcat tttttatgtc tagtaatagg tggccgtcaa cgaccgggtc ggggatgagg
    99901 aaggtggtgt ttcggaaagt gatggttcgg agatgttgag tagctgcctt gacctcgtca
    99961 taggaacggt cgagagaaaa tagtgctgtg acgagtagtc gttgattgat ttcagctgct
   100021 aaggaggctg ggacgatcca gggtgtaact aattcccagt catgaatctt gatcgtcaga
   100081 ggtgaggatg aggtggtgtt ttgcgcggtg atgtttccat taaatggagg tatgcagcat
   100141 agagtgtcgc ctttttccca gagcacgggg cctgtgttaa gcacagtgta acactgtccg
   100201 tgtttcatga cgttaagagt caactggttg ccttctacgc gtcggagaac ggtcggggtc
   100261 atgttccgca gcaggctgcg gattcgtgta taacctctgt ttttatcgag gaattggtgg
   100321 aggccaaggt tctgatgctt gatcaggtgg tggcggtgtg gaatcggaat gacggctccg
   100381 actaatcgac cgagtttgct aatatctgtg atcgtgagtt tgtgttcgaa cgtgcagaac
   100441 accgtcacgt ccatggtggt ggctgcgtca gtctcctcac ggctggcgtg gatcggtacg
   100501 gatggcgata gggtcggtct aatagactcg gtttacgagt tgtacatgat ctgtagttgt
   100561 agaggaatta tttcaccaat ggcgtagtta ccgaaatggg tttctgccgc ttcgttatag
   100621 ctgttagggt ttttcattct gttttctaat agcccttgtg tggtggtggt tagtaaggga
   100681 taggcttctt gtaagaagcg gcaagggttt tcgattaact cgtcggttcc ttccatgcaa
   100741 acgtattgaa tatcggtatc accgtggaga cagtctttgg ctcggaccat gtattcatcg
   100801 atggtcttga agagtgtctt attggcgttg atgatgtctt cggtgttaaa aaattgtgtg
   100861 catggactgt agatgcgtga attaaaacct agtcgttcgc ggtgtctttg attgtaaaga
   100921 atgtcgttaa tcgatccggg gagagaactc cagggattat tggtcgccgc aaacgtttga
   100981 gcgtcgggct cctgatggtt gtagagggtg tgttgggctg ctgtctcgtc gtaaggatcg
   101041 acgccgagtg tgcaggaggt gcgtcctcgt ggggtgttgg gatttttaaa gtagttgacg
   101101 ggggtagtga ctggggtcaa taacagttcg caggtggcac gttgtccatg aagattgcag
   101161 acatcttgtt tagtggggat ttttccaaag gtgagggcgg ccatagtgtc ggtgtcgagc
   101221 atctgaatgc gctcggcgcc gatcgtctgg cgaatccatt ggtcaacctc agggtctcga
   101281 tgaacgtgca tgggatagac ttgaaacaga tcttgaacag tagcacccat gtcacttcgg
   101341 acctggtgaa gccatgccag gcaggtgttg catgtatagc cgagtcccat atcgatattg
   101401 ttgacgtgct gtgtgacgtg gtaagtggtg cagatgtcgc gttcttcttt ggtgactatc
   101461 gggttgttga tgattagtga cgtacttgat ttcccgctgt atagtaacgt gtctccttga
   101521 aaagtgtctg ttcggactcc ggttaaggca aatccgggat gtaatctgac tttgctttgt
   101581 aggatgaaag agaccggaga gagtttatga tgcatcgtac ctagagtcat aatagattgt
   101641 agatttggcg ggcaactggc tgagtaaatg ctaaagggcg aacggtgcca attatggtat
   101701 tcgtgagcga aggctgtggg gagtgggaag cctccgtcgt tgcgatgata gtgtggaaag
   101761 tctccgataa agtttttgat atcgtcgctg acagccatgg cgattcctgg gtaggagtaa
   101821 aagcggtgga atggtatggc gatagtatac tcagctagaa tttttggggc ggttgtggcg
   101881 caaaaaccgt tgtagagtac gtgttgatat gaagtaaagg tcatgtttcc gtggttttgt
   101941 gctgggtcga gttgtgtttg aacttcaaga actttagcgt tttcgggtac aaattgaagg
   102001 gcaaggaaca tttctcgaca ggtttcgagt atacccacgt tgtggttggt tgctacgtct
   102061 ctgactaatt ggatcagcat ttctcctggg tgagctgcta agtcttcacg ttcttctcgt
   102121 gacgctggtg gaaaaaatgc atcgcggtaa aagagatcga cgaggagaat cttgaggttc
   102181 agaccgagcc cacaggctcg gttattggtc agggctggta ttatacagaa gtaataaact
   102241 ttatgtaaca cacagtcttc gtcggatatt ctgtcttcgt cgataaaaag aggttcgtcg
   102301 gcatccatgg cggcgagacg cgggacgtcg gaaactccat ggtggcgtat ctcgatgtta
   102361 gcgtttgcta gtggttgtcg atcggcgata atgcggatgt ggtctctggt ctgaggtaga
   102421 tgtgtcaaaa agggaggaaa gaggcgaggg tcgtgaaggg cgcttacata ggtgtggagg
   102481 ggttcgtcgg ctagtttcac gttggggctc gagaggctgg tgacacgtgc gacgaatcgg
   102541 acgatagcta agatgttttg ataatgtgta tggatttgag tgggaatcag accatcggct
   102601 aagtgttcag cgattaattt aatgatcggg aagctgtgcg caaaggctaa aaggtgtcta
   102661 gtgttgaagg tagtaacgat gcaacgcgcg atcaggttcc gtaagatcaa gaatgcgtcg
   102721 agattgccgt ggatcaaaag atctaagaga taaaagagtt cggggtaatt agggttagtt
   102781 agggtaacgg tgaggagctg aagtgtgcct tcgtaatcgg ggggtggtct ggtcttcata
   102841 atttccatgg cttgacgtgc ccgtgaatca tgaaaaccag agggtgcagt cccttgaggt
   102901 aggtttccga ccataatacg gggagtacaa agagcagcca catctccatt ctccatgtga
   102961 tgggtgaagt caaagaaagg atgtagttcc gtgtagagtg aggggttact ggttttgaaa
   103021 aactcttcgt tcgagtgatc ttgtttgatt tcgttggttg ttcgacagac ttctcgtcga
   103081 actctgtaaa aatgaatcgc tcttctggcg atgctaccca tgtgttcgtg ttgaaattga
   103141 cattgacaca gactacgatc ggctggtggg ccgttttcga taaaggcttg caggcatggt
   103201 gccggatcga agaacacagg gtgacagatg gtttttaagg tatccgcgta ttctattttt
   103261 tggatgtgcc gatcgcgatt gaggaaatac acggcggtgg gtagggtgtt ctgcatggtg
   103321 tcggagagct tcagtttgct ctccaccgtg gtgtagcttc gatcgtctga tacgtagaga
   103381 cccatcggaa agaaaaatgt gaggtttatg tgtgtttcga gcggatctcg ggtgtcggtg
   103441 tttttgtaga cgcggcggca attttctaga gccacgttgt gttcaccgag cttaatgacg
   103501 tccatttgga gctgagtcat ctgttgggtg gcgctgcgac cgagggccgt ttcggtcagt
   103561 tcgtcttgtt tatctgtggc taggtgagct gtatattgat taaagtcggc cataatggca
   103621 tgatgtgcaa tggcggtaac ggcgttatca cgatttagga caaagttgcc gtaagtggcg
   103681 ggggccgtta cgttttcttt agtgatgagt tgattcaaca ttgaggtgag gttttgcatg
   103741 acgttggctg tactgatcag cacacccgag agacgttttc cgctggaggt cacataggtc
   103801 tgagggttgt cgagaatact ttcggttgcg gcttcgacca ttctcaagag gaaacgggtg
   103861 ataaagtctc tgtccctggt gcggtttaac acgaaagtcg aagtcacgag cttgtttttg
   103921 aaactgcgta tgatgttggc gcgttgaacg cggttcacgg tttgacggca gagggttgca
   103981 ttttccacca gcgtttgaac tataaagtag ggcggtgctt ttcggagcaa cgtttgtagg
   104041 aagttatgaa tcaaaccacg ttccatcgcg tctgcggtgt ttttcaaagc ttttagcacg
   104101 gtgtgaatgg cttcgatgtt caggacctga tccaggatgg tttcttcaaa agtctccttg
   104161 agatgggtta gacaagcggc gctgagttcg aaggggatgg taatcggagc tttttcgctg
   104221 tattttgtga ccatgatagt cgtctgacgg gacgtgggca ttcccgctcc actggccacg
   104281 cggggaacct ggatgtggaa gagcattttt ccagttgtca ttttgttgag atcatcgaaa
   104341 cggatagcgt gagctgccaa ggctaatgac gtggatagaa actggaccca ttcgatgcga
   104401 ttacaaaaag tgccaaagat ggcctcgaaa ttgatgttgt agcggtcggg atcgtctccg
   104461 taatacatcc gtaagctatc gaacatttct tctccggctg atgttttgac atgcatcaaa
   104521 aagtcgttcg agaggcctaa tttgggaagt aattcgagtg cggaccagtt ctccatgacg
   104581 gcgttggtga agtaatggcg tcatcggact caatctgttc ccgtgaaggc gaatcggctc
   104641 taatagtgga gtcttttcgc cagcggtatg ttttgaatgt gccggtacat gtaaactctt
   104701 ataacttaac ccaggagcta tcgatggaag aggatgctcg ttttgctcgt tccgtgcgag
   104761 tggacgttga acgggtgcgt gccgtttttc gcacgttatg cgaagcctgt ccgctgcacg
   104821 tgactactga acgagatcga gtccggatcg tgctttgccg tctcttgtta ggaccggtgg
   104881 ccgttccgtg ttattgcgat gaatgggata ctaatgaata tatggtagaa tacactcact
   104941 tctgctcagg tcctctcctg tatgtgcatc gacgctgtcg gtgtcgaact ccggcggggc
   105001 agggtctggc cttcagtgtg atgaggggac atcagacgac acatcttttt cgcggtttat
   105061 tgtcgttagc ggagtggaat caacatctac ctcggatgtt ttgtgcttgt atgactttca
   105121 cgtctgaccg ttatgtcatg gcgtgtcttc cgagtgcttt gagtttacat ttggatgact
   105181 atccgtatct gatgggtgag atcggtcatt ttttaacgat cactgagatc gatgaatgtg
   105241 tgcaagctat ggtgcgacac ttgggtcagc aggtgtctaa ccgggttcag attcattata
   105301 agctgctgtt tggtgttcac ttacgtcctc aagcgccttt ggcgcggagc ggtacggaac
   105361 atttttttgc tttggagctt caaaaattgt ggttgaatgt ggaatatcac aatggcgtca
   105421 cgttcgattt cttcgggtgt atttttcggc aattctacat caggcgggct cagacgatgc
   105481 tggccttacg cacgcctgaa cagacggcgt gcgtattaag cgctttttct ttgagtcgtt
   105541 ttaaacaaca agtgttgtac tttaaaatct cggtgaatta tggaaagcat aaattgggat
   105601 ctgggcgtaa tctgttgcgt tatcgtcgtc tccatattct attttccgac gccgatgcgg
   105661 tgtggagaaa tctgtttttt atctactatg aacaagctaa cgcagatcag gtggagtccg
   105721 tcgcgactgg gaaagaggct gcaggatctt ctgcggcttc atcggtacga gcggaaactt
   105781 cttcatcggg aacttcgcgg ttgttaaggc agactgtgac agcgacggat ctctgtaggc
   105841 ggcgctatat tcggattgtc actcgtctat tgtttgccag gtatcgtcga cgttgcgaaa
   105901 cggtgatgtc tcacgaaacc cctcaagcta ttcttgactt cacgggatcg ttttggagcg
   105961 tttcttattt agctcaagtt caagaaaccc ggcgagctac tcagcgctat gccatgcagc
   106021 ttcgcaaact gatcggggga cgggaatttt cggaagtcac cagtgtgact ttggatcgga
   106081 tagctgtcaa cgcttttaat accaatcgag tgattaatat gaaagctacg ttgtcagcac
   106141 gaccgcggtc ccggggacat tttccacgta acatgacgca tagttttgtg atgtataaac
   106201 atacttttaa agagccagcg tgtactgtca gtacgtttgt gtctaacgat gcggtttata
   106261 caaattcttt aaatgtgaat attcgaggct cttatttaga gtttctctac gcgttggggg
   106321 tttatcgtct ctatgtcaat atcgatcact tctttctccc ggcggcggtt tgcaacagca
   106381 actcgtcact ggatgttcat ggcttggaag accaagctgt cattcgttcc gagcgaagta
   106441 aggtgtactg gacgaccaat tttccttgta tgatctccaa taccgataat gtgaatgtgg
   106501 gttggttcaa ggcggctacg gcgattgtgc ctcgagtttt tggtgctgat ctggaaggga
   106561 ttatgcttaa agaactcacg tgtcttcgtg ggatgagtga tatgtgtatt gattacggac
   106621 ttcaccgagt gtttacggaa ttggagtaca gaaactctta ccagattcct tttttgtcga
   106681 aacaattgat tctgtttatt aggggttgcc tattaaaact gcatgggggg gataaaagac
   106741 tttatttgga ccgatttatg tttgaggtgg tcaagagcgg ggtttttgat tatagtaaaa
   106801 acattacggg ccataccaag attaaacata cttgtgcttt gattggtagc cgtctggcaa
   106861 ataatattcc gaaaatcttg atccgtaaca aaaaaattaa gttggattat ctgggacgta
   106921 acgccaatgt gttaacggtg tgtcgtcacg tggagcctgg ccggacgtca gtcgggcgtt
   106981 taaaagtctt gctggaagta ctgagagcgc tttatgccgt gagcaacgct ccgcacacca
   107041 agaacgtgat tcgtcagacc gtggcgcgtc taggtgggcg tttggaacac gtgggtgaat
   107101 aagcatggaa gggtggctag atgctgcgct cgtgttaccg aagtctggtc tggttctcga
   107161 tcatatgttg gaaaatgagg gcgtgtctga tttcgtgcgt cgaatgcttc ctgcaccgga
   107221 ggatgtgaaa gaaaattgtg tctttgcctc ggaattggct tttatcgcca gtggtcgaca
   107281 tggtcggcgg acttcgatgt tttcgattta ctggcatttg cacagcgagc tgatttatgc
   107341 tctaactggg atcacctatt gtgtgaagat tgtgatcgaa tgtggtcaga tccaatatcg
   107401 tgatgccagg gacgcttatg cgattccagg aatttatatg attcggcctt ctttgtccga
   107461 tagtggagct atttcttctc gaaacgtttc ttggccgagt gccggtatac ggtggccggg
   107521 tgatgtacgc atctggttag tgcagcgaaa agtggaaact tttgagaaat ttcaagaact
   107581 tctcaatcgc ctgtcagagt cacggattga aaaatggtgc ccgatggacc tcggtgagaa
   107641 gatcgatccg actttggaat ctttgtctct gggggggacc gagtttgcgt gtcgagtctc
   107701 ggtggcttat gatcacttac gtgctggaga tctgcctcgg actgcacagc agttgttaga
   107761 tcactgtgtg actttggctg cggcgaaaat tatgttgtgg ttagacgtgc ctcgtctgga
   107821 caattttttt ttatgccagg tgtgtctcta cgagttgggt gaggatgagg tgggggagga
   107881 gttgatcggt ctgttacaca ctaagaacaa ggtctccaat ccagatttta atcttcatcg
   107941 tcgagctatg aaaagtgtag cttgtctggc ctttttgctg aattgtttat tacgacatca
   108001 gaatatgatt cctgagttag aagagcgact caatgaaaac gatctttacg tgattgctac
   108061 tcgacgatat tatcggagct ccggaggtgt cgagaggagg actatcgcgg ctgggagtcg
   108121 cttactttca gaatatgctg acacgttgtc ggtttccgac agctggaggc gtctgaatct
   108181 gccagtgccg ctggatgctt cttttacgcg ggaacagctg gtcggattgt tgcggactta
   108241 aatcggtttg aagcggtagc tgcgaatttc gtcgcacatg tagatggaca tgatgagagc
   108301 gatgatcaag tcgtcggcct ggcgattttt tttggccgaa tatgtactgt tgagttctgt
   108361 taaagtgaca cgatggatgt ttcgaatttg ctctaaaaga tattcgatcg ggtcgtatga
   108421 taatttgata gtgtaggaga ctaattcttg tgaggctttg acgtagccag aattaaactt
   108481 ggtgatgaac tcttcgactg ctagtcgttt gtcgcgtccc attaagtaaa agggttgttc
   108541 aatgttattc tggtctggag tgtggtaaaa aaggacgggg attcggtggt tacataagat
   108601 attttgttta atcaggcaag cgattcgtac ggccgcagct tggttggaat ttccttctat
   108661 ggcgatgcga atttcttcca aaaaagggtg aagactgatc acggagatga gcatgtgagc
   108721 ggcgcattcg gcaatggcga cctcagagct ttccgagaga tcttttagaa agaaatgttc
   108781 tagaccgtag attagatact gattgcgata agttccgatg gcggcaatgc ctgtgccgga
   108841 ggcgtgtcta ttggtcgtaa aagctgggtc taagtacaca taaagcttcg tgccaaagtg
   108901 attgtaagcg ttcttgttca tggtactgta gcgaaagatg tcgaattctt cgcgactctg
   108961 atcggtgatt aaagctgagt tttctacaat cttgttggtg cctccgatga tttcatccat
   109021 aaaggaacca ggcatgaaca tattggctgt gcgtcggact tgagagttca gactgatgaa
   109081 ggtgggcttg tgtaagcggt agcaggggca ggctgtggcg tcaccttttt cgttgaaaca
   109141 atggaggtgt tcttcacaga cgtaggagac cacattaagc atgtcgaagg gggcgttatt
   109201 tagtcgtgtg aggaaacagg tggcgtcact ggtcgtgtta gttgaggaga tgaatatgat
   109261 ttttgtcgta ttctgggcca aaaagcctaa tatggtgtta aaggcttcct ttttgatgaa
   109321 atgggcctca tcgacgagta acaggttgaa gttctgacct cggatactct gtggaaaaaa
   109381 aagacatgat gagtcagcag agtggcgggg cgattttcac gtgggcggaa acagaatgac
   109441 ctcaaaaacg atgagcgagt tttgtgaatc gcagatgacg gctttccggt gatggggacg
   109501 catgaaggct agacgtgctg gtcgcgcgtc atttagacga aatgaattcc ttactagctg
   109561 aattgaatcg tttaggtgtt ccacatgata gatcggaaga tctgttggtt tttgccgata
   109621 cgttgtttca gaagttttct tttgtttttc aagatcaaga gtcgaatcct cgcaaggtgg
   109681 atctgttgtc ttcgcttttt gaacacttga cgattgaatg tgtgaacgag atgctggatc
   109741 tgtgtgctaa caacaacgaa gctgtcgaaa agttgtctga gtgattgatg gtcatggcgg
   109801 acatggttcg tccgttagag tgttctccgt gtgaagcgtt aggagggtgc gagatgcatc
   109861 aggtgtgtaa cgcgctaact gaagagatcc agcttcgatg cttctatgtg tgtgtcaatt
   109921 gttacaagac tcatgtgtgt gatctcagtg aaggttgtgc tttggtttct actttggaag
   109981 gttccgtgtg tttaaagact gggttagtct atgagtctct atgtcctgcg actcgtgtga
   110041 atgtgttgga acctacgggg gaaacttcgg ttgatgatgt gaatgtggtg ggggtgatca
   110101 tggctagtgt ctataattat ctgatggctc atgcgacgag atacgcagat gtgatcaaag
   110161 aggtggtgga tgacggacgt ttaaaaaagc aggtggagga tgcggtgtat ttcacattca
   110221 atcgagtctt tcgatcggtt cagaacgtgc aacggatctc tctacctgtg atcagtcaac
   110281 tgtttacgca gttgataatc ggaattcatg cgaagaatac gaagtacgac tcttcagtta
   110341 ttaaagtcag tcgccgtaag agagaagatg cgttattgaa acaaatgcgt ttcgagtatg
   110401 gaaacgcacc tgttttcgga tcttgacttt caataccgtt ttgatagtct cgcccaggtg
   110461 ccgattcact tggtgttcga tgagacggtt ttgactctcg aaaagttgtc tcaactggtc
   110521 ggggtgtatt ttaagacgga gtggggtcaa gattggcaaa gagcactgtt tactgtggtg
   110581 ccgcgaagat ggtgtcttcg ccagtatttg gatcaacgcg gtctgaaaag tccagatgtc
   110641 aagatagttt gtcaacatgc agtttttacc actattggcg tctcttgtgt tgatcgagtc
   110701 atattaggag gtcgattagt ctacgtacgt tttgtcttga atcatcgaca gtcatcggtg
   110761 gcggcggaaa atcggcgctc ctttgtcgac tgtgagtttt tcgtcagaga tttgttaaaa
   110821 ggtcgccact ttaggagtca agaggaggct tcgagcgacc gcttggtctt gccggtgaac
   110881 gataggcctt tttttgaaat tcctcatggt gatgctcgga gtaaaattgt ggggcagcag
   110941 ttgctactgc gttctggggt gactgaacag tatacgggtg gcgctttaga accgccttcg
   111001 aaaattcgcg gttatgaatt atcgaaacga cctgaagtgg aaaatcctga tattctttat
   111061 gcgtttggag aaaatgaagg gagaatcatc ccttggactg aggaatggga atcgggtggt
   111121 gtggtgggaa ttcagaccgt gtgggatgtt tcggctcaag ttcgagtcca tgtgttgtgg
   111181 tatcaacgct cgttttggaa ctctttgaag attgactatc gagatgaaga ggtggatatt
   111241 cgacagtcgt tagagactta tcgtcgtcac ttggtagtgg gatcttcggt gtttgaaaac
   111301 atctaccgcg agcttcgtgt taatgtagca gagagacgag cagtcagaca attatttgat
   111361 tgttttgtct cggctgatct agatccgtcc tttttatggg aaatggcgtg tgcttcttta
   111421 gatctctgga tctaccgagt cgagaaagag agctgcatta ttaaggcgtt gacgacttgt
   111481 ttacaacagt ctcgcgatgt gcagggtttt cgacagtatc gagtcgtcgg tcagggtggg
   111541 cgacgagagg cttgggccga tgtgatttat aacgcgtctg gacgtgtcga tttgggtctt
   111601 caggtgtctt tagaagtgtg ctcaagtagt ggcttgtggc ggacaaagga tcgtcatggt
   111661 tacgttctcg attgggtagc caacccggag gtttgtgtta tctacgccac gagtcattta
   111721 gatatttatt ggattctacc tgggggtttt ggaacagttc ttccaattcc tgtccatggc
   111781 gtcgacctcg gtttgctgta cgagagattt aagactcctg aagtactttt tacaacgtga
   111841 atgtgtctgg agaagagtag gtgcaagttc gaaacaccga gaatatgtgg ctatagcttc
   111901 gaaatcggca acttttgaca tggatggtca agatagtcgt tgcttattgt gtcgtatcat
   111961 cgttctttct aaagacggag ttaacgttgt gtgcttgagc attaacacga cctacatggg
   112021 atcctattcg actaaattgc atcgtgtaaa acatgatgtt gggggggtag aaacgtttta
   112081 cagttttaag atcgatgatg aattgtgtcc caagacggta ccttttgctc cgaccttcac
   112141 acctgttcgc agcacagttt cttttaatgg gatgtcggcg gaattttttt acgacgtctg
   112201 tagtctaccc tcggcagaag aactaaaaag tattatggtg aagggaggtg agcagagtaa
   112261 caagaaagct attcgacttg gcggtcccgg cgcctgggcc gtgaaaacgt cgttgggtgt
   112321 agatctctat ttctatcttt tagaatacga tctgtatacc acgtgtacgg ggaaagattt
   112381 tttgccttct ttggctagaa ttgtttcagc taccacgtgt tgtggggaaa tgtcttgtcc
   112441 attttgtaag gatcacggaa ctcatgttga ttgtactgga aaatatgtgg gtcccgtgcc
   112501 ggataaaggt atgtgtttct gctatatgtt gtgtaaaatg ccgacagccc ccattactaa
   112561 tgatagatat atgccttttt tatgtgactc ggaggaagcg acgcatattt ctgtttctgg
   112621 ggctggaaag tcaaaggtga ctttggaaga tcctctagag agttatatca ccgtttacaa
   112681 cagtgctgga aaagcgttac ctctaaaaag cggatgttgg aaactggtca agttgagtca
   112741 ccctgcgagt cccttacttt tgtgtgcctg tcctgtttta aagggcgtgg tgctttaaaa
   112801 agatggagat acttacattt gtgttgtagc agctggcgaa aagagccgtg ctcttggctg
   112861 tctgatgatc gatgctgatg acattatctt tattctccac tgcgtattct gtagcgaacg
   112921 tgtagcggca tcggaattcg acttctttga gcacgaattg agaaacatgc ttctgatggg
   112981 ctacgtaacc gatactaatt cctataatat gtttgaggag aaaggagatc actggaatga
   113041 tgaaccatgt tttaccatgt cttcgtggga ctaagaacac tgtcgctttt tgtttaaaaa
   113101 tatcgatgga gggttgggtt aaaaagtcaa tttcgaaagc gtgaattaga tattgtaata
   113161 cacgattggc cagtacggga agtttggtga ctgcgatgaa aaagatcacg tgtattaata
   113221 aatttttttg gaaaggttct aagtgtattc gtgtgtgttc ttggtctgcg ggggtgaagc
   113281 ctccgtccag ccacttcttg aagtctatca taaagttgtt gatctgagtg aattgaggat
   113341 ctcggtagag ttccgtcagc gcatctatct tttgataagc atcgcgttga tgatctggac
   113401 atggccaaaa agttacttga tcgatggcgt ttttgagcgt ctcgctgaac aacagatgag
   113461 ggcgcttttc atcttcggga gagttgtagt ctcgatagcg accacagaac gtcacgagcg
   113521 ggagaaaagt ttcgttacac gcatgcgcca ggccgagttc gggatgcatc atctgaaaac
   113581 gcttacgata tagggcggcg acattgggga aacacgtgga gatgtaggag gctggactct
   113641 ttttcttctt ctttaattcc tcatagcgac gctgaatttg tgtcaaagat tcgccgcgca
   113701 gcatgtcgtc ggaagccggg agttccgggg cggtgtcgac agctttgtgt tcggtggaac
   113761 ggttagttga gctctcggct cggagtgacc cggtcttggg cgtctctgag gtgctcaaat
   113821 ttgacgaagc ggtggagatg gcgctagtgg cctgtgaagc cgcttcgcct cacgatcgat
   113881 atcgtttgat cgaaacacct agcgagaatt ttcttctggt cactaatgtg attcccaagg
   113941 agatggcgac gtgctcgggt gaatccgagg cgggtgaaaa aaaggcggtg aatcaggatc
   114001 tcctaggttg tctgtatgga gaggcgttct cgcctcccgt ggtttccagt cgagattacg
   114061 ttctaaagaa tttgcgacat acggcaaatt accacggaga gcttctgtac gggagttatc
   114121 tgatgtataa caaagaacat atcggattat ctctgtcgat caataaggca agtcacgtgg
   114181 aaagtatttt acgagacgtg ttcgcacccg gtttattgga acatcacaat gtgtgtgata
   114241 ttgaggcgtt gctttggttg ttgtattctg gtccacgtag cttttgtgct cgtgatgcgt
   114301 gttttggtcg ggaacagctg ggatatcaca tgccttttcc ggcactgctg ccaacgctgt
   114361 tttacgagcc ggtcgtggat tacgtgacgt atatgaatct cgctgaactc tatgtgtacg
   114421 tctggtatcg aggttatgag ttcgcttcaa ctcgagatga ttttcgcgtc tctttaaaca
   114481 gtgtgacctt ggaccgcctg caagaggttt taaaggctgt gagagcacgc ttctctgatc
   114541 gagaagtgcc ttgttggcca gtctcgtcac gaacttgcgt tttctgcgct ttgtatagtc
   114601 agaatcgttt gtgtctggac gtggctcgga atggaatagg cgcggttttt tacagtccga
   114661 ttctgcttca agattgtccg gccgtcgtga ctgacgtgac cttgagtcac attcttcctg
   114721 gacaaggtgc ggtgactttg tttccggtgt accacatcgg caaattgcta gacgctgttc
   114781 gctacgccga aaacggtgtg gctcgcctgg agctataatg acgtcaacta ataaagagct
   114841 cttaaaagag gcgatgagga cacagttaga gaagacacat catcagtttc tgaagcgtgc
   114901 gtatggtgaa aaacatcacc ttactcacca tcaagtttta cgggtgatga gagcggctct
   114961 ccagcaagag cagcgacgag acgctctggc cgttcaagag atctccgctt gccttctaag
   115021 agatcagccg cgtgttcagc aagaattggg aaaagccaag gaactgcagc gtctacaggt
   115081 agatgagcgt ttggactcct taactgagtt gaaagacacg gtggaggatt catattcagc
   115141 cctagtggat tctgtttcta cagtttgtga gatagacctc gaagaagaga ggtgctgaaa
   115201 aaaaaagttg tgtgtgatgt cttctgaaga gattcctacg tcgcccgact cggccgagtc
   115261 atcgcctact tcgtgccctc cagcacctaa aaaaacccgc cggcgtcgtc gcatctgtag
   115321 aagaggctgc tcctctgtta aacggacgct gaaatatccg aaattatcag agtcgatgac
   115381 cgggtcggat gtgaacgaga tgacgagtca cagtacggcg tcatcgggat ctggaagccc
   115441 tactgaacgt ttcttgcgtt gtgaagaaag aattgagaaa tcgggacgtt cgtcatcgga
   115501 aaatatgagc tgtccgattt gtcgtcgaag tgaggaactc ccgttaacgt cgtcagtggt
   115561 gtatagcggg tctgaagacg aggcagtcga gcgtgaagaa tgtggacata cttattctaa
   115621 tgaacaccgt attgtgactt cggttcgtgg tttaacatgc gatcccaatg ttttttgcca
   115681 gttaaccgcg cctcagttgt atgaaaccac cggagcttcg actcatgttg tcgtctatgc
   115741 accgaaaagc ctggatttct gtgaatcggt atgtcaggcg gtcaatttgg atgacgagaa
   115801 tcggcgtctc ggtcaaggtt cttttggtga aatctggcct ttggatcaag accgcgtggt
   115861 gaagatcgct aagaggcaca gtgaaaccat tctgacggtg tggatttctg ggatgatacg
   115921 gtctagggca ggtggtgtgt ccgatcaggg agacggagtg tttcgaggtc ttttaacgtc
   115981 agttggttgt tgtctactgc ataatgtaac tgtgagtgca cgttttcaga cagacatgta
   116041 tcatcatgat gcttggggct tggagtctct gaacagctat ggcatggctt ttaaagtttt
   116101 agccgatgcg gtgcgttttc tcaatcatga ttgccacgtc tgtcattttg atattacccc
   116161 catgaatgtg ctgatcgatg tgaatccgca gaaaccgagt gagatcgttc gagtggcgct
   116221 gtgtgactac agtctgtgtg aaccctaccc cgcgttgaat cgacgctgtg ctgtcatctt
   116281 tcaagagact cagagtgcgc gcatcttgcc gagctgtcga catcggctac gagaatgtta
   116341 ccacccggcc tttcgaccga ttccgttgca gaagttggtg acactcaacg ctcatgccag
   116401 gtttccgatt ggcagttcgc aacgcttctg tgcggctgag atgacggcgt taactaacgt
   116461 gctgatgttc tgtcttgccc ggattttgga ccgtcgcggc tttgagactg ttcgtgctga
   116521 atctgaattt ttgttgttta aacacgcgtc ggccgcttgt cgggctctcg atttaggtga
   116581 cgtggtggaa tgttccaagg cctgcctcct catcttggct gcgcaggcgt cttatctgaa
   116641 ttacatatta ggcgatgtgg ctgtaccagc cgtctgcaga ctgcatcgct ttgtggagag
   116701 tcgtttcgac cgacgacaag tggccgtttt taagcgctat tatggagagt gtggaaaagt
   116761 catggatcat ggaaatgtgc gcaagaattt ggatcagatg ttgaatacca gatgcggcct
   116821 gtatttatac gacgcggtac ggagagcagg ccgttttact tcggtggaag atctcgagtg
   116881 tgattgtcgg atcatctttc cggagtagat cagaggactt gagattggct atgtggtaca
   116941 ccttgcttct gtgagcggcg agatggatgt cgacgatctg gcttgtgtcg tcacgatctt
   117001 ggacgatgaa cctctcaatc tgtttctcat gaacagtttt ctcctgcatc aggatggttt
   117061 acgtaacatt cctttcaacg tgttacgctt ggtgtatttc tatcatattt ttgtcaaggt
   117121 tcggcgttta catgcaatct ctatcgcgga tgatttcgtt tcacgaatga gttctctagt
   117181 caaagatgat tggttgcgag agattcttag taacagatat cgagaatctc gggacgagct
   117241 cataggagcg ctcgacagct tggtgtcaaa cgattacgag aatacggcgt atgtttggtt
   117301 gagtaggctg ttaagtctcg ttcccgatta caaacagatt gaactatatc agatcttgga
   117361 gaaagagtct agaggacaag ccgagagtgt ggtgtggcat gctattcgta cggacacggt
   117421 ttcggccaca cgcttctatg aagcttttgt caatggaaac gcgttcattc ctgtggaggc
   117481 tcggaagcct tggagttctc cggctatgac tttcggcttt catcatgagg gtgtggtcaa
   117541 gacgcttata gagttccaca tcatgtgtgg tcgggaaccg gtacgtgatg gactgggcct
   117601 gttgatcgac ccgacttcgg gcttgtttgg ggcttctttg gatctctgtt tcggtgtcag
   117661 caaacacccg gaaaccggta cgcttgcgat ccatccaggg gctcgtgttt atgaaatcaa
   117721 gtgtcgctat aaatatcttc gtaaaaaaga agatcctttc gtgcagaatg tgttgaagcg
   117781 acatgatctt caagcggtgg tgcagttcat agtttcgcat cctattccgg gggtagagta
   117841 ccgtccggac tgtgagacgc cctcagctaa ggagtatctg ctttcttatg atgcgatttt
   117901 tcgccacacg ttgaagcgcc atcgaccggt aaaagcccct gaagctttac gttctcatgt
   117961 ggatgatctt ttgtatctga ataaaaacca aacctcagaa gtggtcatct ttgacgctaa
   118021 aatcgtctcg gatgaaactt ttagtgaaaa tgggaaaaaa gacacttttt caagcacttc
   118081 cgtcgatgct ggatggggat cagaaaatga tgaaaataca ccggaactgg tgaatcgttt
   118141 agatgtcttt gaaatttcgc gcttttcatt gccagctttt gttaatccga gacaccatta
   118201 ctattttcag actctcattc agcagtatgt gttgagtcaa tactatataa agaaacatcc
   118261 cgatccggag cgcatcgatt gtcgcgatct gccgacggtt ttcttggtct cggcaatttt
   118321 tcgtgaacgg gactctgaag agcttggtcg agagctgtgt gttggaggtc gcgtgtttca
   118381 ttgtgatcac gtaccgcttt tcattatcgt gacgccagtc gtgttggatc ctcgatttac
   118441 tcggcatgca gtttctacag ttttagacaa ctggaatcgc agtctttcgc gccagacgaa
   118501 cctaccgata tgggttccca atgcagctca ggaatatgta gtcagttctg tcccacgacc
   118561 gccaacccct tgacggatgt attgggtcgc cgagtggatt tgggagttta cgatgtgatc
   118621 agctcctcgg aggaagagga tgacttgaag aatgacgatg ggagtgatga agaaagacca
   118681 cctcccaaaa agcctatcac tgcagtagtt caattaaaac ctccacgcac taaagataag
   118741 aaaacgcttc tacgtcctcc tactcctaag agtaagcgaa aaagtctcag actgatataa
   118801 aacaaaacac aaagaacagg tacaaggaat tatatacatc ttttattcag gtggcttttt
   118861 ttgtacttaa taaaaatatc tgcacgctta tcgagtgtgg tgtgtctttc caaatgatga
   118921 tggctttagg cttcgtcgtc ctcacccttc agggcggcga tttcgtcgat tgaagttagt
   118981 tctttatagc tgcgagaaga acggcggaaa aagcgaatga accgacagag agtaaaaatg
   119041 gcccagatta cgaaaagtat gcccagtgag acattgatct cgcgagcgta ggcagatgca
   119101 tataaagttt cgtacttgag tacggggtac accaggccga gaagaccaca tagggtaccg
   119161 aaatggtagc caaagagtac tttcatgtat ttgtgtaaga tactttcgat gatcaaatag
   119221 cagaggatag atagcactgc aaaaagcgcg aagaccacca tgaccatgtg tccgctggtc
   119281 acgaaaaagt tgttaccaaa agcgaggcag agagagactg aaaccaccat ggtgttgaat
   119341 cccaggttgg tctggacgag attgactacc acggttttca gttgcacggt gcctctgagt
   119401 tctggatgaa tccgactcag aagaaattta ttgcgtttga gtgattggta atgggtgatc
   119461 aaggtaatcg tataggtagt taggcagata taatggatga aagccataaa agcgatcatg
   119521 ctggggaggc ggaaagacat ggtcagggtg aacagttgaa aagtatccat gcacaacacg
   119581 aatagaaaac aagatacgct gtcgcccata taagagatgt cccgcgaccc ttgattgagg
   119641 ttgagtcccg gctctttgcg aagacagatt ttgaaccagc agatgagata gtatagcgtc
   119701 acgatgagga agatgaactg ggtgaagatg acgtagacag tgatttgaat gttgtccatg
   119761 tagagttggg ggttgaagac gtgcatcacg ttgtagctgg taagattcag ttgagtgaag
   119821 tcgatgatgt gattgtacac acaagggtaa ccgatatccg gaaagttcat ggcgattagg
   119881 tgaatggtga cattcacgaa ggtgagtagc aggcagagaa ccgagatgga ccaggttcga
   119941 ctgttgatgt tgtcaacgtg agaccccatg gtgatcgagg aaggttgaga agattgcaca
   120001 gcgaaggtga aaccggttac ttgaatttca ggtgtcgtcc gccagatccg gtggattgat
   120061 tcgttaaata ctactatggt agggtggtct agaagacgga tgactcgttg gtaattccgt
   120121 tggatgcgat ttttggttca cggtatcgag tcggtaggga tgtgacttgt cttcaagata
   120181 tttagatgac tcgcggcagt tcactgcagt tggcttctcg cttttgtcga gatcgagtca
   120241 gcatggaaac cgactcttct tgtttgcttg gagtgtcctg tcatttaggt gtctatgggg
   120301 tggttggatg cgtacctgtg ttacgttgtt tgtttttaga actgggaacc tcggagcctc
   120361 agttacgaag tttgcttctc cgaggagagc gtcttagcga ttctgaggcg cgggtgcttg
   120421 gacgttttac gtatgcgtct ctggcggtcg gagcgacgga ggctgaagag cgaagagtgg
   120481 cgttgaatcg gagaagtgct ctgttggcga aaacgttcaa cagttcgtcg gcggctcgga
   120541 tgttgtctcg gctgttcacg gtggtcagag tccagctgga tggacaacgt gttgaggtgt
   120601 tagccgtcga agctgcattc tctagtgaga atcgtcgtcg gttagaggaa gtcctcagtc
   120661 tatatcatgt ggctaaattg gtggttatag ggtcgtaccc ttcggaacca tacggtcctg
   120721 gatcttctct gaagaaggat ccaggtgaag actcacgaga aacgttggtg gagtacggca
   120781 cgcatgccaa caaaaagttt aaacgcggtt attgcgcatc ggatctggcc ttgtcgtttc
   120841 gggtgggggc tcgcaagtat gtgtgggaac agtctgattg tgaaagtgtt cgtctggaag
   120901 atcttttcca ggttagtgat gtgcgttttc tacggactga tatgcgattg gtgacacctc
   120961 ggaatttcgt cgccgtggca gtcacggacg agcagtgttt tgtccttttg aagacggctt
   121021 ggcgttggat ctacgatttg tgtttttcgg gttttcatgg gatgcggccg ctttttgatt
   121081 atctgggacc tgatctttat gatcaaggcg ggccgcgctc gatgtttttt ccaggttttc
   121141 ctggtctttc ggtttatgcc gtggaggggt tatcagtgtt actaaaggag acggcgattg
   121201 acgctatggg agaaatcgtc tcctgttgtg gactacctga cattgtgggg acggtgggga
   121261 agttttcagt gtgtttgcgg tcagatgtac cggtgcttgt gcccccggaa gatttgagcg
   121321 tgttttcggg ggaaaataag ccgttgagga ttaacggcac gtctttttcg gtgcgatctc
   121381 gagatgattt tcaatgttat ttgcatttga aacccgcccc gcttcaccga tttactttac
   121441 aaggattgat cgaaggtgtg ctcgcccgtt gtgtgcgagt tgaagatttg gatactgatt
   121501 ttccctataa tcaccgcatt actcgtgatg aagtatgttg tcgtttctta gaaaatttac
   121561 gacatcaggc tttggatgct tttctccaca ttcaaagttt attaggctac ttattacaac
   121621 atttgacttc ggcttgtacg tcggctggcc tcgaatgggt catggtgaag catcatcgtg
   121681 aagtgtatgc ttatgataat ctggcagcgc attgtgctat ggtgtctgcg gaagtctgcg
   121741 tacgaacagt gttgtcctgc tattggagaa aactctttgg cgatcttgca gttgatgaat
   121801 tccgttgtgt gcatacggac agcgcgcctg gcatcttggt gttacttgag gagcagcagc
   121861 aacgggtggt gggggccttt catcgatcgg gagagatgac gtggttggat gtggtaggac
   121921 aggtgctcac tcgggtgctg gatctcaccg tgtcttccga tgcatctcat gtacgggatc
   121981 tgtaccggga agttctcttt cgctttgtca gctaccgtaa tgatgtatct ttttgggttt
   122041 ctacctatta tcctggcgat gttgtgcgag cacacgttgg agttatcgat tgtgctccgt
   122101 ttccaggtgt cttgtcgctt cagggcgaag tgttggtgca gtcgagagac gctgcgctcg
   122161 aaaccgatat tggatatgga cggtatctga agcaagcgtt tagcattcta ggtttctgtg
   122221 tgaacctcca gctagagagg caagcgcaga tatcgggggg gtcagcttta ctcaccgaag
   122281 acatggtgga agaaatcggc tcgacagtgc tgactgacgg gcttcacttt ttccaattaa
   122341 ataattgaaa ccaactcacg gtgtgatgtt gtggggatgg agtccgttga caaagtgttt
   122401 gtagaagttg ggatagctct cgttgagtac ttcgtgtaga gcagtgctaa cgagcatgtc
   122461 gtcgttagta gtgcggttca tgaggcagag ggaagcgttc tcatcttctt tcagactggc
   122521 taatcggaga aagagacgag caatggtttc gacgtaagac gttctggttt cgagatagag
   122581 aacgaaaatt ctcggaacgt gagctttcaa ttcttcttca gggtgatcaa aaaagaggta
   122641 gagagctgta cagatcaatc ggcggcaact gttgaggagg aggacgtcta aaggatcgtt
   122701 gactgaaatc tctcgaatga acagacgcaa gtcttgcaaa cagcgtttag tgagtgccag
   122761 gttttctacg cagctcaaaa cgatacataa ggtgaattgc ttgagattgc tggggcggat
   122821 cacggcacaa cgatgtttaa tgcggatcgc agagagtttg actcgcgata gggtatcttc
   122881 ggtgtcgagt agaaaaatgg ccgaataacc taaccaagaa cctcggcatt ggcattcttc
   122941 gtaatattca tgcatagaga tcaatgttcc atggtcggtg tggacccaga gtcgatggtc
   123001 acggtgtgtg atatcgatga tctcgggttg catacaatag actgtctcgc ggtcttcgca
   123061 gtggacttcc atcacgccgc gaatcatcag ggcgtccatt tccaaaacgc gttgtggggt
   123121 gtttggtgat ggtttcggtg aatgtggaag tgggttttct ccactgcttt tctacatgtt
   123181 cccaccgagc tttttctcgg ttgcatacga atcgtacgta ctgtatcagc ttactctcgt
   123241 cataagccgc ggctaatatt tcgttgaagg agaggtcgag ataggcttcg gggatgggtt
   123301 ctagggtaga aagagagagg atgttgaaga gatatggaac gacgacccgt tcgacggtgt
   123361 agttggagta gaggatggca tcttcgtcac cttgggccgt gacagtgcgg cgtagacgaa
   123421 aagtgcgaaa gtactcgttc tgccagagat cgctcaggag cgcttctagc tgttcggtgt
   123481 ggggcacgaa ttgagaaaaa aaactgttgg ccacggtgcg gttatcgtca acggagaaag
   123541 ggcagaaaga tacttcttga gcttttttga ctgcttcgat aatcgagagg tggttgagtt
   123601 ctgcatccgg catcatggcc gtttgggttc gatgctggtg ttcttgtcgc gataagagcg
   123661 atttcaattc ccgtacgtgc tgctcccaag attggttgat ggtttttaag tcctgaatct
   123721 catcgatctg ggactggatt tgttcttcta ggcatttaat catttgtttt ttgaacagat
   123781 cgcggatatc gcgatctgcg ggtacattga cgtttccgct gggtgcggct cctgtcgctc
   123841 tgggggggag aagacgggtc tgatcgacta aagaaggggt taagtcttgg agaaacgatt
   123901 caacactgtc ttcgattccg atgcgtgatt tactgtcgga gacgtttagc agaaacttga
   123961 tgatggcttt cttggcatct ccggctcggt cgtgtttttc catcatgtcg atgatttttt
   124021 tacagttcat ttcatgttga ctagctgtaa tcgctttcac cggaaaagtg ttaagcagtt
   124081 ggcagacttt ttgatgtcgg cataaactgt cgtaacgaat aatttcttcg tagaggtgag
   124141 ctactggagt agtataaatt aaacggtctc gttcgtaaga gagaggttca gctacgatct
   124201 gaatctccag tggacggttt ctgtccttgg cttcgatttt cccgggatcg ccgcgcttgt
   124261 agatatagat atcggacgag ttggagatgg agacggcgtt gaggttgtga atgattctca
   124321 ggagaagagg gaggttgtgt tgcagtagct ctcgagctaa agggtgactt tctgtggctt
   124381 tctgtatggc tgcgcggacg aattgctctt gtaactgttc gtctcgcgga ttctgtttga
   124441 cggtggcgat gggcacgata ccgacggtta ccaaccaatc tatatagagg ccatagttat
   124501 cgtcgtcggc gtagcggtaa aggatgtctc gaacggcacc gagaatccca gtacgtacac
   124561 tctgtccgac cgaagaggcc cagagttcga gatactgatc gaagtcttct gggttgacag
   124621 cgtgataggg aaagagttgg gcgtgatgtt tccattcgtc ggcaatatgt tttacggtga
   124681 ctgtgttgaa tatagtttta cagattccgt agagtaactg tttgcggagc acgcaagggt
   124741 ccctgagaat ctgatgaatg cttttaccgc ggcaggcgcc gacaaaaccg tgaagaaatt
   124801 ttatgtagct gagagttttc ggtgtaggaa agatgtcgat caccggagat gacgaggtgg
   124861 aatttcggtc ccggaagtac gaggattcct taattcttaa cctttcgtca gctgctaaga
   124921 tcgaacggat tgttgataag gtcaagtcat tagcaggaga atgttttgag aaagaggatt
   124981 ttccgtccca atggtatagg ttcattagtc aatcggtccg acaggaagcg atcggggagg
   125041 atggtgaaga agagatccga gttccttgtg tggacaaaat tccgtttttt ccgttccgtg
   125101 tgcttttaat tacaggtacg gcgggagcgg ggaagacgtc cagtattcag gttctcgcag
   125161 ccaacctcga ctgtgtcatc accggcacta cggtgatcgc ggcacagaat ctcagctcag
   125221 ttttgaatcg tacacgttct gctcagatca agacgattta ccgaactttt ggctttaaca
   125281 gtaagcatgt tcatttatca gacagcgtcg gggcttggtc tcaacggtat cgtgtttgtg
   125341 atccgagcga cgaggacacg attcaaaaac tgcaactcaa tgatttggtg atgtattggc
   125401 cggtgatcgc cgacatcgtg gatcgacact taaatatgtt ggacaagaaa gcttctttag
   125461 atggggtgtc tgaactttgt gatagtaaca ttattgtgat cgatgagtgt ggggtgttat
   125521 tgaggcatat gttacagaca gtggtgtttt tttattattt ttataacgcc attgcagata
   125581 ctcgtttgta tcgagagcgg cgtattccat gtctcgtctg tgtgggttct ccgacgcaaa
   125641 cggaggcgct cgagagttgt tacgattatc aacggcagaa taagaatgtg cgacgcggag
   125701 tggatgtact ttcagctctc atctgtaatg aggttctgat gagatactgt gacatcgctt
   125761 cgaattggat tatgtttatc aataataaga ggtgtactga tttagatttc agcgatcttt
   125821 tgaaatacat ggaatttgga attcctctta aagaggagca tattagttac gcggatcgtt
   125881 tcgtgcaacc gccgaatctg attcgcaatc cctcatatgc gtcggatatg accagattgt
   125941 ttttgtcaca tgcggaggtc caagcgtact ttaagagatt gcatgatcag atcagagtga
   126001 gtgaacgtca tcgcttgttt gatctgccgg tgtattgtgt ggtcaataac cgcaattatg
   126061 aagaactctg tgaattgact gacccgttgt cggtgccgcc tcgaatcgat gtatggtttc
   126121 gtaacaattt agctcggatc attaattact cacagtttgt agatcacaat ctgtcgaatg
   126181 aaatcacgac agaagtgctt cgaggttcta cggcccgaac gggggaggga gaagaggagg
   126241 acgaaggaga cacgggggga agtgaggagc agatcgaaac actgcttact ctacgtataa
   126301 cctatatcaa gggtagttcg attggtgtta attctaaagt taaagcgtgt gtggtaggat
   126361 atcacgggac atttgagagc tttgtggaga ttctccgcaa agacactttt attgaaagaa
   126421 cgccttgtga acaggcaggg catgcttact ctttgatctc gggtttgttg ttttctgcca
   126481 tgtatctgtt ttatacttct tctttcgcca ctgaagagat tcttcgggag atctcgcgga
   126541 ttgagctgcc ggatatttcc tctctctgtg gaggagtgga agaggttagc acgatgcccg
   126601 agaatgtggt ggaagatgtg tacgacatcc catgtctatc gtctgaagat gggtatcacg
   126661 atgaggtgtc ggacacggat cttctgacta acactgattt atacaccgat cctttctttt
   126721 taaagtatac taagccccct gtgacgggtc tactctcttt tgaggagacg gtgcatatct
   126781 atacaacgtt cagacagatc ttcattagac gttatcaggt aatgcagagg caaacgggag
   126841 gagagtttgc taagtcgacg atgattgcct ataatcgtcg gaatgtggtc accaaaggaa
   126901 attgccaaat cgtgtctcag accggctctt tcgtaggtat gttgtcgaat gtatcccctg
   126961 ctcaaacgta tactttagaa ggttatacga acgataacgt tttgagttta cctggagaga
   127021 gatataggct ccaccctact gtcgtgactc ggggtttgtc gcggcttgtg gtcaaggacg
   127081 ttttgggttt catctatatt ttggatgtga acgtgtctcg gtttgtggaa tccgcacacg
   127141 gaaagagttt gcacatctgt accacggttg attatggtat cacgtctagg acggcgatga
   127201 ccatagctaa gagtcagggt ttgtcgttgg agaaagtggc gatcgatttt ggggatcgtc
   127261 cgaacaatct gaaaatgagc cacatctacg ttgccatgtc acgggtgact gatcccgagc
   127321 atctaatcat gaatgtgaat cccatgcgct tgtcgtacga gcggaacgcg ttgatcacgc
   127381 cgtacatctg ccgggcgttg aaagatcaga agacgatgtt gatcttttag ggacagctgc
   127441 gcctggaaag acaaaagccc gagaaggagc gcgactgttg tgggaggagt cgcgccccgc
   127501 aatgcccgtg ttgtttttga cattactact acactggtga taataatgat cccgttctga
   127561 tcaggataaa taaaacatgc gtgattatca acaaatttgc caacagctaa aatttttctc
   127621 atgtagcaga atatagatac cttttttcgc taacgttatt tccagaacaa aaagataata
   127681 tcgtgagaag ttcacgaaca ctccatatag tcaaaaattt aaatctcata ataagtagtg
   127741 gtggtatcga ataaaaaaat agtgagagga gaaagtatac gatgtctata cgctaatgaa
   127801 gagaatgtaa ttggtatata atgacaacat aagtgatagg ttatgaaatg taatcatcgt
   127861 gcgtcctgtg tttcttgcga gatggaacac acaacagtag ataggcgttt ggctagccga
   127921 gtaattccta ttagattttt cttctcgcct tgttgttgta ggctttggca gattgtgttt
   127981 ttgaggaaag aatgccgttg gtatgtgtat aagatgcgat ctgtcagtaa tggagaccaa
   128041 taattcgcta cacccagctg ttattcatag ttcttgttac ggaagcttgt gtttcaatat
   128101 cgtaagaaag gcctatcgca aggacagaac agttacagta aatttaattt cctaagataa
   128161 gtactaaagt cctacgggtc ttgatttatc ctactgttca gaacaacatt agatcggaag
   128221 aaacaaacta ctaaagtaaa ttatgtgtac tgaatatgtt ttaaaattaa gaacgctgca
   128281 ttaacgtgga aattgtaacc ttaatgtcta accgtgatct tacgttaaag attctctaat
   128341 tacgaccatg aaaaaataaa aattaggctt atccatctat ctaccctagg aattaaactg
   128401 atctacctat gtattcttta agctatgact tatcactatg tagagtgcct tatcatctat
   128461 gtctatgtgt ctctagatct ctacgtgttt ctatatctat gatgtcctat gtcctatacc
   128521 ttatgttcta tgtcctatcg atctatatac acgctggctt gtctaacgct tggcggttac
   128581 ggtttacagt tcatcacgga ccagccgtga ggtacgagaa gcgtggtggt tgcacaaata
   128641 gctctagcgc ggtatgcttg ctggcttgtt tgctggtgtc tgtggcaaac gggtcgtgac
   128701 gatgatgatg tcggacgcgt acgcgcgtct tctagtcgct atgttactct gtttttagga
   128761 taattgaaat gtgatgcttc tttaacgtga tgcttagact atgtctgaga agagaaccgg
   128821 gaatgccata gacttttttc ctagtcggcc actctcatca agtagcagtt ttttatcgat
   128881 cggtgcttct tctttcgcac gttcggttaa gtaacaagtc tggctttcgt cgggggtaca
   128941 tcctctgtaa aaattatcag tggtaacaag atatatattt ctgtatgaag aagattacgt
   129001 ttttgctgct aacaaaagaa tctagaataa tcagaatcgc ttctgcgtca aagcaataat
   129061 gcatctttct gaaggatttg ccatccccga tagggggatc tgtagccttt gatatatgct
   129121 cattcatgta catccatttt gtagttaact ttgagtagtg tcctttatat gcgaataata
   129181 ttggtaattc caagagaaat cataggggaa gaatgatgat gatgatgatg atcattgaga
   129241 catctcgccg aatgcatgtc gtcgatcgtt agttagtatt atcgtcgaga attgtactca
   129301 aggtgacgct tagtatctat caatcatgaa aatgcagaaa gagtagtgca actgctaatc
   129361 aggtatagtt ttctttaaaa aaaagctgaa aggaatctct gaaggtgctt cgatatcttc
   129421 tctttgtata caccagaatc aatcaatcca agcgttgtgt cttctatgcg tgtggcatga
   129481 gtagtattct aacatttgaa aagatacgtg caactaaatg tagatcttca aaccagctaa
   129541 gatgctgaga tagactttcc aaagtaagat tagcattacc tgtggcgtaa cctctatcgt
   129601 tgcggtgtat ttatttgcta tttgctattg gtttttgcac atatagtctt aagtttatat
   129661 cttattctct gtttaacctc gcctgacctg ggagagctaa ggtagtatcg tataggggaa
   129721 caaagctaat gagcgaacta atgcttactc aagaaaattt aatgaaaaaa gttgctggca
   129781 acatgtgcca ttgtcgggtc atgctgaaaa gactaaccta cctgtttttc cgtggtttcg
   129841 caattatccg tctataaaag ccggggtcgc ggttgaggga gacagttgcg gcgttcacgg
   129901 gtgacatgtc tgcgctgcgt agttattgcc ttctgtggtg tcttgtggtg atcagctcgt
   129961 cgaaaatcag gaagaaggtg gattgtagtt ttcgtaccgg ccctttctca ggaatgttgc
   130021 aaagtttgcg tcatgattat tccaaagtta agacggttct ggtaagtgga tcttcatcgg
   130081 tagctgtgaa atgaatggtg ttggagaggt ttcgaaactt gagtccggtt tttttttgtg
   130141 tgtgtagcac gatcatgaca cggttcatac gacttctttg ctgactggag atctgctcga
   130201 tgaaatgttg ggacctcgag gttgtcaaac cacggttcag ttaatggaaa aatatctcag
   130261 cgaatggctt ccgaaggcag atcgattgta tctctacgat aaccagacga ttcggacgtt
   130321 ggatcgcctg ggaggcactt tgaacggctt gatgaaagat atggttcaat gtgtaagttg
   130381 acagttgaag attccgtgct agaagtcaga atgcctacct cacgttgtct gatattatat
   130441 tttcggtttc gtagccgatg ttaatatgtg gcgcgccgtc ttcagccatg atgggtctgc
   130501 agagccgtga aaataaggtg aggcgggtaa caatatggga gtcgtcaggg gggtcgactt
   130561 gggcatctta cctgaatctc ggttttcttc tagttacctg gcaacgccgg tgtgtacaaa
   130621 ggtctggctg aaatcgatct tctcggtaat tatttggagc tgtatatgtc gaaattcagg
   130681 cggtagcact tcactggcct tgaaaatcgg cgatgtctct tttcttcgtg ttttaataaa
   130741 cgtattgttt aacattgtaa tgacgtgacg tcgtttgttc ctgggcgggt tttgggagaa
   130801 ctagtgtata aataggcagc gtcttcagac gttggatctt ggtggagttg tcaacctgaa
   130861 gattgctgga gcggtgagaa gttcagcggc gaagatggaa gccgaccaag cgacttccat
   130921 acgaaaatat atcaccttta acagtccgaa ccgaattttg catcagaatg tcagccaggt
   130981 gatggacgtg cgtcaattca tttttgaaag cgctaagatc gtcgattgtg tcaacggtga
   131041 gggtcacgtc tcgacgctgg gtaaaggttg gctgtgcgct accatggtgc agactggtga
   131101 gtcgagctca tcgtcgaaga gtcagcaggg attcatgtcg attgatatca cggaagacaa
   131161 tgtgttacgg gacagcttgt ttctccgcgg tggagtcgtt tttaataagt ctgtgtcctc
   131221 tgtggtggga agcggcgagg ctggtccggc gttgttgacg atgatttcag agtccggcag
   131281 tcttcaattg acttatgtaa gacattttac taacagaccg gcgaccttgc cggtcgaaca
   131341 acatgtcgag cgaaggtcgg ttgaagaaga acgacggaaa aaaccatcat ctagcagcac
   131401 tgtcgatgct aatggctttg ctcttcggga tcctcggtta ttgaatcgtt cgaaggagag
   131461 aaaaagagag agtgagggag gtaagtgacg ggtcatatgg ttcgagttga atccgttcat
   131521 ccgtataggt agcatgttag taatttcgtg cggtgtcttt gtccaggttc tcctcgagga
   131581 gataaacggc aaaagacaca tcacgaatct agaaatgagt ctgaagcgag accgcctcca
   131641 gagcccggaa cggatgccgt ggcattttta aattatacca acgctgcgtt ggcggatgct
   131701 gtcgacggtg cgttatcatc ttcgatgaac gttgatgtac cgggggatag tggtgagact
   131761 cgatcttcga ttgtcgaaaa tcgagccacc gaagatatgg gcgacagtgg gttaggggaa
   131821 gcggcagaga cacggaatag tgatgatggt ggtgtggaag gctcctctaa ccccgttcct
   131881 cctccgaatt cgcaggatct cgtgcctcac agtccacgtt ttgatgacat cataaagtcg
   131941 ctaaaaaagc tgttcagcga ttgtaaagac aaaagacttt gccccaccgt ggcccgactc
   132001 cccttagatt tcaaaccttc agattcagat gatgaggtgc ctgggacttc atcagctacg
   132061 gccccgacac caccaccctc tcgcccctca cgtcccgttt gcgagataaa gccttctgtt
   132121 agaccggtgg aagaaagaat cgagcgatca gatcgtcgcg gtcgtggtcg gagcaccaga
   132181 agcggcaaca acagaactcg acaaccccgg aggcccaggc gccgagatcg agaacctgac
   132241 ttgacttgga ggccaccctc ttttttggaa gatggactgg aaattgttga tgaagatgag
   132301 gccgcgattg ctgccgctgc tattgaaggg ttgatgtaaa taaataaacg agaccattta
   132361 ttcttgtatt cttgtattaa taaacaaatc tataagttcc aatctatggt gtgttgaccg
   132421 tgttcttgaa gatagttgtt agtcagggta aagtgatcgt tacctacaaa agacttctgg
   132481 gtgttgcgcg gagagggatg gcaggacttt aacactagat gcttagtctt atcgattaag
   132541 tactcgcggg tttgggcttc agctccccag agcataaaga ccaaatgctc tctagtttct
   132601 gaaagttgac ggattattct ttcgctgagt tgttgccagc ctaaatgacg gtgggatcct
   132661 ggcttattgc gcaccacggt gaacacggta ttcagtagta gaacgccttg tcggcaccag
   132721 gcgtccaaac agccgtggtt cgggggttgg aaattcatga tggttcgaga gagttctcga
   132781 aatacgttga ttaaggaggc tggggtctgg cgcccgggga aagtaccgaa agccacgccg
   132841 ctggcactac cgtcgtgata cgggtcctgt cctacaatga taacgcgtac cgattggggt
   132901 tcgttcaagt gactccaacg gtggacgtgt tcaggtgcgg gataaatggt ctcagtctgt
   132961 ctggctaggc ggacggtgtc taccacactt ttaaggagcg ctgtctcgtg ttcaaaaaga
   133021 tctagaaaag tgatccaaga gggatggatg ccaaataatc ttgattgttc gtcaggactt
   133081 aacgatgacg gctggttgtc cggtatatgt ttgagcatcc actgcttgag tgccatgact
   133141 tctaaagaac agtacgtttt tcttcgggag gagtttgtac tcggcgtcga ggtcttggta
   133201 atacttctcc aagcgagcga ttaaagggct ttggagctcg ttttgagtga aaaaaccttt
   133261 aataacattc cagatggcat aaaataatcc tattccggtt ttaggaatgg gaattcggat
   133321 agggcggccc attttgctat cttcgtttct agctcctagc aaaaccgcga atttgaaatg
   133381 aggtagaagt tcaaagccta gaacgttctc ggtaaaaatt gtgttgacgt acgttagttt
   133441 tgtcaaatcg taagcacggc agacatctgc ataacaagtg taaattgccg cttcttgacc
   133501 acaaacaccg taaccactca tcgctttcat ccaggccgga gctgtatctg aacggagtat
   133561 ggccaagagg atgcggagtt gcttggtgtt attatgtaac aatgccagat gatcgataaa
   133621 agtatcgtcg ataggaattt ttgaggtgat cgttgtaata ccgctatgat tgtaccggat
   133681 gagttgagag agcatggcgt cgtcactagg tggcttaacc agtggttccg acgtaccgtt
   133741 ttgagtaccg tttaagacgc tatcgcccgc aacacattga cgaacgagag tgacgcaggt
   133801 ttcattatcg gcactagcta aggttagaag aacggaaaat aagaacagca ttaggagata
   133861 ggtctattgt ttacaggata ttgtctgtac cggttgagat gagcgttgat gtctaaagtc
   133921 acctcgtcta gatggagcag cttatataat gtagtcatga agaatgagct ggcataagga
   133981 ttggtggaaa aggtggtgtt gtcgacgtgg aaaacagcta ctccgtcttc acaagatgta
   134041 gggctaaaag tcacactgtc tactgattgc catgaaaaat tacgtggtgt gaaaacgcag
   134101 ctgatgttgt cagttagatt tcgtgtacac tcggtggcga tatacagtgg atgagtatta
   134161 cgctgagttt cttcatctcc actgccgatt tcgtcttctg aagtataata aagattttct
   134221 gaaacacgaa ggcagtcgtc tggtggtgac acagtgctaa atgattcgat ggtgttttca
   134281 gtcgtatttg tcagaaccgt ggtgctcatg gtggtgttag ttggaaccct ggtgctgtta
   134341 acagtgacgt ttgtggtgcc gctggaaccg gtggtatttg tagatacact tatggactcg
   134401 gtggttgcag aaacagtggt cgacgtcacc gtggtcgaat ttgatgtggt ggtaggtgta
   134461 cttgtggtcg tagttatggt agaggatgtt gacgtcatgg gggcggagag tgtggtcata
   134521 ttggaggatg ttttgccggt gctggaagca gtagtagtgg tcatgggtgt ggaagcgtgg
   134581 gttgaactag agttagtacc agtgttgcta cttctaattt cgctgacgct actagtgctc
   134641 gtggtattgg cggagatgtg ggtcgtggca gtagcggtgc tagcgaacgc tccatgagcg
   134701 acgcagagta gcagaatgaa tgacctcata ccgcagaagt gtttgtgaat tcgctatatg
   134761 ttgacagatg aaagctggcc agtgaagggt aagacagttt tatgatgtta acattaaata
   134821 tgttcggata ttgatcaatt accgatagac atagagtcat agcatccatt aaatctttct
   134881 tagtagcgcc tgatatatac agttggtgaa gaccgctgtc agcgtagcac gcggatcgtg
   134941 gaaccacatc ggtcacatta cggagtaggt ccccgcggtc ttcgtggcgt ttgaaattcg
   135001 aaatagtttg cgaatcgtga ggcagacatt gagaagctat ctgcatacct gccagtatgg
   135061 tgaggttatg cagttttaca atggcagatt ttagatactg aaaagagtta ccacatgatg
   135121 cgttgacttg tatctgtacg tgggtcgagt cgtgtgtctg tagaagtttt ccaagttcct
   135181 caaaaacatg tccgtatttt gagaccatgg ggtggggttg cgggaggcgc cgtcttcgaa
   135241 ttagtgaggt gccatatgga taattcgaag tatcgtttcg cggacgtggc ggggacttct
   135301 gaacgggagt agcgggcgtc gcgatgattt tgaccatact gacatttttg tcgtcgggcg
   135361 gaatttttac gaaaccgttt ttaggtgaga tcaccatagt acgatgtctt ttccttttat
   135421 tggctggagt gagggataat tgaataggtt cattgacgcg gacgatctcg agtttagaaa
   135481 acataccgaa gatatgtgat tttaaacttt aattcctact tttttaacac atgggtcagg
   135541 tttttcctct gataaaagcc tgtggtactt tatgaggggg aggtagtaga gacatctgta
   135601 gatgacgtaa gataacaacg taagcattaa tgtgaacagc agggtgaccg tatatataag
   135661 cgcgacataa gccgcgtcgt cttcagccca gactagcgta tatgttaccg tgtaattaaa
   135721 attggaggat gtcgctttca acgtgacatg tttcacggtg tggttgaaga ggaaacagaa
   135781 ttccttgcct tccgttcggt tggagtctcc gcagaaacac ggttgcatgg tctggtcgcc
   135841 taccagaagt gtgacagtga agttcacatc aggaatcatg aggacgtgga aggtgtaatt
   135901 ctcctgcgtt cccttgatgt atgtgctcaa gactggagag ccgtggaaga tccacttcga
   135961 agtgatgttg cgatttaccg cgataaagtc gcattcgtac atcgtggtgt ggtgggcgtg
   136021 agagttcaga tgtagggcct gttccgtgtt gttgtagaag atctgtacgt ctagagagat
   136081 caatgaaaac agtcatgtgt ggtatgttga tggtagcggg ttttgcttac cagacttgta
   136141 aaccagatga gtatacgact tctgttggta gctgctgtcc tgtctgtcaa tctgggtata
   136201 tggccacgtc tgaatgcagc gagtatacag gcacggtgtg tacaccgtgt cgtgtctgca
   136261 acggatctgg aatgacgact atccaaaatt gttctgtcac tcagaatgcg atatgcatgt
   136321 gcatggacgg ctacaattgc tctaaagagg ttaacaatag ttgtgtagag tgtttgagat
   136381 cattagagac aagcggttca gatattaatc acgatcagaa taatgacatg agtttctcgt
   136441 cattggaaat ccagtacttc gcgataccgt taattttgct aatgtcctta atgatactta
   136501 tcattgctgt tattttcaga tatagaaatg ttctcagatt aatgattctc acttacctgg
   136561 atcggtcgcg tttccaccct tgacatcgac tcttccgacc atgcgacgac catcgtgggt
   136621 agacacgttc tttttaaaac attcaatcgc catcagatcc ggtgcgtcca ggctatggtt
   136681 atagttgact ttacatgtgc tgttcatcac atgcttttca taatcgtgat gttgatgaca
   136741 agaaacggaa aagttgctgt gagccaggct caaaggcaag atgcatagta gcagaatgca
   136801 ggaacgcatt ttgcccgctg ccagtagaac gaagacagac agcttttatg aaggaaagtg
   136861 gcgacgtcat agactgggac ggacagttgt tgagcacact agtctgtagg tcatttcccc
   136921 tggaacttac gttaataata aagatgctgt cggatgttga ctcttagcta ctgaagtgac
   136981 gttcaatctt aacgtgtcgt ggttctaaga gctccattac gtggatagcg tcacgctgct
   137041 gcctctttat acgatcttcc gtaaaaccct tttaacatac cgatcgccac gatgctgagg
   137101 gtaaagataa tacccgttag ataaagattg aggatgttga gatctagttg acagatcggt
   137161 gcggcacgga agttttgggg gcgtgctatg caaagagatt cgtttctaaa atgatggtgc
   137221 tcagtcaatc gaacattaaa agtaatgtta tgcttgggag ggagagtttc taacctactt
   137281 tggtattctg agttttggct gtgaagatag attgtgacct gtttggtgac aaattccgtc
   137341 tgatgaagtg ataagggaaa gtggtcttgg tctatgttcc aatacacgga cgctacgtgc
   137401 ggtttcacgt ctgatttaca tgttactcgt acatctccat tagggagttg gcagatgtgc
   137461 ataaccgtac cccacactcc cgaaaaccat gacgctgtaa caaaaaagac taggagacgc
   137521 attgttctac aacgtgtatt tattgaggat agtataatac actatgaatc aacagtgatg
   137581 tagactgaag gggggaagct atttacattc agtgcatgaa ctcagttttg tattctgatc
   137641 atttattcta ggtcttcaat agctttttga actgcctgat tcaaggtgtc catatcatca
   137701 ttaccagttt ggaactggcc cactacatat gcagaagaac agtcatcata gatgggtagc
   137761 atgttttccc ccttgtttaa atcagcggtt ctgatacaga cctgtctggg gtacttgtga
   137821 agaagcggta agcaaacttt gatggcctga aggtaatcag cgggtgtggc tgcatggacc
   137881 atgatggttc tgtagtcaga agacctgggg cataactggt gagtgtggtc ctctttcaga
   137941 tcccaaacac ctttgactcc atcctcacag gcctttgaca cgttacggac ggtactagga
   138001 gaatgaacca tgggtgcggt atgttcaagg gtaaagggtg atgaaatgct caggttgcat
   138061 atcataccaa gttgtgctcg gacgtcttcg attgctgatt tcacgttgta tgttctggtg
   138121 tagtgaatca taaacatggc cctggtggtg ttcatggtct tgcatttagc gatagcgctc
   138181 tcgaggacct cgttcatcgg tgtaggttta aaaggtaaat ttttatactc caatgacctg
   138241 gtggtcgctc taaacattct agagatatct gacatcttca ctctacctct tttcgcggga
   138301 cccgttggtt tgtcgaatgc catcctggtt tttaggatgc ttcgcacttt tgctggttca
   138361 aatgaaggtt gttgtttttt gccgggtctc tttttcttgg tcgcaggtgg tgcagtcggg
   138421 gagtttttgg actctgaggt atcagaatct gattctgaag agctggatga cgaagatgat
   138481 gacgtgcacg gtgattgagg cttaccaact acaagacttt ctgagtgaca ctccacactc
   138541 tctgtacaga caggagcgtt aacatctcca ctatcttcat gctcttcatc agagtcggag
   138601 atcacgatac aagatgaggt gggtgtagtg atgggttgtg ggttgtattc taccttcata
   138661 ggtagccatt cagggggcat tttcataggg gtagattttc taggtctttt tctgggtgac
   138721 tgatcctccg gaaatggagg tgatggagtg taaggggcat ctggggaagg ggtggaatga
   138781 atggggttga tgattgagga tgatgatttg atgataccag gtgtgttagt ggaggaagag
   138841 tctaagatac ccgccattga tgccgcttct gccagaatgt caatgcctcc taataaatga
   138901 tacaaaacag gattgatttt gtaaatgctg tttattgaca gagtatagag tataacatag
   138961 agtataagtc atcaacaata ttgattacat gatatgctca acaatattga ttacatgata
   139021 tgctgattat atgattagcc tgactgacat taaaggctgg cttaacattg cttgcttctg
   139081 gtgaccatag gatggatgtt acggggtttg ccctcatctt caggttcttt cttctcctca
   139141 agggtcttct cttcaggact ttcaggggtc tcactcttaa gttcctcctc ccttttaacc
   139201 tcttcctcat catctgattc tcccgcccca tgaaccacta cggtttccat acgcactggg
   139261 gtctctacat cacctgctat cactctgtaa gtatcaacat ctggtctgcg tctgtggtga
   139321 attacaccac aagtgattgc agctaggcag ctattggaga tccttctgag cttagtctcc
   139381 atatctatca gctcctggtc cagattaaag ttattttgct tagcatttat gactttaaca
   139441 gtctcctcca aaatatagag acagagtgtt ttcaacatct cctgtgactg agtgatgata
   139501 tcataggctt tcatcagcaa gctatctaag ataactttag attcatcatt tacattctta
   139561 gcagtttcat cagtgacttt gacagccaca gcatctagtt gggggaaaat ggtttcttgt
   139621 tcagatttca gagtctcaat tagaatctta gcgttttctg tgaccaagtc tttgggtaag
   139681 tattcggaat tagtcagcaa agacacggcc tgactctgag tttctgtaat tctgggcata
   139741 cacagagttt tcatcatcat ttcaatatgc ttcaggaaaa caaatttgca cttatcctct
   139801 ggtccttcaa ctagttgttg aaccttaatc tttgctgcct taatgcatct ctccatatgc
   139861 aaccctgcta cattacaagt ttgggccagg aatgattccc atatctcctg catgccgggt
   139921 gtgatcacat atctgtcttt caaaaggtaa cacattctag taagattatc tggttcagca
   139981 ctcaactgct ctacagtttc attaactaac ttcattcctt tcttgagtgc atcccaaata
   140041 tcatctgcat tctttataat gactctttta gactcattgt atcttgagat gttctgctct
   140101 cccaattctt gacgagagat gtgtagttgc agctttaatt gttctagaat gcagggaaca
   140161 tactataagt acatatcaga taaaaaaaat aatgtgaagt acatatgtga tgagatacac
   140221 ttaccaaggc attctttaaa tggatcatca tctgtgttgt ctgcaacagg aaagagaggg
   140281 tctccaagag acagttgtgt tttgacctct tcattaaggg ttttctggat aaatcttctg
   140341 gcaatcgtca ccggatcctc aggctggctg taataaaaaa ggaagctctt tagatgtgtg
   140401 ctgattaagg ctatacagat gtcacctgaa cccaacaaca aaaataaaaa acttacaata
   140461 tcttaggttg tttgggtgga gatggtcctg aagaagttcc ttctcctggg tcgtcgtcat
   140521 catgtggtct cttaggtggt gggttagcag ccatcttggt agctgtaatg agatatggtc
   140581 tgttttacag gtggcaatgt cacagaatgt tcatgtatgg aagtctcatg atcatctcac
   140641 atgccatcaa tgtgatggga aataccagta agtgaagatt agaccaaaga cacagacaca
   140701 tttagtgatc caaaaataga tattaagact aatgtctatt tccagatcat tcagctgtga
   140761 atactacaag tgtgactctt accttcagtg aatctactac atcagaagac tctggaagga
   140821 cttattcatc tacccacaga tggatgcgcc cattgagcac tctgggtgct ttattgggaa
   140881 tgttcggact ggtattcgtg gtgttgatgt gtagtttttg ttctactgat aagaatttgg
   140941 aagatgtcgt gcaagagatc gtggagacaa cggaccggca gacaagagac accgccgtca
   141001 ttgttatgcc agaatgtgag acaaaaaagc agatgaaaat ctttgtatgt acagattctt
   141061 cctgtaaata aaacaatcta actcagtctc tgaatataaa caaagttttt ggcaaaatgc
   141121 caaaattggc acgttgccag cggcatggtc tggtgccaaa ggttcaaacc atgtgattgg
   141181 caaacggcca aatagagaag gtgattggcg ttggcaagcg gccaggatag cgtgtcttgg
   141241 catgcagcct attgtgagat gtgtgttgtg aggtgtcacc agatgtcaac catcacctga
   141301 atgtatatac attgatgacg ctaagttaac catttgttaa atcaagagat acattataat
   141361 taccagggtg tgtgccaaga tagagatcaa cactacatat ggcagcaatg tacataataa
   141421 aggcatatgg aacatcaata tatataagaa ggcaatatag gccatcagta tatacgttgt
   141481 ccacgtcatc aaggtatata atggcggcca gccccatagg ggggaagata tggccccata
   141541 tatatattat ataatatata ccgccaccag ccaccaatca gcatgcaggc tataccatcc
   141601 ggactcctta ccttgacttg gcaggctctg gccgcttttc agtgaaggtt tctcggctac
   141661 gatgggctgg ataggtcccg gtagtagctc tggaggacgt gtagccttca cggtgtctgg
   141721 atgaagaatg gcggtctgct aaacgggagc ttcttatata ctctaaggca acagggaacc
   141781 tcccattgcc cgcccagtta cgccttcgga acgccccgta acgcccacag taccgccccg
   141841 ttacgcccct tttggctcat atgcctgtta tgtaacttgg aaagtccctg ttattttggt
   141901 gccaaaaaca ttgagtaatc cggaaagtcc cacggtattg ttgccaggaa tgggtggtct
   141961 ttatgactca atgttcttgg cagtactcca ttgacgtcaa tcagcatgtg ccaagaacat
   142021 tgagtcatag ggaccacctt attttatgtg ccaagtctgg gtgggaacca ggaaatacct
   142081 taattgaccc cgtgttctgt gccaataacg gatataaaac cgtgccaagt acattgagtc
   142141 atatggaaag tccctagttg tttatgccaa atagggtcat gagaacacgg aagtactcta
   142201 agtgacctta tgttcttggc acggtgtata ttgagtcata tggaaagtcc ctatgtgcca
   142261 agaacatagg gtcacttggg ggtatgagaa cacggaaata ccctatttga cccgatatta
   142321 tgtaccaata taattatcga tcactaatca aagaccctcc ccattaataa attaactcta
   142381 tatatgccat atattgatac ttatgaatgg aaagagttaa atcattaaaa gcagtatata
   142441 attgatatat ttattgtgat tggtgataat taaatgtata tatagtattg atctatactg
   142501 gcttagagcc aaggtatagc tgatacattg atccctgctg acctagggcc aagatatagc
   142561 tgatatattg atccctactg gcttagagcc aaaatatagc tgatatattg atccctgctg
   142621 gcctagggcc aagatatagt tgatatattg atccctactg gcttagagcc aagatatagc
   142681 tgatatattg atccctactg acttagagcc aagatatagc tgatatattg atccctgctg
   142741 gcctatggcc aaggtatagc tgatacattg atccctgctg gcctagggcc aaggtatagc
   142801 tgatatattg atccctgctg gcctatggcc aaggtatagc tgatacattg atccctgctg
   142861 gcctagggcc aaggtatagc tgatatattg atccctgctg gcctatggcc aaggtatagc
   142921 tgatacattg atccctgctg gtctagggcc aaggtatagc tgatacattg aaccctgctg
   142981 gcctagggcc aaggtatagc tgatacattg atctatgttg gcatgagcca ttgtatcgct
   143041 gatagttggc atggtgccaa gtgtcagcga caatggcgac agtccacgac agtgacgata
   143101 gtccgcgata gtggcgacag tccacgacat tggcgatagt ccgcgatagt ggcgatagac
   143161 cgcgatagtg gcgatagtcc gcgataatct gcgatatgtt ccctactata aagtttgcat
   143221 agtgaaactt agttttcaat ttaaccaggt tttattacac gccattttgg tgtccatcgt
   143281 cttgctcgtg ctgttgtatg tattgtttaa cataatcaaa tatgtatcta agtctaatat
   143341 cttaacgtga taggacggag tcatccaggt agtttccagt cgatcgacca atcctatcat
   143401 tctgcctggt gtatcatcga agtcagtata tagtgcgcag cgaagttctc ctacgttcat
   143461 gacatgggcc ctatatcgaa gcaagataca tcgttactac cagttatcag atagtatcgt
   143521 tgtttataga tagaaaattg tatgacttac gggttgtagt tgcagtatgg tacatgacga
   143581 tgaagagcaa atttggtaat gttctgtttg atagataaaa tgagattatt catcttactg
   143641 aagtttctag gtgacatgca aagtcgtcca acgcggcaga gaaacctgaa tggatggcag
   143701 attacattga atcaagaacg acttatcaca ctttctatgt gatttagaat gttttattaa
   143761 catacgtacg atattgtata cagatcacat ttcttgaagt catagcagtc ttccaattgt
   143821 tccctgagag caatgtgagt gcagcatgtt tccttatagg taatcgcgta acaagctgtt
   143881 gcgaaaacag tgaatatgaa aaagtaacgt cttcgtaaac gagacatgtt attttgttcg
   143941 cttgatagtt gagaaatatg gatgagtaca catcgtagag actacacctt gggtagaata
   144001 agcatgtctc agttcaattt taaattgaaa ctgtatatta ttctcacttt tcatcaggac
   144061 aactgtttga atatgaaata tacaatttgt ccatcttgaa ccgtctctaa ctctatagcc
   144121 taacgggatt tgtttagaaa ccggatgtgg aaaaatacgt ttagctaagg tcttttcatc
   144181 ctgacttaag gatagtgtca tgttgttaca ggcggatatg tttcggagca gacggaacat
   144241 cagcaggtcc tttccgctaa aaatcataaa gaatacatta gtaactgttg attgactggt
   144301 caagaaattc aacttgtata actaattgat acgtactcta tatatgcgat gacttgacga
   144361 gtccattttg agtcgttgac gattagagtt ttgttgttca gagtatgaag ggcaaacaat
   144421 ttttgtgtgc agttaatagc ggtatagtta gtgtaagaca cgaacaagtt ggcgtgcatc
   144481 aatggtaaag ggtggatagg gcatcctttg aaataaccgt ggactagatg gatccagaac
   144541 attaatccta tagtggtctt cattttaatc ccactgtatc tcaaaaattg ccgataatat
   144601 ttttttggct ggtgtaatga tagacgagcc agtaacgtta actttcgcgg tgctgtttag
   144661 ttgatatgtc ttattatatg gttctagccc aaatgcgttg gttagaagaa ttacttctgt
   144721 tatgttgatt ctgtcaatta aaaacagcgt tcagtcgcat gttatgataa ttaaaaaaac
   144781 ttctattacg ttacttactt ttgtataatt ctggggtctt cagttccgaa gtattgggag
   144841 gcaatattga aaattcgatg caaataattt tctcgctgtg tgtagttaat tataggagcg
   144901 gacttgtccc aatatcctat agcagtggat acgttacatg agacataaac gatctggacg
   144961 cacatgcaga ttaagagaaa acgacacgag ttcatcttgt cattgtaaaa agatttatta
   145021 tacataatca ctggagaatg tgctagtcat gttcaggatc tctcaatttc acttcttcca
   145081 aaatctttgt accgtacgaa gaagatgagt tttcatcgtc agctagatcg acatttatct
   145141 tgattggcag agtaacttcg tgggcccttt tgaaatcctc ataagttgac atgtagtacc
   145201 gtattgcgcc gttagcggcg tcgattaacg gttcgatctt tgctacacca gttgctgtcc
   145261 gtagctcttt tttctcagag tcgaaatgtt catagttctc gttgaagaga attacagtcg
   145321 gcgattcggg ttcgtggtca gaatcatcat cttttaagcg ttgatatttg gcagacataa
   145381 ctggggtaga gcgacttctc tgcggcactt tgattagatt agcgcattct tcatcgaatg
   145441 gattttcaga taagtctgga tcatagtctg atcgatttgt tcggcaagag ctgtataaag
   145501 ctgacgctgt tacaacgatc agtgttaaaa gtgaaaatgc tgtgacacag tagataataa
   145561 aaggtgctac tttcagaacc gcgtctatta atgatgttcc ggtgttgcag atcgtgccgt
   145621 tgacagccgc cgcagtcaca ttagtggcca tagttgtgtt cattctgact ctgccgtagc
   145681 ggtgtttatc agctgcatat gaatccacct acgcgtgacg acatgtattt ttgtgtcgtt
   145741 ttctaagaag attatgatat aaagatttct atctgttacg cggaagatac ttcatgaaca
   145801 caaacactag caatacgatg attaaggtta tccattcaca tgtagttaga tcgaagggag
   145861 ggtctgaatg actttctgcg gttttttgtt caacgtgagg aagcggcgtg ttaggttttt
   145921 gtaacggttg gcacgtggca tgttcatgtg ctcggtgatg gtcgatgaaa tgtagattgt
   145981 attccacatg aacggtctta gaattatcgg catcgataat tctgatttga aaagccacac
   146041 cgatagcgtt ttggacagcg ataatagtga catcaacacc gggtatgtct ccatgggcta
   146101 agtaaagacc gttatgttca ggacttttcc aaacgatggt gtagcgtttt tccggaggtg
   146161 atatagtaac gataaaagtt gccgtcaatt caggttgaag agtaacattg tacgtcataa
   146221 agtgagcatc catttcggtg cataggcatt gcaaagtagt gtcagttctt aatatcaggg
   146281 caaattgccc aatcatagat tctgtatgat aagaaccatc tttattcggt actgttttct
   146341 tcaacttgaa aaaaggtgta aagtaaccca cgttatctgg aataccaggc atttccaagg
   146401 taaggttgct atagtaagtt tctaaacggt catgacaatc tgtagtatgg gtgatgagtg
   146461 gatgattgtt tttgccccat gcgagttcaa cgattttgtt tggtaagcaa gttgctgcgg
   146521 cacataagga ttccttttta tccggtattg cgcattcctc atcctccttg attccaagga
   146581 tccacagatt aacacaatta tctaaaggtc ctgttctaca agccatccaa ccgacttttc
   146641 tgactacata atcgcgaact gaaatgttca tgtgaaaaag agcgtgaccg cccgtataaa
   146701 cataatcaac tttcaccgta tcagcgtagc tgttgataat ttgtttagaa atcagatata
   146761 acagaacgat tcttacgaga agcttctgat gtgaagttat tacagtcagt agtagcatct
   146821 tactcgatgt ccaaaaaagg tatccactgg taaaatgtta gcttttatat gatggaaggt
   146881 cgactagaag atcttaagta tcttctaagg gttttgcttc agttcaaagg tgtctcacga
   146941 agccttaata acacgatgtt gttccatcag aagctgaaca cggaatgggt gttttaatgt
   147001 tcatatcagt gtgtagcatt ggagaacatt ttcaaatgta ctctgagagt agatgatgac
   147061 agagaaacgt aagatttttc tgttttatgt ggttcacgac tctctgatcg taagcatcta
   147121 tgtaaaaaca caatttatct tcttctattc tcacgatcag tgttgatgtt agttctcgat
   147181 ctcgaatctg tctattgatt ccgtaagcca tattgttcca agacatggta taacttatca
   147241 ccacgtgaag tgttaagtat caacaggatt ctatggcaag tttgaaggac gaggtcttta
   147301 aaacaatacg ttggaaatgc tccgtaggta taacagttac tttgtgtgac ataacggttc
   147361 cgaactgatg gtaacgtgat aaattaaata ggtctgctgt gtagcagacg gtctgtactt
   147421 cggaccccga tggagactca cgtagaagaa aagttccaga tgaccatttc taacaaatat
   147481 ctgaacagcg tgaagataaa ttgtgaggtt gatgttttgt agaagctgca taacaaatgt
   147541 ttttagaaca ccacatgaac ttttaagcat cagacgagta aatcttctat tcttcacggt
   147601 cgtactcggt ccaaacggta agacgaggtg ctccggcttc aagctaactt tatatcgtag
   147661 tattctaggg cgtgtcgcgt gatgtaagct tgaggaaact ggtgttgaag ggtaaacgtt
   147721 aggtcctgtt tttgtcatag atcaaatcca aaactgaaac tgtggaaaac catacagaat
   147781 tgcttgtgat gacatttgaa ataaaacgca acaagctaaa agtgagtata aaattttatt
   147841 aacatatgtc gtttacaaag cgggtgctta ccgggctaga aaaactgcgt tcgactaaca
   147901 attataataa aaaagataca taataacaag caaatccatt cacagatgga agcaaacaca
   147961 gtccagagaa aaggccatgt ataatctcga gactttatgt ttggcgagca tgttctagat
   148021 ttacattttg cccgacatct aatcattaga tttgcggctt ccacattttt cttgaaaagt
   148081 ttataagtca acacggcaac tgtcggtgtt tcgatgggat gtgtaaccgt gatgtccaaa
   148141 actatgtggt ttccagaatt tctggctaga agatcaatcc taacgtcgcg ttgataatat
   148201 gttttgttct gccgatgttt aagagctgtc cattctacct gatgattacc ataggctgtg
   148261 gtgtttaatt gtaggcgtat tttaagtctt ttggataagg tgatatttgc agttgttaca
   148321 tttccaagaa acccgttgac gcggcaggta ccttctccaa aggtgctcag gaacactgga
   148381 aatgatttgt aaatagtttt aaacggcact tggtcatctt taaaatctgt attttgaatg
   148441 ataccgtaga gtgtattaaa tccgatggtg gttggagacg ctgggaaatg aagatggaga
   148501 tgagatctga tatttttctg atgtgggaga gaggcatctg gattgacgta aagtgataag
   148561 gttgcctttt ctgagccgag tctagattta atctcggtac tcttcaatcg cgtttttacg
   148621 gcagggcatg ttgtttcaga tatattcctg agagatagtc cacgtgcgtc ctcactgacg
   148681 aatctttctt tcactgtgca gttttccatc gatacggcat tgcaacgtag ccatcccact
   148741 tcaaataaaa tctcttctgt taatacagtt agggaaaaat ctgcgtttcc tcctaagtca
   148801 tcaaggtagt aatgctgaaa ctgacattct gccgatataa tagttacgta acagagtagg
   148861 ttaaagctta caatgttaag aatgttcgct ttcagcattt taaggccgaa tggttgtccc
   148921 caattgtgtt ctgaacttaa cgttgttttt ataatatcgg tgtgacatca ctaagggcag
   148981 tcggaagatg taatggtgac gggagtggat agtacaatta atatgtgtcg ttatggtcga
   149041 cgtctgggta ggtcttttgt cttagttttt atcatgtata attttacagt aagtctatgg
   149101 tgtaacttga ctatccggtt tataattctt tcatttcaat cagtagttca gtaggttctc
   149161 ccaagacttc tgtcagatag cgtcttcttc gcttcttggg gcagaatagg gtttttattt
   149221 ggtatcggta tatatatatg actaccaaaa caattaaaat cgccaatagt aatcctatga
   149281 agtatcccga tgctttgttt cttctcgcag ccttgatgtt agggtttgaa tggtttttaa
   149341 aatcggtggt gaaagtcgtg actgaagtag tcaatgtggt tactttaaat gtgtttgcag
   149401 acgagttgat agcctgcgtg tttttcgtgc tgatttcggt agatgagttt gagctttttt
   149461 gatggctggt tgaagataac ggactagttg gggttgaatt cgataaaaca gtttgagaag
   149521 taaatgaaga tgaaatcaga gagttggtcg aagtagatgt gctgatagtt gtttccggta
   149581 tagttgtgtt ctggctcgcg gtagtgctga gtttcgtagt cacgtttgaa agtgaagatg
   149641 tggagatgag tatgcttgta gacataacat tggtagtatt cggtgaatta gttgccgtgg
   149701 atgtgttggt agtactcgat ggattagttg gcgtggatgt gttagtagta ttcggtgaat
   149761 tagttgtcgc ggatgtgtta gtagtattcg gtgaattaat tgtcgtggat gtgttggtag
   149821 tattcggtga attagttgtc gtggatgtgt tagtagtatt cggtgaatta gttgtcgtgg
   149881 atgtgttagt agtattcggt gaatttgttg gcgtggacgt gttggaagat gatgtactga
   149941 cagaagtggt cgtgggtgat gcaatggtag atgcgttagt cgtagtgatg actgtagtgc
   150001 ttgagtttga ctttgtaatt gaagatgttt ggatcgcagt tgtgaccaca gttgtggcgt
   150061 tagtctgttg acttgtagtt gaaatatctg tatttgaagt tgaattagtg gtcgggatta
   150121 cggtggtaat cgaaggtgtc gtcacggcgg tggtggaaac gacagatgag gagtatgaag
   150181 tgtcaggtgt gctagcacta agtgtagtag aagtagaatt tatttgcaaa ctagtaggtg
   150241 atagcgtagt attcgtagaa cctgatgaag ccgaagtggt ttgattagct tctgagatga
   150301 agcatgtgat tattaaacat acaaagacgc ctaatgctgt tttagatatt gaaatcataa
   150361 ccgagatatg acgttatcaa ataacgttgt tttagacgaa tatgttacgt gaattattcg
   150421 tatcagactg ttatttcgga ggttctttta aaatgacttg agaattttaa tgtaaggtca
   150481 gaaccttaac caggatgtgg tagtcagata tagatagtga tgacggctgc gacatgatta
   150541 ctgatgttaa cccggatatg atgtgtctga tgataaggtt ttgtagtgtc cattagattg
   150601 gaatctatac ataaaagaaa atgtcgtata tttagtagtt ttgaatatgt gattctacgt
   150661 gaagcgttgt agacgtcagg gatgacgtcg tttgatgaag atagtgtctc catcctttgt
   150721 cagtttgtgt ctcattttaa aaagttgagg ttcgagaatg tgatagttca gacagacttt
   150781 atggtggtta tccataactg cgatcgcctc tactttagga caaccagcag ttggcagatg
   150841 tctaattatg tattgtgact ttaatggtat ttttgtcatt aaattgccgg tacagcgaca
   150901 tcggagctct tgaatcgtgg ctgaagtaaa tgatacggta aaaataacgc atgagatagt
   150961 aatcaaacgt gtgaagctga tgttgttcat cacgatatgt aaatcgcaaa tagtttacag
   151021 cgcataggct gaggtatgga atagatttgt agacggttag atgattgtaa catcatgact
   151081 acgtggtttt cgtcgaggta atcgtgcagt atttagatct aaaacttttc ttctgagagg
   151141 tcttcgtctt cgtttagcta acatcagatt cttataaatt tcttgaatac cccaaccggg
   151201 gaaatcaacc ttcgtcttgt agacgtcaag aaccattttt ttttgtatat tgaccttcaa
   151261 catgagcata aataagagtc tttttatgta tactgcttct gggtcgatgc agactttggt
   151321 attgtttaat aacgtcgtta taacctgtcg gtttttacaa tgataattag catttattgg
   151381 ttgtatatat ttaatttgcg ttttaatgtg tgtaacattt tttataagat tgctagtacc
   151441 acagacgcat ctgttggcat ttttgtgagc cgaggtcgtc acgatcatta acacattcca
   151501 taaacataac agtttgaaat aaggtattga taccctcata tctttattat atccgtttat
   151561 ttatatatta ttaggagaat gaattattgt aatcaagtgt gaaacaggta tacattgata
   151621 agatacgtta ttatctttta aacgttttcg gtagtaagaa gtaacgtgta ctctttaacg
   151681 gatatacgca gcaactggga tcttttctga gcaactgcca ttgcaaaaca gttagtaaga
   151741 cccatattag caacagagtt cctgtatcaa tccataccca gatgtgaata aaagcaatcc
   151801 gctgctggat tgaatttgac gttgcgtttt gtgaaggaag aagtggaagt acaggtagtt
   151861 ttttcacggg gttcaatctc ttcatgatgt acgtttctaa acattctggt acttgtccgc
   151921 tacggtcttc gattggtggg atccatgtgt tacctaaagc gtctccacat acacggttct
   151981 tattgattga taagaaccca caacttgccg ccatgatggt cgatgtagag tttttacata
   152041 tctggtctgg tctgccgtac gggtaacatg ccaggggtcc cttgttagaa tatgagtatt
   152101 ttttccatgt gaatatagca taccttatat cgtttgaaga ggctatataa taatctgata
   152161 tcatcgtttc aacttggata aattcatcag gagggttctc gtaataacag gtatatagac
   152221 cggtcaagtt gtcattcatc ttgaattgta atgtgatggt cgtatagtta ctacgagttg
   152281 ttttgaatac ttcgatgcct ttagctgcga atgtcgtctt acgcattaca aatcctgttt
   152341 cgttactgta tttatagtat aagatgcgat acagccgtat tccgaattca ggatctttat
   152401 acagtcgcaa tgcgaatgtg aagataaagt tttcagtatc aggaaataga caggatattg
   152461 atacattctg accggtttgg aggtatctac ttttcacgtt attgttgtaa gcacagagtc
   152521 tagagatgtt gttgctcgtg gagcctgctg tcaaggtgaa tattataaaa ctaaataaca
   152581 aacacgtagt gaaacaagtc atgctgacca cggagtggtc tgaagttata gatcttttta
   152641 tattattcac gatggatttc tgatgacgta ctacatgagg atgtttcggg aaacgtgcaa
   152701 atatatacgc gatcgtcggg gaacgtttcg gcgacgatcc aagctcccgg tatccattct
   152761 gaacctttta atttagctcg ggtcttctcg ggaatcaagc ctttgtgaaa agcggcaaaa
   152821 gcaccctcac gttctagcag gataaagcag ttgtcgctgc ctgcgactag tgtggcgctt
   152881 agacttgagt cttgaatcag ggagacgtgg tcgatgagtc gttcccaacg accgggtccg
   152941 tctctcgggc gcttgcaaag gaggtcggta gtgttgtgtg gtaaaaggcg tcttcttgta
   153001 gtcatgacgc tgtgaggcgg tcaggttagc gttgtgatgt atatttgtct tataccgcgt
   153061 ttttttcttc ggaggggaaa tgtgtaatta ttctcacgta ggtggttttt tcggtgtgga
   153121 cgacgatgaa ggtgatctgc ggagtgtaga ggcaacgtcg ccagtacgcg cgaaccgcgt
   153181 tttcaggtgt aggttgcaga cacattgtta acaggtgtat cttctttggg gtaatcgttt
   153241 ttttaacgta tgtgtcatgt gtagattaaa taggactgtg ccaagtggtg acgtcagttc
   153301 cctagaaagg catctattcg agtaggcggt caagcagcag tcacagttac ggtttgctgg
   153361 cacataaaag tagagcgtta aagagaagga gctggtgtca gcggtgatca tgtggttgct
   153421 cttgctcctc agcattttga ctgttggtgt aactaccgat gctaagcaac atgatgcttg
   153481 gccgggtctt attcttgact ggttggaagc ttggttaggg tggatacaat cggcttctgt
   153541 cagcgtttcc ataagcgtta gtggagagat gatgtctcat gactcggtgt cggcggtaac
   153601 ggaagcaagt cataacggga ggtcgcagac cagcactgtg gtaagcaata ctaccgccat
   153661 aacgacggaa cgttcgaata ttactacagt tagtacgaat atcagcgctg tgacgataaa
   153721 cgcgaccagt gcggcgataa aaagtactgc tgtgataaac agtactgtgg tgacgacgcc
   153781 caacgtcagc gttttcacga cggaagagtt gaacaacagc atgacgactg tagctgttag
   153841 tgcggtttcc aaaaaacctc agtcagcggt tcaaattata gatgtgaaca aaatcaactg
   153901 gactgctgtg caaatagaaa tcaatctaca atatgtatcc acttgggatt cgtatctgcc
   153961 agtgtgtaag ccgcggtttt cttcttgtat aggggagaag acgtggttgg taaacgtcga
   154021 tctagagagg tgtgagacgg tccgtcctaa agtgaagcat ctcggaatcc gtgtggaaaa
   154081 caccacatcg ggaacgcggg ttgtagtgat tgtcgaaggt gtttgttgta aagtgaacga
   154141 tcaatggagc ttcgtgataa aatttaagga catgctggcg cgtgtgcggc accgaaatgc
   154201 tgtcaaagtt gattattcca agtgcacgtg gccacgggtg tgggctgaga ttgatccggt
   154261 catgtctacg ctaggattgt tgatggaccg atttgtcggt gaagcagaac gtcggtcgcg
   154321 atgtaaggct gagcatattt actattatgg tttacagaag gcacaagagc ttgctttcga
   154381 ttcgttgggg aatgcgcgac tcaatgtgtt gccgaacact tttgacgtcg atgtatcgaa
   154441 cggaacggag tatctgatgt atgttttgtg cggaatagta tctctattgt ttctggtggt
   154501 gttgattcga ctcggtatca gactgtggag acggcggtcg atgcaaaaac tcaggagcag
   154561 attagagatt tggagtgtgg agagttctga agacgttcat gagtaagtat tgaggcggta
   154621 gacgccggta agagaagatc tatgaaggta ctgaaagtgt tcttttcttt ttttttacag
   154681 gattaatgtc tctgacaaga aaatcctcat ctgaggatga ttcattccat gtcgagcgaa
   154741 aaatgaaaag atatgggttg agatggctgt gacgcgtaat aaagaaacag gacatggtca
   154801 atacgtgtgt ttattaacgt ctaagtcgag ggagtcagtg tagtgcggcg aaatgcgggg
   154861 cggagtgcac gtggcctgct tgttgcagat gttagcgtgt gagaaacaga gcacgtgtac
   154921 ctagccccgc tctcgccgga ccacggagtg cagacgagag gacagagtgc cctgtcaagt
   154981 acacgtgtct attagtttgg agacacagtg tagagacaag gtactcagtc cgcgttgaca
   155041 tgccagcgat cgttctcatg aaatcttaat cgacatgtag gtgagaatat ggcaagggac
   155101 gtttccatct aaatgtcgat gtagatgtta tgagaagatg cgacgatcag ggatgatgga
   155161 gctaagctgt ctgtttggag tagctgctcg acgcgcggtc cctacagccc cgtgagaacg
   155221 cgcggcgctg tggctcgtgg cggtcccacg tgagggtaga gaaagcgtgg ggagcgagtt
   155281 cagcaagctg cgaaggagtg gtaggtcaaa accaaggatc taaggtgacg tctttttcat
   155341 cgcgatggtc ggcgacttgg tagaaaacgt tttttatata agcgacagtt ggtagctgtt
   155401 gtagggtagg aaaatcatgg cgtttcatga ctggtgatgt tgttaatgga caaggctgga
   155461 tttcaggttc agcacgtttg cgccttttgg aaacgctctt cggttttttt tgaagacgtg
   155521 atgcgggaaa ctgtttgggt cgaacaacgg gttcgtcagg aggcattgca ggcttgcttg
   155581 gtagttcgag ttcaggaggc aagtcgggga ggttcggtat atctggaagg gggggaagtg
   155641 ctggtagaag agtcagatca cacacgtccg gcatcgttga aagatcggat gtgttggagt
   155701 tttcagaatc tgcgtgaaat tcattaggtg ggagttccgg aggagtgccg tacagactgt
   155761 cttcctcctg cgcttcttga gcaagtaagg ttgatagctg taacaggaga ggttggggat
   155821 gagtaaagtg gagggttatc cgcgcctccg gccctcggat ccttgctgcc ctgctccccc
   155881 agatcctccc gcacgctcta gtcccccatc cgcaccgcca gcaaggtcct tcgcacctgg
   155941 aggcgaggcg tcggctccgc gcctcctcgg gacctcgggg atcctgggga ctgcatcgag
   156001 gtgcgaaaca gctcccggtg gcgagtggtc cttgcaagtg ttgtgagagc gctagtgcag
   156061 agcgggtgca ccgagcgagc gaggtgcgtt ggggcggcgc gaggcacgac acagccagtg
   156121 tttttcgagc gcgagtcgaa gcgagcggtg tgagcgcagt cctgcgcggg ccgatttaac
   156181 gtcccggcgt tgccgtccct ccccccgaca gcgttgcgcg gcgtggcgct tggcgttttg
   156241 tatgtcgctt ttcgacgctc aaaggatcgc gcgcgctgct tcgagaaagc tggccgaggc
   156301 tgctgaacag tagctctgtg tctcctgaat aactaccagc acgatgagga aaatgataac
   156361 tatgccctct ccaaacagcg ctcccctcct ccgcgctccc ctgaccgctc ccctcagcgc
   156421 tcctcacact cccgctcctc acacccccct cccggctccc tccccgctcc ctccccactc
   156481 cctccccact ccctccccgc tccctccccg ctccctccct agccgctctc tctctcgctc
   156541 tctctctcgc tctctctctc gctctctctc tcgctctctc ggtgtcgggc ccgctttccg
   156601 gggtctggcc cgctttcggg cccgaggccc gctgtcggcc tcgctttcgg gcggcttcgc
   156661 gctcgctttc gggcccgagg cccgctgtcg ggcgcgcttt cgggcccgat tcccgctttc
   156721 gggcccgctt tcgggcgcgc tttcgggccc gacttccggt ttcgggccgg ctctcagcgg
   156781 gccttgtgcg ggggtgaaaa cggaggcgga ctttgtcggt cggaccggcc gagcgaggtg
   156841 tgtggtggcg gttgggcggg cgagcgaggt gtgtggtggc ggttgggcgg gcgagcgagg
   156901 tgtgtggtgg cggccgggcg ggcgagcgag gtgtgtggtg acggccgggc ggccgagcgc
   156961 gctgtgtggt ggcggccggg ccgggcgagc gcgctgtgtg gtggcggccg ggccgggcga
   157021 gcgagccgcg ccggggcggc cggcggggcc cggccgcggt ttcgcagcgc gcgtcggggc
   157081 tggcggtgcg agcgcagggc cgcgcgggcc gctttaacgc cccgggcgct cgccgctccc
   157141 ccccggaagc gcgtggcgcc gcctcgcctg gcgttttgtg cgtgtgaggc ggcgcggcgg
   157201 gcctttcggc gctcgggagc tcgcgcgcgc cgccgccgcc gctctcgaga cggccgcgag
   157261 acgccgccgg aggccgaggc gagcccgagg cgccgtcgac agccgcccgg acagccgccc
   157321 ggacagccgc ccggggagca tgggcgacgc ggcccccggc tcgccggcct caggggcctc
   157381 gggggcgtca gcgccgccag cgccgccggc gccgcctcgc gccgacaccc ccgggcccga
   157441 aagcggcccc cccctggggc tcccgccggg cctgccggcg ccgggcctcg ccgcggcccc
   157501 cgccaccgcc gccaacgccg ccgcctggtg ctcctggctg ggcctcaagc ccagcgacgc
   157561 cgccgcgccc ggcctcaacg ccgccccgcc gccgctcgcc cacatctcgc agccgctgcc
   157621 ccagctcccg cagcagctcc cgcagcagct cccgcagcag ctcccgcagc tcccgcagct
   157681 ccccgcgccc gccgcgccca cgctcatcaa gctcgtgcag ctcattcccc ccgccgccaa
   157741 cggcgccaac ggcgccagcc tcgccgccgg ccacgtcgcc cgcgccgccg tcgtcctcga
   157801 ccctccgccc gccgacgccg aactcgccgc gcacgctccg gccgcccaca ccgctgccca
   157861 cgccgctctg gctgccggcc aactcacggc tccacccgca acgcccgcac acctggcact
   157921 cggccaagct ctccccccga cagcctccgg cctcacaccc accctgcccg ccaacacgcc
   157981 gaccctcacc cacaccacca cccacacctc ccacaccacc cacaaccaca caaccctacc
   158041 acaaagcccc cccctcaaac acacccccgg ggggaagaag acacgagaaa acacccggag
   158101 ggcagtcgag cgcgtgcaat cgtgcggccg ggggagaaaa gcgtgtctgc tgcctcgagg
   158161 tccaccggct ctgagccagc tttccccgtt ggcgcagctg gctcagctgg cttcttcgct
   158221 ggatcctcag ccttccggcc acgtctctcc gtacgttggc agcagtccag cggcaggcag
   158281 acgctcccct gtgcctccca gtgcggagcc tggcgtccac cgtcccgcgc ctcgactgcc
   158341 gtcggcgttt tcccctttct ccgcgggagc cgactgtgcg gccgactgtg cggcggcctc
   158401 ggcccctgcg ccctccgctg ccgtcccggc gctcctgcct ccctggcccg tgtgtgggcc
   158461 gtggtctctg gcgccgccct ggtggtcagg gtggtccggg tggtccgggt ggtccgggtg
   158521 gccgtggtgt tcgaacccct gggtgttccc gtggccggct gccggctggc ccctgccctg
   158581 ctggtgggcg ccttggccga cagccgcgtc cagggaacct gagtgcgcga gctgcgtgtc
   158641 gccgtgcgct gactcctccc ctgaatgcgg ccaccgttcc gggccttccg cgccgccctt
   158701 gccctaagac gtccaccacc tccgtgtgcc ctaggtgcct gtgaccggac agagcgggaa
   158761 gactctcgcg agggcgcgtg ccggcggcgg ggcctcgtgg tttattagct gcctccctgt
   158821 cccgactgtg ctacggcgtg tgttgcagcg tgcagtgcag actgcagtcc cgcgtggcgg
   158881 ccatccgcgc tctccgctgc agtgcacgtc gcggcctgcc gtcgccgtcg cggtgaagat
   158941 gagcggcggc gcggagccgg ggcggctgtc ggctggagcg gccgctccgt ccgctccgtc
   159001 cgcggcgtcg ctggtgagca cgccgccgtc cccgcgtccc gagctgaccg aagacgagtt
   159061 ccgcgccctg gccagcgcgt gggccggcgc gtttctggcc aacacgacgg cgcgcgccac
   159121 gcggcgctgg tgccagcgcg agcagggcgg cgtgctgccc ctgggccggc ctcacgggtt
   159181 cttcgccgtg gtgactccgc gctcgcagat gcccggcgtg ggcgccaccg acctgcggca
   159241 gatgtcgccg agcgacgagt ggatcgtcct ggtggcgacg gtggtgcacg ccgtgccgtc
   159301 ggcggctcag gaccgcgccc acgccgcccg gctggaggcg cgctcgccgt ggacgtcgga
   159361 cggctggtgc cgcacggacg gcctgtacct gggcgtgggt ccgcggttcc gcgtgttcct
   159421 gctggacctg gcgcgactga ccctgcacct ggcggcccgc gacgccgacg agttcttccg
   159481 cttcggactg ggcggcgtgt cgcggctgta cgcgtgcgac ctgctgcccc gcagcacgac
   159541 ggagccggcg cggctgagcg aggcgctggc ggccgccagc cgcgcggcgc acgcggcgca
   159601 cgcggtggcg gaggcgcacg ccggacacga actgcagctg gtgacgccgg gccggccggc
   159661 gcagacggcg gtgctgtggc cgcgctggtc tgacctgcgg aacgtgtggc ccttctgctc
   159721 gcacgcgcgg ccggccgagc tggtggaggc ggcccggcgc cacgtgacgc agcggctgtg
   159781 ctgcgcctgg tacccgctgg ccgtggtgct gagcaacctg ccgaaggagt cgatcgcgcg
   159841 cgtgccgctg gtggcgctgc tggacgagct gtgcgccgtg tgggcgtact gcacgctgga
   159901 cgggcagctg tacccgctgg ccgacgacct ggggcacctg ctgcgcgccg gcacgctgtc
   159961 gctgctgcac ctgggccgca cggcgtcgtc gtcggagacg gagacggcgt tccgcctgct
   160021 gccgccggtg gaccgcgagt tctgggagac gccgcgcgcc gacgcgctgt tcctgcaccc
   160081 gcgcgcgcac cagcagctgc gcgacccggg cagccagctg cgcttcctga cgcgcagcga
   160141 ccgcttccag ggcctggcgg cgggcgcggg cgccgtgggc ggcgggcgca gcggcgagcg
   160201 cgacgccggg ctgcgggccc gcgacgccga gctcctgggc ctgccggggc tgtgccagcg
   160261 ctcgccgccc cgcagcccgg cggcggcgct gtcgcacgcg ctgcgccacg accgcgaccg
   160321 ctggcggccg acgcgggcgc cggacccgcg cacggcgttc gccgaccccg acccgcagga
   160381 gtacccgcgc ggcgcgtcgc ggcccgagga cgtggccgcc cggcggctga gcaagttccg
   160441 cgcgcgcgac tcgcgcgagc tgctgcggcc gctgccgcgg ccgccgctgg agacgacgcc
   160501 ggagcccccc atcgccgcgg cgccgtcaac gtcgtctgcg gcggcggccg cggagagccc
   160561 ggccggctcg ggggccgaag ccggggacga cgccgacgac gccgcggcca gccgcggaga
   160621 gggcgccggc ggcgaggtcc gcggccacgc cggcggccaa ggcggccagg gcggcggcgg
   160681 cggcggccac ggcgcccagg acagccagca gccggccggc ggcggcccct gcggcgcggc
   160741 cctggccggg ccctgctgct gcgactgcag ctgccacccg gcccgcgggc cgcccgccgc
   160801 cgtgcagagc gcccggcagc tgggcgccgc ctggcgcacg ctgagccgcg aggcgcgcca
   160861 ggcgcgagag gcgcgccagg cggcggcggg cgggggcgcg ggagggccgg gagcgggtgc
   160921 gggtgcgggt gcgggcggcg gcggcctctg cggcggcgtc cagcgcatgg cgctgagcct
   160981 gccgggccgc gagtgccaga cgcgctgagg tgggggtggg gcaggcgcaa taaagaccac
   161041 gctagcacgc cagtgtgttc cggctcctct ttattactgc agctccccgg ggcgggcggg
   161101 gcgcgggagc tggcgggagt gggagcggga gtgggagcgg gacccgggag ctggcgggcg
   161161 gcgggcggct ggagaggcag caaagggctg gggagggacc cactcctccg ggcggcggcg
   161221 gctgaaaggg cagcaaaggg ctggagaggg acccactcct ccgggcggcg gcggctgaaa
   161281 aggcagcaaa gggctggaga gggacccact cctccgggcg gcggcggctg aaaaggcagc
   161341 aaagggctgg ggagggaccc actcctccgg gcggcggcgg ctgaaaaggc agcaaagggc
   161401 tggggaggga cccactcctc cgggcggcgg cggctgaaaa ggcagcaaag ggctggagag
   161461 ggacccactc ctccgggcgg ctacagctcc tcctgccgcc gctgctgctg ctgctgctgc
   161521 tgccagtcgc cgcgccgctc cggcgccgtc agccgcccta ccgcttctga ggcgatgacg
   161581 atggcgtggt cgccgcagca gcggccgcgg cagcagcagc cgcagcagca gcggcggcag
   161641 cagcagccgc ggccgaagga gcagcagccg cggccgaagg agcagcagaa gcagaagcgg
   161701 aaggcgaggg cgacgtcgag cgcacgttca gagatgaatc cgctaactct tcttcgcact
   161761 gcttcggttg cttttctttt tgtttttttg gcgtatcgtc tcccgagcca aaccagcgta
   161821 gcatcagcac cagcagtagt agacgcagcc acattatcca cacgcgccag ccaccgctac
   161881 gacgtcgttg ttttttgctt tcctggtcaa attcattttt ggtttctgac atattggaag
   161941 acgtcgctgt acccgggata atccgcacgg gacgagaata ttcgtcttct gtggttttca
   162001 ttgtgtttta aactgctgtt tctattcaga taagtaagga gtcagtggtc acctggctct
   162061 ttattaagcg aagcaatcag acagatagcc aatcgttgac taatctcatt tcatacaaag
   162121 gacatataaa aaggaagaaa agcaagaaaa acacgcctcc tacaaataga acaaagacct
   162181 tacttcgcct taaaagccaa tctacaatgt tatacaaatt agctaagaca tacgtaaaca
   162241 gaagtattct gcttaataag aacatgtacg tccatacata tgctacataa cgtccttcca
   162301 tccaaagacg caacacgtcc ttcacgttgt aatcaaaagg ccaccacgat acttttgtag
   162361 ataactgaca cttataccac tgttcacaac cgaaacacat ttgaacctct atatacacaa
   162421 atgaaacggt gatgtcactt aagtcttcta tcacatcgtc catttccaga acgtacatat
   162481 cttcttgaat ttgttgtttc ctcagccgtt tacgtaaatc cctgacattt ctaccacctc
   162541 ccatctgaat ataggcactc gtcacaaaaa catcagacac ccctctaaac caaaaacgag
   162601 ccaccatgtc gttccctgat atagtgcact gtgtctccat caaatcttgt ccacagcgcc
   162661 caaaacacga tgagccacag gtttgacgaa tttcatttcg ttgttctcta tctagtgtat
   162721 catcttcaat acttagtcgt gttaatgctg aacgtaagac tttatctgat gaagtgctgc
   162781 atatttgcag gtactcttca tacgtgggtc gctgcggtcc gaaagcttcc ttcactgacg
   162841 tcggtaacgg cagactctga attcggtaga tgagcgccaa agtcacccaa atggtaatgt
   162901 ccctggaagt cattttcatc tgaatcaccg cttggcgttc aacgttgata tgagttcacg
   162961 ctgtctttct tacatttata cattttctgt ctcctcctta cttgattata agccaatatt
   163021 gtgtcatctt taaaaactac aactttttcc ttcctaatct ttttcagcga aactactagg
   163081 atctttacgg aatcaaccga cgactctgac ctttgtgacc atgccacctc ccgaacccga
   163141 cgaaagtcgc cttttaaaac gagaaatggt gactactgga actgtggtga catgttttct
   163201 ggtcatcgct tgggctctga tagtaaccgc tttactttgg ctgctattaa agccatctta
   163261 gttgcactcc aagcaattcg ttcaaaagct tttattcata aacgtaaatt gaaaaaacat
   163321 ctagatgtat gtcacctaga ccaaaaattt gtgttacaca tatacatatt gagactatac
   163381 atgcataaat ttccagagat cactaaatcc atggcaggat ctgtcttatc cattatacat
   163441 aataaccaac acacttcttg ataaacgaac gcattccaaa ccatcatcag cacacattgg
   163501 cagacagtat accagtcact cggtaaatgg ttctgagcac atatgacgcc gaaatctaca
   163561 atacttattc ctatagtcca tcgccacata gtgtcttgat ccattttagg caagtcccgt
   163621 cttagaattc caccgaaagt ctcaaacccg gtcacgatga aaaaatatgc taatatgatc
   163681 gagacgcaga tcggcaaact tagtgtatct atggaatgac tgttgaagtt gactgatgtc
   163741 accttcaatg tgatcatagt tccgaaaaac cacaagcgga gcaaaatatt tctccaatgt
   163801 tttaaccaaa tccagacggt aagggaagat acctcgagaa tcaaactgag tccgatttca
   163861 tggtctatct tctgagtcca ccatggtttt ccaatcctca gccaactcca cgtaaaacat
   163921 aacgcaaaac aagaaagcaa agccagacac gtcaggccga atacgcgtct aagcagacat
   163981 agttctcgcc attcaaaaag caaacgcaca gcccagcagg gccacccgtc gaaccgttct
   164041 ctgggtctat tggatctgtt ttcaattcta attgccactg actgtggtct ggagcgtgat
   164101 ggtcgacatg gttgtttgga tctagttttg atgacaggct cgcaacccat gctgacgtgt
   164161 tgccaatctc actgaaaagg cgacggtctg caataacttc ttatatacaa ctcacagtag
   164221 cgtagcgtga cgtctgaatt aggcgtttca gtttcgtgtt gagaaaggaa aaactctaaa
   164281 agcaaaaacc gaataagcat ccagactgac agatagtttt cattatgcac gaaacgcaaa
   164341 catatgtatc gacatagaac ataaacagat ttgctacaat cacgaactct agcacagaat
   164401 tactgttaat cactgtggcc aacatgaaac gagtatcgct gatgatcagg taatatacta
   164461 tggctagaag acaacacagt agacctaatc gtaaattgct tggtaggtca aaccaagaga
   164521 tccatacgat cagtaaactg gtaattagtc cgtatctccg tttacttaag accggattgt
   164581 tggtcaacgt cgacttgtaa attatcagat tggtgatgat taatattttg atggtcagga
   164641 ttcccgaata caagttgatg aagaatccac ttgattccat gccggccgtg acagaagtag
   164701 ctttaaaaac agctaagcta cttagcagca gaatgctgat atctggcctc ttttcgcgtt
   164761 ttattaagca ccaagcgcct actgccatag cttcaaaact caacgcgacg atcagattat
   164821 ctacagccaa tgctcgccaa cattgaacgt tcgaccacag aacgccaaag atcgcgcaag
   164881 atgtgatcaa taaagctact aggctgtaaa tacgagacac gaaactcaaa tcacgaaatg
   164941 agatgatgaa cggacgagaa ttaccattga ctgatccgat gaaccatttt gaggtagttg
   165001 tgtgttttgt cggttccttg tttaccggtg aggattcttc ggtaataggt ttcgaagatt
   165061 tctccggatg attattaaga catacggtaa ctgtcatctt gacagaaata tcgcttctgt
   165121 ggagagcaaa ctataaagaa acttcaatct agtccaacta gatgttttta atctgggtga
   165181 acattatata ccattatcgt gctaagacac tcccgatttc atatgacgta aacaaaatcg
   165241 ccgctttcga ctctgtcgac tggtgtatga gatctaggga ctcgaaaaac gatgcttttt
   165301 cgaaattgtt tttgtcgttg ctttattgtg gaattgataa cccccatatc caagacaggg
   165361 aagatatagt aacaaaccat aagtaataag cgcacagata tgaatccatc acggccatgt
   165421 aaaaagttcc gacgacagca ccgacgttca ctggctctga gtccggttct gatgattttt
   165481 tccaaagtgc gtaatgatct tgcatgatga aaatattcaa caagatcggt ggacagatgg
   165541 ctaaaacgac tcggagactt ttgggtatca agtctagtcc gagcgccacg ctaaccaaga
   165601 cgctaagtgc cgccacacat ggtcgattgc tgaacgtaat aggccgaatc gagggaatca
   165661 cccgactgca agggatcagc ataataaaaa ctgtcaaaac catagtggcc ggaaaaatga
   165721 gcgtgtagag tttaaaatta ttgacagttg cgattaccga cgttgttttg cacacggtta
   165781 atcctcctaa aaaaaagctg ctcatggtgc ccgatttggc ttgtatcacc aggaaccaag
   165841 agactagagc tagaatctcg tgactcatag ctgtgctcag atctccaagg acagttagct
   165901 gttctgaatc ccaatagatc cataatgcac caataaccag actacagatg attgatgtgc
   165961 cgaatagcaa gtacacatga gcgacgagac ccggactgca agatggccac aaaaggatca
   166021 agcgacgcca caaatcctga tcgagatatg aaagagattg ttcccacatc gcgaccatcg
   166081 tggtttgatg ttttcggatt gtggcatggt gtttttcgga tggcttttcg ggagccgtct
   166141 gtatacttga aggcaccgtc atgttatgag acgatctgaa ttggcgagag actaatctca
   166201 aacagcttcg agagttttat agacctaaat gtgacgttga atacaattgg ttttcgtttt
   166261 atgatccgag acgctggtgc ttcttcaact tccttatatg atctttaaat gtagctctta
   166321 agaggattat tttatacacg tgagaaacgt taaatgccta attaattaca gggagcgtaa
   166381 acctaattga acgtctgtta tgtacaagta gagagttgtt gttatcataa cctcttcatt
   166441 tagacttgtt tctggctttt tttcatgcag acacttgaca tcacatatac cgaagatgga
   166501 caccatacct aatagaatca tcgttagtgc gtggcttacg tcgacagaaa tttgactaag
   166561 acatgtaaca gaaatcgata agctagaact catcaacaga atgcaggttc ttggaattgg
   166621 tgctagattt tcagaacgtg gtgtaaaacg actgatgcag atcaccacga aacaaacaag
   166681 ccccgtgcca agactgacaa tcccgctcat ctttaagtcg atgttttgac tgaagaccac
   166741 acatgtattc ttgcaagcca ccattaatac cagacagacg tgactcagta tggcatttcg
   166801 acactggaaa gtgcataacc aaaagatgat ccccaactgg ctgagaactg cagttatgct
   166861 atagcgatag ttgacttgaa cgctaacttg tctcataagg aaagaaactg cgggatagat
   166921 gaacataaac aagagtaatc tgctataaac acggggtagg tataattggc ttcgttcttt
   166981 acacaagttc cgatacgccg ttagcatcga ggttattctt tcttgccaga tcgtagtgtt
   167041 ggacctgctt tgtacactcg tacgctcttc agtcacagat ttttcaactg tttctgtttt
   167101 caatacagtc acctcaacag gtattgtcat cttgctgtgg tgtcaagcaa gttttcaccg
   167161 acggctctga agaagtatct ctatcgagag ctctgatcaa aagatcacac tgagaaaaac
   167221 ttgaatttaa aacctttagt ttcataacaa cgtcaccata aggaactgac gatgatgtta
   167281 aaaagtgtcc acgtcaattt atcagagaac ctgcgacctt taagtgtcga ccatgcattg
   167341 agtgaaaaat tcagcatcta tgggaaaaac gaacaccaac caaataagca ttgagtatat
   167401 cgcaacgaat gccagatggt atattgagta atatacgcgt ccaggagata tagaaaacta
   167461 ctgacgatga tgttcaactg ttctgtctca ttcggcgcag tagtctttgt ccacacgtcg
   167521 taatgctcca ccataccacc catatatgtc ataaggagac acaacgacat aatcacttgc
   167581 attatggagt tcttgtcatt gatcgccgca cagatagtta tggtgagact tataagcatc
   167641 aggtggccag atttcactag gctaggtatc ccactagaca ggtgatcaaa atagtaaatg
   167701 agaataacta gacctataat acagattccc agtcctagga tccacggtaa aagtgcttgc
   167761 caacagatct ctgttaaaag gctcaacgaa acgatcttac ttatcgtcaa tatgatcaca
   167821 catccgattc ttaaaggtgt taaatgacat cttgttaaaa aaagacaatt actcacagct
   167881 atgacttccg aaattatgat tacagtcgtc ttgtgagcag tgatgacggt atactcgttg
   167941 tagttcaata ctccagaaca tataaaagaa gtccatacca taaaactaat cccagtatac
   168001 atacgtaata atatgatgac tccaggtcgt tgtgacataa ggcggttcca ttgtgatatt
   168061 aatttttctt gtacattgat catctgaaac tgcagtcgag tagctcgaac atcatcggct
   168121 tcagatttag aacagtccgt attttttgac gggatgtcgg taataataga catcacgtcg
   168181 agtggctttt cctgaccgta actttatttt ttcaaaatgt gtctacattt cgtggctaac
   168241 ctgtcgactg gagttttttt aaaaatgatc ttctggagct ggtaaagtca ccattttaca
   168301 gaaaccgaag gtacatgggt ttaaaaacac tacttgatcc gtcattgaaa tagctacatg
   168361 tagagtcatc aaatatagaa acatcttagc gattagaagc ccttgctgta aaagttttaa
   168421 ttgagagtgc attaacaaca accggcattg ctcccaaaat attccgaagt agattgagaa
   168481 ctcaaagatg gccagaacga caatctgtac ttcaggtgag aaatagtcat ccgtaatgct
   168541 gtaaatggtg actgctgcac ttattaccgt agcacaggct acttcgataa tagtcaggtc
   168601 ttcacggacg ggtacccaat tattacaaat aaatgttgcc actaacacga ttcctacacc
   168661 catgtattct cctaatatta acggtgatat tcttgttaac atagtgaccg agagtatttt
   168721 gctcagtgtc aacgcacaaa aagttaaagc catttgaact ctgtcatgag cacgtaacat
   168781 tagaaaacag ttgatgccag ctgtaatttc aaatgttata gctacgcatt ttctaaaaat
   168841 gatcgtctgt ccacttgcta tggattcttg gtcaatgatc acgtaaaccg ctaacatcat
   168901 tgtagtgata taatagctcc gtaagaatat gatgaagtcg aatcgtaacc acaacattcg
   168961 ctgatagagt agccatgtct taaaaatatc tcgttgccaa ctggtttcta gacccatatc
   169021 gattttcaaa gacgacactg tcatatcgga agatttttca acgctctgta accactgcga
   169081 atacaaaaat aaatgttatt cgttttggat tacatgatgg acatctatta tcctaggctt
   169141 tgaccttaat atagcgctaa ctgccttcta actgtaactt accgtttatt aaatcttttt
   169201 ttccgcctcg ttggtggttc ccacggtttc tgaggagatc tgaagtttga ccatattccg
   169261 ttgtacccag aaatggcttt gaggatgaga tagaggaaca aggaagcaag tccgcataaa
   169321 attatgaatt cggtgacgta tactaataag ggtgtatcat ctttatctgg cgcttcaaaa
   169381 ggacccgatg tctgcttttt aggccaagga aacgtagtct ctttgatccg taattcaacg
   169441 tgtcctaagg catcgaatcc aatttcatca gggtgttgaa ggccgtaata atacacacgt
   169501 tttcctttac acggactggt gcctcgatgc tttcgcatgg tggccatata attctcagcc
   169561 atgatactaa aattggttaa catcgggtag atcggcatta atctcgtatg ccaagagcaa
   169621 ttgtaatcta ccctcagagc gttgtgatga gtcattccac cgtaccaatg tcgaattaga
   169681 aatacgaaat tagcttgtcc ttcaatgaca cagcaaagtc cttcataagc taacgggact
   169741 gtttttccgc ttggaagtgg acgatcgtct ctccctagta ccatccacgg aacgtcatat
   169801 ttatcgcaat aagagatgtg aggtctttct aaccaagttt ggttcaaaac acagccagtt
   169861 agattgacgg tggtgttata caataaatcg atccattttt gagcttcaca ctcatctgat
   169921 gaattgtttg aactcggggt agcggtttcg tcccccgaac cttcatccgt gctggtagac
   169981 gtaaacggtg ttgtcacgac cgttgatatg gtcgaattca ccgtcacgtt agtggtgagg
   170041 tttgtgactg ccacaggagt cgtcacattt ggtgtgacag tggagttatt tgaggacgtt
   170101 gacgtggtat tagcaaaaac cggtaagaat aaactagtaa ctaaagcgct tagaaaaatg
   170161 gtggggatcg acatgatcga agtacaaatc tctaattatc cggtttaatg ccagtaacgt
   170221 gtaaaaaatt ctgcacaaga taccgaatga tttctgatta agctttattg agatttttac
   170281 atcagactgg gggagcccca aggaaattca aaataattcg gaaaagagac tttagggaca
   170341 ggacactggt aacgccacat gagttgtgct cgaataactc ggtgtttcca agcctccttc
   170401 tcgagagtga cttcttccca gttggccgta tcgtgttttt ggagttctgg atggattttg
   170461 ctggtggaag agatttctga gctctccgac gctgagggtg aaggtggtga gagaggcacc
   170521 ttctctggcg aacggtgttc gtcattcggt tcggagccaa tatcgtgcac gatcgcatcg
   170581 tgacaactgt cctcatcttc atcttcttcg ggtccgaaac tacgaggagc cctaaaacag
   170641 cgtttaccgt caaatgccgt ggtaatgatg tcatcttcct gccaagcacc atcttcattc
   170701 tcaggtagag tttggataga tcccacgggg aaggtccaat tttgattctc catcagggtt
   170761 ccggtaggta ccatgtcggt gcgccctaga acatcgtcga attgaagctc ttctctcatt
   170821 aaagtgggcc gtgtcagcca gtcgaaacag ctctccatct cttcctgagt aatgggatat
   170881 tgcttataag ccggcatggc gtctcgactg caccagtgtg agcaatgagg tttggtctcc
   170941 aatagggcct ctccgcgaca tccgcgatca aaccggtagg aacctttgag tttcagatac
   171001 ccgattctga aaaacatctg aatatcatcc gctaatcggt gtaaatctcc gtcctctgat
   171061 ttgagagcat agacggcacc gaagcgatcc aaaatgacca cagccatggt cgcgaaagtc
   171121 cccactttca tgtaataacc tgtgactccc aagacgtgcc attggcaaca caaccgacaa
   171181 gtgattcggc ggcacatttc ttcaaaggcc tcgtcgctca tcgccacaaa cggcttggat
   171241 tttcgaagtt gattcacatc tcctaacaag agcaagggtt ctctagtgtt ttcccccggt
   171301 gtggtgatga ccagatttaa ccctttcaga tcgagagcga tctcagccag agctttaaca
   171361 tcgcgacagt ctgctgaaag tagacgatcg acgtggtatc tgggctccac ggtgctgtac
   171421 ggagtactcg gatgtttgta caccgaatcg caccacatca gaccgttttc agccagatct
   171481 tccaaattct gcgctacttg aaataacgca tccactttcc agtcgtacac atagacggcc
   171541 cctgtggctc cgaggagcat cacacatgtg gtttcagaca gaatcttatc ttcccctccg
   171601 gaggcgcgta cggccaacac gccgacagtc ataagattct catcacagca cagatactca
   171661 cggtccaagc ggcgcccccg gactggagcg atatcacttg aatctcttaa aaccagaaac
   171721 cacgttccgg ggttccgcag acaaatggcg acaccttgat ttttttggac atagtcccgt
   171781 agagccgaat gatcgtgcat gcgaatgaaa agaccgtgga gcattaacat catctgttga
   171841 aacacgctcc ggcgagtata ggctacgcca aagtcacagc gtactacatg ttctggacga
   171901 tcgtcatgac ttttcaagta ctgggtccag gccacgcacg tcgatttcga cgttagcggc
   171961 attgtttttt ccaggagttt gggacaccgg gtgctgtccg actgaagcgt ggagaaagtt
   172021 agatgagtgc ttaatatagg atcgagtctc ctcccatagt ttctgctttg atgatctttt
   172081 tctgacgtca gtcaacacac atctccacgc cactttatcc taatcagacc gttattcata
   172141 aaattctcgg aaatcaaaca cccgtctaaa ttctggaggt tgtggttcat ccatcgtgtt
   172201 gattcgacga gcctccactt cagcctcgct gacggattct tctttcatgt agtcatctga
   172261 gatttttttc tgctgaaacc accactcaag tacttcggcg tccagatctc gatcggcatc
   172321 ttcgtagtcc tcaaagatga tgtcttcggt cacgtcgaat ccgagatctt cccactcatc
   172381 ttcatccgaa tccgtttcat cctcctcatc catgtcatcg gcgtggcgat tccgaccgcc
   172441 ttgacgtctg ggtgcttcac cctcgtcatc gtcatcgtcg ctgcgttctt cattgttgtt
   172501 atcaccataa cgttgtattg actgccgtct ctccggtcgc ggtgaggcca tgggcggtcc
   172561 attggagata cgatcttgcc agagagcaaa agcatcccac gtatcccaag tcatcagcat
   172621 ctccggttta aatcgacctt cgcgacaaag ccatctgaat tgtttttcca tatcgtgccc
   172681 gagccccagc tgcaaaaaag tacgttgtgg caacgtgatc acgggagtat ggatgcattt
   172741 cggtcgacgt tccaactgag ctacccgcct cagatagtgt tcgtggcgac ggcgaaaata
   172801 aagtttgaca aaaccggctt tgaaaaactc atgtagatta ccagccacac gatacacttc
   172861 tccagattgt ttatatgacc acgtgcggaa agttccgttg cggatagtca ccacatagac
   172921 acggccaaaa cgatccagaa tgatcagttt ggaaactaga aacacaccat tgcagcgata
   172981 agatccgatg actcccagca agtgccatcg acatttcagg cgaagggtga tgacaacgtg
   173041 acacgctatc agtctacacg tgtcgacggc ttcaaacggc caataatcat gtaacacacc
   173101 gaaatgcggt agcagcttta aaactttagc gcgacggccc ggagtatgga ggctcacatc
   173161 tcgttcttgg tgaacactta cataagcgtt cacggcctga ggatcgtgag ctcgcgccaa
   173221 caaaccttga acgagatcat ccggcacggc agtcgcatac ggcatactgg gttgacggta
   173281 tatcatctca caaccgagta gaccgaatcg agccaactca tcagcatttt ccgctaccat
   173341 gttaatgact tcatcttcct ggtgatatag gtacagacga cctttatcac ccaataacat
   173401 gaagatacct gtgtgttcat attcttcctc tccttctcct ttagtgatga tacattgacc
   173461 caaaatcatt agaggttctt cgcaacataa cacgtcgtcg aagaatctgt cattcagttc
   173521 cggaagcact tcttctggct gaagctgtaa ataccagtta tgcggaatcc ccagtgaaag
   173581 tcgtctatcc acgttgctgc gaacaaactc gcggatgacc gaaaagcgtt cctgatggat
   173641 gaagatgtct ttgaaatctt ccatcacctt caggaaaact gatcttttgg tgtgacaata
   173701 caaaatcgac tcagcatgtc ctcgaggcaa gcctgaactt ttgtcccagc gagttctcca
   173761 catttctgag ttcaacggta ttctaaacac cttggcttgg agaagaaaaa cttagaatcc
   173821 tcagctctcg cttgagagcg tcggtgaagt tcagttatca aactgaagtg aaggatctct
   173881 gagtcctgcc aacggtttca aaggaaacgg gttcgaatag gtgatgtaac gagattgcga
   173941 caccaaaccc ggaatgacac gtcgtcgact gtcacgtgtt gcaaaccgac tggcgatcag
   174001 gcaatgaatc cgaggtccgg agtcctgaga actggaagcc tggcgctctg cttccgctaa
   174061 gcctgtaaca tccggatcca ccacgtaagt atccgagtta caatcaaacc gttgaatgac
   174121 caaagtgttc ttgtccagtt tttcccagac tccttgatgg ggatcaaaac gatctttcaa
   174181 acacatccat tcatagtgtt gccgcaacac acgtcgctga cgtcgttgtt gatcatgtga
   174241 gttcagctta tttttgttaa ataagatctc tctcatgcgt cgaaccccac gttcctcgtt
   174301 atgtgggcag atgggtgcaa attccagacg tgttttcatg ttattctctt catcgaagcg
   174361 acgattgtga aagacatact ttaagagtcc catgcgaaac acttcagtga ggctgtcggc
   174421 gattctccgg atataatgat tgggatcttc tatttgaagc aagtacacgg ccccgaacca
   174481 gtcgagaaag agaagcaggt caacgtgaaa aggtcgaccc gctcgtggag ttcccaccgc
   174541 ccccaggatg taccatggtg tagctagatt ggctttcata ttctgccacc agcgttcgct
   174601 ctcttcatcc gtgagtgtac agaaaggcca catgttccgc agtcgagtca ctgtcttgca
   174661 aaggcggagg ataaccggcc cgtaacccgg agtctgtagt ttgacatcgt tcccttgaaa
   174721 acgctctgcc gtcgcgtagg tcccttctgt ggtggttgaa ttcataaaca gaatgtgcat
   174781 actcttacca cttttcggag ggccgtaaga tgtccctgtg gcgcgacgaa gagcttgatg
   174841 aaccgtatcg cgataagcga tttctgattg agaaacgccg tatctcgcta attcgtcaag
   174901 atgatgagcc accagcaaca gacattcctg gtaagtatcg taagcataaa ctcgagaaca
   174961 actcccccaa aagattaaaa attgagtcac aatatagtcc ttcggatcat gggacggatt
   175021 ctcctcgagc atcaccacag cagaccctaa taagcacaga ggttcagcac agcagagtcg
   175081 tcgcagagcg ctgtttttta catcaacggt acaagcgttg ctgttcaaaa tcacatacca
   175141 tttgcccgga cgacccaaac agaggaattt tccgtgattg atcctgacat attccataac
   175201 ttcgagagga gtgactgaga gaaacagacc tcgaaagtct ctcaacactt tctgttgtag
   175261 ttccaaggcg aaacgctcat cggattcgcc gaaaacagac atttttctaa agcggagtat
   175321 gaaaactcac ctctgaaggc tgaaatgcac cgctggtcgt cttccacaat tggatagggc
   175381 tgacagctgt cagccgcctt ttgacttcac agatagccgt tgtgcgtgtg tcgtcattga
   175441 tctcaatctg tctaccgctc gacggctctg actggactga atattgcaca taccgcagtc
   175501 agggttgtcg agcggttaac agacaagaaa ccaaacgcgg tgaactcaac acttttacct
   175561 agtacgagtc atacggtttc aagtcagacc tgaaaccgtg tcatgatcac attaaaactt
   175621 tctataacca cggaggtaaa tacgatccgg gtttagggat aggggggtag acgggtgatt
   175681 ttccgttttg gatgatcgtt cgcgctacac gacgtaagag aatatcacga ggtagaagcg
   175741 gatcttcatc gacatcgaaa aaagtcgacg acgcggtctc ggtcgttttg tggtaacgtt
   175801 gcatctcagt ttccagggtc tcatcgatcc cgatcgcata atttagagtc ttcggggggt
   175861 aaggcaagga gagtccgcta cgtgtataac gttgccagtt atccaaggcg actttcactt
   175921 cggcttcttg tggtaaatca taacgatgac gaggatccca actcccgtca gccgctccca
   175981 cggccgcctc tccgacgtgg aattgcccat taatcgttcg attttcttcg aagcgatcag
   176041 gtctcgtgag ccaacgatac cgcggttggt aattgcgtga tccactcaga tattcaatat
   176101 gtgagtaccg gtcccaaaaa tgatgcatgg tatgcggaca ttgaccgggc acttccaatt
   176161 cctcggcgtc gcgcctggca gtactaaagc gacgtccttt agtatagagt ttcatcaaac
   176221 cgatcctaaa gaacatggtg aggttatcgg cgagtttcca catctcgctg acaaacaggc
   176281 tgaagtaata cacacagccg atttcatccg cgagaatcag atagtcacca tgaaacacac
   176341 cagaaggtaa acattcaccg atgactccga tcaccacacc gcgacaacac aactgttcag
   176401 ccagaatagt gaataactct tctaaagatt ccgcatccat acagagaaat ggccaaaatg
   176461 cttgtatatc gaagggagaa ctacagagtt gtaagactct cgtctgttct cccggagtgc
   176521 gtaaaggtat catctgccat cggtacttgg acaatacccg acgcaactcg gggagtgatt
   176581 tagaggcttg aatcaattcg gttaccattt gagagtgaga ttccgtaaaa gatggcataa
   176641 aaggatggcg atataaaatg tctaggtgaa gaagaccttt tcgagctaga ctgtcaaaac
   176701 tggtagcgac tagaaatagc accgtatcga cacggtcgaa gcaccatatg gtctcataac
   176761 gtcccattaa gaggactggt gccgaggacg tctcggtgtc agagttgctc tcgatagctt
   176821 cgaaatcctc atcttcagaa tccgaactat tgaaggtatc agataccggt ttgatataac
   176881 gcaagatgcc caagacttct aatggattat cacagcacaa gaatgactcc caaggtaagg
   176941 gtgaattatc atccccgttg gttccgaaga tgacttcgaa cggagtatag cacaacctcc
   177001 atcctagagg ggctggaatc gccgtacttc ttcgctcctc gtagcgttcg tatacaagat
   177061 tgcgaatttt gtatcttgag tcttgagaca gaataaagtc tcggaagctt cgaagtgtgc
   177121 gtcggaccgc ttgtgccgaa acgtagcgat atgaagattg caaagccatg tcttcacctg
   177181 ccattggaac agaaaaagaa cttcagtatt tttatctgca ctaccacgtg aggggaaatg
   177241 ataaaaacga tgacgctcaa cctcaacggc cttgatataa gaagtcttga ggtcgtaagg
   177301 gcacattctc agaccacaca ggtgagaaac atgattcacc gcaagattcc ttcggtgtgg
   177361 aaattcttct tctcctggat cttcgtgtgt cttaactgct tcgcctttcg ccaaagatgt
   177421 gaagttccat gggaaccttc atattcttgc aacgactgga cttacaaagg actgtaatat
   177481 gattaagagg caggacaaga acagcatgga aaaatctttt attaccgggt tttttttttg
   177541 attcgttgaa gaaacacacc tgagatctca aaatgaacgg aaaatcggaa ggtcacaaat
   177601 ctgtattcaa agtgtgatta gaactcaggc tcttcaatat caattatgaa atcagcacag
   177661 gcaatctaac ctactctaca aatgacacct aaatctctat caagtggttc tttaataatc
   177721 aaaatatatc atcatcacag aaaatagagc tgtgccggga ccataaaacc ctcagaatag
   177781 acccggtcga gagaggattt gggacgacat cactgtgagg tctccaacct cctcaatgta
   177841 aaccaaaata actccgaaat gccaaccgcg agatgatgat acactacaaa tctgttaagc
   177901 ggtgccgttg gcattgtcaa aaacagtgac cacaatgatt ctaatcgcat ttatagtagt
   177961 atctttgacc cattctagca agattgccag ggcaggctat cagcgttcta ttattcaaaa
   178021 agtactaacg tttatgtctg actacgttca gggctacttt aacaactttc tatataagat
   178081 gagaggaaaa ctacttactt tctcccaagt tctatagcgc ggtcatggag atagaggacg
   178141 tcgtctttcc aatcgtcagc caccagataa tctcttcagg ctacgtcgat agctgcagat
   178201 caagaagaag acatctcaag ttgcatgctt tacgagggac taaaaagtta gcgtggttat
   178261 atcacgttac aacatattgg gttacagtgt cgttgttctg agaatcaggt cggtgaccag
   178321 atttttcctt gctaactact atctctattt ccgcagtgtg agcactgaat agacggtgag
   178381 ccgattcgtc tacaatgtca gtcttaccat tatgaaatat gaacaaccgg aagtgcgaat
   178441 gaatctgcgt gatatcttga agtctataaa aacgccctga tcagcagttc ggttttcacc
   178501 gttatggtgg acgtggtcta aaacccaatt ggcaaaatgg agtataattc taatcttaat
   178561 tatcccgagg actctactat catctgtgct cggtgtaaga aaaagatctg ttcaaaatgc
   178621 ggtcgcgcat ggcctttggt ctctacccgg gagatggagg ccacaatccg cctggaacat
   178681 ctccatcgca ttatctggtt cttgggatat caattcatat ggatagtttt ggtgacagga
   178741 ctattgacat gtatcccttc ttggtacaaa cttgtctatc aaaacgatgg catgatcgta
   178801 ctttatacct tattgaacat catattacta ttcaacatgg atcatatgca tgatcatctt
   178861 tccaatttca ttctcctgac ttggtcagct gttttaatcg gcattctgat tacgggcgtt
   178921 acactgttcc acagttggac agagatcaag gaggcgttca tgttgacggt gatcatcgtc
   178981 atcgcactgg cgacatacgt tcaccgcaga gagcgagatc tgaatcgtgt cttagactat
   179041 ttatctatcg ggttgtgtgc aataactgtt ctgggcatca tatggttact ccgtccgtgg
   179101 gctagtggga agttaatact gagttcccta tgtggaatct taacatgttt aataaccgtc
   179161 tacgagctcc atgttgaacg gtggtttccg atcggaaaac aacgttcggc tatgttacgg
   179221 tcggcgactc ttggaatgca catttttgtt tttacgtgta gtatacttgt catccggcat
   179281 ttagtgtttc gatctactta actgacgtca tatagatttc gggcaaatta aataacatgt
   179341 actgaccaga tagctatata aacaacgaag ggaccagata cataatcatt tcaaggttat
   179401 tagaccgact caagaaattg taactccaac gtcgttgatc cagttgcgat gaaactgcag
   179461 actgtaggag acactcttgt gaaaagcaag accgaagaca cagaatgtgt aactgtcgag
   179521 atttccacca ccatattgga aaccgcgagt gttcaaacag aacatctacc agctaaaaat
   179581 tcggaacgaa ccgaagagca gcgtccggaa catctccgtc agatttattc acttcttatt
   179641 attcttatct gggctaccgt actcattata tgtgcactct gtagcccagg tgtgtatgaa
   179701 tatctcacgg gaagcaaggt cgcagtctac gttgcctgtg tcttggcggg attgtcatat
   179761 ggctttatcg gtgtctacga accacggtat ccatggaaca aaatagctat atcggcatgc
   179821 tttatcataa cctctaatat gagtatcgtg acgatcaaac tgttttgtgg cagtactatt
   179881 aatatcgcga tcatcgtctc cggatgtgct ctcgtcatag acttattggc attctatatc
   179941 gcatatagta aaaaagactt taatgttacc attcctcgag tcgctacata cggcattcct
   180001 ctactaagcc ttctgatcgt cttgtggatt cttcgtggaa tacaggtcat cccgctgata
   180061 agtttgacgt ttaccatttt aatctttttg tcgatgactc acgagatgta taatgaacga
   180121 tatggaccca tgaagaagca gcggtccccg atgtcgcatg ccttgacttt gtatctctat
   180181 gttctggtca ctcattattc tgtacttctg cttccttatt atttggagtg tataaataaa
   180241 atctgaatta aatcaaccgg tcgactgggt cgtaaaaacg ttgagaaaaa aatcaggcgc
   180301 gtaagttttt tacgtcgtgt tgtcgtttcc aacgtatcac actctatcga tataagaaaa
   180361 gtgctggaaa ctcaaacagc gcataacgaa gtgctttgat gataaagcac tcttcactcg
   180421 acatgaaaaa taaaacatct atcaaacatc agaaattcac aggagccgac catactctgt
   180481 tggaaaagcg tcgacagcga ttgtctttta tatatttatt gtgtgcgatt cagtttggaa
   180541 tcagcttcct tacaggagct ttaattcgaa ctacttctat tctctaccgc tatctacaga
   180601 cagaaaattg gattgtctac atcggcgccg tatgggcttg gtgtgttcat agttggatag
   180661 tacattcaaa tcaccagatt tcgtggtcgt ccagttcgac gtggctatac ttttcactcg
   180721 gaatagacgc tggatttcta acgattcgtt ttgtaccata ctatgatttg ggggatgtca
   180781 tctggtccta tgtggcgaca acgatcatgt ttctactttc ttggtatacg gccacgagta
   180841 aatcagactt aaaactgttc ggctatgtca gcagaacgca accatggatt atggcgctct
   180901 tatacgctat ggaagtagtt tggggctccc aagtgatgtt catcatcgcg acgcttctaa
   180961 tattttactt attttgtaat atgacttatg agctctattt ccaatggtct acggttctac
   181021 ctcccgattc accggtgagg catgcagcca ccttgtattt ccagcttttt ttgacgcaac
   181081 actgtttctt actgtcattg aattacttgt agtttctgct aacgaaaacg gcgatgtatc
   181141 gactgcaaga tcttccacat ctagaaacta tttccttcag aatagaaaag ctccccacca
   181201 gaggtgattg tgtctcagta tgaaaataaa gcagctagta aacactagat cattagagaa
   181261 tggatttgac taagggaccg ctacttcaag acaataaaaa atatccagaa actgaagcgg
   181321 cagcattgca tctggaaagc agaaccgatc ccatggagaa agtctcgacc gatgaagaat
   181381 cacaaaacac accgcgcaat tctcgagaat cccgttgtcg tcgactgcgt tcgatttatt
   181441 cgttagtggc cgttcaatgt cttctcgctt tcatcatcgg attgatcata tattacaata
   181501 gcaacatcta ttgttatgtt gaatcatggg acgagatttt ttacataggt ccttcatcgg
   181561 ccataataac tcacgttgtc atgactaaac ttcctcgtca aagagtatgg tcgaatgtag
   181621 tgctgcgatc tgcatttttc gctatcgggc tggagactag tttagtcatg gttcgcattc
   181681 tgagtgattt gactatgcaa ttcgttatgg tagcatatat cattactcta tctgtgtttc
   181741 ttctggcttt ctgggtttcc gtcaccagat ctcgttacgt taagttgaca aaattcatcg
   181801 cgacgacagg agcgctgata atcatcgtac tatacttgtt cagctcatgg aacgactata
   181861 tcttggtggt tggttgcatt tttttgatct actatgtatt taatctgatg gtgaatgaga
   181921 ttgattctca gtggtctcgg agcgaattta cggagccttc tattcaccat gcgaccaaag
   181981 tctatctaca gtggacagct ctctgctacg cagtcatagc cactatggtt tggttcacgg
   182041 tgtggggaaa aagtaaattc gcacgatttg tttttaaaac gaggacctag gcacagtcgc
   182101 tgtctcacct agtgaagaac aacgtcgatc gacggtgaca ttatgcgtcg ccgtgataca
   182161 tctgcagcgg cgaccgggtc tgctttatgc ggcaatatct tatgcggaga tcgactacga
   182221 tgtcgaaagt gccgataccg gtcagaagaa ctttccactc cgaatcaaca ccggcatcag
   182281 ctctgtgaga tctatacact tgctcttctc gaattaggga taaatgtttt aactggattt
   182341 gttatagatg tttctggttt tcatcactat gtgcaaacgt ataataacca ctttctgttt
   182401 ttaggaacgt ttttgaccat ggccgcttat ctctccattg cggtctatga tcctgtttat
   182461 ccatggtcta caaaaatgcg tctgaccttt ttctctatag gcatgtccag tagtctcatt
   182521 tgtatgtcga aagtctatac atcatacgca ttacgaatca ttatgatcga ttatgtacac
   182581 gcttttctga tttactggtc aactatctgg atagtcaata ttaaaaaatt acatcaaaaa
   182641 ttaatgctaa agatcatttt aacattagca gtagggaacg ttatcttcct agttgtttgt
   182701 ctcacctgga aacctatgct gtacgcgttt cacgtcatcg ccatagcttt tatatatgta
   182761 gccacagtaa atgagatgct gctacaatgg tctcagagaa tgccttgttc tcaaatgttg
   182821 catgccgcta actcatatat actctttgtg gttttaagcg gtctagttca ctctcttcgc
   182881 tattactctt ctctgtcatg gctctttctc caataaagca agacgcgttc tgaccttcat
   182941 tcagtcgtcg gacaccaaaa gaggcctgtt tcgataaaca ctagtcaact ggaagaaaag
   183001 actgaagctg tgaacaaaac ggtttcgaag atcggaaacc aagatgcgtc cttggttcaa
   183061 cagtcgtcaa gtcaaatccc aaacatgtcg attactcacc atgaaagtcg cgatcactct
   183121 catcaccgga tttttgtcat acgctttgaa cttgatcgac gatgtagaat cagcgaatac
   183181 gtttataact attggaagca ttctaacggc aatcggatat gtttttatcg tactttctaa
   183241 tccttcgtat ccatggtccc catgttcgtt actatgtttt tctatgatta gtatcggcat
   183301 aacgctaatc acggtttcta tgtatgcttc atatggcatc ggctttaatc tggccggata
   183361 tctgtacaca tctctcctta gcatattagc tttttacatg tctccaaaaa aatttagccg
   183421 aatctccgtt atctttattg taactatagg gacatctttg caagccactg ttgtgatgat
   183481 gatttactac ggatcttggt tgtccgtgaa catctgtaac gtcatcattt tatataccgt
   183541 tctgatgtac atgtgttctt ttcaaaaatc tgagagtact gtgtcttgca tgacaaaaac
   183601 cacgctattc tacctgacgt ttaatggtct tctgtatacg gtgaattctt tacgtctgct
   183661 tgtgcacttc tgaaaaaata tagacaaatt ctaaaacgtt aaaaaaatag atgaagttcg
   183721 tttatttgac caggaggata ccattcgtag cggatggtta taaaaccatc attacgacga
   183781 gttttttagt cagaatatgt tacagcagct ataggacagt ttaaacgcaa acttcaaaga
   183841 ccatctagtt caacatctag cgagtaatcc gggttcgaga ccacagcatc gcgttcatat
   183901 taacatcgtc aaaccacccg cgatgaagta tcaaacgaag ccaggtctca tggaaaaagg
   183961 tgaagcacta cttgttgaac caacatcgaa gataccacgt ttatggaaat taatggcaga
   184021 cttgtttgtc cggcccagtt atgaggatcc caaccatcga cgtcaagatc gtttgaacat
   184081 tatcttaaaa tggttatttg tgacgacctg gatctcttta atcactatgg aagttctgta
   184141 cattccggtc atatatgacg ctattatcat gaggcatcac tgtatccttt taatcactag
   184201 catggtaatc gcgatcctga ttcatgtaat cttggactgg tataaagcta aatatccgtg
   184261 gcccatgtgg gtgactatac tcaacaccat gatgagcata ctcatgggtt cggcgatcac
   184321 gatcctaaca tcttttttta ctatgatgga tgcactgttt tcgagtctga tgactatgac
   184381 tttatgcaca ctactttacc gatacgtggc ggtgacaaaa cacaatctgg gatacgttaa
   184441 aatcgccaat tatgtgttca tacctgtata tttctttatc ccgctgctgt ggtatctata
   184501 cggcatccgg atgttaaaaa tcgtcggtct aatgattgca atgggaagca ttttgatgac
   184561 cacttatgag ctagatcaac agcagcattt gttaccgccg gaatttgatt cattactcaa
   184621 acatgctcac aatctgtatt ttggaggaat gtcgatgtac tatggaattc tgttattaaa
   184681 atatggttgg caacatccgg ttaattaaat ggtcgaatat tgtacgtatg tcgtgtgtca
   184741 tttaaaagac gaaggttgac agcattaaca tgtcgtagtc ggtttcacat ccggggcggt
   184801 tcttttctta atgctactct acacttaaaa gtcaatctga ctgtcaacga gccacattca
   184861 gatgaatgca cgttgaagtc aagaagcgtt aaatcaccat gatgcctgag tgtagtttgg
   184921 acgaatgtca ggccgttgtt acaacgaaca ccaaattagc cgcagctcca tctgaagaaa
   184981 gggtaatgtc accccaactg agcaaacaac acaaacgaca tctttgtcta gtctaccttc
   185041 tttttttagc cgagctctgg acaaccatta tcacagtctg tgtttggcag attccggtat
   185101 tgcacacgat catgagtaaa agtctaattc cggttagctg tcattttgct ttgactttct
   185161 tgatgtttat tgtgattact gtacgtaatc cagaataccc atggagctta acaacctctg
   185221 cgattttcgt cggcatgggg atcggcatag gaggaacaac ggcgtctttc atacgagatt
   185281 atgcagattc actcagtgct atctactctg gaactgttct aatctgtctg ctttcattct
   185341 gcgtcgtgct acatgttcaa cacaatttgc tttacttcac tttgcccgcc atgttaacgg
   185401 cagtaccggt gataatcatc attggaagct tcgcggagtt ctggaacata ccgtcgctca
   185461 gaggtttcgc gtgtatgatc ggagttattt cgttgtgttt tagcatcacg tctgaactat
   185521 atatccaatg gcgtattcct gttcagaaac agaagtcttc tatgacacaa gcggcgagat
   185581 tctatctgac tgttcacagt ttgagctacg cgattatgtt caccgataag tatcttacat
   185641 taaaataaag tacagtactg gctccgttct tcttgggtgg acaggggaga gcgcgatcat
   185701 gaatcggagg gaggatttga tcgttaatga gatgatgaac acgttcctgg ttggtaggat
   185761 agtatgtatg acgtcgaact acacatgata aaaagctaac cggtcatcag accaaagcgg
   185821 tacgatgcaa cagcggtacg agaatatcac actaacggta caatatagta gcggtacaag
   185881 agtattatct cgatgacggt acaccacggc ggtacgaaga acggagaaac agaatgccta
   185941 cacagatatg tcgatatgga gagatcaaat acgaatcgtg cacagaccga aaattcgtac
   186001 ttcgaagtca attaaaatgg cacttagggt acttaatgat tatcgcttca aatctcatca
   186061 ctatgacagt gttaggtttt aaggctgcta gaatagcgta cgatgatcgt aaacaaagtg
   186121 atttaaaaca catcttagta acatgtccga aaacgtggat aggttttgga aataagtgtt
   186181 tttacttctc tgaagatact cgaaactgga catttagcga agtatattgt gctggaatca
   186241 atgatacttt agcccagttt actacaatgg aggagctcaa ttttcttaaa agatataaag
   186301 gcccatcgga acactgggtc ggtcttcgaa gacaatcctc taaccacact tggaaatgga
   186361 tagacgagac ggagcataat aacaccttcc ctatcagggg agtaggtgaa tacgcttatt
   186421 tgaacgacaa cggagtaggc agcgccagcg tttacactga ccgaaaatgg atatgtagcc
   186481 gaatgttcaa cactacggtg gcatgtcaca caagtcaaga ttcttcagtt cgttagatct
   186541 cgaagatcat ttgacattta tccgaagcat gcacaacggg aaaattgcat ttgttaccat
   186601 ggactttgaa aagacagcat ctaaatctac aataactcaa acttcaaaag cttatcgttg
   186661 gaaagatgtt ttacatacgt tgcatgtcca ctatgacact tcttcatttg atttattttt
   186721 ctggatcgct ttttacgttg tgtttactgt tctcataagt ctaatggtgc tacatgttcc
   186781 gaccttcaat atgttgaaca gttggagata ttcagtattt ttattaatag ttgttgtgat
   186841 tctctatatt ttattagata actgggatct aggcttactg tggacccatg ttttaatgac
   186901 aacctgctca acactcgcag gcatcacgac agctggttta ctgctttttg aaacagaatc
   186961 ttccacacac ttctgttaca tcatgttaca tgtgacgatc acgctgcaag tctaccgcac
   187021 cgaacaatat ctttaccctt tgaacaatcg tcaacgtctt tgtacttgtg ctgttttctg
   187081 tatgggtctg atttggctaa tacgaagacc ttgggcagtc caaaaattaa cttcgacgat
   187141 gtcttgtgtg atcaccatgt atgttagcat gatggacgac gcatattatc ggcaacgagc
   187201 cagattccgt acaccatatg tcttgagacg tgtggcagac tggtatatcg atctactaat
   187261 gtatggttac actgcaataa tgattcagaa cattgaacga gaataataaa ataattttta
   187321 actactgaac gtgtttggaa aatgtattcg aatacgtgga gcgagatcag tctataaacg
   187381 ttttcgataa acatgcagga tgagaaaaga aaacaacaaa acactgagac ttaataatgt
   187441 tattattgag ctaggggacc atttcttgaa gtatcgctga gaaagtggga cgttacatga
   187501 tgaagtgcag taagtgctat tagatctttc gatcggattt tgtatctgac aagtataaca
   187561 tccatctgtc gtgacgtttc tgatatagga ttcattgcgg ctgatgacag tcaaatcgtc
   187621 ggatgaaaga gaataccagg tgtaattaac aaacgtagtg ttgtaggtat tgatacctga
   187681 acagaacaga cgaacattgc agccctttgc tcgccgagtg acattaaaag ttatatttgg
   187741 tggttggaga ataggatcga atacttgaag attaaaagac catcgacgcg agtgttgagt
   187801 tgtattagta atctgcacga tatacagatt agaatcgttc ggataaactc gtgatacata
   187861 gagtatacca gttccgttta agtgagttcg attttgaaag ctgctgtaat atgtagatcc
   187921 tgtgctacct tcccattcgg cgattttttg agtatcagta catagccagg tgatatcatc
   187981 caaggtttct gtcacccgtc caggaatgga aagagttaaa ttacggcctg aataggcatt
   188041 tacgatataa atagattcgt cggctaatga catggacaga actatccatg tccagatcca
   188101 gttccacatg aatttccgtt tctttctatt agacatttaa ttactacgat cgacgtagca
   188161 ttccacgtat tgtcgcttga gcaacattgt agcgagcaga tattctcctt cgatagatta
   188221 aaaaaagaat tattataata atgattagga gcatcatgaa aaaaaaacct atcccccaat
   188281 gccacctagc agctcgagct tcgaaagaga cattacatgt agtacaaggt gtagaatctt
   188341 ctaaggatgg aaacggtgta ctttctaacg tatctgtcgg aagaccaggt ccagagctaa
   188401 aatctttcga tttacccgta gttcttggat ctctagatgt tttagttgta ggtttgctgg
   188461 taggtttggt cgttctagat gacctagtca ccgacttagt tgtagtccta gtagtggtcc
   188521 tagtagtggt tggtcgtttc gttgtccgag gttcctggtg taacgataat aagagggacg
   188581 aagaactaca tgacgaaagg caaatggtac tgttgcgatg ttgatacggt gtactcacat
   188641 tacacatgta gcatcttgta ctgttctgta acgctatgct tacagttata ggattatttc
   188701 cgctcaaagg acggtatgta ccattagata aaacatgcca gctgcaatta gtatgcggtg
   188761 ggtgacatga cccgttgtaa ctacaatatc cagtaaactc acaacgacca ttgatatttt
   188821 tagcagtcat ggtcacattc ggaccagtca ataagttgaa gtaaacgatt aacacgacag
   188881 atcttgtttg atccgaacgg gaggtcactg ttctaacgta ataagtacct gcatctcgtt
   188941 tcgttacgtt gcgaatcatc aagctaccag tcgttgcgtt caaacgaaac ctttgaagat
   189001 atgtgccgta atatctcagc attacaccat ctcgttctac gattttatta gtcacgttat
   189061 aaaacgacca cacgatcctc gtgggttttt ccgtaggtac tttaggaata ggtaaggtga
   189121 catttccacc ttctcgtgca aatctgtaat catctggatc ctgagatgtg aaaattgcaa
   189181 aaacaactgt acttaaaaat agaagatata aacatcgcat attcaaaaat cacgagtctc
   189241 cataatgctt tattgagacg aaaaattcgg tttacagacc gccaaaatag tgaagccatc
   189301 gctacggcaa ccgcggcacc cagccaaccc acttggcacc cagccaaccc acttggcacc
   189361 cagccaaccc acttggcacc cagccaaccc acttggcacc cagccaaccc acttggcacc
   189421 cagccaaccc acttggcacc cagccaaccc acttggcacc cagccaaccc acttggcacc
   189481 cagccaaccc acttggcacc cagccaaccc acttggcacc cagccaaccc acttggcacc
   189541 cagccagttg tgtgtgtttc tacgttatgg gtataggtaa tattttatag gtttgtagat
   189601 cgaccatgaa acaattgatg tcactaggca agggttaaca acagcaagta agggttaacg
   189661 gcaccaggca agggttaacg gcaccaggta agggttaacg gcaccaggca agggttaacg
   189721 gcaccaggca agggttaacg acagcaagca agggttaacg gcaccaggta agggttaatg
   189781 gcaccaggca agggttaacg acagcaagca agggttaatg gcaccaggta agggttaatg
   189841 gcaccaggta agggttaacg acagcaagca agggttaatg gcaccagata agggttaacg
   189901 gcaccaggta agaattaata gaaacaacgg ttatatttca gaataaatga aaggttattg
   189961 agaggtctgc caagtgttat aagttcatgg ttaagtgcca agtgagtagg ggtcttttgt
   190021 actaggagta cagccaaggc attcatagca cggaaataac aaggtaaaaa tagaatgttc
   190081 tgggacagag gatgtcagtt gagaacatac tgggcgttct gccatcaatt gttaacattt
   190141 ccttttggaa caattgatgg caagaagcct acctgggaaa tcagccaggt actttccaaa
   190201 aacgtcattt cggtttctaa aacggaatca ttgattggag gggactcggg ccaacggaaa
   190261 acaacgtcaa tggccagcct actcggtaag tacataagtc cagtacggat agagcagctc
   190321 agacggcgtt ctgagctgct gagcacggtt acaagaaact gcttaacctt gcaagcaaag
   190381 aaaatggatc caaaaatata tctaattttc tcattgctta ttatcagttg ttcttcaatg
   190441 acaatgaagg aagaaatgcc gttctttgga aatgaagatg acaataacag tgatgtggga
   190501 tcaggaacat cggacgacgt aatttttaca tctccatcgg cctcgacgaa tctgcaacca
   190561 acaccttctc aatacaaaga gctctgcgat accggtaaga aacaaggaat agactggcaa
   190621 aacaatcctt taagaactct tttattatcc tcagaattat cagagacaga tatatatgat
   190681 atagagatat attgttcatc tatttgtgta ggagactggg aaaactgtaa aataacaaat
   190741 gtcagcggga aatgtaatgt taaggattca atgttaaata ttaagatcga agtcaaagga
   190801 atttttatgg aaaatttatt gattaattat gtagcattac attattataa atcgccgata
   190861 atgaatctca gagacttaat agttttaacc agaattgata aaaatacata ttggctgcaa
   190921 tatgacaata taacactatt agatcctaaa gcattacaac tcgtgatgag tccttgttat
   190981 ctatgtgagc gaaaagattt tgtttgtacc atatctactg aagttactgt gctgccactc
   191041 gactgttcat taatagactt tgtgcatata tacctagaag agagatattt attagcgtta
   191101 tgggtttata tcctattatg tgtgagaatc ttcttagtag caagattgtt agaatcatat
   191161 cagtgtttta cattggaatc ttcaagtggt tggaagttgt ttgctaagtt gatgggggtt
   191221 atgatagtga gtgtaataac agtgtgtata gcaaccggag acatatatgc gatatacaaa
   191281 ttcttgttac aaaatggcgt gtcttaaaaa tttgcgccgt catattttat agactgtgca
   191341 aattcaaaat ccgcgaagaa agatctgaaa aaggaactgg aagaagaatg gctaaagttg
   191401 caactgggag aacacttcac caaggaccct ttcgatagta aatacccaaa tctgacgtgg
   191461 taaaacgacg gtgcagtaaa aagtcgggaa cattcaatgt cgtgtgaagc agtcgaagag
   191521 gagcattaaa tgtcatgtga agcacttttt tcaaaggcag caacgttgta tgaagcagtc
   191581 tgtataataa attacccttg tactatgatg tgtttctgtc gttattaccc gcgacgtttt
   191641 gaataagtct ctatacaaag ggaaagacta caaagtatag gctgatactt atgactgttt
   191701 cataagtagg aaaaaaagta ggaaaacatg gatttgggat tggatatgtg attggcgaga
   191761 actgcttaca aagggaaacc acgtcagtga gataaatttt ataaacagca gctaagtgcc
   191821 agcagttcag gtgttttcag gaatcatcat gaagtgggct atagttataa tccacattct
   191881 tttcggagcc ttatgctgtc gcggtgtggt acctggttac ttttttcatg aatggatgct
   191941 ggagttcttt agtcctgacc aaatcacaag taccgaaaaa acgcaatcgt cagaatcgcc
   192001 aggatccaaa cctcatgctg aaaccaaatc tggacccaag ataccaacgc cagaggagtt
   192061 taaaaagttt tgtgatagcg gtaagcataa cttgacagac tggttaacat cccctttaag
   192121 gaaattgttg ctcacaagat acgccactaa catacacttt gaagtagatg aatattgtaa
   192181 acatccttgc gttggaggtg atgatggctg ttacattcag aaagtagaag gagaatgcaa
   192241 gctgaaggac ggagattttt cagtgactgt tgtgtataca gggaactttt atctaaattt
   192301 gactatcaca tattttgtaa tgcaagacta tgtaggtaat gcaaaagatt tacaagattc
   192361 agcattcttg gagagattaa ccgataataa gtatatgctg acatatgaga gcccggtcag
   192421 aattgtccat gttaaagaga tacacttgga agtctgtccg tgcgaagtct gtcgtagaca
   192481 atatttcact tgtattgtgt ccactaaagt aactatttca ccttttgagt attatggctt
   192541 aggagatgtg attcatcttt ggttagaaag tcgttactgg gaatttgctt gggtatatat
   192601 attgataatg ataaggttat ccttgtgttg tatgtttttg ggagacatct ttgggatatt
   192661 ggataggatg cagggatgga gtccgttgaa gattgttttg tatatctggg ggcaactagt
   192721 gttttgggta atcttgcttt atctagtatc aggggagctg gatgccctat ggtattacat
   192781 gttaccgaaa gggcaatggt aacctaacta gaatctgtta tacaggttct cttgaaagaa
   192841 agattaaatg tgaagcagca atgcgttgga atggagagat gcaaatagca gaagcagaag
   192901 cgttagcaac acgtgaggcg gccaggttag ccaaacaaag agtcatcgaa ttacgtgcat
   192961 ctgcaatgat ctgggtacaa acacaggtag aacatatacg tcaaagacaa gcagaactcc
   193021 gtctagatat agaagcagcc acacgaatgg atgtgaagtc agtggcagaa gaggaatgga
   193081 aagctgtcca agacgatttg aaatatgcta gagaagaagc tcagatggcg agagaagacg
   193141 cagagtcagc aatacaagag gcagagaacg cgcggcgaca gcatgaattt atagctaaac
   193201 gtgttgacga attgtatgag gaagccgtgc ggctcgggcg gctgacggcg ccggagcggc
   193261 gcggcgactg gcagcagcag cagcagcagc agcggcggca ggaggagctg tagccgcccg
   193321 gaggagtggg tccctctcca gccctttgct gccttttcag ccgccgccgc ccggaggagt
   193381 gggtccctcc ccagcccttt gctgcctttt cagccgccgc cgcccggagg agtgggtccc
   193441 tccccagccc tttgctgcct tttcagccgc cgccgcccgg aggagtgggt ccctctccag
   193501 ccctttgctg ccttttcagc cgccgccgcc cggaggagtg ggtccctctc cagccctttg
   193561 ctgccctttc agccgccgcc gcccggagga gtgggtccct ccccagccct ttgctgcctc
   193621 tccagccgcc cgccgcccgc cagctcccgg gtcccgctcc cactcccgct cccactcccg
   193681 ccagctcccg cgccccgccc gccccgggga gctgcagtaa taaagaggag ccggaacaca
   193741 ctggcgtgct agcgtggtct ttattgcgcc tgccccaccc ccacctcagc gcgtctggca
   193801 ctcgcggccc ggcaggctca gcgccatgcg ctggacgccg ccgcagaggc cgccgccgcc
   193861 cgcacccgca cccgcacccg ctcccggccc tcccgcgccc ccgcccgccg ccgcctggcg
   193921 cgcctctcgc gcctggcgcg cctcgcggct cagcgtgcgc caggcggcgc ccagctgccg
   193981 ggcgctctgc acggcggcgg gcggcccgcg ggccgggtgg cagctgcagt cgcagcagca
   194041 gggcccggcc agggccgcgc cgcaggggcc gccgccggcc ggctgctggc tgtcctgggc
   194101 gccgtggccg ccgccgccgc cgccctggcc gccttggccg ccggcgtggc cgcggacctc
   194161 gccgccggcg ccctctccgc ggctggccgc ggcgtcgtcg gcgtcgtccc cggcttcggc
   194221 ccccgagccg gccgggctct ccgcggccgc cgccgcagac gacgttgacg gcgccgcggc
   194281 gatggggggc tccggcgtcg tctccagcgg cggccgcggc agcggccgca gcagctcgcg
   194341 cgagtcgcgc gcgcggaact tgctcagccg ccgggcggcc acgtcctcgg gccgcgacgc
   194401 gccgcgcggg tactcctgcg ggtcggggtc ggcgaacgcc gtgcgcgggt ccggcgcccg
   194461 cgtcggccgc cagcggtcgc ggtcgtggcg cagcgcgtgc gacagcgccg ccgccgggct
   194521 gcggggcggc gagcgctggc acagccccgg caggcccagg agctcggcgt cgcgggcccg
   194581 cagcccggcg tcgcgctcgc cgctgcgccc gccgcccacg gcgcccgcgc ccgccgccag
   194641 gccctggaag cggtcgctgc gcgtcaggaa gcgcagctgg ctgcccgggt cgcgcagctg
   194701 ctggtgcgcg cgcgggtgca ggaacagcgc gtcggcgcgc ggcgtctccc agaactcgcg
   194761 gtccaccggc ggcagcaggc ggaacgccgt ctccgtctcc gacgacgacg ccgtgcggcc
   194821 caggtgcagc agcgacagcg tgccggcgcg cagcaggtgc cccaggtcgt cggccagcgg
   194881 gtacagctgc ccgtccagcg tgcagtacgc ccacacggcg cacagctcgt ccagcagcgc
   194941 caccagcggc acgcgcgcga tcgactcctt cggcaggttg ctcagcacca cggccagcgg
   195001 gtaccaggcg cagcacagcc gctgcgtcac gtggcgccgg gccgcctcca ccagctcggc
   195061 cggccgcgcg tgcgagcaga agggccacac gttccgcagg tcagaccagc gcggccacag
   195121 caccgccgtc tgcgccggcc ggcccggcgt caccagctgc agttcgtgtc cggcgtgcgc
   195181 ctccgccacc gcgtgcgccg cgtgcgccgc gcggctggcg gccgccagcg cctcgctcag
   195241 ccgcgccggc tccgtcgtgc tgcggggcag caggtcgcac gcgtacagcc gcgacacgcc
   195301 gcccagtccg aagcggaaga actcgtcggc gtcgcgggcc gccaggtgca gggtcagtcg
   195361 cgccaggtcc agcaggaaca cgcggaaccg cggacccacg cccaggtaca ggccgtccgt
   195421 gcggcaccag ccgtccgacg tccacggcga gcgcgcctcc agccgggcgg cgtgggcgcg
   195481 gtcctgagcc gccgacggca cggcgtgcac caccgtcgcc accaggacga tccactcgtc
   195541 gctcggcgac atctgccgca ggtcggtggc gcccacgccg ggcatctgcg agcgcggagt
   195601 caccacggcg aagaacccgt gaggccggcc caggggcagc acgccgccct gctcgcgctg
   195661 gcaccagcgc cgcgtggcgc gcgccgtcgt gttggccaga aacgcgccgg cccacgcgct
   195721 ggccagggcg cggaactcgt cttcggtcag ctcgggacgc ggggacggcg gcgtgctcac
   195781 cagcgacgcc gcggacggag cggacggagc ggccgctcca gccgacagcc gccccggctc
   195841 cgcgccgccg ctcatcttca ccgcgacggc gacggcaggc cgcgacgtgc actgcagcgg
   195901 agagcgcgga tggccgccac gcgggactgc agtctgcact gcacgctgca acacacgccg
   195961 tagcacagtc gggacaggga ggcagctaat aaaccacgag gccccgccgc cggcacgcgc
   196021 cctcgcgaga gtcttcccgc tctgtccggt cacaggcacc tagggcacac ggaggtggtg
   196081 gacgtcttag ggcaagggcg gcgcggaagg cccggaacgg tggccgcatt caggggagga
   196141 gtcagcgcac ggcgacacgc agctcgcgca ctcaggttcc ctggacgcgg ctgtcggcca
   196201 aggcgcccac cagcagggca ggggccagcc ggcagccggc cacgggaaca cccaggggtt
   196261 cgaacaccac ggccacccgg accacccgga ccacccggac caccctgacc accagggcgg
   196321 cgccagagac cacggcccac acacgggcca gggaggcagg agcgccggga cggcagcgga
   196381 gggcgcaggg gccgaggccg ccgcacagtc ggccgcacag tcggctcccg cggagaaagg
   196441 ggaaaacgcc gacggcagtc gaggcgcggg acggtggacg ccaggctccg cactgggagg
   196501 cacaggggag cgtctgcctg ccgctggact gctgccaacg tacggagaga cgtggccgga
   196561 aggctgagga tccagcgaag aagccagctg agccagctgc gccaacgggg aaagctggct
   196621 cagagccggt ggacctcgag gcagcagaca cgcttttctc ccccggccgc acgattgcac
   196681 gcgctcgact g
//
DBGET integrated database retrieval system