LOCUS       NC_016841               1308 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS6,
            complete sequence.
ACCESSION   NC_016841
VERSION     NC_016841.1
DBLINK      BioProject: PRJNA84387
            Assembly: GCF_000240185.1
KEYWORDS    RefSeq.
SOURCE      Klebsiella pneumoniae subsp. pneumoniae HS11286
  ORGANISM  Klebsiella pneumoniae subsp. pneumoniae HS11286
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group;
            Klebsiella; Klebsiella pneumoniae complex.
REFERENCE   1  (bases 1 to 1308)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 1308)
  AUTHORS   Ou,H.-Y., Jiang,X., Liu,P. and Li,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2011) State Key Laboratory of Microbial
            Metabolism, Shanghai Jiaotong University, 1954 Huashan Road,
            Shanghai 200030, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003228.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
            Source DNA is available from Hong-Yu Ou at hyou@sjtu.edu.cn.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1308
                     /organism="Klebsiella pneumoniae subsp. pneumoniae
                     HS11286"
                     /mol_type="genomic DNA"
                     /strain="HS11286"
                     /sub_species="pneumoniae"
                     /db_xref="taxon:1125630"
                     /plasmid="pKPHS6"
     gene            326..862
                     /locus_tag="KPHS_p600010"
                     /db_xref="GeneID:11743761"
     CDS             326..862
                     /locus_tag="KPHS_p600010"
                     /codon_start=1
                     /transl_table=11
                     /product="RepA plasmid replication protein"
                     /protein_id="YP_005221105.1"
                     /db_xref="GeneID:11743761"
                     /translation="MQTQNVVTDKEREIRKRDLEDKDRKNASERRQEQKNQNFTQVYP
                     LGWKRLRELFRKNPGAAELYSMLAENIDGSCGAVVADQTHLASLLGVGRQTISRYVKW
                     LEEQGVLVKIPVAGKVCAYALNPHEVWKGYDNAKPYAAFLTKTLVNKDGDIQRRIMAM
                     FHGNDARQGMEGDTPEAE"
     misc_feature    <467..652
                     /locus_tag="KPHS_p600010"
                     /note="cAMP-binding domain of CRP or a regulatory subunit
                     of cAMP-dependent protein kinases [Signal transduction
                     mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:440428"
     misc_feature    572..709
                     /locus_tag="KPHS_p600010"
                     /note="helix_turn_helix, Arsenical Resistance Operon
                     Repressor; Region: HTH_ARSR; smart00418"
                     /db_xref="CDD:197713"
     misc_feature    599..619
                     /locus_tag="KPHS_p600010"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    order(602..607,617..619)
                     /locus_tag="KPHS_p600010"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    602..607
                     /locus_tag="KPHS_p600010"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
CONTIG      join(CP003228.1:1..1308)
//