GenomeNet

Database: RefSeq
Entry: NC_016838
LinkDB: NC_016838
Original site: NC_016838 
LOCUS       NC_016838             122799 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS1,
            complete sequence.
ACCESSION   NC_016838
VERSION     NC_016838.1
DBLINK      BioProject: PRJNA84387
            Assembly: GCF_000240185.1
KEYWORDS    RefSeq.
SOURCE      Klebsiella pneumoniae subsp. pneumoniae HS11286
  ORGANISM  Klebsiella pneumoniae subsp. pneumoniae HS11286
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Klebsiella.
REFERENCE   1  (bases 1 to 122799)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 122799)
  AUTHORS   Ou,H.-Y., Jiang,X., Liu,P. and Li,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2011) State Key Laboratory of Microbial
            Metabolism, Shanghai Jiaotong University, 1954 Huashan Road,
            Shanghai 200030, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003223.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
            Source DNA is available from Hong-Yu Ou at hyou@sjtu.edu.cn.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..122799
                     /organism="Klebsiella pneumoniae subsp. pneumoniae
                     HS11286"
                     /mol_type="genomic DNA"
                     /strain="HS11286"
                     /sub_species="pneumoniae"
                     /db_xref="taxon:1125630"
                     /plasmid="pKPHS1"
     gene            201..1418
                     /locus_tag="KPHS_p100010"
                     /db_xref="GeneID:11818038"
     CDS             201..1418
                     /locus_tag="KPHS_p100010"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein A"
                     /protein_id="YP_005220808.1"
                     /db_xref="GeneID:11818038"
                     /translation="MLSAVNDMLSAVRYMLPTVLCMLSAVIDVCCQRLEPKGIHMSTK
                     NKKESEIKEIPEDNEILEEDALNLYTGDLVPNSNNTVQPIALMRLGLFVPTLKGTKNS
                     SRNKSNMIDASRELVQLEVARSEGYSNIKITGPRLDMDHDFKTWVGVVRSLAEYGEPT
                     GRVELSITKFAKFCGYPSSQIRKTLRDRLTNSLLKIMRTTLSFQRTHEEKNVDDTNKI
                     SLLMVHLINSVDYNEKKDSIVFYAEPKLSELYRFDHKVLLQLKVINKLPRKETAQALY
                     TFIESLPPKPAPVSLARLRARLNLSTRNVSSQNQTIRNGLKSLQELGYLEYSEVKRGR
                     SVYIQIHSRNPKLKVTSSKPEKPEAPKQAEEAKGEIDAKQNLKNKISELSQNLTPENI
                     KLIEILTNSLKLL"
     misc_feature    1047..>1235
                     /locus_tag="KPHS_p100010"
                     /note="Sugar transport-related sRNA regulator N-term;
                     Region: SgrR_N; cl26310"
                     /db_xref="CDD:331131"
     gene            complement(1870..2082)
                     /locus_tag="KPHS_p100020"
                     /db_xref="GeneID:11818039"
     CDS             complement(1870..2082)
                     /locus_tag="KPHS_p100020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220809.1"
                     /db_xref="GeneID:11818039"
                     /translation="MALTMTGLEIEKTSGYWRAKGFRKPDMLERLEREDGYIIHQRRE
                     WRMFDPETGKLTSKAQTLWGLLKQIH"
     gene            complement(2082..2696)
                     /locus_tag="KPHS_p100030"
                     /db_xref="GeneID:11818040"
     CDS             complement(2082..2696)
                     /locus_tag="KPHS_p100030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220810.1"
                     /db_xref="GeneID:11818040"
                     /translation="MVNGSGLAIFREFQALALFRSHLQLKIDKLVFTYYEDIHRYPVT
                     HLFNTVYVGLPDDRDTQESSVSCQRNHCEHARTGAGRHLYSTGLHRDSGMRKITLLLA
                     ALSFSLLADTRIYQCDMTVSQVKNDQISRPTKADFGALVVDSGDQFYVVRGDEVLSSP
                     YLAKRNGKLVGVGEDKLIYNKSHDVYGVHSKNQSFFFDGCKEVG"
     gene            complement(2780..2956)
                     /locus_tag="KPHS_p100040"
                     /db_xref="GeneID:11818041"
     CDS             complement(2780..2956)
                     /locus_tag="KPHS_p100040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220811.1"
                     /db_xref="GeneID:11818041"
                     /translation="MKRLWDAANAALDVIDAEIAQGLPEPEWAAQLREVIALIDEPSP
                     EQDDCSPYLDLNNK"
     gene            complement(3127..4149)
                     /locus_tag="KPHS_p100050"
                     /db_xref="GeneID:11818042"
     CDS             complement(3127..4149)
                     /locus_tag="KPHS_p100050"
                     /codon_start=1
                     /transl_table=11
                     /product="putative recombinase"
                     /protein_id="YP_005220812.1"
                     /db_xref="GeneID:11818042"
                     /translation="MTRSKKVSHWIDSGFPPLNKAISGRYDGGFPSGRIVEIFGPPSA
                     GKTFLATAAMVSAQKQEGLAVFLDHENSFDVGLAVANGLNADEDDGQWVYKQPDTFEE
                     SVELIGTILKLVRDEELIPADAPICIVADSLASMVPNSKAEKFDKMAEGTAKDKDQLN
                     MNDNTALARATSANFPTLALWARKYNACIIFLNQVRTKIGVMFGDPTTSPGGDSPKFY
                     ASVRIRLGASVMKDGKDKIGQDVGAECIKNKVAPPFGKCSWKFYFDPTRGLDVIESLV
                     EHMLEEGYLPKNASGRVEIGDKKYTKSQIVDMYRDKPLPEIIAALQAIDERRAKESAS
                     AETEEA"
     misc_feature    complement(3301..4143)
                     /locus_tag="KPHS_p100050"
                     /note="RecA/RadA recombinase [Replication, recombination
                     and repair]; Region: RecA; COG0468"
                     /db_xref="CDD:223544"
     misc_feature    complement(3280..4068)
                     /locus_tag="KPHS_p100050"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(order(4009..4017,4027..4032))
                     /locus_tag="KPHS_p100050"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(3754..3759,3943..3948,3952..3954,
                     4009..4017,4027..4029))
                     /locus_tag="KPHS_p100050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(3757..3771)
                     /locus_tag="KPHS_p100050"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(4115..4474)
                     /locus_tag="KPHS_p100060"
                     /db_xref="GeneID:11818043"
     CDS             complement(4115..4474)
                     /locus_tag="KPHS_p100060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220813.1"
                     /db_xref="GeneID:11818043"
                     /translation="MLKSLINGNTTTPTMLAKEIVFFHGEHAVVALPRILGAAGMSVT
                     EREYGLISEQVVKILSRMAKHLNHDAIKFDEAAASKRINETKRSLRMAKGKSALAMAL
                     KKKIGSNDEIQKGFTLD"
     gene            complement(4474..5418)
                     /locus_tag="KPHS_p100070"
                     /db_xref="GeneID:11818044"
     CDS             complement(4474..5418)
                     /locus_tag="KPHS_p100070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220814.1"
                     /db_xref="GeneID:11818044"
                     /translation="MNYLFVDGNSLGYYHQQSDKLHNGEMEVQAVFGFVKNVRRYASI
                     LHARPMILWDGFSDKRRDYYPDYKANRDEDPEMKRMKEGFAVQKPYILKMMAALGVNQ
                     LIAKDAEADDLAGMLVGRLAPQPTVDHIYLLTGDGDWLQLVREKVSWVSLREDAKHKQ
                     VNFEQFPELIGLPTPRAFLEAKALQGDTSDNIKGVGGIGDGGAKELLHEWGSVAAMVR
                     GINDGSIVINKGRYKTAFNKLAKNAFNEKTGCRMLEAFKRNMTLMNLIDTKFPPSEIE
                     KIKGARDLKAFELLCHELNFRSFLEDLDVFVLPFERYC"
     misc_feature    complement(4948..5412)
                     /locus_tag="KPHS_p100070"
                     /note="FEN-like PIN domains of bacteriophage T3, T4 RNase
                     H, T5-5'nuclease, and homologs; Region: PIN_T4-like;
                     cd09860"
                     /db_xref="CDD:350210"
     misc_feature    complement(order(4951..4959,4963..4965,5005..5016,
                     5086..5088,5092..5094,5155..5157,5167..5169,5179..5181,
                     5236..5238,5251..5253,5257..5259,5287..5292,5296..5304,
                     5308..5313,5365..5370,5374..5382,5386..5391,5398..5400))
                     /locus_tag="KPHS_p100070"
                     /note="active site"
                     /db_xref="CDD:350210"
     misc_feature    complement(order(5086..5088,5092..5094,5257..5259,
                     5398..5400))
                     /locus_tag="KPHS_p100070"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:350210"
     misc_feature    complement(order(4951..4953,4957..4959,5008..5016,
                     5155..5157,5167..5169,5179..5181,5236..5238,5251..5253,
                     5368..5370,5377..5382,5389..5391))
                     /locus_tag="KPHS_p100070"
                     /note="5' ssDNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350210"
     misc_feature    complement(order(4954..4956,4963..4965,5287..5292,
                     5296..5304,5308..5313,5374..5376,5386..5388))
                     /locus_tag="KPHS_p100070"
                     /note="3' ssDNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350210"
     misc_feature    complement(order(5167..5181,5206..5223))
                     /locus_tag="KPHS_p100070"
                     /note="helical arch; other site"
                     /db_xref="CDD:350210"
     misc_feature    complement(order(5005..5007,5011..5013))
                     /locus_tag="KPHS_p100070"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:350210"
     misc_feature    complement(4627..4899)
                     /locus_tag="KPHS_p100070"
                     /note="H3TH domain of bacteriophage T3, T4 RNase H, T5-5'
                     nucleases, and homologs; Region: H3TH_T4-like; cd09899"
                     /db_xref="CDD:188619"
     misc_feature    complement(order(4807..4809,4822..4830,4834..4866))
                     /locus_tag="KPHS_p100070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:188619"
     misc_feature    complement(order(4849..4851,4858..4860))
                     /locus_tag="KPHS_p100070"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:188619"
     gene            complement(5479..6486)
                     /locus_tag="KPHS_p100080"
                     /db_xref="GeneID:11818045"
     CDS             complement(5479..6486)
                     /locus_tag="KPHS_p100080"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulator"
                     /protein_id="YP_005220815.1"
                     /db_xref="GeneID:11818045"
                     /translation="MSKSLLDLLNKTRGDIASKRGNNVDLTRLKDGNNYLRIFPNKED
                     QNGVFFQTFGMHYVKHQNEEGKEVTTAYICEQHTHNRACQLCEMVMEGRARYKGNKAM
                     EERIGQMRATPRYLVNGVLSAREDFGDAEKCQLIELPSTVFDDICKVMSEDIADDIGN
                     PLSKEEGYAFLIKRTGSGRDTKYDVSPKRKVYKGDIPEKLWSTQHDLIAYANQADETR
                     LLSTVRTMGRLIGIAAPAATTAAISSPAAASAATLPGFGTITGHTEGAAAVATTSTPE
                     PAKTSLVDEEILRAAEAEFVPEPEEVKASAAAATTTAAATSTSNDDEGLDDLLAELES
                     L"
     gene            complement(6606..7037)
                     /locus_tag="KPHS_p100090"
                     /db_xref="GeneID:11818046"
     CDS             complement(6606..7037)
                     /locus_tag="KPHS_p100090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220816.1"
                     /db_xref="GeneID:11818046"
                     /translation="MSTEIYEKIMTDLEFDRDNLEEVWRQQPRLLMEYGARLARAERE
                     VADAKLSLDAIEAKIYDIERKNLSMNGIKFNESVLEAKVRTSPQYLAKRQKLDDARLI
                     ADIYKHAVTAFSHRRDMIVQASKMAIVEIERLGAERFTPTR"
     gene            complement(7202..7501)
                     /locus_tag="KPHS_p100100"
                     /db_xref="GeneID:11818047"
     CDS             complement(7202..7501)
                     /locus_tag="KPHS_p100100"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_005220817.1"
                     /db_xref="GeneID:11818047"
                     /translation="MPRTIKGIAIVATSLILSGCAFPDKDGDFGAYVHSCQQYAYGKA
                     YAFEHRDLAYKICKDAAKLWGDEVPAYVIRQIKLHPEIPEDEIKYAAMAGSLGNN"
     gene            complement(7638..7892)
                     /locus_tag="KPHS_p100110"
                     /db_xref="GeneID:11818048"
     CDS             complement(7638..7892)
                     /locus_tag="KPHS_p100110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220818.1"
                     /db_xref="GeneID:11818048"
                     /translation="MVGCAGMKIPNYDEVKTSPHYTECREFAADVYKNNGYSKEANTV
                     IFNMDDRKAQAIVSGCVVTMSKNSIEEAKADLNKRLQLMG"
     gene            complement(8133..8558)
                     /locus_tag="KPHS_p100120"
                     /db_xref="GeneID:11817908"
     CDS             complement(8133..8558)
                     /locus_tag="KPHS_p100120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220819.1"
                     /db_xref="GeneID:11817908"
                     /translation="MSAANKIAQELTAIPQEFQDKAIEATLRSQFWEIIDCPVTLDLA
                     LAFAKQDGADPICRLRKCARALALKTQDPKACQYLLEIYESDKPEEELASFKTFRDRL
                     VLKVAKEFMEVSKIGDVRKYRLKRQTRVTLSNIFGKKVA"
     misc_feature    complement(8573..12090)
                     /note="potential frameshift: common BLAST hit:
                     gi|294502044|ref|YP_003565781.1| DNA polymerase III"
     gene            complement(8573..9067)
                     /locus_tag="KPHS_p100130"
                     /db_xref="GeneID:11817909"
     CDS             complement(8573..9067)
                     /locus_tag="KPHS_p100130"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III"
                     /protein_id="YP_005220820.1"
                     /db_xref="GeneID:11817909"
                     /translation="MGLGDELIRPSIGIKPKIMVILDNANGNDARTGYFMENGYDDFK
                     AKLLVSGDLRMGDLYVTGVCKKVKDKEKDYTKDEIGQFIDFMREEINLVRPTYVLTCG
                     SRATSLFNNKSKPSDLVGRKEYLPDLDVTVFYGFNPNILYFRPEEGEKLEAILAEVAE
                     TINK"
     misc_feature    complement(<8705..>8932)
                     /locus_tag="KPHS_p100130"
                     /note="Uracil-DNA glycosylases (UDG) and related enzymes;
                     Region: UDG_like; cl00483"
                     /db_xref="CDD:320999"
     gene            complement(9046..12090)
                     /locus_tag="KPHS_p100140"
                     /db_xref="GeneID:11817910"
     CDS             complement(9046..12090)
                     /locus_tag="KPHS_p100140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA polymerase III alpha subunit"
                     /protein_id="YP_005220821.1"
                     /db_xref="GeneID:11817910"
                     /translation="MKALMVRTDFSLGESALKAEHAVKVAKEAGYTAVISADTMNIAS
                     VIPLQRAAGDEMAVICGVKLNVVDDPTYEYRAKLAKESNGCMESLERGRNYCFTALIK
                     NEQGYRDICELMTLANTREQFYFVPRLALEQLAATYAKGNILLLTSDIGSVFQRPDFA
                     KIISALITAGGRENFYSVVYPHPTPFYDQINVRAMKVASALKIEPVAFYPAYYEGVDD
                     ADIKDIAHMVMNNIKVDQPHRLRIPHQRDNAINGRRHLLQALKEFSVRMGVSVSAAMA
                     STTQDSIVKACEWRWHEMAPALPKMADDEPATLMKLAVAGLRKRLSNKEFGYTPPASE
                     HRVYVDRLKYEMETLTRLGFCGYFLMVRDLMNHSRETGIPVGPGRGSSAGSLVAWCIG
                     ITNVDPIRHGLLFERFINPERLDLPDADLDFSQARRHEVIEYLNARYGEEYVAGIPNF
                     TYLGAASALRDTARIYGVDAADMAVSKELKTLEDDSLSLSELREQLASLDKYATKHPD
                     AFKAASKLQNLMRGFGRHAAGMIVAGVPLTERTPVERRGDARCIAFDKRYCEAMGLIK
                     LDVLGLATLDLLDSAKRYIKESTGKDINLDAIPLDDRKVLDGFAAGYTQGVFQLESGP
                     MRKLLKDLGGGIEPMSFKTVVATTALFRPGPIQSGMLDDYVAVAKGFMPPQSLHPVLD
                     ELTAETNGVILYQEQTMNATRLLAGFTMAEADGVRKAIGKKDMEKMKSMGEKFIVQAQ
                     AGWIDVVMEDGTAQRIHRAEHFKCEDGKLRTVEEALDAGVKLPMAVVSVTGSHPGLSE
                     TKASEIWQAFEKNGAYQFNKSHSVAYSLISYQSMWLKTHFPAEFFAAALTILGEDKHQ
                     GLVKDALTYGIRVLPPDINMSSNRIEIRTLEDGSQVLYAPFSAVKGCSENGCQAIMRA
                     REKVGGKFESLAQFEEAVEKRACNSRVRESLQKVGAFASIEPGSMPAIDPVRLRDQAE
                     LMGNLVIDAVKASRPFEMNPKRSAEVNVLMTRMAAEWAWAMS"
     misc_feature    complement(<11641..12081)
                     /locus_tag="KPHS_p100140"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     alpha-subunit of bacterial polymerase III; Region:
                     PHP_PolIIIA; cd07431"
                     /db_xref="CDD:213986"
     misc_feature    complement(11563..12075)
                     /locus_tag="KPHS_p100140"
                     /note="PHP domain; Region: PHP; pfam02811"
                     /db_xref="CDD:280902"
     misc_feature    complement(order(11917..11925,11932..11934))
                     /locus_tag="KPHS_p100140"
                     /note="PHP Thumb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213986"
     misc_feature    complement(9868..11166)
                     /locus_tag="KPHS_p100140"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; pfam07733"
                     /db_xref="CDD:285034"
     misc_feature    complement(9223..9495)
                     /locus_tag="KPHS_p100140"
                     /note="Helix-hairpin-helix motif; Region: HHH_6;
                     pfam14579"
                     /db_xref="CDD:291259"
     misc_feature    complement(12271..13466)
                     /note="potential frameshift: common BLAST hit:
                     gi|294502045|ref|YP_003565782.1| porphyrin biosynthetic
                     protein"
     gene            complement(12271..13116)
                     /locus_tag="KPHS_p100150"
                     /db_xref="GeneID:11817911"
     CDS             complement(12271..13116)
                     /locus_tag="KPHS_p100150"
                     /codon_start=1
                     /transl_table=11
                     /product="porphyrin biosynthetic protein"
                     /protein_id="YP_005220822.1"
                     /db_xref="GeneID:11817911"
                     /translation="MTVNINTPYPEFVPEVKAGYVYGDFDLIKDIFMMLEIGIPGYLW
                     GHAGTGKTSLPTQLCALLNRPVIRSQHTASTEEAHITGQILAREGTTYFEPGLLSLAM
                     KNGWVYLADEYDFAFPQILGIYQPVLEGEPLVIKEATPDWRRVAPHKRFAFIGTGNTN
                     GSGDETGLYQGTNIQNAANFSRFGIVSHVKYMKPGAEVNMLVEAGIIREYAEKMVKFA
                     NLVRDGYEQHLISQPIGPRELLLSAKIGMMRGDFAAGIEKSFINKLPSTSAQAAREVV
                     QKIFG"
     misc_feature    complement(12274..13086)
                     /locus_tag="KPHS_p100150"
                     /note="Cobaltochelatase CobS subunit N terminal; Region:
                     CobS_N; cl26344"
                     /db_xref="CDD:331165"
     gene            complement(13158..13466)
                     /locus_tag="KPHS_p100160"
                     /db_xref="GeneID:11817912"
     CDS             complement(13158..13466)
                     /locus_tag="KPHS_p100160"
                     /codon_start=1
                     /transl_table=11
                     /product="putative porphyrin biosynthetic protein"
                     /protein_id="YP_005220823.1"
                     /db_xref="GeneID:11817912"
                     /translation="MPSPANGAEKSFHHLKSHISMGRCEGIPEEAKGLGVDDVVKMYT
                     TAFPGEPTLSPKAIEALKNKRSEKAGADGKIADISSHPGYAGTVESKLSLSPLTSCLA
                     "
     gene            complement(13600..15885)
                     /locus_tag="KPHS_p100170"
                     /db_xref="GeneID:11817913"
     CDS             complement(13600..15885)
                     /locus_tag="KPHS_p100170"
                     /codon_start=1
                     /transl_table=11
                     /product="porphyrin biosynthetic protein"
                     /protein_id="YP_005220824.1"
                     /db_xref="GeneID:11817913"
                     /translation="MATKPSKTVLKEVQDFRDSVKRVVGLLSGKNIPVAECGDTAYVR
                     YNKKGEPVMVNIPSIPDDASPALMNAIRGFLDHEVGHLLFTDEKVVKKMRNTKAFGLW
                     NALEDVYIERRMSEVFTGSRRNLLSTRNLMIDKYFNPHVKKAVAMCRGDQRELFLKFF
                     LCPVLRAWDGQPTFADFMEEHWHLIDKPIAVLKEFGVDEAVRRMDSTEDCVKVAAAMA
                     KILREMTEMPEGPLPERESSLTKKTEPEEDSSDEPAAGDDTEVCDEEGLDSTPDEFSS
                     DDEDDEKSDKSISKYIPNNDKVINDTESKPEDGDLGHENVDDLPDSEETTADDPVTSL
                     GSDAGEEVDDEGDYSPSTNDSAKDRPGSSSDDSEAVEDGEGEGKADKDGGEEKDEGDR
                     DTSDESDAGFAPHADDMSLDDALKALENVDEEIGSSTEDALASAIKSELASASLSDYR
                     PYNRSYDFLGPIDEAEEHIKRARKAFGAIPMYSPVDRYRIVPEGRKLFEMKVERHLSS
                     SVSSTLAKDLERAIASRNRVQFIPGQRRGRVHGASLYRLSMNDDRVFRRKEDHKAVNA
                     CVQQVIDLSGSMGGRKIELALASAYTLADALDRIHVPNVITGFTTYGNPDVATMSKRG
                     FSRFEALMLPIIKNWHEKANSPEIRARMGCVAETFPLLNNVDGESIAQLASLFAGRME
                     DKKIMIVQSDGAPCAAGDGFSNHLRSVTNDIENTSDINLLAIGILTDAPRRYYKNYAL
                     VNKVEELGTSVVSELSRIILE"
     misc_feature    complement(13603..15546)
                     /locus_tag="KPHS_p100170"
                     /note="Cobalamin biosynthesis protein CobT; Region: CobT;
                     cl25849"
                     /db_xref="CDD:330670"
     gene            complement(16002..16214)
                     /locus_tag="KPHS_p100180"
                     /db_xref="GeneID:11817914"
     CDS             complement(16002..16214)
                     /locus_tag="KPHS_p100180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220825.1"
                     /db_xref="GeneID:11817914"
                     /translation="MEKLSSNLLALNVGNVFALTHLEAAEVLSELPNHQVNVRARDAT
                     VFRFSLENGSFTLINTGDLSFAVRIN"
     gene            16488..16868
                     /locus_tag="KPHS_p100190"
                     /db_xref="GeneID:11817915"
     CDS             16488..16868
                     /locus_tag="KPHS_p100190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220826.1"
                     /db_xref="GeneID:11817915"
                     /translation="MTMADEKTARYVAYIDSLITVSPKSQSAISREIGYKNPNILSLI
                     KKGRIPLPVEKVLPLAEALNADPVRLMMMVLEDRQPELADFLRDQGIAPLTPEEREVL
                     AAFRNRFPAQTDGVEQVVEAIKKL"
     gene            complement(16863..17966)
                     /locus_tag="KPHS_p100200"
                     /db_xref="GeneID:11817916"
     CDS             complement(16863..17966)
                     /locus_tag="KPHS_p100200"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_005220827.1"
                     /db_xref="GeneID:11817916"
                     /translation="MKNTFDRARAAENTSQEAITYLDRATQMDARSVSMQGADLTFAD
                     AFMLFTRLSLLITRRRPEIAVHCVLIHVLPHIAQEKVSNLNRIMVNQLVNPLILEGKI
                     VMGRRVFSIMKQFLGWCAFQGIIETSPLNDMSLNKVAGGAKTAPRERCLTDAEVWVFW
                     NVWDYFDVCPGTKWAARLCLVAARRPDEVLRARVSEFDLKLNVWNQGSRNKSARSHTL
                     PMSSLMRKCVEELIAYGAGSQWLVPSNKKEKADTPMSKVAIAQALRRILERPELGEVE
                     SFTPRDLRRTARSYFPALNISQEVSRKIMNHSLEGIDRVYDRYDYMDQMREALESFSS
                     YISSIVEQPDLEEIDHKMKGDRLSTELIRVNFS"
     misc_feature    complement(16959..17513)
                     /locus_tag="KPHS_p100200"
                     /note="Bacteriophage P4 integrase, C-terminal catalytic
                     domain; Region: INT_P4_C; cd00801"
                     /db_xref="CDD:271182"
     misc_feature    complement(order(17019..17021,17112..17117,17124..17126,
                     17412..17414))
                     /locus_tag="KPHS_p100200"
                     /note="active site"
                     /db_xref="CDD:271182"
     gene            complement(18053..19537)
                     /locus_tag="KPHS_p100210"
                     /db_xref="GeneID:11817917"
     CDS             complement(18053..19537)
                     /locus_tag="KPHS_p100210"
                     /codon_start=1
                     /transl_table=11
                     /product="putative retA reverse transcriptase"
                     /protein_id="YP_005220828.1"
                     /db_xref="GeneID:11817917"
                     /translation="MYGEEKSDSLIVAAKQANNPKGAESVERRSGAKGNAEQPHMRRT
                     QSRESMSQRLSRVREAAKQRKKERFTALFHLLTVEALEAAFLSLSRKAAAGVDGIRWM
                     DYAGNMKNNITDLHRRLHQGSYRAQPGRRHYIPKADGKQRPLGIASLEDKIVQYALVK
                     ILNAVYENDFMGFSYGFRPGRSQHDALDALATGLVRTNVNWVLDADISQFFDRVSHEW
                     LIRFTEHRIGDRRVIRLIRKWLTAGTSEEGQWRATEEGTPQGAVISPLLANIYLHYVF
                     DLWAHQWRRRYATGNVVMVRYADDIVIGFDKRYDARRFRIAMQRRLREFGLTVHPEKT
                     RLMEFGRFAAENRAIRGKGKPETFNFLGFTHISGKDRNGRFMLIRKTRRDRMTATLKA
                     IKDGLRRRWHYSIPEQGKWLRRVVQGYLNYHSVPGNFPTMQKFRTHVTNLWRRALRRR
                     SQKDDTTWTKANKLAAAWLPRVRVLHPWPVERFTARHPRQEPGA"
     misc_feature    complement(18185..19303)
                     /locus_tag="KPHS_p100210"
                     /note="group II intron reverse transcriptase/maturase;
                     Region: group_II_RT_mat; TIGR04416"
                     /db_xref="CDD:275209"
     gene            complement(20650..21060)
                     /locus_tag="KPHS_p100220"
                     /db_xref="GeneID:11817918"
     CDS             complement(20650..21060)
                     /locus_tag="KPHS_p100220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative toxin YafO"
                     /protein_id="YP_005220829.1"
                     /db_xref="GeneID:11817918"
                     /translation="MKATWNSDSYAQFLEPVFRVMPDLETSLLTDFVSFKNGFYPAVF
                     GKDGPYTEPGSVVSSRVYHVHLLFTKQERNSHRNRFNCTSDRALVYTQHAKFQDVYSL
                     LAIFPKEAHKTASDPVKMSDIAKYAAAFQKLTNP"
     misc_feature    complement(20665..20955)
                     /locus_tag="KPHS_p100220"
                     /note="Toxin YafO, type II toxin-antitoxin system; Region:
                     YafO_toxin; cl08066"
                     /db_xref="CDD:324193"
     gene            complement(21070..21675)
                     /locus_tag="KPHS_p100230"
                     /db_xref="GeneID:11817919"
     CDS             complement(21070..21675)
                     /locus_tag="KPHS_p100230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220830.1"
                     /db_xref="GeneID:11817919"
                     /translation="MHLENCLEDMNVISNALATVTSNASRFSTSKVTSKREGAMPSIY
                     RHTGYGLKPVRPGFAGANDFKMPQTEGIPVQESSMAAQLAEIEQRLEELTTKHVRLTH
                     HISGYSAEQIRDMFGESRYEDLKNIDLTIRGLEGFVNKFIRDVDQPHPYMKRLSDAIT
                     EYRLAVSDLLMILNQCFNEVEVIESQTGLIDEDVFANFSFH"
     gene            complement(21770..22138)
                     /locus_tag="KPHS_p100240"
                     /db_xref="GeneID:11817920"
     CDS             complement(21770..22138)
                     /locus_tag="KPHS_p100240"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="YP_005220831.1"
                     /db_xref="GeneID:11817920"
                     /translation="MIVMAISNEYLPLPFGVAGYYPPGSEIGRNPQFCEDNREKTMKF
                     VIYGRENCSFCKRAVELAKQLQGHGYGEYQYIDIVAAGIDKQKLSEMVGKPVETIPQV
                     FLDDVPIGGYTEFAAFASTL"
     misc_feature    complement(21776..22015)
                     /locus_tag="KPHS_p100240"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:351069"
     misc_feature    complement(order(21842..21847,21977..21985,21992..21994))
                     /locus_tag="KPHS_p100240"
                     /note="GSH binding site [chemical binding]; other site"
                     /db_xref="CDD:239017"
     misc_feature    complement(order(21974..21976,21983..21985))
                     /locus_tag="KPHS_p100240"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239017"
     gene            complement(22146..22919)
                     /locus_tag="KPHS_p100250"
                     /db_xref="GeneID:11817921"
     CDS             complement(22146..22919)
                     /locus_tag="KPHS_p100250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220832.1"
                     /db_xref="GeneID:11817921"
                     /translation="MGNKRKQTRRAARQALKSKPRIHGYEIDTIIVDELAAAPALPPK
                     PKRDNSPLEARNEAQAHYLISLDTKTLTFATGEAGCGKTYLAAAVAAQRLLNKEVDKI
                     IVTRPVLQADEDLGFLPGDMSEKFAPFFRPVYDVLQKRLGGSFLEYCLKPEVAKVEIA
                     PFAYMRGRTFENAVVILDEAQNVTASQMKMFLTRMGENVTVIVNGDVTQCDLPGNVKS
                     GLEDALQRFQPSRQVGLIEFTAEDCVRSELCKVALQAYL"
     misc_feature    complement(22152..22919)
                     /locus_tag="KPHS_p100250"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:354812"
     gene            23160..24749
                     /locus_tag="KPHS_p100260"
                     /db_xref="GeneID:11817922"
     CDS             23160..24749
                     /locus_tag="KPHS_p100260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220833.1"
                     /db_xref="GeneID:11817922"
                     /translation="MTIPAKIDTTNLLTILGVIAAVWAIITPTSRLRFRFCMTRWDLL
                     IIGLIFILANYLVFAPALRQVGLYYSFGPWIWGLDSSSAVYLLFLLAASYLFIRLKSP
                     TLNRGKIKLFLELIESLHLTKKYDELVLLVEPQLDEIISLANGKPNLIVQWIDKLYGG
                     SDRNALLNGEEPKERNVLVKGLYSLLSPLREKLSSNYEASDKAREVLLNILTSPDLTR
                     HLSLAYPHFCLRLIGADEVVRSDFIDRFINSLLDSPGSRLYVELKNNQNTCTGGRLAI
                     PETNRLLHFFFADSVYASKSGIYRAIGESVCWRLDEDSKLSEILNKPLGSYREQSRFS
                     CPINSGITMFEIMVHQGIHQRLQDHLWLHYFKHFAEKILYQMKVQSIDSIAEHQTPYH
                     YLLCRLFGIAIDWAEQSSYIKTVNNSKEDSRYIPKEATKVLGSMLEHVIPSPKLKGYS
                     KVSILQMVVTCYTRLEERQINDIGEALLIHTTTGEFNSTSLTYRRKLLSIFKRMDPYL
                     QGNAKKFREKIELAIQIKLNR"
     gene            24949..25104
                     /locus_tag="KPHS_p100270"
                     /db_xref="GeneID:11817923"
     CDS             24949..25104
                     /locus_tag="KPHS_p100270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220834.1"
                     /db_xref="GeneID:11817923"
                     /translation="MSITALNGLATFAESFRSDGGGELQTVQRCVGDGGWIRTTDQLI
                     NSQPLYH"
     gene            complement(26044..26433)
                     /locus_tag="KPHS_p100280"
                     /db_xref="GeneID:11817924"
     CDS             complement(26044..26433)
                     /locus_tag="KPHS_p100280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220835.1"
                     /db_xref="GeneID:11817924"
                     /translation="MTLAQLKDIYARNDLTADELRVVVDRLNQQRTKFDTELPEIKPP
                     VTGGWLSRSRSLQQAQINKNLCNHYKEQIQQWITLIEYYEGSLSKYEKVKRFVGKHKW
                     FFVIATTVIAKSYVAYDVIEGWISKIV"
     gene            complement(26524..29490)
                     /locus_tag="KPHS_p100290"
                     /db_xref="GeneID:11817925"
     CDS             complement(26524..29490)
                     /locus_tag="KPHS_p100290"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase for transposon Tn1721"
                     /protein_id="YP_005220836.1"
                     /db_xref="GeneID:11817925"
                     /translation="MPRRLILSATERDTLLALPESQDDLIRYYTFNDSDLSLIRQRRG
                     DANRLGFAVQLCLLRYPGYALGTDSELPEPVILWVAKQVQAEPASWAKYGERDVTRRE
                     HAQELRTYLQLAPFGLSDFRALVRELTELAQQTDKGLLLAGQALESLRQKRRILPALS
                     VIDRACSEAIARANRRVYRALVEPLTDSHRAKLDELLKLKAGSSITWLTWLRQAPLKP
                     NSRHMLEHIERLKTFQLVDLPEGLGRHIHQNRLLKLAREGGQMTPKDLGKFEPQRRYA
                     TLAAVVLESTATVIDELVDLHDRILVKLFSGAKHKHQQQFQKQGKAINDKVRLYSRIG
                     QALLEAKESGSDPYAAIEAVIPWDEFTESVSEAELLARPEGFDHLHLVGENFATLRRY
                     TPALLEVLELRAAPAAQGVLAAVQTLREMNADNLRKVPADAPTAFIKPRWKPLVITPE
                     GLDRKFYEICALSELKNALRSGDIWVKGSRQFRDFDDYLLPAEKFAALKREQALPLAI
                     NPNSDQYLEERLQLLDEQLATVTRLAKDNELPDAILTESGLKITPLDAAVPDRAQALI
                     DQTSQLLPRIKITELLMDVDDWTGFSRHFTHLKDGAEAKDRTLLLSAILGDAINLGLT
                     KMAESSPGLTYAKLSWLQAWHIRDETYSAALAELVNHQYRHAFAAHWGDGTTSSSDGQ
                     RFRAGGRGESTGHVNPKYGSEPGRLFYTHISDQYAPFSTRVVNVGVRDSTYVLDGLLY
                     HESDLRIEEHYTDTAGFTDHVFALMHLLGFRFAPRIRDLGETKLYVPQGVQAYPTLRP
                     LIGGTLNIKHVRAHWDDILRLASSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRI
                     ERTLFILDWLQSVELRRRVHAGLNKGEARNSLARAVFFNRLGEIRDRSFEQQRYRASG
                     LNLVTAAIVLWNTVYLERATQGLVEAGKPVDGELLQFLSPLGWEHINLTGDYVWRQSR
                     RLEDGKFRPLRMPGKP"
     misc_feature    complement(28984..29475)
                     /locus_tag="KPHS_p100290"
                     /note="Domain of unknown function (DUF4158); Region:
                     DUF4158; pfam13700"
                     /db_xref="CDD:338907"
     misc_feature    complement(26593..27750)
                     /locus_tag="KPHS_p100290"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     pfam01526"
                     /db_xref="CDD:334579"
     gene            complement(29494..30054)
                     /locus_tag="KPHS_p100300"
                     /db_xref="GeneID:11817926"
     CDS             complement(29494..30054)
                     /locus_tag="KPHS_p100300"
                     /codon_start=1
                     /transl_table=11
                     /product="Tn4653 resolvase"
                     /protein_id="YP_005220837.1"
                     /db_xref="GeneID:11817926"
                     /translation="MQGHRIGYVRVSSFDQNPERQLEQTQVSKVFTDKASGKDTQRPQ
                     LEALLSFVREGDTVVVHSMDRLARNLDDLRRLVQKLTQRGVRIEFLKEGLVFTGEDSP
                     MANLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSDEQAATLRQRATA
                     GEPKAQLAREFNISRETLYQYLRTDD"
     misc_feature    complement(29668..30042)
                     /locus_tag="KPHS_p100300"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29851..29853,29860..29865,30019..30021,
                     30025..30027))
                     /locus_tag="KPHS_p100300"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(30019..30021)
                     /locus_tag="KPHS_p100300"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29701..29703,29713..29718,29722..29727,
                     29866..29868))
                     /locus_tag="KPHS_p100300"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29695..29697,29704..29706,29713..29718,
                     29725..29730,29737..29739,29830..29835,29848..29850))
                     /locus_tag="KPHS_p100300"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29680..29682,29692..29694,29701..29703,
                     29713..29715,29722..29727,29734..29739,29773..29781))
                     /locus_tag="KPHS_p100300"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29680..29682,29692..29694,29701..29703,
                     29713..29715,29722..29724,29779..29781))
                     /locus_tag="KPHS_p100300"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(29677..29682,29698..29700))
                     /locus_tag="KPHS_p100300"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    complement(29509..29634)
                     /locus_tag="KPHS_p100300"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cd00569"
                     /db_xref="CDD:259851"
     misc_feature    complement(order(29512..29520,29524..29529,29623..29631))
                     /locus_tag="KPHS_p100300"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            30043..30210
                     /locus_tag="KPHS_p100310"
                     /db_xref="GeneID:11817927"
     CDS             30043..30210
                     /locus_tag="KPHS_p100310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220838.1"
                     /db_xref="GeneID:11817927"
                     /translation="MPLHDVSLVEGGLSALSVPLCLKAHFCQAEIYNLRGHVSKNGKA
                     DSILTKRRGPA"
     gene            30364..30798
                     /locus_tag="KPHS_p100320"
                     /db_xref="GeneID:11817928"
     CDS             30364..30798
                     /locus_tag="KPHS_p100320"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_005220839.1"
                     /db_xref="GeneID:11817928"
                     /translation="MRQNLPVTGRNLELPKDANILSTTSPQSHITYVNPDFIKISGFT
                     EEELLGQPHNIVRHPDMPPAAFEHMWSTLKSGRSWMGLVKNRCKNGDHYWVSAYVTPI
                     AKNGSIVEYQSVRTKPEPEQVLAAEKLYAQLRSGKAARGFVE"
     misc_feature    30451..30708
                     /locus_tag="KPHS_p100320"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:312074"
     gene            complement(30840..31763)
                     /locus_tag="KPHS_p100330"
                     /db_xref="GeneID:11817929"
     CDS             complement(30840..31763)
                     /locus_tag="KPHS_p100330"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase InsC for insertion sequence IS903"
                     /protein_id="YP_005220840.1"
                     /db_xref="GeneID:11817929"
                     /translation="MAKQKFKITNWPTYNKALINRGSITFWLDDEAIQAWYESATPSS
                     RGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLRCPDYSCVSRRAKS
                     VNISFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRKLHLAVDSKTHEI
                     ICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHDELRRKKISALIPPRK
                     GAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVKQLFGGSLTLR
                     DYDGQVAEAMALVRALNKMTKAGMPESVRIA"
     misc_feature    complement(31374..31709)
                     /locus_tag="KPHS_p100330"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:290455"
     misc_feature    complement(30885..31415)
                     /locus_tag="KPHS_p100330"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:334608"
     gene            complement(31843..32694)
                     /locus_tag="KPHS_p100340"
                     /db_xref="GeneID:11817930"
     CDS             complement(31843..32694)
                     /locus_tag="KPHS_p100340"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase CTX-M-14"
                     /protein_id="YP_005220841.1"
                     /db_xref="GeneID:11817930"
                     /translation="MMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVAL
                     IDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNP
                     IAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRT
                     EPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRA
                     GLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAA
                     RIIAEGL"
     misc_feature    complement(31876..32688)
                     /locus_tag="KPHS_p100340"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl21491"
                     /db_xref="CDD:354834"
     gene            32698..32820
                     /locus_tag="KPHS_p100350"
                     /db_xref="GeneID:11817931"
     CDS             32698..32820
                     /locus_tag="KPHS_p100350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220842.1"
                     /db_xref="GeneID:11817931"
                     /translation="MHSLCHHLKLPIRSIRVTSVFPKFHVCFLLASKITISRRI"
     gene            complement(32865..32987)
                     /locus_tag="KPHS_p100360"
                     /db_xref="GeneID:11817932"
     CDS             complement(32865..32987)
                     /locus_tag="KPHS_p100360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220843.1"
                     /db_xref="GeneID:11817932"
                     /translation="MKNVWYNKNIINKIECCSVDNLQSLLSIIAAKMKSMIYQK"
     gene            complement(32968..34230)
                     /locus_tag="KPHS_p100370"
                     /db_xref="GeneID:11817933"
     CDS             complement(32968..34230)
                     /locus_tag="KPHS_p100370"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005220844.1"
                     /db_xref="GeneID:11817933"
                     /translation="MINKIDFKAKNLTSNAGLFLLLENAKSNGIFDFIENDLVFDNDS
                     TNKIKMNHIKTMLCGHFIGIDKLERLKLLQNDPLVNEFDISVKEPETVSRFLGNFNFK
                     TTQMFRDINFKVFKKLLTKSKLTSITIDIDSSVINVEGHQEGASKGYNPKKLGNRCYN
                     IQFAFCDELKAYVTGFVRSGNTYTANGAAEMIKEIVANIKSDDLEILFRMDSGYFDEK
                     IIETIESLGCKYLIKAKSYSTLTSQATNSSIVFVKGEEGRETTELYTKLVKWEKDRRF
                     VVSRVLKPEKERAQLSLLEGSEYDYFFFVTNTTLLSEKVVIYYEKRGNAENYIKEAKY
                     DMAVGHLLLKSFWANEAVFQMMMLSYNLFLLFKFDSLDSSEYRQQIKTFRLKYVFLAA
                     KIIKTARYVIMKLSENYPYKGVYEKCLV"
     misc_feature    complement(32974..34221)
                     /locus_tag="KPHS_p100370"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:316242"
     gene            34431..35462
                     /locus_tag="KPHS_p100380"
                     /db_xref="GeneID:11817934"
     CDS             34431..35462
                     /locus_tag="KPHS_p100380"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_005220845.1"
                     /db_xref="GeneID:11817934"
                     /translation="MSGSLSSVSVLAILSPLGRLVERARNISNNPLSQSLYTGRTDEF
                     GQIEFALRMMQAETGAIVGRIGDASNRLSEHTRGLLKDIESSNVLTVEQQAETDQIAT
                     AVNQMVASIQEVASNAQHAADAAGRADTETASGQRLVAHTSQSITALEGEIRQATQVI
                     HELEGQSNEISKVLDVIRGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLAAR
                     TQQSTTDIQSMISALQERAQSAVTVMEQSSRQAHTSVAHAEEAATALDGIGQRVNEIT
                     DMNAQIATAVEQQGAVSEDINRSIINIRDAADTNVQTGQNNLQSAKSVAQLTSALSEL
                     AKQFWEKRG"
     misc_feature    34467..34601
                     /locus_tag="KPHS_p100380"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(34467..34472,34479..34484,34488..34493,34500..34505,
                     34509..34511,34557..34562,34566..34571,34578..34583,
                     34587..34592,34599..34601)
                     /locus_tag="KPHS_p100380"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    34677..35447
                     /locus_tag="KPHS_p100380"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     gene            complement(35773..35988)
                     /locus_tag="KPHS_p100390"
                     /db_xref="GeneID:11817935"
     CDS             complement(35773..35988)
                     /locus_tag="KPHS_p100390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220846.1"
                     /db_xref="GeneID:11817935"
                     /translation="MIVLSKREKDTLREISQWSCFYANWKPKTRAKLEQMNLVANVEP
                     EGKEENYQLTNKGRELLEQLIEAGEYS"
     gene            complement(35972..36136)
                     /locus_tag="KPHS_p100400"
                     /db_xref="GeneID:11817936"
     CDS             complement(35972..36136)
                     /locus_tag="KPHS_p100400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220847.1"
                     /db_xref="GeneID:11817936"
                     /translation="MIVFLGVGFVIGTLVMLSCINDYVKRGLMERRGRVYRIIDITNT
                     LKETGDDRPE"
     gene            complement(36148..37470)
                     /locus_tag="KPHS_p100410"
                     /db_xref="GeneID:11817937"
     CDS             complement(36148..37470)
                     /locus_tag="KPHS_p100410"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA ligase"
                     /protein_id="YP_005220848.1"
                     /db_xref="GeneID:11817937"
                     /translation="MEKLIALKHKLDAIKAMGTNAKKEALASMDDFEQRMVSLMLNPF
                     VRFGVKKYNVADPLSKSVSSDEKAIELLEKLAARELTGNAAITAVESLVASMCADGQD
                     VFRRFLLKDPKAGVGISLCNKVFANPIPKFEVQLATAYKEKGDKYPFKANPKARWPMI
                     GSLKLDGLRVICEVIVDEEEVNFLSRTGNPITSLDHLKPAMLELGKLSGYKHIFFDGE
                     GTAGSFNNSVSALRKKNVKAVGATYHIFDFFLPEWRVQAKTVEYQKNGMKLKQRLSLL
                     VAWFRNTRGQDYAADIHMHPFYIIYSHEDFVERFMKRLDDNEEGEMGKDPDSVYEFKR
                     TRSWWKLKDENEADGEIIGFLPGDPDAGFAHTLGKIVIRLEDGTEVRASGIKHRYLDE
                     IWHNQDKYMGRIVKVNFHEYTPDGSLRHPRLKWPKCLRDTEERVGDKE"
     misc_feature    complement(36199..37446)
                     /locus_tag="KPHS_p100410"
                     /note="DNA ligase; Provisional; Region: 30; PHA02587"
                     /db_xref="CDD:222893"
     gene            complement(37470..37937)
                     /locus_tag="KPHS_p100420"
                     /db_xref="GeneID:11817938"
     CDS             complement(37470..37937)
                     /locus_tag="KPHS_p100420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220849.1"
                     /db_xref="GeneID:11817938"
                     /translation="MATKTDLSKIPSISGLNGYSLRCPEVKLNGHDSYCSYTVCQHTI
                     LAFKEKRLPASSFTSCANAISAGKCQALKMMVEEIRQGESLYFVDMPALIEEVEERNR
                     TARTLQPKRGSASIYSGIKGKCQSSTVAETGRLPDASEIYSELIKETLKEKTD"
     gene            complement(38017..38805)
                     /locus_tag="KPHS_p100430"
                     /db_xref="GeneID:11817939"
     CDS             complement(38017..38805)
                     /locus_tag="KPHS_p100430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220850.1"
                     /db_xref="GeneID:11817939"
                     /translation="MKEDIEQAVLEMIKKSGVELGVGELESIIDASFNTASEHISNAL
                     SCVPLREGATHTSVVVWYAKTPEMPGTVQKRVALVAFIVPSLETGIGPVARFGAWYDD
                     KIIFSNCYQMESREMLEHSVDVTLRAVESKCETVGEAFVSVMTSPDVEKRHVDLVAPP
                     GLLEMIMSGDYNKAIARVRELDYGRICDLCRSDLDLINVIVEAGRVCDGVLAQYASKI
                     SRLANEMPMLIQEAKSHAVHAANDLLTPYRYEAASDKMTGWATW"
     gene            39067..40269
                     /locus_tag="KPHS_p100440"
                     /db_xref="GeneID:11817940"
     CDS             39067..40269
                     /locus_tag="KPHS_p100440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220851.1"
                     /db_xref="GeneID:11817940"
                     /translation="MKNHADCSKEECMTLWTDSYQSSINSISNYIEMNFPPYSDIPDN
                     LFQVDDSKLADCIIVVAWRYFRNLYIHRRDSLNKYTSYTQKFLNQGNIPSLGDLKDDK
                     FYFLNKILRIIFEYNFWASDDFGPPMYLKPEILEKLDRLKPLTDFPVNFIAIERSMPA
                     AMTKDLLLSNNFASLIKIATTVEEFENTIYQQIDRGLEDVNNKTNVLKEQIEGLIDSS
                     DSSIKSLKEYEAKLHDYENDYNFALLSKAFSTLLKNKRSECATNHRSITIFSMWLIAT
                     PLLTLLNHIFNFYPVEFNLNALFYFLPILSLELLFFYFMRLYYIEGKSIKAQILQIEQ
                     RLSLCEFIHDYVEKKNNSGADKESWSLFEKLIFSPIQVSSENIPSLLDGASSIAELAG
                     KVLSKDSK"
     gene            complement(40312..41436)
                     /locus_tag="KPHS_p100450"
                     /db_xref="GeneID:11817941"
     CDS             complement(40312..41436)
                     /locus_tag="KPHS_p100450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220852.1"
                     /db_xref="GeneID:11817941"
                     /translation="MTMSDLKELLSELDFEQWLDMEGIIYRRGGVSARGREVNIKECP
                     VCGSTNWKVYFNLTNNVGKCFAGDHPEEIQFNKLVFLKHYSGKSRRAFEEYVHNALLS
                     QGWAPKKEEVVLASAVELEGPVALPRHYELPIDGRLPDYLVERNITPELAKYFDLRYC
                     VEGKHAYVDPYTDQVKGQAFDMRILIPIYDLNGVMKTFQGRDVTGAAERRYLFPMQLP
                     ASGRFLYNGHNAVGKQTVVVCEGAFDVMGVKRAIFDEETLRDYVEPIGTFGMHLSGNT
                     TVDAEDQLGAFLSLKADGLRNVIMMWDSEKQAIRNTMAAARRLSSIGLNVKIACLGEE
                     GLDPGEATQEQILKAYYRAKPYSKQLELQSKVLGIRVFNS"
     misc_feature    complement(40417..>41019)
                     /locus_tag="KPHS_p100450"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; cl26789"
                     /db_xref="CDD:331610"
     gene            complement(41584..42924)
                     /locus_tag="KPHS_p100460"
                     /db_xref="GeneID:11817942"
     CDS             complement(41584..42924)
                     /locus_tag="KPHS_p100460"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA helicase"
                     /protein_id="YP_005220853.1"
                     /db_xref="GeneID:11817942"
                     /translation="MTELCHTGRGLSEEFDDDFQNRLAAYFCRDHEFLTRAGDLVAPN
                     QFSNAANAILVNMVSGYFRMYKSAPSSAAILDMLKRAKRDKTIREEMFPDVVAAFKRV
                     LSEKLSDTAYMVDQVATFAKSVAFDDALIKAAEMKEKGDFQGAMAIMAKVQQIGSNEA
                     TGIYDYFASAAERYKAREYEASDDYVPNSITTGLPLLDRMLYQKGWAKREMVLFMGFA
                     KSGKSTAMGEFSINATLAGYNVLYLSLEVHTSILSDRFDARLSETEMSKLVEQRDDVH
                     RKLAEIGATKGVGNLWVVERPSGSMSPADLDRMLNSMKANGMIPDMVVVDYADLMRAS
                     YDLRDDRANIRSIYTDLRALYDKHNVAGITASQTNREGGSSEVATMMHAADNIEKVRI
                     ADLVITINKTEEEEAKGEARLYFAGSRNQKGGVSIRVKQNLEQMRFIERIMEVL"
     misc_feature    complement(41689..42798)
                     /locus_tag="KPHS_p100460"
                     /note="41 helicase; Provisional; Region: 41; PHA02542"
                     /db_xref="CDD:222864"
     gene            complement(42989..43714)
                     /locus_tag="KPHS_p100470"
                     /db_xref="GeneID:11817943"
     CDS             complement(42989..43714)
                     /locus_tag="KPHS_p100470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220854.1"
                     /db_xref="GeneID:11817943"
                     /translation="MSQIFFDTINNGQYDFMTGWDTVAMDKWVAENIGLSRCQGEAEL
                     FDTKWFDYRDMHPLMATCLFTEAYKRAYSQIMLSHGREHFETAPFSTGLKRLPYQELS
                     AVNKTSLWKARQFADRYCCSYDYFISTVLSAAARRLWDKLPRPQHLWQPELIEIFESK
                     LANRAGTRLDDSVVSFKHLGDMQHDPIQERYFEWVLERLKHITRDKRIRTIFSAVWLM
                     ELVPERVIYAHYPEELEEARRLC"
     gene            complement(43897..44058)
                     /locus_tag="KPHS_p100480"
                     /db_xref="GeneID:11817944"
     CDS             complement(43897..44058)
                     /locus_tag="KPHS_p100480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220855.1"
                     /db_xref="GeneID:11817944"
                     /translation="MDEEISNLINAITKRTDLSEPQKAMMITEIIQNEINKLGKRGLE
                     EVAKNVIQK"
     gene            complement(44300..44734)
                     /locus_tag="KPHS_p100490"
                     /db_xref="GeneID:11817945"
     CDS             complement(44300..44734)
                     /locus_tag="KPHS_p100490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220856.1"
                     /db_xref="GeneID:11817945"
                     /translation="MIALIERDLKKKEEAEKKNKNETVVNLFLLNEKSKLLKAKTLSV
                     VIVIASALTVFFFGIPIWSVLIGLIPLVLIEMKDRVITYRVAKGYFGRNAPEAIQLVK
                     FIRENTDKFDSNDSGDGRRKVLNPEKEKNVSADDTVKGWQNA"
     gene            complement(44881..45066)
                     /locus_tag="KPHS_p100500"
                     /db_xref="GeneID:11817946"
     CDS             complement(44881..45066)
                     /locus_tag="KPHS_p100500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220857.1"
                     /db_xref="GeneID:11817946"
                     /translation="MNPLLTLIANFIEKLVYDVETVVEKVSDIFTKGARRKDIETKIK
                     DLEREREFLIKYTIKKT"
     gene            complement(45139..45495)
                     /locus_tag="KPHS_p100510"
                     /db_xref="GeneID:11817947"
     CDS             complement(45139..45495)
                     /locus_tag="KPHS_p100510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220858.1"
                     /db_xref="GeneID:11817947"
                     /translation="MKMGDLAKRPAAEAAAPKSSTPMRQPVRPQGRPTRGKEKIKSRT
                     MSLEDEYFELLEMMKFIPRFEKFTRSDVIRAAIFHLAEKSPQEIEDIVKMNEAITAAD
                     VTMRTDEIKRELMKKG"
     gene            complement(45501..46166)
                     /locus_tag="KPHS_p100520"
                     /db_xref="GeneID:11817948"
     CDS             complement(45501..46166)
                     /locus_tag="KPHS_p100520"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid stability protein"
                     /protein_id="YP_005220859.1"
                     /db_xref="GeneID:11817948"
                     /translation="MTQIIVVGGTKGGPGKSTVAQQIAACLKIKKKKKVQITDIDIQR
                     TTTGWCEDRRHNEELELIPFAYVQDDIIKHITSLRGRYDYVVVDAGGFDSEIQRHAML
                     MANVILIPLRPKRRDLKSLRDIDPIVDSVSSMNDKIKIRAVMNQCPSLPSQAARIIAA
                     KEIVETFGIEAVPVNLYNRNVYDDAEEAGRSIFEMTGAERDKKAEAEIEALVEYVMTL
                     EGE"
     misc_feature    complement(45528..46157)
                     /locus_tag="KPHS_p100520"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     gene            46406..46927
                     /locus_tag="KPHS_p100530"
                     /db_xref="GeneID:11817949"
     CDS             46406..46927
                     /locus_tag="KPHS_p100530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220860.1"
                     /db_xref="GeneID:11817949"
                     /translation="MSIELSSTQNTYGLLNSGNPYSACWRFFEPRGVHIDQLGEKTLK
                     QLVEKRLIQKPLNMFFISYGALIGIDRGGLKQARKIYEGIERAKNVRLGPLLFACGIY
                     GVEEEEAWLLAEKFNSLEALYDASVDSLLSHGFLNESVAVNAYNFFRHPANVLALTEL
                     QEKAGLKISNVKI"
     misc_feature    <46481..46921
                     /locus_tag="KPHS_p100530"
                     /note="DNA ligase, NAD-dependent; Region: dnlj; TIGR00575"
                     /db_xref="CDD:273148"
     gene            complement(46982..47137)
                     /locus_tag="KPHS_p100540"
                     /db_xref="GeneID:11817950"
     CDS             complement(46982..47137)
                     /locus_tag="KPHS_p100540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220861.1"
                     /db_xref="GeneID:11817950"
                     /translation="MIKPQTVGVQFCDGANPIYISKDDALTEETEREILIHNTLGERL
                     CRWGYAK"
     gene            complement(47130..47381)
                     /locus_tag="KPHS_p100550"
                     /db_xref="GeneID:11817951"
     CDS             complement(47130..47381)
                     /locus_tag="KPHS_p100550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220862.1"
                     /db_xref="GeneID:11817951"
                     /translation="MNGSLLLKVKSTIMTLAAVFFVLVGAYTWGGRAARRAMEEKAQR
                     ETNKRLQGTVDVKNETINEVRTKDASAVHRELRDKWMRD"
     gene            complement(47384..48076)
                     /locus_tag="KPHS_p100560"
                     /db_xref="GeneID:11817952"
     CDS             complement(47384..48076)
                     /locus_tag="KPHS_p100560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="YP_005220863.1"
                     /db_xref="GeneID:11817952"
                     /translation="MSTPRGIRNNNPGNLDKGSPWQGLVNNPAEPRFCTFKDPVWGIR
                     ALTVTLITYHDKRRAKDGSSIDTIREVIERWAPPHENNTAAYINEVSKAVGVTPDMII
                     DLHDYNTMRPLVEAIIRHENGRGPLKTLNSWYSAEVIDEGMRRAGVVKPVTAVKAVPV
                     TKETAGATVTAGIGIAQLADVMPQISVAMDKAQGHITSGDTVRIIFGIATIVVAGFIA
                     WSQVRKHQAGVV"
     misc_feature    complement(47639..48070)
                     /locus_tag="KPHS_p100560"
                     /note="internal virion protein D; Region: PHA00368;
                     cl30808"
                     /db_xref="CDD:357684"
     gene            complement(48090..48413)
                     /locus_tag="KPHS_p100570"
                     /db_xref="GeneID:11817953"
     CDS             complement(48090..48413)
                     /locus_tag="KPHS_p100570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220864.1"
                     /db_xref="GeneID:11817953"
                     /translation="MSNEMAGVTPEQVERIAAIVAREVVGKLSKELRDDIGQEVNDQL
                     RTYFGDMTPAQHSIQHSNLDKLLNRLDTISSGFFGGIISKITSFLITVLLLGLAAYGV
                     KNGLQ"
     gene            complement(48510..50009)
                     /locus_tag="KPHS_p100580"
                     /db_xref="GeneID:11817954"
     CDS             complement(48510..50009)
                     /locus_tag="KPHS_p100580"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail protein"
                     /protein_id="YP_005220865.1"
                     /db_xref="GeneID:11817954"
                     /translation="MAMYEVGTVTGAANQAKVTGISTKWSEPALGIQEGSILVIYRNG
                     SADLYAIKSVNNDTQLTLTRNITTAFSGAKYGIITSETASTSSFANQLASAFTLWRNV
                     VQGWSTALTGSGNITMTDPITGTQVTVPAIAGMAKASDLDALAKLSGGNNLAGSQIIT
                     SDSSGFILGRNNDIGLVKKSGTYGKLMVGSGTRFSVVKGNKSTISPEDTQTEIMGVDS
                     AGNMTVPGNISAGKYFAQAIELSMSTPYIDFHHNNSTNDYTARFITTAADQLSVQGSH
                     LRVDRDLRVGQAADIGSWIQCRYDCVSQQTDFGSPAIGALVSGGRVRSRMTGRGGNGD
                     TSGAWGGFYLEEYVGYNHRVVLYMDGFDRKDAWLFYTGGTISTPKGDVMTTGSDVRLK
                     KDFTDSQKGASKRINALGVCEFNMKGETRRRRGFIAQQAEKVDPIYTFQSGDVEIDGE
                     KINILNVDQTAIVADLVTTVQEQCNCIEKLKEELKNLKDLVMQTPETAA"
     misc_feature    complement(48702..48851)
                     /locus_tag="KPHS_p100580"
                     /note="Chaperone of endosialidase; Region: Peptidase_S74;
                     pfam13884"
                     /db_xref="CDD:316407"
     misc_feature    complement(50062..56548)
                     /note="potential frameshift: common BLAST hit:
                     gi|375260349|ref|YP_005019519.1| gp24"
     gene            complement(50062..52683)
                     /locus_tag="KPHS_p100590"
                     /db_xref="GeneID:11817955"
     CDS             complement(50062..52683)
                     /locus_tag="KPHS_p100590"
                     /codon_start=1
                     /transl_table=11
                     /product="Gp21"
                     /protein_id="YP_005220866.1"
                     /db_xref="GeneID:11817955"
                     /translation="MGLGAAGGVMMKADANASAITTLQNTVKNQGDNIDSLSSSTTAL
                     ENSLASSNASVDAASQIPGNLIVNPSFERGTEGYTGWSGIATVVTLQVPHLGTKAAKL
                     AAGGSAGVGQKISFKKDRSYKIGIWAKQDPNTTIQSTDNTKFRVADGNGLIASKAYGP
                     FTSNWQEVSWTWKATKDVLADVQFTAFLSAGAMYFDDFYVVDVTDSVETQANSSAITK
                     LDSRVTKTENDITSQGSQVTQLKNDLATTNTNVSKKADAAALTALTNRVTQNEKEIET
                     QSSQTTSLKNSLSTVQAMGSNPWFDGSLETYSENQQISGSRAVVVSSQKRSGAKSLRV
                     SRGAGEGGNSDKSIGKWIALRENAVFRIELWAMMPADQSPSSGWSTIVGLQTQNAANN
                     INWPSAITITEGSLGGRGTWKKFTGTLRVATGHTRGVFWVSTRGSTGSGTPGYDLYID
                     DVVVTDITDAKEAQDSANANASALTSLTSRVTNVEGQVTSQASQLSSLTSQVNDASSK
                     VDQMAQTITNNEKTQSSLNTSLQSQIDAQASANIKNQTELNNATTSLAAIKSTQQTQA
                     TTISALSQQQTNLTAQVGGQSAELQELKKTVVENGNVSSTWMVKMETNSNGKKYAAGI
                     ALGIDGKNLQSQFLVQADRFGLINTSNGNTTTPFVVENGVAYMNAAVIKDGSITNAKI
                     GGEIRSDNFVNGSNGWRIGKDGSSQFNNVVIRGEVHANTGVLNNVTINENCTVLGTVQ
                     ANKIVGDVVTMTDRVVKNWPASGNTSSGTRYLIATIDGMPFERRMVFNGSVAIVQVWR
                     QNVTIRVDETTVWTFDSGNDGKDFETSIFSIRIPASNFGQRHQITIQWPNRGDSGQFR
                     FTGVVSMYRTTGSISLA"
     misc_feature    complement(52153..52497)
                     /locus_tag="KPHS_p100590"
                     /note="Carbohydrate binding domain; Region: CBM_4_9;
                     cl19911"
                     /db_xref="CDD:303077"
     misc_feature    complement(50701..50886)
                     /locus_tag="KPHS_p100590"
                     /note="Domain of unknown function (DUF1983); Region:
                     DUF1983; pfam09327"
                     /db_xref="CDD:286417"
     misc_feature    complement(<50437..50586)
                     /locus_tag="KPHS_p100590"
                     /note="Fibronectin type III protein; Region: DUF3672;
                     pfam12421"
                     /db_xref="CDD:289206"
     gene            complement(52643..56548)
                     /locus_tag="KPHS_p100600"
                     /db_xref="GeneID:11817956"
     CDS             complement(52643..56548)
                     /locus_tag="KPHS_p100600"
                     /codon_start=1
                     /transl_table=11
                     /product="Gp21"
                     /protein_id="YP_005220867.1"
                     /db_xref="GeneID:11817956"
                     /translation="MYVNGVRVAFGNASWNTVSFDLKAGWSTVEFLVNQWTGQAYINL
                     GFKLSEKVAQLNSALGMNALSNAISAVTSNVSTVGDRVTSTSQSVTDLRNSLEQTNAN
                     LANKADAQALSTLQNTVSKQGDTISSQGNSITNLNNTLTAARNAGDNLIPNYDFLQGA
                     TAWDIQYPAGVTFGNFGDGKAGVKLNRTTTTSPGIFSNNNKPLPLNGQRKYRVVVKAK
                     GVSGAMNMLIRRQNKIGQTDSNYEDKNVTLTSEWQTITWETGLTASNADGQNFKLYAH
                     PANAEIWVDTFKVFDITDEVKIKANSDALSTLSSTVTQQGDKITSQGNSITKLTNDLE
                     AADANIAKKADQSAVTTLTGRVEKTESGLTAANSNITSLNSSLNQQSKRGANLLPDGT
                     FESYAVGHNLSNNRVIVTTDDSHGGNKCIRVTRPNDYNANATDNSDNHIFSGFQVRDN
                     AVFYMECWVKRDAKSTAMAENAQISIGLSLQYQDNSWQWPAVTKAAKDLSSTQWTKVS
                     GYLKSTKSGIKQAMVRISIPNVSSVKAGNSFLIDDLVITEVTDAYNAQSTADANANAI
                     STLDSTVSQQGDQITSQGNSITKLTNDLATTNNNVSKKADQSALSVLSGRVDQTESGL
                     SSANSSITALNSSVRAGNATSGDLISNPTFDPEFSQMGFTVVSSSSEGVPANCPYAYV
                     ARIAARDHHPNFAAIPATLGDVYEMSALVACGTGSADFNLYLGTATRPSGSVGAPLSS
                     GGNRKASATWQRVTWRFKITQGIVDRGFFRPFLQINQSSPFGTVWYVTDWHLRNVTDS
                     SKVQDSLDATAKAVDSLTSTVNQQGENISSIGTRTTNLENNLRTTNANVAQKADANAL
                     TALTNRVTQTEKDINSTSSSVTNLNNKVDAISVGGTNLIKNSGDMTGWSNVVSDTYRG
                     NAVISATVKAGSGYKDLREITLESPVDAGEYVYSFYAKGGVAGQTMTAFFYNPNTTTS
                     IETSQGAKGNNTDGRAQFTLTTSWARYWVKWKQTPTTGTKRLILCRIESNTSKDQTVY
                     INSPKFEVGNVVSDWNESPSDSASASAVDSLTTKVNQQGTSISSIGNRTTSLENGLST
                     AQNNIAKKADASALQDLRNTVTSQGGDLTAANSSITSLQASMNRRTVFTVTARGNGNS
                     VTPGVFDESGKNLFTPGRSWALVTFAKHSDGSTVIATSKTYDVFGSANNGATMSADIE
                     ALASGTYVCVLTFDEPSGNRGKVLSALESLGGTSEVVNSLPYRGAYILLGRKGMKPGD
                     GLELRAPTGGDGTAHIRPQSSCERGNDGTGRRRRCDDEG"
     misc_feature    complement(52766..52999)
                     /locus_tag="KPHS_p100600"
                     /note="Interleukin-like EMT inducer; Region: ILEI;
                     pfam15711"
                     /db_xref="CDD:292339"
     gene            complement(56607..62231)
                     /locus_tag="KPHS_p100610"
                     /db_xref="GeneID:11817957"
     CDS             complement(56607..62231)
                     /locus_tag="KPHS_p100610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail protein"
                     /protein_id="YP_005220868.1"
                     /db_xref="GeneID:11817957"
                     /translation="MDQFKKKRLPLLIAGAGGKKSSGSSRTPVEADDTVNSRAMASIL
                     DLLGEGVVGGLINGAKSIFIDGVALENEDGSFNYSGVTWDFRDGSQDQSPMPGFDFVE
                     TPKAVNTQLKTTNAVTVAIDNDDADRVRVIMKFPSLRSIDKKTGDTNGTSVQFKFQLA
                     NGNGSFYDVIATGESSSDVTLTAKKTGVYYRSYEIQLPKPGRAYKVRVLRLSADSNDQ
                     YLFNDTWVDSIGEIVDTPMNYPNSVLVGLKVNSEQFGSSMPSRSYLIRGLKIRVPSNY
                     DENTNTYNGVWDGTFKLLSSSNPAWILFDLLTNARYGLGKFVSESMIDLGQLYQIGRY
                     CDEEVDDGFGGKEKRFAINTQITSRQDAYRLIQDIAGAFRGMVFWAGGMVNIMQDSPS
                     DPVMLFTNANVKDGLFTYKGSARKDRPSVALITYNNKQDGYKQNVEYVEDQEAMARYG
                     ERKTEAVAFGCTSRGQAHRVGLWLLYTARMESDMITFTAGLDASFLMPGETVLIQNKY
                     RAGKRNSGRIVSFTKNSITLDAPVSLKKSGSFIRIINQEGKIVERDINETGDNITKVT
                     FKTALATADQPVANGVWTITEPDLVPMRARVVAIAQGETPGSFDITVVQNNASKYQAI
                     DNGATLVPENTTVLDPTYSKPSNLVISEGTYLSSPGNLSVKLMLAWEGKSPEYWVSWR
                     RSDEGNVSNWQSARATEEQYEIVNVAENGRYDFQLYSVSFGGKKSEIITAVYQVKGTM
                     TPPGAPTSLTAVGDYRNVVLNWVNPDSVDLAQINVYASKTNKLDTATLIAQAATTTFT
                     HAGLGDNETWYYWIRAVNKRGMVGQPNSNLGTEATTRDVLSFLKDKITSSELGKELLD
                     EIDSKATQEAVDNAIGEVQNSVNESIQQVENDLAQTSSEIKAQVDSVNQSLKEDIDTV
                     NQTIVDNIDTVNQTINTNISNVNSQIEAAKQSIKDGDAALSQEIKNAQSSLTTSLSQT
                     SKDLTAAIQKETNDRIADVNDAAKQAADQLLSAKNELKTSIDSLSEVVTSGDENLARQ
                     ISQIAAGTGEQFDSLKIWYFDQDAEGWTEDDNGYTPMSVTSDGWLKANNPTSTCRSPN
                     GLTIDAHAYRFIKMRIKKVGNPTWNAKMFWIGADETGWNAGRSVVINEPEYDDKGIAI
                     LTLHDLEWRDSTTIRRFRFDFTSGQDADNYLLFDWIAVGRPTPGAGMAALQEEQQARA
                     NADTAEAQARSTLAAQIRGSSESGNLDDIRSGLIYQEKNARITADAAEASARESLQTE
                     FNRNKASVAEELHTLSTEQASQASKITGLQTSLGQKADASAVQTISQKVEEQGNTLKS
                     QGAALSTLDNRVGSVESGVSANSKAITGLQSTVTQQDKTLSSQSESITTLNNSLSDIQ
                     SDTDTAKSNPSNLLVNASFERDLAGWSAGNSVSSVIKASAPHSGSKILVCAAGTVQIT
                     QSVSVVEGRIYKLSSFVRCTTDAVISSPGNNKLRIGAATLLKEIPIRPENLPKDETWK
                     EVSDTWKATLTGKVDVSIMSSLKTGSQYFDDVGFVDVTDALAIEANASATNALTSRVS
                     SVEGTITSQGQQITSMQNSIKNKADASAVTNLTNRVTAAENQISSQSQSITSLSNSLD
                     NANADADASKAIIGNMLKNNSFERGFEGWEYVGWTLLEAQTPKSGKYIIQAGKLASGG
                     DSGCNQTVELQAGKTYRIGAWVRKSADFAINNAGNNKISLRNADLTPLKDISITGAGL
                     STNWALISGEYTPAKTASVVVSLRASVASGYMYLDDVFCVDVSNEKAIDATSNALSTL
                     NSTVTQQGKDITSNSNSITSLSNQMVNGRQNMWVRSVYSVQLANNTTEPTFSDINGKA
                     PISIDEVPDAAKTGLCERRQLRDRALQSLREG"
     misc_feature    complement(59391..62192)
                     /locus_tag="KPHS_p100610"
                     /note="Phage-related protein, tail component [Mobilome:
                     prophages, transposons]; Region: COG4733"
                     /db_xref="CDD:227076"
     misc_feature    complement(60678..61163)
                     /locus_tag="KPHS_p100610"
                     /note="Putative phage tail protein; Region: Phage-tail_3;
                     pfam13550"
                     /db_xref="CDD:290283"
     misc_feature    complement(60057..60263)
                     /locus_tag="KPHS_p100610"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    complement(59193..59669)
                     /locus_tag="KPHS_p100610"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl21509"
                     /db_xref="CDD:304399"
     misc_feature    complement(56991..57362)
                     /locus_tag="KPHS_p100610"
                     /note="Carbohydrate binding domain; Region: CBM_4_9;
                     cl19911"
                     /db_xref="CDD:303077"
     gene            complement(62248..62859)
                     /locus_tag="KPHS_p100620"
                     /db_xref="GeneID:11817958"
     CDS             complement(62248..62859)
                     /locus_tag="KPHS_p100620"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail protein"
                     /protein_id="YP_005220869.1"
                     /db_xref="GeneID:11817958"
                     /translation="MSELVHVQLGGAMAKNFGRHWKLKVRNTKQAIDLIEANRPGFKA
                     WIKRNRNHFDKYHIQVTNKQGHKWSIDDTEYQMMGESENIAKIRITPVPRGSGGKAFG
                     WFQTFVGAAMIAVGALASGLTFGASSALVMGGMSLMMGGVSMLISPQASNASVRQADN
                     TDSFYFDGPQNTSNQGNPVQLNYGEEILVGSQIVSSSITIDQL"
     misc_feature    complement(62251..62859)
                     /locus_tag="KPHS_p100620"
                     /note="Phage-related protein, tail component [Mobilome:
                     prophages, transposons]; Region: COG4723"
                     /db_xref="CDD:227067"
     gene            complement(62847..63644)
                     /locus_tag="KPHS_p100630"
                     /db_xref="GeneID:11817959"
     CDS             complement(62847..63644)
                     /locus_tag="KPHS_p100630"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail protein"
                     /protein_id="YP_005220870.1"
                     /db_xref="GeneID:11817959"
                     /translation="MSNQTLPELGSEVMQDIYRCAIQRYPNEACGFLVRTQGEKYRFM
                     EAMNVSETPREDFVMRASDIIAAEDAGEVIAIWHSHVERSAEASDPDRSGCEATELPW
                     MILAIRKNVESDMPFHFSEMNVIYPCGFEMPYLGRPYVFGVFDCWMLCRDYLKREFDV
                     ELNANAHLHIPSWYTGDNDILDQNYRNEGLVRMAPGTEPQRGDIFFIQYGKMPDHCAV
                     YIGDGMIMHHQIDRLSCRAYYGGMYQKHTTHHLRHRDLLKGDETCLN"
     misc_feature    complement(63327..63611)
                     /locus_tag="KPHS_p100630"
                     /note="Mpr1p, Pad1p N-terminal (MPN) domains with
                     catalytic isopeptidase activity (metal-binding) found in
                     proteins also containing NlpC/P60 domains; Region:
                     MPN_NLPC_P60; cd08073"
                     /db_xref="CDD:163704"
     misc_feature    complement(order(63372..63374,63381..63383,63405..63407,
                     63411..63413,63561..63563))
                     /locus_tag="KPHS_p100630"
                     /note="MPN+ (JAMM) motif; other site"
                     /db_xref="CDD:163704"
     misc_feature    complement(order(63372..63374,63405..63407,63411..63413))
                     /locus_tag="KPHS_p100630"
                     /note="Zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:163704"
     misc_feature    complement(62889..63239)
                     /locus_tag="KPHS_p100630"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:334297"
     gene            complement(63637..64335)
                     /locus_tag="KPHS_p100640"
                     /db_xref="GeneID:11817960"
     CDS             complement(63637..64335)
                     /locus_tag="KPHS_p100640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail protein"
                     /protein_id="YP_005220871.1"
                     /db_xref="GeneID:11817960"
                     /translation="MGIRADIQSLSPSSLIELFELDMSVTTSGGKLYFHAGTNGLSQP
                     IVWQGVSYEPWPIKASGFDKSGQGTLPRPKIQVSNYDGVISAELQANDDLIGCKIIRK
                     MTLARFLDAVNFPDGNPTADPSQHFADEMWFVEQKTLETHQYVEFELSSVLDLMGVQL
                     PYRQIIKNSCPWKYRGTECGYTGPYFDKNNQQTSLAGADYCTKRYDACNARRNYFANG
                     VIHFGGFIGATRYE"
     misc_feature    complement(63643..64320)
                     /locus_tag="KPHS_p100640"
                     /note="Phage minor tail protein L; Region: Phage_tail_L;
                     cl01908"
                     /db_xref="CDD:295085"
     gene            complement(64422..64757)
                     /locus_tag="KPHS_p100650"
                     /db_xref="GeneID:11817961"
     CDS             complement(64422..64757)
                     /locus_tag="KPHS_p100650"
                     /codon_start=1
                     /transl_table=11
                     /product="minor tail fiber protein M"
                     /protein_id="YP_005220872.1"
                     /db_xref="GeneID:11817961"
                     /translation="MSRKVFNWYPDYESEKTVKPNVTVLNYGDDYEQRQSQGLNRIKE
                     EWSLTFTRSHDVVNDVDDFLTARAGVESFVWTNPRGKAIIVVCDSHTVKRYPGYQVLT
                     ATFRQVFES"
     misc_feature    complement(64428..64757)
                     /locus_tag="KPHS_p100650"
                     /note="Phage minor tail protein; Region: Phage_min_tail;
                     cl01940"
                     /db_xref="CDD:351642"
     gene            complement(64801..66138)
                     /locus_tag="KPHS_p100660"
                     /db_xref="GeneID:11817962"
     CDS             complement(64801..66138)
                     /locus_tag="KPHS_p100660"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phage tail tape measure protein"
                     /protein_id="YP_005220873.1"
                     /db_xref="GeneID:11817962"
                     /translation="MFNRRNVEQMISAWAPESDSIISAGLMQSHEEKAAEFSDTYNRN
                     LKALIELRDKATDPKIISLYNKQLNQLVAAGNNALIKQTGTATQQLALEYENLADQIE
                     GTWTDLFSGLTDTLTDFVVNGKMSISSLATSFLKDITNMVVKTQITLPLMNMLGMGTT
                     NAGNAQSGNLMNGVASAIANQGVQLGNSGVSVANGDKSVGEATKETASGVNSMGQASQ
                     NAASGLSQAVNGVWDWTKSLFTGTDATKDQTKAVNSSILSMGNLSTAAGALAATFAMV
                     GASSSSSSSRWLNFGLSLASTAVSAWAGSASSSSSEPKPNVKKHANGGIFGKEGVVPL
                     RAYQKGGIATSPQLAMFGEGSMNEAYVPLPDGRTIPVTLSAESAGKSTGNAVSPVSIQ
                     INVTKDGRTSESSSGSESNLWNGAARQIKSIVLETIAEEKRSGGSLNPHTTRG"
     misc_feature    complement(65497..>66069)
                     /locus_tag="KPHS_p100660"
                     /note="phage tail tape measure protein, lambda family;
                     Region: tape_meas_lam_C; TIGR01541"
                     /db_xref="CDD:273681"
     misc_feature    complement(65686..65883)
                     /locus_tag="KPHS_p100660"
                     /note="Lambda phage tail tape-measure protein
                     (Tape_meas_lam_C); Region: Tape_meas_lam_C; pfam09718"
                     /db_xref="CDD:286761"
     gene            complement(66140..69340)
                     /locus_tag="KPHS_p100670"
                     /db_xref="GeneID:11817963"
     CDS             complement(66140..69340)
                     /locus_tag="KPHS_p100670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220874.1"
                     /db_xref="GeneID:11817963"
                     /translation="MSQNVEFILSLEDKQFTASIDRAGKLLTKFGERATKPAQKIKNL
                     ERSLGSVSSILGALETRLNSTADKLQDVAAGFELVSNTSRKAQRELSAISTDLRTFTD
                     RVDSATSSTHKFLASLRKVQSELNEFSDWVKYAGDHAGKFNTEIKGATTSLGGMNTRL
                     NATSKRLSNWGTTTSQAAEGLKKVKDQMDGVIRSQQLISRPVRVRTTTTGGGGSGGGA
                     DRFTAASHRGGSRENGVFSGLRGNIFLLGEIGDAARTVTDILFGWQKPIVDAAAEMQR
                     MRVMLRGLNKDKVNPGEAAAQDMQYIVNMAKNAPFAMQALTDSFVKFRSAGLDPTDGS
                     LKALVDSVARFGGDSELLKRAAVAVQQMSGKGVVSMEELRQQLGEAVPNAMKAMADAA
                     GITMGELTKAVSSGTVEAKQALSLMFVGLRAENENAAKDMMQTYTGALAQLQTSFTLF
                     ADRVGQAGYLDSLTKGMKELSAVMNSAEGISFANSLGEGLTTAIDGLRELAQWLAKNQ
                     ELVITLGKIVAGMVAFKMLRAGILGVVGAGGQMLSTFMKMSTVIQTPFTLGATAVTRF
                     NRAARMGLAPIPSLIFAIRGAITGLKGAFAGLTAFIAANPIGAAFTVATVAVAGLITY
                     MTMLRNETSKVVEEIRKIPEAMTAAKRAQMAERASQLEKQIQRDQQALKTGESVNYIS
                     TVAGPVAVKESKEVVEARLKKNQEEYKRTTDTIALGDGAVSKRLAKEAAESQIEKIRA
                     DNQLFSATFVKARQEALDKIQKINDDKTLSDDEKNKLLAPLRETVNKSYLQPAQKLVD
                     SLSSRKTATEKQIAHFSDLLEKAKKEGNTEQVQKLQGSIRGYQEHLETIAQELTQAEF
                     ERDNAAKTGKGVKTNQGTVLGLGTSDKGADKALAQYMRNQMDSAVYQRTLPDGTPMMD
                     FEGKPIIGPKQLKTQLNLQKASTASSLEKMSEKERAAAIAALTKAREQDAAAAERAGK
                     RTANASERAAKREERAQQKLAAGYQKALDKADQLMGQMGESSKATVSFDQSLRDVTKS
                     LTDLANATPNEFISQEMVDQAKKTSRGFEERYPRIP"
     misc_feature    complement(67244..68596)
                     /locus_tag="KPHS_p100670"
                     /note="Phage tail tape-measure protein, controls tail
                     length [Mobilome: prophages, transposons]; Region: HI1514;
                     COG3941"
                     /db_xref="CDD:226450"
     misc_feature    complement(68102..68329)
                     /locus_tag="KPHS_p100670"
                     /note="tape measure domain; Region: tape_meas_nterm;
                     TIGR02675"
                     /db_xref="CDD:131723"
     misc_feature    complement(66869..>67168)
                     /locus_tag="KPHS_p100670"
                     /note="Ribosome recycling factor (RRF). Ribosome recycling
                     factor dissociates the posttermination complex, composed
                     of the ribosome, deacylated tRNA, and mRNA, after
                     termination of translation. Thus ribosomes are 'recycled'
                     and ready for another round of...; Region: RRF; cl00240"
                     /db_xref="CDD:294170"
     gene            complement(69348..69572)
                     /locus_tag="KPHS_p100680"
                     /db_xref="GeneID:11817964"
     CDS             complement(69348..69572)
                     /locus_tag="KPHS_p100680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220875.1"
                     /db_xref="GeneID:11817964"
                     /translation="MLSRNIDRLRAEEDVRNLQVARVAQADGDGVKAFMEGLQLRIGR
                     PVVTDKVYRPHMDKADPDAKEQLMQIFGRG"
     gene            complement(69698..70015)
                     /locus_tag="KPHS_p100690"
                     /db_xref="GeneID:11817965"
     CDS             complement(69698..70015)
                     /locus_tag="KPHS_p100690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220876.1"
                     /db_xref="GeneID:11817965"
                     /translation="MTKLLDLDSILPPKKSIKFGGKEYPIVEMTVGLFVSIKQMEDKD
                     LMNMSPVDQVTAYAELVRKVIPSVPDSVLEKLTVQQLQQIFTFAMEVIDEENEKAAGE
                     GAK"
     gene            complement(70077..70823)
                     /locus_tag="KPHS_p100700"
                     /db_xref="GeneID:11817966"
     CDS             complement(70077..70823)
                     /locus_tag="KPHS_p100700"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220877.1"
                     /db_xref="GeneID:11817966"
                     /translation="MSNTHVKNIKLGACKVSFGGVDLGYTKGGVQVEIATETLKVTVD
                     QLGQTTISELIQGRNITITAPLAESVLKNMVDLMPGSTLSSGEDTVTITSAQGVNLID
                     VAKELVLTPQDATDYVLTIPKAATAGNFTMTYQSDDVRVFSVEFSAYPDDAGVLGKMS
                     LPKPVESVTLTPSSPTVKVGAKVQLSATFTPADATNKTGVWSSDATDKATVDQNGLVT
                     GKAVGSANITFTTNDGAKKATKAVSVTAAS"
     misc_feature    complement(<70083..70823)
                     /locus_tag="KPHS_p100700"
                     /note="Uncharacterized conserved protein YjdB, contains
                     Ig-like domain [General function prediction only]; Region:
                     YjdB; COG5492"
                     /db_xref="CDD:227779"
     gene            complement(70891..71283)
                     /locus_tag="KPHS_p100710"
                     /db_xref="GeneID:11817967"
     CDS             complement(70891..71283)
                     /locus_tag="KPHS_p100710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220878.1"
                     /db_xref="GeneID:11817967"
                     /translation="MFVEAFAKLIQKNGLGKVGTDIFCHYMPAKVKSGILLINPNTGI
                     AIDPDLQGFYFDSFTIVVRNASITKSVEMANKIMDILPVSNVESDGVFFKMVRPMAMP
                     ITYPINDGSLIETGIPLEFAGYFIELNK"
     gene            complement(71285..71758)
                     /locus_tag="KPHS_p100720"
                     /db_xref="GeneID:11817968"
     CDS             complement(71285..71758)
                     /locus_tag="KPHS_p100720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220879.1"
                     /db_xref="GeneID:11817968"
                     /translation="MGLKYDAHQFKRAGARLNNSQKAFKRYLIRDMEKLARLVERLAR
                     AMAPLETGSLESAIFARVVKEGYAGLRIELSVSGAKQREGHPGVEVGDYAKYMELGKY
                     RLGYLSRMKNVTNPPVAGVKPKVGPYFLERATQISEKQFSQTIMEAARKAGFTRG"
     gene            complement(71749..72093)
                     /locus_tag="KPHS_p100730"
                     /db_xref="GeneID:11817969"
     CDS             complement(71749..72093)
                     /locus_tag="KPHS_p100730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220880.1"
                     /db_xref="GeneID:11817969"
                     /translation="MNISWQAELSIYRFGSKNVYGEAQLQFVRKTKVGVVKFEQSNEK
                     SSVRADSSGSRGKAALELFDAVLIVPLEAAVQLDDVLVLEGQKLKVSSVHRRWGLRGR
                     PGHLELGANIWV"
     gene            complement(72191..73024)
                     /locus_tag="KPHS_p100740"
                     /db_xref="GeneID:11817970"
     CDS             complement(72191..73024)
                     /locus_tag="KPHS_p100740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220881.1"
                     /db_xref="GeneID:11817970"
                     /translation="MALIDTFRSGDIVSLTFAFNVLDIDSASYTVRDSAGTTLVDEEP
                     LDIAEGQMSIPVVISAEHNQLVEKERDLRYVIVKATAGGLTHEERQMYVLLNSFELSV
                     PAQSFATVADAQMQAIDMINGDTLLADGEGLMRKRLIEATRRIKTLPFSIRRIMRIDF
                     DRYDRPQNMLNVYDIPWGADGVYRQDLVDWERITSEQFADLPDYFKEALLLATVNEAC
                     EIANGNDIASAREDGILSESIGETTNMYRTSKVANVRVARSTWRLLISYINNRMIVRR
                     A"
     gene            complement(73024..73173)
                     /locus_tag="KPHS_p100750"
                     /db_xref="GeneID:11817971"
     CDS             complement(73024..73173)
                     /locus_tag="KPHS_p100750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220882.1"
                     /db_xref="GeneID:11817971"
                     /translation="MQRFTREELESIADCEGIAGLRQIGNTLGVKAKGIVEMIEGILK
                     AQGGE"
     gene            73341..73529
                     /locus_tag="KPHS_p100760"
                     /db_xref="GeneID:11817972"
     CDS             73341..73529
                     /locus_tag="KPHS_p100760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220883.1"
                     /db_xref="GeneID:11817972"
                     /translation="MIEEWQLCYGNAVFKVNAAQDARVSKELRFQKMNFCWFHEFSSE
                     QGGQSHPLLLNQAAAAVT"
     gene            complement(73505..73933)
                     /locus_tag="KPHS_p100770"
                     /db_xref="GeneID:11817973"
     CDS             complement(73505..73933)
                     /locus_tag="KPHS_p100770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220884.1"
                     /db_xref="GeneID:11817973"
                     /translation="MSEKKVKITEKAFTDFTGVMFRTSFTKSVSDHPVNERMQNRITA
                     AMRAVPMEPTVAVTGVSVSPKSASVEVKKTVQLTATVAPAGATNKKVTWASKNAEFAT
                     VDAATGLVTGVAEGTATIEVTTADGSHKATATVQVTAAAA"
     misc_feature    complement(<73544..>73774)
                     /locus_tag="KPHS_p100770"
                     /note="Uncharacterized conserved protein YjdB, contains
                     Ig-like domain [General function prediction only]; Region:
                     YjdB; COG5492"
                     /db_xref="CDD:227779"
     gene            complement(74012..74890)
                     /locus_tag="KPHS_p100780"
                     /db_xref="GeneID:11817974"
     CDS             complement(74012..74890)
                     /locus_tag="KPHS_p100780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220885.1"
                     /db_xref="GeneID:11817974"
                     /translation="MPLLREEAEKLSNNELEQGVIETIIDRDDLFAVLPFMKINSKAY
                     LYNREKTLSEATFIDVNDTITEGAATFEEKVAKLRILAGDVDVDKFLATTMADTNNQL
                     AIQVRQKVKGLARAFRRNLIVGDSTTNNKAFDGIPKLMHDDQKIDISGASMTFSMFDE
                     LVDAVKDLGADCIMMRSEHLRAYRALLRTVNVGPSEIMMENFGRPMLCHNGVPFIVND
                     FIPVADSTKADIYCLHLSEENGVTGLYGGENAGIVVENIGTVQNKDAVRTRVKWYCSL
                     ANKHDKAIAALTNVKI"
     misc_feature    complement(74090..>74848)
                     /locus_tag="KPHS_p100780"
                     /note="Phage capsid family; Region: Phage_capsid; cl27082"
                     /db_xref="CDD:355611"
     gene            complement(74917..75816)
                     /locus_tag="KPHS_p100790"
                     /db_xref="GeneID:11817975"
     CDS             complement(74917..75816)
                     /locus_tag="KPHS_p100790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220886.1"
                     /db_xref="GeneID:11817975"
                     /translation="MNLWQMLMARRGLMDVAESHERGGAGAGAPAGAEEQGTQESGKQ
                     NGEQKDQPKIEDDEFGGMTQEELLAELRKSKKAGADLLKENMKRKEKERAMADQLAQY
                     GDIDPARARQLLEAEQAAENARREAEQAELERRGEFDAVKKQMIEAHQAEMAQRDERF
                     SALESENAALKAQLVEMTVGASFSGSNFLREKVLMTPAKARVIYGSHFEVGEDGNVVG
                     YDKPAGQKERAVLVDGEGKPLPFESAIERILRADPEADALLRSEAKQGAGSISKPTHK
                     VTQPKNKSTMDKLTAGLGKIGIK"
     misc_feature    complement(<75319..>75717)
                     /locus_tag="KPHS_p100790"
                     /note="Family of unknown function (DUF5401); Region:
                     DUF5401; pfam17380"
                     /db_xref="CDD:340095"
     gene            complement(75839..76486)
                     /locus_tag="KPHS_p100800"
                     /db_xref="GeneID:11817976"
     CDS             complement(75839..76486)
                     /locus_tag="KPHS_p100800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220887.1"
                     /db_xref="GeneID:11817976"
                     /translation="MGTKRVFTYDSESGNQPFYLSPDPKQAQMIITTIQTVINEIYHS
                     VGVAGERTKQDNAKGIDNSSGAAKLYDFQRVNSLLITKAERLERAERQMMFLAAKWMG
                     VDLDEEHSLIAYPESFDIRGLTDEFAVAEKLGLLEAPDSVRRYQMEMLIEKIFPNISA
                     AMQKEFEKDLLNFPPKNALNTLENKSVLTYHRDTVQESGQDLSQGNGNSSTQATE"
     gene            complement(76600..77427)
                     /locus_tag="KPHS_p100810"
                     /db_xref="GeneID:11817977"
     CDS             complement(76600..77427)
                     /locus_tag="KPHS_p100810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220888.1"
                     /db_xref="GeneID:11817977"
                     /translation="MEEKQMELTDKQIKDLVARRHPEYIKKKEHWDFLASTYAGGRAW
                     FDDNIFRYFKEGDQEFKERLERAYRFNHTREVVNLINKYLFKEDIHRNVEEAPEPIQK
                     FWKRATRQNVSIDGFMSALDLQSSIYGRVWVVVDSTMDSDAESVADEKKKDVRAYAYW
                     ISPQQMLDMAWDDDGNLIWALIVEVARDDQDPFTSSGQEYQRYRLWTRNEWYLFREEV
                     KKGAGNAGRRTAKVVLEDKGEHKLGVVPVFPVDCIGESESPYLARRLLMISPTLTVQ"
     misc_feature    complement(<76678..77352)
                     /locus_tag="KPHS_p100810"
                     /note="Phage portal protein, SPP1 Gp6-like; Region:
                     Phage_prot_Gp6; cl19531"
                     /db_xref="CDD:302900"
     gene            complement(77445..78701)
                     /locus_tag="KPHS_p100820"
                     /db_xref="GeneID:11817978"
     CDS             complement(77445..78701)
                     /locus_tag="KPHS_p100820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220889.1"
                     /db_xref="GeneID:11817978"
                     /translation="MSIPSSLSLVQLHSGQMQVFQSPHRFKVVCAGRRWGKSRLSIST
                     IIRAAAKERKQRVWYVAPTYQMARQILWDDLQEVLPRKWIRKKNDTTMTIVLKNGSEI
                     ALKGADKPDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSE
                     FHKLWTIGQNKELQRKGQWKSWQFVTADSPFVPTAEIEAAKNDMDPKSFAQEYLASFE
                     NMSGRVYYPFDRSVHVKPLQFNPKLPVWVGQDFNIDPMSSVILQPQPNGELWAVDELV
                     LFSSNTAEVCDELERRFWRWKSQVTIFPDPAGAYRQHARGESDIDIFKEKGFLRVDYP
                     KKHPPIADRVNSVNRMLMSASGETRLYIDPKCKHLIDSLEKVIYKPGSRDMDKSGGIE
                     HSADALGYPVHRRYPVKNRVILGGSR"
     misc_feature    complement(<78036..78701)
                     /locus_tag="KPHS_p100820"
                     /note="large terminase protein; Provisional; Region: 17;
                     PHA02533"
                     /db_xref="CDD:222858"
     gene            complement(78704..79345)
                     /locus_tag="KPHS_p100830"
                     /db_xref="GeneID:11817979"
     CDS             complement(78704..79345)
                     /locus_tag="KPHS_p100830"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="YP_005220890.1"
                     /db_xref="GeneID:11817979"
                     /translation="MTVEKDESKTRLTPAEWAEAEAKWTSGEYTLSKLEEEYGIRRET
                     LSRHFKKRGLEKGADSVGKMVRESLKSDAELRAKARAEKIEDRRTRYDGWAYALGQMV
                     MVEVTTAKREGKPLASIEDDLKSLQRASGTLAKCFEISSKALGMEKDEGGEEDIPNLV
                     FGELTPSQVAQLRKEDDEPEVIDDDLLESLEEEALSEAESDFDASGEDDDGDA"
     gene            complement(79521..79787)
                     /locus_tag="KPHS_p100840"
                     /db_xref="GeneID:11817980"
     CDS             complement(79521..79787)
                     /locus_tag="KPHS_p100840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220891.1"
                     /db_xref="GeneID:11817980"
                     /translation="MTLTDKQKDIIKTINLGHERGHLLDLDELLEVLPYRTTKQSMQF
                     SLRALIKKGLVEKHDCRPREDSGYQRRTLGLTTLGRARAKLLVM"
     gene            complement(79797..80687)
                     /locus_tag="KPHS_p100850"
                     /db_xref="GeneID:11817981"
     CDS             complement(79797..80687)
                     /locus_tag="KPHS_p100850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220892.1"
                     /db_xref="GeneID:11817981"
                     /translation="MTDIIIKRYRPEEFPRHLDFLERMTVTRGTVEDWHALKSLHYKT
                     DGKPFAPTYYRCELDGRLVGVVVMAFPKLLLAPRHRMFPKLKPTTNTTVANQYWGRYV
                     NNNFAVISRSVVDTQYRGVGVSYRMINLVSRMHDRPIIEIQSSMSKYNPFAMKAGFCF
                     IRPERPKSYESALRVFQRHFRSDPGDNEAIVKELFAMTDSRRRRALRDLVADYHKNSS
                     LAKAGRNRGTTIQDIADSLVDEASIVKLLKDIHNLSFTSPLYGVYRNPDFGRQLPDTL
                     PLLAFDKQPLNAPLDIALPA"
     misc_feature    complement(79818..>80687)
                     /locus_tag="KPHS_p100850"
                     /note="ABC-type ATPase fused to a predicted
                     acetyltransferase domain [General function prediction
                     only]; Region: MK0520; COG2401"
                     /db_xref="CDD:225265"
     gene            complement(80693..80947)
                     /locus_tag="KPHS_p100860"
                     /db_xref="GeneID:11817982"
     CDS             complement(80693..80947)
                     /locus_tag="KPHS_p100860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220893.1"
                     /db_xref="GeneID:11817982"
                     /translation="MPDLKIVERKPSKETDNNNVEVIRLLEDALQYAREGKSQSLALL
                     MINNDGSVLDCWHNGGRPYVMVGAMESLRLDFINANIERR"
     misc_feature    complement(80940..81577)
                     /note="potential frameshift: common BLAST hit:
                     gi|18466740|ref|NP_569547.1| putative ABC transporter
                     ATP-binding protein"
     gene            complement(80940..81362)
                     /locus_tag="KPHS_p100870"
                     /db_xref="GeneID:11817983"
     CDS             complement(80940..81362)
                     /locus_tag="KPHS_p100870"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="YP_005220894.1"
                     /db_xref="GeneID:11817983"
                     /translation="MKDEGLSVASIDDFTFDNDVNVIDQLGKTTSEALGLLSMAGLND
                     AYLFVRKPSEMSDGQKYRLKIAKLIESGAKVWAADEFGAVLDRVTAQVVASNLQRAAR
                     KVGATVMVATTHEDLKNALRPDMQITKHYKERVKVEYA"
     misc_feature    complement(80943..>81344)
                     /locus_tag="KPHS_p100870"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; cl26602"
                     /db_xref="CDD:331423"
     gene            complement(81359..81577)
                     /locus_tag="KPHS_p100880"
                     /db_xref="GeneID:11817984"
     CDS             complement(81359..81577)
                     /locus_tag="KPHS_p100880"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="YP_005220895.1"
                     /db_xref="GeneID:11817984"
                     /translation="MSTYTINVSFQTRVNKTTRTLEIAESFGLGLDEKDWTLYDNLEL
                     EVEQGDVVYITGQSGSGNLSCCVSYNAR"
     misc_feature    complement(<81395..81469)
                     /locus_tag="KPHS_p100880"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     gene            complement(81574..82242)
                     /locus_tag="KPHS_p100890"
                     /db_xref="GeneID:11817985"
     CDS             complement(81574..82242)
                     /locus_tag="KPHS_p100890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220896.1"
                     /db_xref="GeneID:11817985"
                     /translation="MTKTFEIVYRDPAELIPYEMNAKKHDEQQIRDLAAAIKKRGFDQ
                     PITVDKDDVIITGHGRREAALLAGLKSVPVIVRDDLSDEEVKAKRLEDNRLASIDYDA
                     IKLQKELESLVFGDVEVFGFDERELNVLVGSMTEEMDTGALVMDLGEETERQKEEHTE
                     ISREVAAEEVRVVDVLGFKTLPAGSAIVVGDLLAHMEEITGESGVDAFVAYAQKVSSG
                     GVEA"
     misc_feature    complement(81622..82236)
                     /locus_tag="KPHS_p100890"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     COG1475"
                     /db_xref="CDD:224392"
     misc_feature    complement(81955..82212)
                     /locus_tag="KPHS_p100890"
                     /note="ParB N-terminal-like domain, some attached to
                     C-terminal S-adenosylmethionine-dependent
                     methyltransferase; Region: ParB_N_like_MT; cd16403"
                     /db_xref="CDD:319260"
     misc_feature    complement(order(82054..82059,82063..82068,82072..82074))
                     /locus_tag="KPHS_p100890"
                     /note="putative ParB Box II like motif [polypeptide
                     binding]; other site"
                     /db_xref="CDD:319260"
     gene            complement(82242..82946)
                     /locus_tag="KPHS_p100900"
                     /db_xref="GeneID:11817986"
     CDS             complement(82242..82946)
                     /locus_tag="KPHS_p100900"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220897.1"
                     /db_xref="GeneID:11817986"
                     /translation="MQWIVSKSMDVKITILQVEIARLRPNPWNTNSVGAQNFEKLKGS
                     IEKLGFFKPILARELDGGQFEILGGEHRWRAAMEQGISTVPVISVGKISDLVAKQMSL
                     VDNERYGEDDQVALQRLIEEIQSELDYQLSEIAPYDDELAATLARESAIDLEMLEALS
                     RGDEEPIEKDSREKAERVGAEHQTMRFKVTFDASDRVTETIKSIIKEQAINTGNDMEN
                     AGEALVWLVDNYKECI"
     misc_feature    complement(82251..82910)
                     /locus_tag="KPHS_p100900"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     COG1475"
                     /db_xref="CDD:224392"
     misc_feature    complement(82629..82901)
                     /locus_tag="KPHS_p100900"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:334841"
     gene            83006..84565
                     /locus_tag="KPHS_p100910"
                     /db_xref="GeneID:11817987"
     CDS             83006..84565
                     /locus_tag="KPHS_p100910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helicase"
                     /protein_id="YP_005220898.1"
                     /db_xref="GeneID:11817987"
                     /translation="MTVRIVSNAVNAMVSGADDNVKRLVQEMLSYEVEAGDWKGTSTM
                     FNWSKNAFPAGFAKSVAANLVKAGIKCVHIRKDKVPALGKPNPAVNPFPYNPDYAYQD
                     QAVETLVREGMMIAQIATGGGKSNVACKAAARIGRMTLFLTTRSVLMFQMADNFQKSI
                     DYRAENGEPWLKGQKVGIIGSGEFQVSRHINVATVQTLASFLEEPPRDMPAEKKAYHL
                     KRRELIKRFLSSVSLLILEEAHESSGSNFYDIARLCINADYRLALTATPFMKASTEAN
                     MRLMAVAGRIEIKVTEKYLIERGILAKPYFVYHKIAYTPDEARIRAELASKHLNFRVG
                     MSTPYQKAYQLGIVYNIGRNEAVVRDALMYRDHGLNCMTLVRIKRHGQILMEMMKESG
                     LRVDFIYGESNQSTRQAKLNSLAAGKIDVLIGSTILDVGVDVPSVGAVILAGGGKAEV
                     EMRQRVGRGLRAKKNQANVCFISDFIDISNKHLMSHSYERKHIIDTTPGFAEGVLPVG
                     SSFDFGVLQRD"
     misc_feature    83252..84478
                     /locus_tag="KPHS_p100910"
                     /note="Superfamily II DNA or RNA helicase [Transcription,
                     Replication, recombination and repair]; Region: SSL2;
                     COG1061"
                     /db_xref="CDD:223989"
     gene            84568..84843
                     /locus_tag="KPHS_p100920"
                     /db_xref="GeneID:11817988"
     CDS             84568..84843
                     /locus_tag="KPHS_p100920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220899.1"
                     /db_xref="GeneID:11817988"
                     /translation="MTENRSISCQVKLTEKANEKLGSFKKRLKERNIKMSKSDIINLV
                     LTKMSTAEFEKIATSMAAAENARQKVLQIYENSGMTKEDLEDILKRL"
     gene            complement(84894..85328)
                     /locus_tag="KPHS_p100930"
                     /db_xref="GeneID:11817989"
     CDS             complement(84894..85328)
                     /locus_tag="KPHS_p100930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220900.1"
                     /db_xref="GeneID:11817989"
                     /translation="MNKCALIALITSSLLVAGCSTQAVRTSAADPVPASRILSTKYNT
                     PSENTQKIIVKRDSGSKGALCTSRLSVDGEPVADIKTSEKVELNLPYGEHILSVDQQG
                     MSIMCGKMNTEREIMVSKDKQDEYRIGVTVSAELFIMKTAYK"
     gene            85487..86017
                     /locus_tag="KPHS_p100940"
                     /db_xref="GeneID:11817990"
     CDS             85487..86017
                     /locus_tag="KPHS_p100940"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005220901.1"
                     /db_xref="GeneID:11817990"
                     /translation="MPNTITDITYGIPAEVWPRDYSKVEASLMFWRKEQIPVKVTMED
                     GQVFCMYVQGTMSSRNKVDLCPAPFDKDNRVRLPLERISTIESGVNDAVTHDFVGRVT
                     VHPDYVDNRPSRRDFFKICRQAHENHKSVRVYMADGREIEGVSLGVDACQVTLAVGNG
                     RKMIVLFDWVERILPF"
     misc_feature    85505..86005
                     /locus_tag="KPHS_p100940"
                     /note="Repressor of phase-1 flagellin; Region:
                     Flag1_repress; pfam03614"
                     /db_xref="CDD:281597"
     gene            86150..86329
                     /locus_tag="KPHS_p100950"
                     /db_xref="GeneID:11817991"
     CDS             86150..86329
                     /locus_tag="KPHS_p100950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220902.1"
                     /db_xref="GeneID:11817991"
                     /translation="MYQFSAAVKAGKSIGESAELCKGLSSDMRELQDCGESESSADFV
                     DTLFETNRRAVVSTQ"
     gene            86651..87301
                     /locus_tag="KPHS_p100960"
                     /db_xref="GeneID:11817992"
     CDS             86651..87301
                     /locus_tag="KPHS_p100960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220903.1"
                     /db_xref="GeneID:11817992"
                     /translation="MSNVTISKKSIIDAAVVITDELQLKADQATQTYNEHYQNGTHTK
                     ADKANMLAASTKLAYFVNNVVNAVNDDKLSGVFYYAIKASKQTPEVFFREAMTNSYSL
                     EKLVYLVKSIKSGKCVYSVADMSGSRVFALIDMINDEIDTFTNGAVFDLMNEAKQANE
                     IKLDAGYTQANQLINLCERLGLVEKIKGMGAAKNGSQQYRFIKNDFYNYLADAFKA"
     gene            87352..87555
                     /locus_tag="KPHS_p100970"
                     /db_xref="GeneID:11817993"
     CDS             87352..87555
                     /locus_tag="KPHS_p100970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220904.1"
                     /db_xref="GeneID:11817993"
                     /translation="MISYDQIRAEYRAKYRAYKLELIDGLSAQRDALNFTFSDLLNSK
                     RDCKRKREYLRLSEMIGKLQNSI"
     gene            complement(88150..88632)
                     /locus_tag="KPHS_p100980"
                     /db_xref="GeneID:11817994"
     CDS             complement(88150..88632)
                     /locus_tag="KPHS_p100980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220905.1"
                     /db_xref="GeneID:11817994"
                     /translation="MNYIATVNTPAHGTISVTYADIEKNILGAWREEETIQLSGKEKQ
                     QIAKDIICNRRFTRVFEKAYVVNSGFGTFVFPVRSGRFCQSKLTEFASQIAIWIKTQS
                     SFDFSDDEAIAQGMRIANNAIKCKNITYAAGVDSWKLFCANFMLNVYASNRIHILAGK
                     "
     gene            complement(88837..89034)
                     /locus_tag="KPHS_p100990"
                     /db_xref="GeneID:11817995"
     CDS             complement(88837..89034)
                     /locus_tag="KPHS_p100990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220906.1"
                     /db_xref="GeneID:11817995"
                     /translation="MDHVEPDEQTSSRFFHYQDSVYDIADFMRDDRFPEWHAGYPLNA
                     FAMLMIRVTDSGDTIDIGLLH"
     gene            88987..89139
                     /locus_tag="KPHS_p101000"
                     /db_xref="GeneID:11817996"
     CDS             88987..89139
                     /locus_tag="KPHS_p101000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220907.1"
                     /db_xref="GeneID:11817996"
                     /translation="MEEAGAGLFVRFDVIHFFLLGRRQVKPGFQPYVFCFGEMVKSVM
                     CVSSLR"
     gene            complement(89244..89663)
                     /locus_tag="KPHS_p101010"
                     /db_xref="GeneID:11817997"
     CDS             complement(89244..89663)
                     /locus_tag="KPHS_p101010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220908.1"
                     /db_xref="GeneID:11817997"
                     /translation="MEVKMSLTKEDLVFDLYYASSTDEEGNKLAQLTVQFRDASAVPH
                     VTTQLARTTLKRDRSKVYAVGEQSVKNGSDTLLAAIEAYYRTDPKTIFEGLMAQVQDM
                     IEGNLGANNTWVGSYGITIVSGGSLEEYLPESVYNVQ"
     gene            complement(89771..90070)
                     /locus_tag="KPHS_p101020"
                     /db_xref="GeneID:11817998"
     CDS             complement(89771..90070)
                     /locus_tag="KPHS_p101020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220909.1"
                     /db_xref="GeneID:11817998"
                     /translation="MILKLDKLQPRKDKPAVLGSITLLDIVANGTAIRLFKETVVVFG
                     ETSRKRIVMSVRRYSAKGWVAKQVIWPESELELALLEVNKVAQQEIQRATTLAIA"
     gene            complement(90219..90431)
                     /locus_tag="KPHS_p101030"
                     /db_xref="GeneID:11817999"
     CDS             complement(90219..90431)
                     /locus_tag="KPHS_p101030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220910.1"
                     /db_xref="GeneID:11817999"
                     /translation="MNMPVIVEVWSVDSLAECLDGVGPALTRKLWSFVPAKGESPKGK
                     DVWHLLTDEEKRELVAAVKEEFPDED"
     gene            complement(90444..90662)
                     /locus_tag="KPHS_p101040"
                     /db_xref="GeneID:11818000"
     CDS             complement(90444..90662)
                     /locus_tag="KPHS_p101040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220911.1"
                     /db_xref="GeneID:11818000"
                     /translation="MYKHLNISITLCGEETCTDELQISLDDVIRSADVAGRIGTLIVE
                     GYREGTFDFHIEDNAMSVAWNCTTSESR"
     gene            91292..91414
                     /locus_tag="KPHS_p101050"
                     /db_xref="GeneID:11818001"
     CDS             91292..91414
                     /locus_tag="KPHS_p101050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220912.1"
                     /db_xref="GeneID:11818001"
                     /translation="MTIRMGEKATFFSLPVSGFADVVEVVVLWFYSGLYSSFWG"
     gene            92539..92724
                     /locus_tag="KPHS_p101060"
                     /db_xref="GeneID:11818002"
     CDS             92539..92724
                     /locus_tag="KPHS_p101060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220913.1"
                     /db_xref="GeneID:11818002"
                     /translation="MAGQYEKAITIKQAIDSINLRHYLLPAIQRKFVWSYGQICLLFD
                     SIMRDYPINYFHDVGYP"
     misc_feature    92599..>92703
                     /locus_tag="KPHS_p101060"
                     /note="Protein of unknown function DUF262; Region: DUF262;
                     cl23836"
                     /db_xref="CDD:304993"
     gene            92708..94405
                     /locus_tag="KPHS_p101070"
                     /db_xref="GeneID:11818003"
     CDS             92708..94405
                     /locus_tag="KPHS_p101070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220914.1"
                     /db_xref="GeneID:11818003"
                     /translation="MWDIRSISIKNDYKFYEFLKEYCQRFNEENPYVPTNAGFHDFKA
                     VIDGQQRLTSLYIGLCGTYAYKKPREWWPSAQDDRILPPRKLYVDLTAPLDSDDEPMM
                     KYNFRFLTDKEYTDSLTDNKHHWFCLHEIFKYEQIDSPDDILFKVVVPELEKRGLISS
                     EFSRKTLLKLYTKIRTENLIHYFNESSQDIDHVLDVFIRTNNGGTKLEFSDLLMSIAV
                     AHWQGDFRRELDELTKNIHQNNEMGFYIERDWFLKTSLMLIDSDVRFKVKNFTSEEVG
                     KIQQQWSEIKSCIKETFVLIRRFGINPQSLISKNAVIPVVYWLYKKQTNGHPLYTTIN
                     LLNKNHNERSVISQWFYMVLLKGIFGSQADALLTSIRDVMKNSLSDVHFPLEKIIDRY
                     KGSNKDLRFDNEYIESLLNIRYGEGRCRVLLHLLFPEMNPTEVFHIDHLHPRNHFSNK
                     YLEKLDYIANSPEKLSFYENPEHWDTIPNLHLLNHSQNTSKQDTSLKQWLSHSSNNYT
                     PSMLLVSDENIEFSRFQEFYNERRNALKQRLLNRVFLTTKIDSSPSTMDTDEEILTD"
     misc_feature    <92840..93355
                     /locus_tag="KPHS_p101070"
                     /note="Protein of unknown function DUF262; Region: DUF262;
                     pfam03235"
                     /db_xref="CDD:281256"
     gene            94609..96165
                     /locus_tag="KPHS_p101080"
                     /db_xref="GeneID:11818004"
     CDS             94609..96165
                     /locus_tag="KPHS_p101080"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction enzyme"
                     /protein_id="YP_005220915.1"
                     /db_xref="GeneID:11818004"
                     /translation="MTSLQQRAELHRQIWAIANDVRGSVDGWDFKQYVLGALFYRFIS
                     ENFSSYMEAGDESINYAALDDSIITDDIKDDAIRTKGYFIYPSQLFCNVAAKANTNDR
                     LNADLNSIFVAIESSAYGYPSEADIKGLFADFDTTSNRLGNTVKDKNSRLAAVLKGVE
                     GLKLGNFNEHQIDLFGDAYEFLISNYAANAGKSGGEFFTPQHVSKLIAQLAMHGQTHV
                     NKIYDPAAGSGSLLLQAKKHFDNHIIEEGFFGQEINHTTFNLARMNMFLHNINYDKFD
                     IRLGNTLTEPHFGDEKPFDAIVSNPPYSVKWIGSDDPTLINDERFAPAGVLAPKSKAD
                     FAFVLHALNYLSAKGRAAIVCFPGIFYRGGAEQKIRQYLVDNNYVETVISLAPNLFFG
                     TTIAVNILVMSKHKTDTRVQFIDASGLFKKETNNNILTDGHIEKIMQVFTSKADIDHL
                     AKTIPYETVAANDYNLSVSSYVEAMDTREIVDIAELNAELKITVSKIDQLRKDIDSIV
                     AEIEGDEVQK"
     misc_feature    94624..96111
                     /locus_tag="KPHS_p101080"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; cl28090"
                     /db_xref="CDD:332911"
     gene            96162..97358
                     /locus_tag="KPHS_p101090"
                     /db_xref="GeneID:11818005"
     CDS             96162..97358
                     /locus_tag="KPHS_p101090"
                     /codon_start=1
                     /transl_table=11
                     /product="Restriction modification system DNA specificity
                     domain protein"
                     /protein_id="YP_005220916.1"
                     /db_xref="GeneID:11818005"
                     /translation="MSALSYLEKLLNGVDIQWKTIGEVTLRTSNIKWREATRSYRYVD
                     LTSVDIETKKIIETTEVTANNAPSRAQKLIEENDVIFATTRPTQQRFCLIDGEYSDEV
                     ASTGFCVLRAKQDEVLPKWIWHWISTSYFKKYVEENQSGSAYPAISDAKVKECYIPVP
                     CPENPGKSLAIQSEIVRILDKFTALTAELTAELTARKKQYNYYRDQLLSFEGGSVEWK
                     SLGEVAIITIGAFVRKDKQNPDADYPVYNGGRTPTGYYEDFNNDGDKIIVSARGANAG
                     FVNKSSTPYWAGNSCYSISVRSTEQLHWMYVYYYLKQSETKLTGIQQKGGIPAVSKKQ
                     MEDLLLPIPSKSEQVRIVTILDKFDTLTSSITEGLPREIELRQKQYEYYRDLLFSFPK
                     PEIASH"
     misc_feature    <96468..97331
                     /locus_tag="KPHS_p101090"
                     /note="Restriction endonuclease S subunit [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    97434..100164
                     /note="potential frameshift: common BLAST hit:
                     gi|291289374|ref|YP_003517706.1| type I
                     restriction-modification system restriction subunit R"
     gene            97434..97715
                     /locus_tag="KPHS_p101100"
                     /db_xref="GeneID:11818006"
     CDS             97434..97715
                     /locus_tag="KPHS_p101100"
                     /codon_start=1
                     /transl_table=11
                     /product="HsdR protein"
                     /protein_id="YP_005220917.1"
                     /db_xref="GeneID:11818006"
                     /translation="MTHQTHTIAESNNFIVLDKYTKAQPTGDSYQSESDLERELIQDL
                     QNQGYEFLAVKSQTAMLANIRAQLQSLNGVAFNESEWRRFAEQYLDSPQ"
     misc_feature    97669..100550
                     /note="potential frameshift: common BLAST hit:
                     gi|215489626|ref|YP_002332057.1| type I
                     restriction-modification enzyme R subunit"
     gene            97669..100164
                     /locus_tag="KPHS_p101110"
                     /db_xref="GeneID:11818007"
     CDS             97669..100164
                     /locus_tag="KPHS_p101110"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type I restriction-modification enzyme
                     R subunit"
                     /protein_id="YP_005220918.1"
                     /db_xref="GeneID:11818007"
                     /translation="MNGGASQSSIWTAPSDSSLDKTRKIHIDYICDFTFDDGRLENIY
                     LIDKKNLLRNKVQVIQQFEQTGSHANRYDVTILVNGLPLVQIELKKRGVAIREAFNQI
                     HRYSKESFNSDNSLFKYLQLFVISNGTDTRYFASTTKRDKNSFDFTMNWAKSDNTLIK
                     DLKDFTATFFQKHTLLNVLFNYSVFDSSQTLLVMRPYQIAATERILWKINSSFKAKNW
                     SKPESGGFIWHTTGSGKTLTSFKAARLATELDFIDKVFFVVDRKDLDYQTMKEYQRFS
                     PDSVNGSDNTAGLRRNLDKDDNKIIVTTIQKLNNLMKAEADLPVYQQQVVFIFDECHR
                     SQFGEAQKNLKKKFRRFYQFGFTGTPIFPQNALGSETTASVFGRELHSYVITDAIRDE
                     KVLKFKVDYNDVRPQFKALETETDEKKLSAAENQQAFLHPLRIQEITQYILNNFRQKT
                     HRTFPGAKGFNAMLAVSSVEAAKAYYSTFKVLQEEAAKKSGSYKCLRVATIFSFAANE
                     EQSAIGDITDESFDTSAMNSSAKEFLDSAIDDYNNHFKTNFSTDSNGFQNYYRDLAQR
                     VKNQDIDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFGNI
                     VTFRDLERPTIDAITLFGDKNTKNVVLEKSYEEYMQGFSDAATGEAKRGFMSIVSELE
                     QRFPDPASIESEKEKKAFVKLFGEYLRAENILQNYDEFATLKALQKVDISDPEAVETF
                     KAEHYVDDEKFAELQTIRLPAERKVQDYRSAYNDIRDWQRREKAANDRDTSTTDWDDV
                     VFEIDLLKSQEINLDYILGLIFDHNRQKRVKKP"
     misc_feature    97687..99609
                     /locus_tag="KPHS_p101110"
                     /note="type I site-specific deoxyribonuclease, HsdR
                     family; Region: hsdR; TIGR00348"
                     /db_xref="CDD:273028"
     misc_feature    <97825..98091
                     /locus_tag="KPHS_p101110"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:282206"
     misc_feature    98239..98754
                     /locus_tag="KPHS_p101110"
                     /note="Type III restriction enzyme, res subunit; Region:
                     ResIII; pfam04851"
                     /db_xref="CDD:282678"
     misc_feature    98362..98376
                     /locus_tag="KPHS_p101110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    98656..98667
                     /locus_tag="KPHS_p101110"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    99616..>100161
                     /locus_tag="KPHS_p101110"
                     /note="Type I restriction and modification enzyme -
                     subunit R C terminal; Region: EcoR124_C; pfam12008"
                     /db_xref="CDD:288831"
     gene            100260..100550
                     /locus_tag="KPHS_p101120"
                     /db_xref="GeneID:11818008"
     CDS             100260..100550
                     /locus_tag="KPHS_p101120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative type I restriction-modification enzyme
                     R subunit"
                     /protein_id="YP_005220919.1"
                     /db_xref="GeneID:11818008"
                     /translation="MPDKASIIDAFFTYAQREQQREAEALIKEENLNEEAARRYIRTS
                     LKREYATENGTELNETLPKLSPLNPQYKTKKQTVFQKIGAFIEKFKGVGGRI"
     misc_feature    <100260..100427
                     /locus_tag="KPHS_p101120"
                     /note="Type I restriction and modification enzyme -
                     subunit R C terminal; Region: EcoR124_C; pfam12008"
                     /db_xref="CDD:314824"
     gene            complement(100612..100827)
                     /locus_tag="KPHS_p101130"
                     /db_xref="GeneID:11818009"
     CDS             complement(100612..100827)
                     /locus_tag="KPHS_p101130"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA modification methylase"
                     /protein_id="YP_005220920.1"
                     /db_xref="GeneID:11818009"
                     /translation="MSAALSVLESFASNTGIDHSKEMNVIHAIVAECEKGIAFMHQVH
                     DFTYGDERHWNKCLRFVLPTLEVEIIW"
     gene            complement(100956..101534)
                     /locus_tag="KPHS_p101140"
                     /db_xref="GeneID:11818010"
     CDS             complement(100956..101534)
                     /locus_tag="KPHS_p101140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220921.1"
                     /db_xref="GeneID:11818010"
                     /translation="MCDKCTAANAEVKKIINEVGAKKLVGMLDSITGHGDAHPLERIM
                     AIVQVMDLFDEPMKILMLARHFGGAYVEEHERANKLQATLDMMSEPKCAPAPELSGDN
                     MGIESKEREIASLKSSLGMLITAFKLMATHNGFKMPELTGDEHPAAIRQLLGAMADNM
                     DEAKSRIEDMMRELAHRHDLNDQPHKMQQVSH"
     gene            complement(101662..101817)
                     /locus_tag="KPHS_p101150"
                     /db_xref="GeneID:11818011"
     CDS             complement(101662..101817)
                     /locus_tag="KPHS_p101150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220922.1"
                     /db_xref="GeneID:11818011"
                     /translation="MAEKLRLAVVAILLVLVVLVDFTGKLMSIAADGVLVGLAIYFAQ
                     PLLKKSK"
     gene            complement(101817..102188)
                     /locus_tag="KPHS_p101160"
                     /db_xref="GeneID:11818012"
     CDS             complement(101817..102188)
                     /locus_tag="KPHS_p101160"
                     /codon_start=1
                     /transl_table=11
                     /product="TciA"
                     /protein_id="YP_005220923.1"
                     /db_xref="GeneID:11818012"
                     /translation="MENRDAVEATVWGAYMIAYADGNCDAKEIAILEKTISALPAFSP
                     FAGEIAQMSSNIRARYEASPRSANAQALRELADVAGTPEAVDVLCLCLDIADQDGIGE
                     EEEVVLKKIAQALQLSLDAYI"
     misc_feature    complement(101838..102173)
                     /locus_tag="KPHS_p101160"
                     /note="tellurite resistance protein terB; Region: terB;
                     cd07176"
                     /db_xref="CDD:143580"
     misc_feature    complement(order(101874..101876,101895..101897,
                     102105..102107,102126..102128))
                     /locus_tag="KPHS_p101160"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:143580"
     gene            complement(102542..103204)
                     /locus_tag="KPHS_p101170"
                     /db_xref="GeneID:11818013"
     CDS             complement(102542..103204)
                     /locus_tag="KPHS_p101170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220924.1"
                     /db_xref="GeneID:11818013"
                     /translation="MYLTHRQDDNVLVRHGSKDGTQKNGGWTFQPQLFLTLKGFQMAH
                     QTPSSSLKKHPRSLRLILAELFSGRVSARLSELEEKVGQMEHRLDDHAVAISNLGARV
                     AMGEVMKARTAKILRDTWGVRANQTRMESSDGSISTKKTTSNGLRADHDLSGSRSNTV
                     DSGVADAGLMQNGFAADAGTSHGKHNQHHHHAPVCHSGWDAVGFDSSSSSCDSGSSSC
                     CD"
     gene            complement(103228..103896)
                     /locus_tag="KPHS_p101180"
                     /db_xref="GeneID:11818014"
     CDS             complement(103228..103896)
                     /locus_tag="KPHS_p101180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ribonuclease H"
                     /protein_id="YP_005220925.1"
                     /db_xref="GeneID:11818014"
                     /translation="MCAHARGKKKIVAARDSGAKMTTKTPARQHTGCRTKSKARYQTH
                     QQSRTNFKTPVVEFNPQLKTVKVFSDGSCLKNPGGPGGYGIVLQYRGEERELSEGFHS
                     TTNNRMEMMGALIALERLKFSCNVILHSDSQYLKNGMTLWMKGWKLNGWITADKKPVK
                     NVDLWKRLDLAASRHNVRWNWVKGHAGHRENEICDRLAKIAAYAAADTPHKKDAGFLV
                     QNDK"
     misc_feature    complement(103306..103713)
                     /locus_tag="KPHS_p101180"
                     /note="ribonuclease H; Reviewed; Region: rnhA; PRK00203"
                     /db_xref="CDD:178927"
     misc_feature    complement(order(103312..103314,103504..103506,
                     103570..103572,103687..103689))
                     /locus_tag="KPHS_p101180"
                     /note="active site"
                     /db_xref="CDD:260010"
     misc_feature    complement(order(103354..103356,103504..103506,
                     103570..103572,103579..103587,103678..103689))
                     /locus_tag="KPHS_p101180"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260010"
     gene            complement(104424..104657)
                     /locus_tag="KPHS_p101190"
                     /db_xref="GeneID:11818015"
     CDS             complement(104424..104657)
                     /locus_tag="KPHS_p101190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220926.1"
                     /db_xref="GeneID:11818015"
                     /translation="MVYPTNVVALVESDFLANARELMKDREKAFSLYEWSLKCLHTGE
                     HKDLIEQLLGELINEVFALQVQLHGRQNDQSKK"
     gene            complement(104860..105453)
                     /locus_tag="KPHS_p101200"
                     /db_xref="GeneID:11818016"
     CDS             complement(104860..105453)
                     /locus_tag="KPHS_p101200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220927.1"
                     /db_xref="GeneID:11818016"
                     /translation="MIAAEKIKKRERDASLRDLWRTPKWLFVAIQRYLGITFDVDVAC
                     NKENALLPSYIGVERDALKSSWGDPGTVAFLNPPYSKITPWIDAAIREQSRGVTTVML
                     IPQSLDTQWYERAAECANETVILSGGRVAFVEPDVELGLVEVNINPGGSMLLIFRGYC
                     QEAGHTISKIPLAVMKKLGGYDPANVVRKKRPRKKAA"
     misc_feature    complement(104983..105411)
                     /locus_tag="KPHS_p101200"
                     /note="DNA N-6-adenine-methyltransferase (Dam); Region:
                     Dam; cl05442"
                     /db_xref="CDD:323057"
     gene            complement(105638..106471)
                     /locus_tag="KPHS_p101210"
                     /db_xref="GeneID:11818017"
     CDS             complement(105638..106471)
                     /locus_tag="KPHS_p101210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220928.1"
                     /db_xref="GeneID:11818017"
                     /translation="MSNLNNTVKKDDLDELTAMLQLLDEPEKLASEAVVGDEIDDLLA
                     DLNDETIVQVPAVAETVMEAKDGGDLTCVFEELENEHESLKVVDVEIPQVESISTLPE
                     IDSTQGDKPQTDEKKEKHAKESSVAAQPKESKAAKKERAAPKPRFSLNDKGDDFYAAA
                     GLKREVFIEALNSAPVKAKDKISNLLNWFNGGPDISIYTVIALRHLIDTKEASSNSIK
                     LALMSYPEKPYPLSTASTQAGQMMAVFPVTGIATRDGGRLLLNEESPIVRKFIAEYSI
                     G"
     gene            complement(106597..107154)
                     /locus_tag="KPHS_p101220"
                     /db_xref="GeneID:11818018"
     CDS             complement(106597..107154)
                     /locus_tag="KPHS_p101220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220929.1"
                     /db_xref="GeneID:11818018"
                     /translation="MTTIVAGLDIESTGLDFRANHKIIEIAITRYELETQKHIDSLAM
                     RFNPRRSIDPKAQAVHGISLEDLSAEPLLSEHAGKIARYISDASVLVAHNGEAFDLPF
                     IRHEFAEYGVTLPELPLVDTMLSGLWATEDGKRPRLEELAFSLGFVYDKAKAHSALYD
                     TDLMMHCFFKAREKYGFYKLPFESA"
     misc_feature    complement(106648..107133)
                     /locus_tag="KPHS_p101220"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(106675..106677,106690..106692,
                     106858..106866,106873..106878,107113..107115,
                     107119..107130))
                     /locus_tag="KPHS_p101220"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(106675..106677,106690..106692,
                     106861..106866,106873..106878,107113..107115,
                     107119..107130))
                     /locus_tag="KPHS_p101220"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(106675..106677,106690..106692,
                     106858..106860,107122..107124,107128..107130))
                     /locus_tag="KPHS_p101220"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     gene            complement(107164..107583)
                     /locus_tag="KPHS_p101230"
                     /db_xref="GeneID:11818019"
     CDS             complement(107164..107583)
                     /locus_tag="KPHS_p101230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220930.1"
                     /db_xref="GeneID:11818019"
                     /translation="MLGEISLADELDRKTIEALTRIADEQSRSLMTEREARLAIRAVF
                     ESVQGLVGDDVGEVLNVAMSQFSERGKRPIFPIHIKMAAGTVLYVSICLDTNEIRILN
                     VTTGEWRAPVECESQEETIKKAAQFVRSALLKGAKKL"
     gene            complement(107647..108291)
                     /locus_tag="KPHS_p101240"
                     /db_xref="GeneID:11818020"
     CDS             complement(107647..108291)
                     /locus_tag="KPHS_p101240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220931.1"
                     /db_xref="GeneID:11818020"
                     /translation="MDYRIGITGAQGSGKTTLAKFIDEHYGIPYVDAGVGALMTRLGV
                     NVGDPMPLFERLQVQMEVARHIELVTRGAEGFVIDRTPADVMAYTLDLVGQTNDQRCI
                     DLVLEIERFCHKTALSNFNAIAGLRPGVNLRAQDYERAQRGSLDRLYVARIDSLMCGE
                     LTKINSLAKSGDLQVFVLSGTCISVDARARSIMRVIDRHVERIESRISNRVTFH"
     misc_feature    complement(<108028..108282)
                     /locus_tag="KPHS_p101240"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:354812"
     gene            complement(108291..108761)
                     /locus_tag="KPHS_p101250"
                     /db_xref="GeneID:11818021"
     CDS             complement(108291..108761)
                     /locus_tag="KPHS_p101250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dihydrofolate reductase"
                     /protein_id="YP_005220932.1"
                     /db_xref="GeneID:11818021"
                     /translation="MIAAVGRNYEIGRGNELPWRCPSELKLFRELTTNATVVMGRKTM
                     ESLKRPLPERHNVVLTRSSGFMPNGFYPATMDDVMQLDGPVWVIGGAQIYSLFLPHVE
                     ELWLSHMGVDAPDSDAHFPRQMMRNLGFFPVLTAHTQRVTEDEPGFQQIVYRRW"
     misc_feature    complement(108300..108761)
                     /locus_tag="KPHS_p101250"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cd00209"
                     /db_xref="CDD:238127"
     misc_feature    complement(order(108441..108443,108480..108482,
                     108498..108500,108600..108602,108690..108692,
                     108705..108707,108756..108758))
                     /locus_tag="KPHS_p101250"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    complement(order(108486..108497,108579..108581,
                     108633..108641,108729..108731,108750..108752))
                     /locus_tag="KPHS_p101250"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     gene            complement(108764..109159)
                     /locus_tag="KPHS_p101260"
                     /db_xref="GeneID:11818022"
     CDS             complement(108764..109159)
                     /locus_tag="KPHS_p101260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220933.1"
                     /db_xref="GeneID:11818022"
                     /translation="MLCEIEDVLARAGHRKAAADENADTLVAGDELIFPTSRMLRGFA
                     RSGAEVVLISHRPEALESATKKWLRDFGIDYDWLHLAPGGVNYETHIKRTLAAHKDDL
                     MIAALVSSSRLRAALSGFHQRPVLYEVSQ"
     misc_feature    complement(<108920..109156)
                     /locus_tag="KPHS_p101260"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:328728"
     misc_feature    complement(109136..109150)
                     /locus_tag="KPHS_p101260"
                     /note="HAD signature motif I; other site"
                     /db_xref="CDD:319763"
     misc_feature    complement(108998..109000)
                     /locus_tag="KPHS_p101260"
                     /note="HAD signature motif II; other site"
                     /db_xref="CDD:319763"
     gene            complement(109179..110282)
                     /locus_tag="KPHS_p101270"
                     /db_xref="GeneID:11818023"
     CDS             complement(109179..110282)
                     /locus_tag="KPHS_p101270"
                     /codon_start=1
                     /transl_table=11
                     /product="putative thymidylate synthase"
                     /protein_id="YP_005220934.1"
                     /db_xref="GeneID:11818023"
                     /translation="MSFLLNREFSNGQLASSSYGRVIQTVVDTGVPSEDRTGTGTLGV
                     SYVPSYYMLTGGAVPLISSKQVNLKPLLVELEWYLQGSGNIGFLKEHGVKIWDAWADD
                     NGDLGPVYGKQWRRWEDTRIVPYSEYRLKEDIFLERGYRVEGYIGLNEDRVVITREID
                     QLQRMVDQLRNDPTDRRILLNAWNVGELEDMKLPPCHFVLSVWSRELDFQTRLSMATD
                     IGIQHNRHGYESIYTQMLCLIEQRGSISEPMLDELGIPKRILNSCLVQRSVDTFLGMP
                     FNIAGYGILTQFIAKITGHMAGAFVHFGFDVHIYNNHLEQVEELLAREHPESSDPIVV
                     FPHEWEELDDFKWDGVQIFGYEPLPWIKAPVAV"
     misc_feature    complement(109182..110216)
                     /locus_tag="KPHS_p101270"
                     /note="Thymidylate synthase; Region: Thymidylat_synt;
                     pfam00303"
                     /db_xref="CDD:333993"
     misc_feature    complement(order(109365..109370,109479..109484,
                     109488..109490,109668..109670,109680..109682,
                     109686..109688,109728..109733,109752..109757,
                     110139..110141,110145..110147,110178..110180,
                     110190..110192))
                     /locus_tag="KPHS_p101270"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238211"
     misc_feature    complement(order(109353..109355,109359..109361,
                     109449..109454,109473..109475,109479..109487,
                     109692..109697,109953..109955,109986..109988,
                     109995..109997,110061..110063,110175..110177))
                     /locus_tag="KPHS_p101270"
                     /note="active site"
                     /db_xref="CDD:238211"
     gene            complement(110476..111351)
                     /locus_tag="KPHS_p101280"
                     /db_xref="GeneID:11818024"
     CDS             complement(110476..111351)
                     /locus_tag="KPHS_p101280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220935.1"
                     /db_xref="GeneID:11818024"
                     /translation="MKLTKLTDHLKLATDKLVGFKPEPYELNPGFGEATESIYKMVDQ
                     FHELFQHPRRVMPTPELLRLRAKLIHEEAVEEGLPAAKKGDMQGLLDAMADFLYVGVG
                     TMVAIKGGLSTGMSYYTQEQSVDRFIHTIMVPGNTVFDDMAIPFNEAEEAALMLAALA
                     DKLEHNKVGDAELIQDLRRVMNKIYVACMMVYRLAEFLGVDVVELVAEIHRSNMTKLW
                     PADAEARRLAVESCKYDKNDLGFRHADGTDMMIGYRLSDGKILKSPTYSDVDLSRFLE
                     QAQASSLYEVVKNSL"
     misc_feature    complement(<111034..111237)
                     /locus_tag="KPHS_p101280"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain found in Deinococcus radiodurans
                     DR2231 protein and its bacterial homologs; Region:
                     NTP-PPase_DR2231_like; cd11530"
                     /db_xref="CDD:212137"
     misc_feature    complement(order(111067..111069,111076..111078,
                     111124..111126,111136..111138))
                     /locus_tag="KPHS_p101280"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212137"
     gene            complement(111429..112571)
                     /locus_tag="KPHS_p101290"
                     /db_xref="GeneID:11818025"
     CDS             complement(111429..112571)
                     /locus_tag="KPHS_p101290"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     beta"
                     /protein_id="YP_005220936.1"
                     /db_xref="GeneID:11818025"
                     /translation="MSYSTFRLGANDATKEPMFLGQSVNVARYDQQKYRDFEKLIEKQ
                     LSFFWRPEEVDITTDRIDFNTKLQEHERHIFLSNLRYQTLLDSVQGRSPNATLLPLIS
                     IPELETWVETWSFSETIHSRSYTHIIRGMVDDPSIVFDGIVTDEEIISRAISISTEYD
                     KLYEMTCARQHLGEDEFERLYVSEFDGKPYPLQRQLFRTLVSINALEAIRFYVSFACT
                     FAFGERKLLEGNTKIMRFIARDEALHCEGTERMLRFMRTGREGLLWAQIAADEEPFIY
                     QTMMDVAEQEMRWADYLFKDGSMIGLNADILKSYVKYRTNLAMRRLGLKPLYPEIKDD
                     PLVWMNKWLLSDTLQIAPQEAEQSTYLVGQIDSAVDRAGLSQFADL"
     misc_feature    complement(111441..112571)
                     /locus_tag="KPHS_p101290"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cl00264"
                     /db_xref="CDD:350992"
     misc_feature    complement(order(112143..112145,112152..112157,
                     112197..112199,112206..112208,112215..112220,
                     112227..112229,112236..112241,112437..112439,
                     112458..112460))
                     /locus_tag="KPHS_p101290"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    complement(order(111840..111842,111852..111857,
                     112200..112202,112212..112214,112221..112223,
                     112314..112316,112425..112427))
                     /locus_tag="KPHS_p101290"
                     /note="putative radical transfer pathway; other site"
                     /db_xref="CDD:153108"
     misc_feature    complement(order(111840..111842,111849..111851,
                     111951..111953,112212..112214,112221..112223,
                     112314..112316))
                     /locus_tag="KPHS_p101290"
                     /note="diiron center [ion binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    complement(112200..112202)
                     /locus_tag="KPHS_p101290"
                     /note="tyrosyl radical; other site"
                     /db_xref="CDD:153108"
     gene            complement(112702..115005)
                     /locus_tag="KPHS_p101300"
                     /db_xref="GeneID:11818026"
     CDS             complement(112702..115005)
                     /locus_tag="KPHS_p101300"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="YP_005220937.1"
                     /db_xref="GeneID:11818026"
                     /translation="MIRIVKRNGSTEPLSEEKYNRVVMWGVEGIRNVSASAVAMGAAA
                     SIFDGMTTSQLHEALVKSAADLISPETPNYSQVAARLNMFKIRKDAFGEFAYPSFYHH
                     IVSNVSRGVYDEDLLKFYSREEIAELGVYIKPMRDELFGYAATVQLASKYLVQNRVTG
                     EIYEAPQQLYMLVGMCLFQNWEDGCAGKTRLEMVKGFYDVTSTFKLSLPTPIMAGVRT
                     PTRQFSSCVLIESEDSLKGISAASSAIIDYVSRRAGIGIGFGRLRALGSEIRNGEATH
                     TGVIPFLKHFQTAVKSCSQGGVRGGAATAFYPIWHLEVESLLVLKNNRGIEENRVRHL
                     DYGVMINRLMYRRLVRNENITLFSPHDVPGLYDAFFVDQDKFEALYLQYEADESIRKK
                     SVPAVDLFSTLMQERASTGRVYIANVDHMNEHGAFDPKVAPVHQSNLCMEITLPTKPL
                     AFTDDPDGEIALCTLSAFNLGALRSLDTLKEVAFYAVAALDSLLDYQDYPMAAAEIPA
                     KARRSLGVGVTNLAYYLAKNGFNYSDPAGNQLVHETFEAIQYYLLDASCRLAEAKGAC
                     DWFSQTKYAQGQLPIDHYRKSLDANPDTSFELKMPWEELRDRIREYGLRNSTLTAQMP
                     CETSSQITNSTNGIEPPRGPVSVKSSKDGIVKMVVPDFAELKDQYEYLWDMPDNRGYL
                     TKVAIIQKFFDQAISANTNYDPTRFPGDKVPMMKLLEDLLFAYQQGVKTLYYHNTRDG
                     AGKREDDDLASVALVEPEDECDGACKI"
     misc_feature    complement(112705..115005)
                     /locus_tag="KPHS_p101300"
                     /note="ribonucleotide-diphosphate reductase subunit alpha;
                     Validated; Region: PRK09103"
                     /db_xref="CDD:181649"
     gene            complement(115081..115650)
                     /locus_tag="KPHS_p101310"
                     /db_xref="GeneID:11818027"
     CDS             complement(115081..115650)
                     /locus_tag="KPHS_p101310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220938.1"
                     /db_xref="GeneID:11818027"
                     /translation="MSKVIKVVGVDPSMSNFGLAIGTLDLDTDKLEIHGLELVETKAG
                     GTKKTVRVNSDDLRRAKEIWRTARPIIEQAHMVFCELPVGSQSSRAQTSYGVCIGVLA
                     CVDKPLIQVTPNEIKHYVGNKLTTSKEEIIQWAVTKQPDAPWLRRKQAGKDVLVAKNE
                     HLADAIASIYSGMQTDQFRQVRDVLKGIL"
     gene            complement(115660..116370)
                     /locus_tag="KPHS_p101320"
                     /db_xref="GeneID:11818028"
     CDS             complement(115660..116370)
                     /locus_tag="KPHS_p101320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220939.1"
                     /db_xref="GeneID:11818028"
                     /translation="MFAVMQSFRLINSYTAARVAPGVGWQNLNIETEQFTALIDLLFK
                     TPLMPSLKSMPPESNAPILINPFSKGGYLPHSGPGFLVIPESSAMVIEDDVLYGAIEA
                     HTSSAFTNLTRLANARAGQVAMPGKAFAGINFNCDSHGRFPERGELSFETEDGDKAMV
                     EFSVPYVLRSNRMVARKLIDIMSYFIGQSMIDADIENGVLTSDSIHVVSSIPEPVRKS
                     PVKTLEEKLMECPVWATW"
     misc_feature    complement(116396..118313)
                     /note="potential frameshift: common BLAST hit:
                     gi|294502029|ref|YP_003565766.1| putative exonuclease
                     subunit 2"
     gene            complement(116396..116980)
                     /locus_tag="KPHS_p101330"
                     /db_xref="GeneID:11818029"
     CDS             complement(116396..116980)
                     /locus_tag="KPHS_p101330"
                     /codon_start=1
                     /transl_table=11
                     /product="RecF/RecN/SMC domain protein"
                     /protein_id="YP_005220940.1"
                     /db_xref="GeneID:11818029"
                     /translation="MNESLAANKSNYGVLKTELKNIQEQALLLDKARQVYSPAGVRSH
                     ILTSVTPFLNAQTAEYLNTLSDGNIVAEWSTMESTKKGEWRDKFNISVRKIGASKTFQ
                     TLSGGEKRKVRIACSLALQDLVASRASKNIELFIGDEIDDALDTAGLERLMGILEAKA
                     RERGTVMIISHKEMKSWFRETTTVEVKEGRSYVV"
     misc_feature    complement(116402..>116977)
                     /locus_tag="KPHS_p101330"
                     /note="DNA repair exonuclease SbcCD ATPase subunit
                     [Replication, recombination and repair]; Region: SbcC;
                     COG0419"
                     /db_xref="CDD:223496"
     misc_feature    complement(<116618..>116779)
                     /locus_tag="KPHS_p101330"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(116408..>116674)
                     /locus_tag="KPHS_p101330"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(116642..116671)
                     /locus_tag="KPHS_p101330"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(116642..116671)
                     /locus_tag="KPHS_p101330"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(116564..116581)
                     /locus_tag="KPHS_p101330"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(116546..116557)
                     /locus_tag="KPHS_p101330"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(116465..116467,116468..116482))
                     /locus_tag="KPHS_p101330"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(116955..118313)
                     /locus_tag="KPHS_p101340"
                     /db_xref="GeneID:11818030"
     CDS             complement(116955..118313)
                     /locus_tag="KPHS_p101340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative exonuclease"
                     /protein_id="YP_005220941.1"
                     /db_xref="GeneID:11818030"
                     /translation="MKFLTLEVENFMALANAKVELDQRGLVLIQGVNAGDSSAASNGA
                     GKSTLMNSLMWCIYGETSHGVKGDDVLSTGHEKNCRVKVTIEDEGKRYAIIRHRKHKE
                     FKNRLIVRGEDGDMTKGKDSLTQEFVERLIGASKEVFMASIYASQEAMPDLPGMSDKN
                     LKTIVEEAAGVDRLTKAYAIARERANAAAARMETTKTKMDACLSLVESAQNELESAKT
                     SSEAWERDRSERLDVARADLVGAEVTLTEVEMELRSLPEQIRDTENAIGKEREKLASK
                     EEHDAKLVKVRGAITDIRASIRITENIQKEAMQRARAFKVKAEEVNTKVGEPCPTCGK
                     AYCVEDLSTVKESFVEQARSEISQAQASATSVAKYQEHLEKALKIESSLVASTPDVSA
                     IISRIEQLTKELGTLRHREKEVVAVEALVARARSEVDRITKETNPFLAVIKRHERKPG
                     CQ"
     misc_feature    complement(<117870..118298)
                     /locus_tag="KPHS_p101340"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:290211"
     misc_feature    complement(order(118173..118193,118221..118223))
                     /locus_tag="KPHS_p101340"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(117960..117962,117984..117992))
                     /locus_tag="KPHS_p101340"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(117888..117905,117912..117923))
                     /locus_tag="KPHS_p101340"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     gene            complement(118310..118543)
                     /locus_tag="KPHS_p101350"
                     /db_xref="GeneID:11818031"
     CDS             complement(118310..118543)
                     /locus_tag="KPHS_p101350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220942.1"
                     /db_xref="GeneID:11818031"
                     /translation="MTSSHNNFWDFIQMIKRLESGEPVLFQKPYPPEGNPQAFYLGQL
                     TKRGLLSRNSFPAHTEYRLRKGQKLTKAIRGKA"
     gene            complement(118543..119628)
                     /locus_tag="KPHS_p101360"
                     /db_xref="GeneID:11818032"
     CDS             complement(118543..119628)
                     /locus_tag="KPHS_p101360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative exonuclease subunit 1"
                     /protein_id="YP_005220943.1"
                     /db_xref="GeneID:11818032"
                     /translation="MTLPYGVISDPHYHKWDSFSTTDADGLNSRLAIQLEATKEAAIA
                     MKKAGCTHMLVAGDTFHVRGTVSPTVLNYVSDAYEWIVKDLGLSVAMLAGNHDLETND
                     SVYSANAAAALKSIGVQIVCGRKPHSIELGDVTVHMVSWRNNHAELISDLKALRARLD
                     GDLHDVVIHTAINKAIPTMPDVGIDAQELKDIGFRLVLSGHYHNHKEVIPGVISVGAL
                     THQNWGDVGSLAGYMIVNPDGSFSHFETSAPKFVNLEDDVDDRQIHGNYVRFRAVVEN
                     DEEGIKLQNVLKSMGAKGVVCNFIRKGSMMEGTASTSETSKIDSLGESVSAYCKIVHD
                     TDGGFDLTKLNALCQEILTEAESAEAV"
     misc_feature    complement(118546..119607)
                     /locus_tag="KPHS_p101360"
                     /note="DNA repair exonuclease SbcCD nuclease subunit
                     [Replication, recombination and repair]; Region: SbcD;
                     COG0420"
                     /db_xref="CDD:223497"
     gene            119627..119743
                     /locus_tag="KPHS_p101370"
                     /db_xref="GeneID:11818033"
     CDS             119627..119743
                     /locus_tag="KPHS_p101370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220944.1"
                     /db_xref="GeneID:11818033"
                     /translation="MCIFLCGYFDIDSKHVKQAINQVNTANQKIYRWNIMAK"
     gene            complement(120127..120282)
                     /locus_tag="KPHS_p101380"
                     /db_xref="GeneID:11818034"
     CDS             complement(120127..120282)
                     /locus_tag="KPHS_p101380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220945.1"
                     /db_xref="GeneID:11818034"
                     /translation="MEDNLDEIFYRRTRPAAVGEYTCPMLSQQFYNLQLLSLRGLDQK
                     ANANVGF"
     gene            120281..120625
                     /locus_tag="KPHS_p101390"
                     /db_xref="GeneID:11818035"
     CDS             120281..120625
                     /locus_tag="KPHS_p101390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220946.1"
                     /db_xref="GeneID:11818035"
                     /translation="MNVMYYSIAGAIAFVTILTALIVNAKKLKTARADSADKAAQLAR
                     YAAIIDAEDEAARIVAQAKTEAANIISVSETDAKFVRDLANAVLGDARTAAEKLSNVD
                     SANRCQAARRKR"
     gene            120648..121841
                     /locus_tag="KPHS_p101400"
                     /db_xref="GeneID:11818036"
     CDS             120648..121841
                     /locus_tag="KPHS_p101400"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromosome segregation ATPase"
                     /protein_id="YP_005220947.1"
                     /db_xref="GeneID:11818036"
                     /translation="MRASYADKKITYDELESALSIYKEDMDFAEMGFYAPHFDFDTSE
                     LFQASIRNNRQQQKDLLRNKTTFGAIYCTTEWTVSGSKAEGNKMTTRGINLTARAFNS
                     ECDAAIANVTFKNINTMESRIYKAFDVLNKLNEVNQIYINHAFLDLKLTELRLTYEYR
                     AKKQEEKEEQREIRAQMAEERKAQLEIERAIREAEEEERRAQKALDKARKEMNEKLAK
                     MTAAQAEKYQEKIDSLQEALTEAELKGLKALSMAQQTKRGHVYVISNIGSFGENVFKI
                     GMTRRLDPQDRVDELGSASVPFLFDVHAMIFSEDAPALEYALHQHFAENRTNLINRRK
                     EFFNVSLEDIKAAVFDVAGDDVDFIETATAQHYHETVAMRKQKADALTMPVKVEKQPR
                     FAEAL"
     misc_feature    120939..121094
                     /locus_tag="KPHS_p101400"
                     /note="Domain of unknown function (DUF4041); Region:
                     DUF4041; pfam13250"
                     /db_xref="CDD:315832"
     misc_feature    121449..121691
                     /locus_tag="KPHS_p101400"
                     /note="This entry represents the putative helicase A859L;
                     Region: T5orf172; smart00974"
                     /db_xref="CDD:214947"
     gene            complement(122155..122799)
                     /locus_tag="KPHS_p101410"
                     /db_xref="GeneID:11818037"
     CDS             complement(122155..122799)
                     /locus_tag="KPHS_p101410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005220948.1"
                     /db_xref="GeneID:11818037"
                     /translation="MDLKRTRWVRRLEDGTYTIESNSTLSNEKVLCSLCGIASKCNIN
                     ETRLKLRDAGVNFHLNSCARYVPLLAFRKPIIGLDTPYFNTMRSGVTWRDRLTEGKII
                     CLVEADTAKILRFGVVDKVYSGPVDEMLRKHSRFNHLCMGGEKIEKVGEVIRRSYGHF
                     LKEDSLLTAIYIRHIKRDFDIEYHSEEELDLVDPRPKAEVFSIVNARQKLSDEP"
CONTIG      join(CP003223.1:1..122799)
//
DBGET integrated database retrieval system