GenomeNet

Database: RefSeq
Entry: NC_016845
LinkDB: NC_016845
Original site: NC_016845 
LOCUS       NC_016845            5333942 bp    DNA     circular CON 02-JUN-2020
DEFINITION  Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome,
            complete genome.
ACCESSION   NC_016845
VERSION     NC_016845.1
DBLINK      BioProject: PRJNA84387
            Assembly: GCF_000240185.1
KEYWORDS    RefSeq.
SOURCE      Klebsiella pneumoniae subsp. pneumoniae HS11286
  ORGANISM  Klebsiella pneumoniae subsp. pneumoniae HS11286
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Klebsiella.
REFERENCE   1  (bases 1 to 5333942)
  AUTHORS   Liu,P., Li,P., Jiang,X., Bi,D., Xie,Y., Tai,C., Deng,Z.,
            Rajakumar,K. and Ou,H.Y.
  TITLE     Complete genome sequence of Klebsiella pneumoniae subsp. pneumoniae
            HS11286, a multidrug-resistant strain isolated from human sputum
  JOURNAL   J. Bacteriol. 194 (7), 1841-1842 (2012)
   PUBMED   22408243
REFERENCE   2  (bases 1 to 5333942)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5333942)
  AUTHORS   Ou,H.-Y., Jiang,X., Liu,P. and Li,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2011) State Key Laboratory of Microbial
            Metabolism, Shanghai Jiaotong University, 1954 Huashan Road,
            Shanghai 200030, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003200.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
            Source DNA is available from Hong-Yu Ou at hyou@sjtu.edu.cn.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5333942
                     /organism="Klebsiella pneumoniae subsp. pneumoniae
                     HS11286"
                     /mol_type="genomic DNA"
                     /strain="HS11286"
                     /sub_species="pneumoniae"
                     /db_xref="taxon:1125630"
     gene            complement(382..822)
                     /locus_tag="KPHS_00010"
                     /db_xref="GeneID:11849782"
     CDS             complement(382..822)
                     /locus_tag="KPHS_00010"
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="YP_005224301.1"
                     /db_xref="GeneID:11849782"
                     /translation="MADITLISGSTLGSAEYVAEHLAEKLEEAGYSTEIQHGPLVDDL
                     QAQGIWLIISSTHGAGDVPDNLVPFYDALQEKQADLSAVRFGAIGIGSREYDTFCGAI
                     DKLEAALKACGAKQIGETLKINVLEHEIPEDPAEIWLGSWKNLL"
     misc_feature    complement(385..822)
                     /locus_tag="KPHS_00010"
                     /note="FMN-binding protein MioC; Provisional; Region:
                     PRK09004"
                     /db_xref="CDD:181608"
     gene            complement(922..1380)
                     /locus_tag="KPHS_00020"
                     /db_xref="GeneID:11849790"
     CDS             complement(922..1380)
                     /locus_tag="KPHS_00020"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator AsnC"
                     /protein_id="YP_005224302.1"
                     /db_xref="GeneID:11849790"
                     /translation="MENYQIDNLDRGILDALMANARTAYAELAKQFSVSPGTIHVRVE
                     KMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALARLESLEEVTEAYYTT
                     GHYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLIVLQNPIMRTIKP"
     misc_feature    complement(925..1380)
                     /locus_tag="KPHS_00020"
                     /note="DNA-binding transcriptional regulator AsnC;
                     Provisional; Region: PRK11179"
                     /db_xref="CDD:183019"
     gene            1532..2524
                     /locus_tag="KPHS_00030"
                     /db_xref="GeneID:11849897"
     CDS             1532..2524
                     /locus_tag="KPHS_00030"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthetase AsnA"
                     /protein_id="YP_005224303.1"
                     /db_xref="GeneID:11849897"
                     /translation="MKTAYIAKQRQISFVKSHFSRQLEEKLGLIEVQAPILSRVGDGT
                     QDNLSGCEKAVQVKVKTLPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPD
                     EDRLTPIHSVYVDQWDWERVMGDEERHVGTLKATVEAIYAGIKATELAVSQEFGLTPF
                     LPEQIHFVHSQELLSRYPELDAKGRERAIAKELGAVFLIGIGGKLADGKRHDVRAPDY
                     DDWSTEVSEGFAGLNGDILVWNPVLEDAFEISSMGIRVDAEALKRQLALTGDEDRLKL
                     EWHQALLRGEMPQTIGGGIGQSRLTMLLLQLDHIGQVQCGVWPAQVRESVSALL"
     misc_feature    1532..2521
                     /locus_tag="KPHS_00030"
                     /note="Asparagine synthetase A [Amino acid transport and
                     metabolism]; Region: AsnA; COG2502"
                     /db_xref="CDD:225304"
     misc_feature    order(1556..1561,1568..1570,1625..1630,1697..1699,
                     1703..1705,1709..1711,1730..1732,1769..1771,1781..1783,
                     1820..1822,1832..1837,1841..1843,2468..2470,2480..2482,
                     2498..2500)
                     /locus_tag="KPHS_00030"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238350"
     misc_feature    order(1751..1753,1760..1762,1829..1831,1877..1879,
                     1883..1885,1889..1891,2234..2236,2273..2275,2282..2284,
                     2294..2296,2426..2428)
                     /locus_tag="KPHS_00030"
                     /note="active site"
                     /db_xref="CDD:238350"
     gene            complement(2528..3976)
                     /locus_tag="KPHS_00040"
                     /db_xref="GeneID:11849899"
     CDS             complement(2528..3976)
                     /locus_tag="KPHS_00040"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase RavA stimulator ViaA"
                     /protein_id="YP_005224304.1"
                     /db_xref="GeneID:11849899"
                     /translation="MTLDMLNVMLAVSEEGMIEEMLLALLASPQLAVFFEKFPRLKNI
                     IAADIPRWREAVRARLKEVNIPPDLDAEVQTYQQAQLLSTSQFIVQLPQILGKLHQLQ
                     SPFAAQAQKLVDDNATFTPALHTLFLQRWRLSLVVQATSLNQQLLDEERDQLLSEVQE
                     RMTLSGQLDPVLAENDTAAGRLWDMSAGELKRGDYQLIVRYGDFLNQQPELLQLAEQL
                     GRSREAKSVPKKDAPMETFRSLVREPATVPEQVDGLQQSDDILRLLPPELATLGITEL
                     EFEFYRKLVEKQLLTYRLHGDAWREKITERPVTRQDFDEQPRGPFIVCVDTSGSMGGF
                     NEQCAKAFCLALMRIALADNRRCFIMLFSSEVVHYELTSESGLEQAIRFLSQRFRGGT
                     DLASCFRAIIERLQNPQWVDADAVVISDFIAQRLPDEVIAQVGELQRKHQHRFHAVAM
                     SVHGKPGIMRIFDHIWRFDTGLRSRLLRRWRR"
     misc_feature    complement(2564..3976)
                     /locus_tag="KPHS_00040"
                     /note="hypothetical protein; Provisional; Region: yieM;
                     PRK10997"
                     /db_xref="CDD:236815"
     misc_feature    complement(order(2717..2719,2801..2803,2987..2989,
                     2993..2995,2999..3001))
                     /locus_tag="KPHS_00040"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238739"
     gene            complement(3973..5472)
                     /locus_tag="KPHS_00050"
                     /db_xref="GeneID:11849901"
     CDS             complement(3973..5472)
                     /locus_tag="KPHS_00050"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory ATPase RavA"
                     /protein_id="YP_005224305.1"
                     /db_xref="GeneID:11849901"
                     /translation="MAQTHLLAERISRLSAALEKGLFERSHAIRLCLLAALSGESVFL
                     LGPPGIAKSLIARRLKFAFQQARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTA
                     GYLPEAEIVFLDEIWKAGPAILNTLLTAINERHFRNGAHEEKIPMRLLVAASNELPEA
                     DSSLEALYDRMLIRLWLDKVQDKGNFRSMLVSQQDENSNPVPSALQVSDEEFTQWQQQ
                     IGNIKLPDAVFELIFQLRQQLDALPNAPYVSDRRWKKAIRLLQASAFFSGRDSIAPID
                     LILLKDCLWHNVESMNLMSQQLETLMTCHAWQQQAMLTRLGAIVQRRIQIQQQQSDKT
                     ALKVTRLGGMFSRKPHYELPAEIQGTTLTLLLQQPLKLHDMEVIHITFEREALANWLE
                     KGGEIRGKLNGIGFAQLLNMDVDTSQHLVVRDVSLQGSRLALPGSAAQENMPAEIRQQ
                     LEALDDEWHQQHNRFSEQQKCLFIPVEWLGRIEASLQDVGAQIKQAKQP"
     misc_feature    complement(3979..5472)
                     /locus_tag="KPHS_00050"
                     /note="regulatory ATPase RavA; Provisional; Region:
                     PRK13531"
                     /db_xref="CDD:184118"
     gene            5690..7558
                     /locus_tag="KPHS_00060"
                     /db_xref="GeneID:11849903"
     CDS             5690..7558
                     /locus_tag="KPHS_00060"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transport protein Kup"
                     /protein_id="YP_005224306.1"
                     /db_xref="GeneID:11849903"
                     /translation="MSTDNKQSLPALTLAAIGVVYGDIGTSPLYTLRECLSGQFGFGV
                     ERDAVFGFLSLIFWLLIFTVSIKYITFVMRADNAGEGGILTLMSLAGRNTSARMTSVL
                     VILGLIGGSFFYGEVVITPAISVMSAIEGLEIIAPQLDTWIVPISIIVLTLLFVIQKH
                     GTGMVGKLFAPIMLIWFLLLAVLGARSIYANPEVLQALNPYWAVHFFLQYKTVSFIAL
                     GAVVLSITGVEALYADMGHFGKLPIRVAWFSVVLPSLVLNYFGQGALLLKHPEAIKNP
                     FFLLAPEWALIPMLIIATLATVIASQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMES
                     GQIYIPFINWLLYVSVVIVIVSFEHSSNLAAAYGIAVTGTMVLTSILSATVARKNWHW
                     NKLFVGLMLVAFLCIDIPLFSANLDKIVSGGWLPLSLGMVMFTVMTTWKSERFRLLRR
                     MHEHGNSLEAMISSLEKSPPVRVPGTAVYMSRALNVIPFALLHNLKHNKVLHERVILL
                     TLRTEDAPYVHNVRRVQIEQLSPSFWRVVASYGWRETPNVEEVFHRCGLEGLSCRMME
                     TSFFMSHESLIIGKRPWYLRLRGKLYLLLQRNALRAPDQFEIPPNRVIELGTQVEI"
     misc_feature    5690..7555
                     /locus_tag="KPHS_00060"
                     /note="potassium transport protein Kup; Provisional;
                     Region: trkD; PRK10745"
                     /db_xref="CDD:182693"
     gene            7744..8163
                     /locus_tag="KPHS_00070"
                     /db_xref="GeneID:11849905"
     CDS             7744..8163
                     /locus_tag="KPHS_00070"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose pyranase"
                     /protein_id="YP_005224307.1"
                     /db_xref="GeneID:11849905"
                     /translation="MKKGTVLNADISAVISRLGHTDTLVVCDAGLPVPRSSTRIDMAL
                     TQGVPSFMQVLEVVTTEMQVEAAVIAEEIKTHNPQLHATLLTHLEQLQQHQGNTIEIR
                     YTSHEQFKKQTADSQAVIRSGECSPFANIILCAGVTF"
     misc_feature    7744..8160
                     /locus_tag="KPHS_00070"
                     /note="D-ribose pyranase; Provisional; Region: PRK11797"
                     /db_xref="CDD:183318"
     gene            8174..9679
                     /locus_tag="KPHS_00080"
                     /db_xref="GeneID:11850139"
     CDS             8174..9679
                     /locus_tag="KPHS_00080"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose transporter ATP-binding protein"
                     /protein_id="YP_005224308.1"
                     /db_xref="GeneID:11850139"
                     /translation="MEALLQLKGIDKAFPGVKALSGAALNVYAGRVMALVGENGAGKS
                     TMMKVLTGIYTRDAGSLLWLGKETTFNGPKSSQEAGIGIIHQELNLIPQLTIAENIFL
                     GREFVNRFGKIDWKQMYAEADKLLAKLNLRFTSQKLVGDLSIGDQQMVEIAKVLSFES
                     KVIIMDEPTDALTDTETESLFRVIRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQ
                     FIAEREVSSLDEDRLIEMMVGRKLEDQYPHLDKAPGAVRLKVDNLCGPGVDNVTFTLR
                     QGEILGVAGLMGAGRTELMKVLYGALPRSSGSVTLDGREVVTRSPQDGLANGIVYISE
                     DRKRDGLVLGMSVKENMSLTALRYFSRAGGSLKHKDEQQAVSDFIRLFNVKTPSMEQA
                     IGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIIL
                     VSSEMPEVLGMSDRIIVMHEGHLGGEFTREQATQEVLMAAAVGKLNRVNQE"
     misc_feature    8174..9676
                     /locus_tag="KPHS_00080"
                     /note="D-ribose transporter ATP binding protein;
                     Provisional; Region: PRK10762"
                     /db_xref="CDD:236755"
     gene            9685..10650
                     /locus_tag="KPHS_00090"
                     /db_xref="GeneID:11849670"
     CDS             9685..10650
                     /locus_tag="KPHS_00090"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="YP_005224309.1"
                     /db_xref="GeneID:11849670"
                     /translation="MTTQAVSGRRYFTKAWLMEQKSLIALLVLIAVVSTMSPNFFTVN
                     NLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGIEVNALVAVA
                     AALALGAAIGAVTGVIVARGRVQAFIATLVMMLLLRGVTMVYTNGSPINTGFSDNADL
                     FGWFGIGRPLGIPTPVWIMAIVFLAAWYMLHHTRLGRYIYALGGNEAATRLSGISVNK
                     VKIIVYALCGMLASLAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIV
                     GTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKKQ"
     misc_feature    9688..10647
                     /locus_tag="KPHS_00090"
                     /note="ribose ABC transporter permease protein; Reviewed;
                     Region: rbsC; PRK09512"
                     /db_xref="CDD:181922"
     misc_feature    10303..10359
                     /locus_tag="KPHS_00090"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            10678..11568
                     /locus_tag="KPHS_00100"
                     /db_xref="GeneID:11844985"
     CDS             10678..11568
                     /locus_tag="KPHS_00100"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose transporter subunit RbsB"
                     /protein_id="YP_005224310.1"
                     /db_xref="GeneID:11844985"
                     /translation="MNMKKLATLVSAVALSATVSANAMAKDTIALVISTLNNPFFVSL
                     KDGAQKEADKLGYNLVVLDSQNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKM
                     ANQAKIPVITLDRQATKGDVVSHIASDNVQGGKMAGDYIAKKVGESAKVIELQGIAGT
                     SAARERGEGFKQAVAAHKFNVLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEM
                     ALGALRALQTAGKSDVMVVGFDGTPDGEKAVNSGKLAATVAQLPEQIGAKGVETADKV
                     LKGEKVEANYPVELKLVVKQ"
     misc_feature    10678..11562
                     /locus_tag="KPHS_00100"
                     /note="D-ribose transporter subunit RbsB; Provisional;
                     Region: PRK10653"
                     /db_xref="CDD:182620"
     gene            11669..12601
                     /locus_tag="KPHS_00110"
                     /db_xref="GeneID:11844986"
     CDS             11669..12601
                     /locus_tag="KPHS_00110"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="YP_005224311.1"
                     /db_xref="GeneID:11844986"
                     /translation="MMKAAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGK
                     GANQAVAAGRSGADIAFIACTGDDDIGERIRRQLASDKIDVAPVRAVAGEATGVALIF
                     VNAEGENVIGIHAGANAALSVSQVEAEKERIASAQALLMQLESPLESVIAAAKIAHHH
                     HTTVVLNPAPARELPDELLALVDIITPNETEAEKLTGIRVESDEDAAKAANVLHAKGI
                     GTVMITLGSRGVWLSAEGESRRILGFRVQAIDTIAAGDTFNGALVTALLEGTALPEAI
                     RFAHAAAAIAVTRKGAQPSVPWRTEIDEFLAQQG"
     misc_feature    11681..12595
                     /locus_tag="KPHS_00110"
                     /note="ribokinase; Provisional; Region: PRK11142"
                     /db_xref="CDD:236858"
     misc_feature    order(11711..11713,11717..11719,11792..11800,11807..11809,
                     11963..11965,11969..11971,11999..12001,12005..12007,
                     12098..12100,12422..12427,12434..12436,12542..12544)
                     /locus_tag="KPHS_00110"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238579"
     misc_feature    order(11720..11722,11726..11728,11741..11761,11798..11800,
                     11960..11962,11966..11974,11990..12013,12176..12178)
                     /locus_tag="KPHS_00110"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238579"
     misc_feature    order(12230..12232,12338..12346,12353..12355,12392..12394,
                     12410..12412,12419..12421,12428..12433,12440..12442,
                     12506..12508,12515..12520,12527..12529)
                     /locus_tag="KPHS_00110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238579"
     gene            12614..13597
                     /locus_tag="KPHS_00120"
                     /db_xref="GeneID:11844987"
     CDS             12614..13597
                     /locus_tag="KPHS_00120"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose operon repressor"
                     /protein_id="YP_005224312.1"
                     /db_xref="GeneID:11844987"
                     /translation="MKDVARIAGVSTSTVSHVINKDRFVSEAITAKVDAAIKSLNYAP
                     SALARSLKLNQTRTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMN
                     RNLETLMQKRVDGLLLLCTETHQPSPEIMQRYPSVPTVMMDWAPFDGDSDLIQDNSLL
                     GGDMATQYLIDQGHSRIACIAGPLDKTPARLRLEGYHAAMARCGLPVAEGYVVTSDFE
                     FGGGFSAMQQLLALPQRPQAVFVGNDAMAVGAYQALYQAGLLIPQDMALVGYDDIELA
                     RYMTPPLTTIHQPKDELGELAIDVLIHRMADPQQKQQRVQLTPELVVRGSA"
     misc_feature    12614..13594
                     /locus_tag="KPHS_00120"
                     /note="transcriptional repressor RbsR; Provisional;
                     Region: PRK10423"
                     /db_xref="CDD:182448"
     gene            complement(13594..14991)
                     /locus_tag="KPHS_00130"
                     /db_xref="GeneID:11844988"
     CDS             complement(13594..14991)
                     /locus_tag="KPHS_00130"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS family transporter"
                     /protein_id="YP_005224313.1"
                     /db_xref="GeneID:11844988"
                     /translation="MSGKKGRSMAGLPWIAAMAFFMQALDATILNTALPAIAHSLNRS
                     PLAMQSAIISYTLTVAMLIPVSGWLADRFGTRRVFIIAVSLFTLGSLACALSSSLTEL
                     VIFRVIQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLVGPILGPVLGGVFVT
                     WASWHWIFLINIPIGVIGILYARKYMPNFTTPRRRFDIGGFLLFGLSLVLFSSGIELF
                     GEKIVATWQALAVIAVSLLLLVAYVRHARRHPTPLISLSLFKTHTFSVGIAGNLATRL
                     GTGCVPFLMPLMLQVGFGYPAIIAGCMIAPTAIGSIIAKSTVTQVLRWFGYRKTLVGI
                     TVFIGLMIAQFSLQSPEMPLWMLLLPLFVLGMAMSTQFTAMNTITLADLTDDNASSGN
                     SLLAVTQQLSISLGVAISAAVLRFYEGFDNASTVQQFHYTFITMGVITIISALMFMLL
                     RAKDGRNLISERHKR"
     misc_feature    complement(13597..14952)
                     /locus_tag="KPHS_00130"
                     /note="putative transporter; Provisional; Region:
                     PRK10504"
                     /db_xref="CDD:182502"
     gene            complement(15004..15705)
                     /locus_tag="KPHS_00140"
                     /db_xref="GeneID:11844989"
     CDS             complement(15004..15705)
                     /locus_tag="KPHS_00140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005224314.1"
                     /db_xref="GeneID:11844989"
                     /translation="MSLSAQQLAAQKNISWVLAEKLAQKILTGEYQPESILPGEMELG
                     EQFGVSRTAVREAVKTLTAKGMLLPRPRIGTRVMPRSSWNFLDKELLSWWLTEDNFEE
                     VVSHFLVMRSSLEPQACFLAAANGTAGQKAQLNTLMEEMIALKRHFQRERWIEVDMAW
                     HEHIYEMSGNPFLSSFASLFHSVYHTYFTSITQNEVVKLDLHQAIVDAILNSDAPGAL
                     LACQALLNAPHHVNQ"
     misc_feature    complement(15025..15654)
                     /locus_tag="KPHS_00140"
                     /note="DNA-binding transcriptional regulator, FadR family
                     [Transcription]; Region: FadR; COG2186"
                     /db_xref="CDD:225097"
     gene            16189..17714
                     /locus_tag="KPHS_r00230"
                     /db_xref="GeneID:11844990"
     rRNA            16189..17714
                     /locus_tag="KPHS_r00230"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11844990"
     gene            18065..20963
                     /locus_tag="KPHS_r00150"
                     /db_xref="GeneID:11844991"
     rRNA            18065..20963
                     /locus_tag="KPHS_r00150"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11844991"
     gene            21065..21179
                     /locus_tag="KPHS_r00060"
                     /db_xref="GeneID:11844992"
     rRNA            21065..21179
                     /locus_tag="KPHS_r00060"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11844992"
     gene            complement(21377..21883)
                     /locus_tag="KPHS_00150"
                     /db_xref="GeneID:11844993"
     CDS             complement(21377..21883)
                     /locus_tag="KPHS_00150"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="YP_005224315.1"
                     /db_xref="GeneID:11844993"
                     /translation="MIPLLAIAAWSGTGKTTLLKRLIPELCALGLRPGLIKHTHHDMD
                     VDKPGKDSYELRKAGAAQTIVASEQRWALMTETPEKPELDLTWLVSRMDASKLDLVLV
                     EGFKHEPVPKILLFRQNSGHRVEELVIDEHTIAVASDVSIATSLPLLDLNDVPQIATF
                     IVSWLERQ"
     misc_feature    complement(21380..21883)
                     /locus_tag="KPHS_00150"
                     /note="molybdopterin-guanine dinucleotide biosynthesis
                     protein B; Provisional; Region: PRK10751"
                     /db_xref="CDD:236750"
     misc_feature    complement(order(21464..21469,21566..21568,21575..21577,
                     21767..21769,21773..21775,21833..21853))
                     /locus_tag="KPHS_00150"
                     /note="putative active site [active]"
                     /db_xref="CDD:349770"
     misc_feature    complement(order(21608..21613,21620..21625,21659..21682,
                     21689..21712,21719..21724,21767..21787,21803..21805,
                     21812..21817,21824..21826))
                     /locus_tag="KPHS_00150"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:349770"
     gene            complement(21880..22461)
                     /locus_tag="KPHS_00160"
                     /db_xref="GeneID:11844994"
     CDS             complement(21880..22461)
                     /locus_tag="KPHS_00160"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA"
                     /protein_id="YP_005224316.1"
                     /db_xref="GeneID:11844994"
                     /translation="MQSEAITGVVLAGGRATRMGGIDKGLQALNGRPLWRHVAEALAP
                     QVDELVISANRHLEQWRASGFPVFRDIQEGYQGPLAGMLAVMQQVASPWFVFCPCDTP
                     FIPSFLVERFIQQRGDAPVVWAHDGERDHPAVALVHRQIIPELEAYLAHGERRVMVFM
                     RQMGGRPVNFSDVKTAFINVNTLEDLQQMQEPS"
     misc_feature    complement(21889..22455)
                     /locus_tag="KPHS_00160"
                     /note="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA; Reviewed; Region: mobA; PRK00317"
                     /db_xref="CDD:234725"
     misc_feature    complement(order(22162..22164,22168..22170,22219..22221,
                     22228..22233,22252..22254,22306..22308,22390..22392,
                     22417..22419,22423..22431))
                     /locus_tag="KPHS_00160"
                     /note="GTP binding site; other site"
                     /db_xref="CDD:133000"
     gene            22533..22802
                     /locus_tag="KPHS_00170"
                     /db_xref="GeneID:11844995"
     CDS             22533..22802
                     /locus_tag="KPHS_00170"
                     /codon_start=1
                     /transl_table=11
                     /product="YihD family protein"
                     /protein_id="YP_005224317.1"
                     /db_xref="GeneID:11844995"
                     /translation="MKCKRLNEVIELLQPAWQKEPELNLMQFLQKLAKEAGYDGELSD
                     LSDDILIYHLKMRDSSKDAVIPGIQKDYEEDFKTALLRARGVIKE"
     misc_feature    22533..22790
                     /locus_tag="KPHS_00170"
                     /note="Protein of unknown function (DUF1040); Region:
                     DUF1040; pfam06288"
                     /db_xref="CDD:336365"
     gene            22878..23864
                     /locus_tag="KPHS_00180"
                     /db_xref="GeneID:11844996"
     CDS             22878..23864
                     /locus_tag="KPHS_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase RdoA"
                     /protein_id="YP_005224318.1"
                     /db_xref="GeneID:11844996"
                     /translation="MHDKAFTFQTLRPDTIIDGLFDLGMRVDSGLTPLNSYENRVYQF
                     QDEERHRYVVKFYRPERWSAEQILEEHQFALQLVEDEVPVAAPLLFNDSTLHQHQGFY
                     FAVFPSLGGRQFEADNLDQMEWVGRYLGRLHQTGCKQRFTARPEIGVQEYLLEPRQVF
                     EQATLIPSGLKADFLKATDKLIAAVMEQWHGRGNTLRLHGDCHAGNILWRDGPLFVDL
                     DDARTGPAIQDLWMLLNGDKAEQRMQLETIVEAYEEFSPFNSDEIALIEPLRAMRLVY
                     YLAWLLRRWDDPAFPVNFPWLTGEDYWRGQTSTFLEQVKVLQEPPLQLTPMY"
     misc_feature    22878..23849
                     /locus_tag="KPHS_00180"
                     /note="serine/threonine protein kinase; Provisional;
                     Region: PRK11768"
                     /db_xref="CDD:236974"
     gene            23892..24515
                     /locus_tag="KPHS_00190"
                     /db_xref="GeneID:11844997"
     CDS             23892..24515
                     /locus_tag="KPHS_00190"
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide isomerase I"
                     /protein_id="YP_005224319.1"
                     /db_xref="GeneID:11844997"
                     /translation="MKKVWLALAGMILAFSASAAQITDGKQYITLDKPIAGEPQVLEF
                     FSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGV
                     EDKITAPMFEAVQKNQTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAA
                     ADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK"
     misc_feature    23892..24512
                     /locus_tag="KPHS_00190"
                     /note="periplasmic protein disulfide isomerase I;
                     Provisional; Region: PRK10954"
                     /db_xref="CDD:182863"
     misc_feature    order(24036..24038,24042..24047,24396..24398)
                     /locus_tag="KPHS_00190"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    24135..24143
                     /locus_tag="KPHS_00190"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    order(24156..24182,24195..24254,24261..24287,24303..24332)
                     /locus_tag="KPHS_00190"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     gene            complement(24563..25462)
                     /locus_tag="KPHS_00200"
                     /db_xref="GeneID:11844998"
     CDS             complement(24563..25462)
                     /locus_tag="KPHS_00200"
                     /codon_start=1
                     /transl_table=11
                     /product="putative endonuclease"
                     /protein_id="YP_005224320.1"
                     /db_xref="GeneID:11844998"
                     /translation="MSRLLAAITLPLSIALTILVTIICSVPIIVAGLIKLLVPIPAVW
                     RSISVFCNFMMYCWCEGLALLLHLNPWLKWDVQGLEGLNKKNWYLLISNHHSWADIVV
                     LCVLFRKHIPMNKYFLKQQLAWVPFIGLACWALDMPFMRRYSRSYLIRHPERRGKDVE
                     TTRRSCEKFRAHPTTIVNFVEGSRFTEEKKRETRSPYHNLLPPKAAGIAMALNVLGSQ
                     FDKLLNVTLCYPDNHTRPFYDMLSGRLTRIVVRINLVPIGEELHGDYVNDKNFKRGFQ
                     RWLNGLWEEKDRQLTDIMRDKER"
     misc_feature    complement(24566..25462)
                     /locus_tag="KPHS_00200"
                     /note="putative acyltransferase; Provisional; Region:
                     PRK14014"
                     /db_xref="CDD:237584"
     gene            25973..28651
                     /locus_tag="KPHS_00210"
                     /db_xref="GeneID:11844999"
     CDS             25973..28651
                     /locus_tag="KPHS_00210"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_005224321.1"
                     /db_xref="GeneID:11844999"
                     /translation="MYGVLNMLRSLILQYQPTHAVVVFDAKGKTFRDELFEHYKSHRP
                     PMPDDLRAQIEPLHKMVKAMGLPLMAVPGVEADDVIGTLAREAERAGRPVLISTGDKD
                     MAQLVTPGITLINTMTNTILGPDEVVTKYGVPPELIIDFLALMGDSSDNIPGVPGVGE
                     KTAQALLQGLGGLDTLYAEPEKIAELSFRGAKTMAAKLEQNKDVAYLSYQLATIKTDV
                     ELELTCEELEVQPPAADDLLALFRQYEFKRWTTDVEAGKWLQAKGGKPAAKPAAPAAA
                     AEAEEEVEAATALSAEHYVTILDEATLLTWIDKLKQAPLFAFDTETDSLDNISANMVG
                     LSFAVEPGVAAYVPVAHDYLDAPDQIPRERVLALLKPLLEDEKVLKVGQNLKYDRGIL
                     ANYDIELRGIAFDTMLESYILDSVAGRHDMDSLSDRWLKHKTITFEEIAGKGKNQLTF
                     NQIALEEAGRYAAEDADVTLQLHLKMWPKLQQHEGPLNIFQHIEMPLVPVLSRVERNG
                     VKIDPAVLHAHSQEIAQRLVELEQRAHEIAGEAFNLSSTKQLQTILFEKQGIKPLKKT
                     PGGAPSTSEEVLEELALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYH
                     QAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLS
                     RDKGLLTAFAEGKDIHRATAAEVFGLPLDSVSSEQRRSAKAINFGLIYGMSAFGLARQ
                     LNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGA
                     RRAGAERAAINAPMQGTAADIIKRAMIAVDEWLRSEKPRVRMIMQVHDELVFEVHKDE
                     LDAVSKKIHELMENSTTLAVPLLVEVGSGENWDQAH"
     misc_feature    25973..28648
                     /locus_tag="KPHS_00210"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     gene            complement(28999..29631)
                     /locus_tag="KPHS_00220"
                     /db_xref="GeneID:11845000"
     CDS             complement(28999..29631)
                     /locus_tag="KPHS_00220"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="YP_005224322.1"
                     /db_xref="GeneID:11845000"
                     /translation="MTNWNYQLTHFVTSAPDIRHLPADTGIEVAFAGRSNAGKSSALN
                     TLTNQKNLARTSKTPGRTQLINLFEVAEGKRLVDLPGYGYAQVPEEMKIKWQRALGEY
                     LEKRLCLKGLVVLMDIRHPLKDLDQQMIEWAVESDIQVLVLLTKADKLASGARKAQVN
                     MVREAVLAFNGDVQVEPFSSLKKSGVDKLRQKLDSWFNEIPPQEAVEDAE"
     misc_feature    complement(29035..29619)
                     /locus_tag="KPHS_00220"
                     /note="GTP-binding protein YsxC; Reviewed; Region: engB;
                     PRK00454"
                     /db_xref="CDD:234770"
     misc_feature    complement(29512..29535)
                     /locus_tag="KPHS_00220"
                     /note="G1 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(29092..29097,29188..29190,29194..29196,
                     29398..29400,29446..29454,29461..29469,29509..29529))
                     /locus_tag="KPHS_00220"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206665"
     misc_feature    complement(29437..29457)
                     /locus_tag="KPHS_00220"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(29446..29448)
                     /locus_tag="KPHS_00220"
                     /note="G2 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(29389..29400)
                     /locus_tag="KPHS_00220"
                     /note="G3 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(29305..29310,29317..29361,29380..29391))
                     /locus_tag="KPHS_00220"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(29188..29199)
                     /locus_tag="KPHS_00220"
                     /note="G4 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(29089..29097)
                     /locus_tag="KPHS_00220"
                     /note="G5 box; other site"
                     /db_xref="CDD:206665"
     gene            30215..30721
                     /locus_tag="KPHS_00230"
                     /db_xref="GeneID:11845001"
     CDS             30215..30721
                     /locus_tag="KPHS_00230"
                     /codon_start=1
                     /transl_table=11
                     /product="Der GTPase-activating protein YihI"
                     /protein_id="YP_005224323.1"
                     /db_xref="GeneID:11845001"
                     /translation="MKKPTSATRGKSGRKSREELNQEARDRKRQKKHRGHAAGSRANG
                     GDAASAGKKQRQAQDPRVGSKKPIPLGVSESSAPAPKQHKPKSEKPMLSPQAELELLE
                     NDERLDALLERLEEGGTLNAEEQSWVDAKLDRIDELMQQLGLSYDDEDEEEEERQEDM
                     MRLLKGGN"
     misc_feature    30215..30718
                     /locus_tag="KPHS_00230"
                     /note="Der GTPase activator; Provisional; Region:
                     PRK05244"
                     /db_xref="CDD:235370"
     gene            30910..32283
                     /locus_tag="KPHS_00240"
                     /db_xref="GeneID:11845002"
     CDS             30910..32283
                     /locus_tag="KPHS_00240"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_005224324.1"
                     /db_xref="GeneID:11845002"
                     /translation="MSEQIIDWDLALIQKYNYSGPRYTSYPTALEFSPQFGAAEFDAA
                     VARYPQRPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDVLEQEIIHRAPLFAT
                     RQVKQLHWGGGTPTYLNKAQISRLMDLLRSHFHFSAEAEISIEVDPREIELDVLDHLR
                     AEGFNRLSMGVQDFNKEVQRLVNREQDEAFIFDLLNHAREIGFTSTNIDLIYGLPKQT
                     PESFAFTLQKVAELNPDRLSVFNYAHLPTLFAAQRKIKDADLPSAEQKLEILQETIGS
                     LTTAGYQFIGMDHFARPDDELAVAQRHGVLHRNFQGYTTQGDTDLLGMGVSAISMIGD
                     SYAQNQKELKQYYQQVAEQGNALWRGIALTRDDCLRRDVIKALICNFQLDIAAVEAQW
                     DVDFASYFAEDLKLLAPLAHDGLVAVDDKVIQVTAKGRLLIRNICMCFDAYLRQKARM
                     QQFSRVI"
     misc_feature    30919..32280
                     /locus_tag="KPHS_00240"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09249"
                     /db_xref="CDD:236430"
     gene            complement(32540..33949)
                     /locus_tag="KPHS_00250"
                     /db_xref="GeneID:11845003"
     CDS             complement(32540..33949)
                     /locus_tag="KPHS_00250"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="YP_005224325.1"
                     /db_xref="GeneID:11845003"
                     /translation="MQRGIAWIVDDDSSIRWVLERALTGAGLSCTTFESGNEVLDALT
                     TKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYL
                     PKPFDIDEAVALVDRAISHYQEQQQPRNAPISSPTADIIGEAPAMQDVFRIIGRLSRS
                     SISVLINGESGTGKELVAHALHRHSPRSKAPFIALNMAAIPKDLIESELFGHEKGAFT
                     GANTVRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRI
                     IAATHQNLEQRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARHFLQIAARELG
                     VEAKQLHPETETALTRLAWPGNVRQLENTCRWLTVMAAGQEVLTQDLPSELFETTIPD
                     SPTQMQPDSWATLLGQWADRALRSGHQNLLSEAQPEMERTLLTTALRHTQGHKQEAAR
                     LLGWGRNTLTRKLKELGME"
     misc_feature    complement(32543..33949)
                     /locus_tag="KPHS_00250"
                     /note="nitrogen regulation protein NR(I); Provisional;
                     Region: glnG; PRK10923"
                     /db_xref="CDD:182842"
     gene            complement(33958..35007)
                     /locus_tag="KPHS_00260"
                     /db_xref="GeneID:11845004"
     CDS             complement(33958..35007)
                     /locus_tag="KPHS_00260"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="YP_005224326.1"
                     /db_xref="GeneID:11845004"
                     /translation="MATGTLPDAGQILNSLINSILLVDDDLAVHFANPAAQQLLAQSS
                     RKLFGTPLPELLSYFSLNIGLMQESLQAGQGFTDNEVTLVIDGRSHILSLTAQRLPEG
                     FILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALP
                     DPALTEYTKVIIEQADRLRNLVDRLLGPQHPGMHVTESIHKVAERVVKLVSMELPDNV
                     KLIRDYDPSLPELPHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGVR
                     YRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARSLIDQHSGKIEFTS
                     WPGHTEFSVYLPIRK"
     misc_feature    complement(33964..35007)
                     /locus_tag="KPHS_00260"
                     /note="nitrogen regulation protein NR(II); Provisional;
                     Region: glnL; PRK11073"
                     /db_xref="CDD:182947"
     gene            complement(35196..36605)
                     /locus_tag="KPHS_00270"
                     /db_xref="GeneID:11845005"
     CDS             complement(35196..36605)
                     /locus_tag="KPHS_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_005224327.1"
                     /db_xref="GeneID:11845005"
                     /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPSHQVNAEFF
                     EEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFYEEPTLIIRCDILEPGTLQGYD
                     RDPRSIAKRAEEYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWN
                     SSTKYEGGNKGHRPGVKGGYFPVPPVDSSQDIRSTMCMIMEEMGLVVEAHHHEVATAG
                     QNEVATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLA
                     KNGTNLFSGDKYAGLSEQALFYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVTSPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEA
                     MDKNLYDLPPEEAKEIPQVAGSLEEALQALDADREFLTAGGVFTNDAIDAYIALRMEE
                     NDRVRMTPHPVEFELYYSV"
     misc_feature    complement(35199..36605)
                     /locus_tag="KPHS_00270"
                     /note="glutamine synthetase; Provisional; Region: glnA;
                     PRK09469"
                     /db_xref="CDD:181884"
     gene            complement(36662..36823)
                     /locus_tag="KPHS_00280"
                     /db_xref="GeneID:11845006"
     CDS             complement(36662..36823)
                     /locus_tag="KPHS_00280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224328.1"
                     /db_xref="GeneID:11845006"
                     /translation="MVLNVHTEALFWCIISIMVQSFCTMVRMIQRFMGHLKVGTDFAL
                     YFLRQQRHF"
     gene            36984..38807
                     /locus_tag="KPHS_00290"
                     /db_xref="GeneID:11845007"
     CDS             36984..38807
                     /locus_tag="KPHS_00290"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="YP_005224329.1"
                     /db_xref="GeneID:11845007"
                     /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFDARTEAQERVMD
                     SNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAF
                     DGPMPQTRFVTKKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDF
                     PIVYASALNGIAGLDHEDMADDMTPLYQAIVDRVPAPDVDLDGPLQMQISQLDYNNYV
                     GVIGIGRIKRGKVKPNQQVTIIDSEGKTRNGKVGKVLTHLGLERIESDVAEAGDIIAI
                     TGLGELNISDTICDPQNVEALPALSVDEPTVSMFFNVNTSPFCGKEGKFVTSRQILDR
                     LNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFEMAVSRPKVIFREI
                     DGRKQEPFENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIG
                     FRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRNNGVLISNGQGKAVAFALFGLQDRG
                     KLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEATVLVPPVKMTLE
                     QALEFIDDDELVEVTPTSIRIRKRHLTENDRKRAMRGAKEE"
     misc_feature    36984..38795
                     /locus_tag="KPHS_00290"
                     /note="Predicted membrane GTPase involved in stress
                     response [Signal transduction mechanisms]; Region: TypA;
                     COG1217"
                     /db_xref="CDD:224138"
     gene            38943..39542
                     /locus_tag="KPHS_00300"
                     /db_xref="GeneID:11845008"
     CDS             38943..39542
                     /locus_tag="KPHS_00300"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="YP_005224330.1"
                     /db_xref="GeneID:11845008"
                     /translation="MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLATLKQHFTMGEAF
                     HQHERGELSDEDFAAAMCHEMNMPLSYEQFAHGWQAVFVALRPEVITIMHKLRAQGHR
                     VVVLSNTNRLHTTFWPDEYPEVRAAADRIYLSQEMGLRKPEAQIYLRVLEEEGFSAAD
                     TVFFDDNVDNIAGANRLGITSILVTGKETIPDYFAKQLC"
     misc_feature    38943..39539
                     /locus_tag="KPHS_00300"
                     /note="?-D-glucose-1-phosphatase; Provisional; Region:
                     PRK09456"
                     /db_xref="CDD:181872"
     misc_feature    order(38958..38972,39261..39266,39363..39365,39435..39440,
                     39447..39452)
                     /locus_tag="KPHS_00300"
                     /note="active site"
                     /db_xref="CDD:319790"
     misc_feature    38958..38972
                     /locus_tag="KPHS_00300"
                     /note="HAD signature motif I; other site"
                     /db_xref="CDD:319790"
     misc_feature    39261..39263
                     /locus_tag="KPHS_00300"
                     /note="HAD signature motif II; other site"
                     /db_xref="CDD:319790"
     misc_feature    39348..39350
                     /locus_tag="KPHS_00300"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319790"
     misc_feature    39363..39365
                     /locus_tag="KPHS_00300"
                     /note="HAD signature motif III; other site"
                     /db_xref="CDD:319790"
     misc_feature    order(39435..39440,39450..39452)
                     /locus_tag="KPHS_00300"
                     /note="HAD signature motif IV; other site"
                     /db_xref="CDD:319790"
     gene            39536..40396
                     /locus_tag="KPHS_00310"
                     /db_xref="GeneID:11845009"
     CDS             39536..40396
                     /locus_tag="KPHS_00310"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease BN"
                     /protein_id="YP_005224331.1"
                     /db_xref="GeneID:11845009"
                     /translation="MLKTVHQKLLHHTRPLLAWLKLLWRRIDEDHMTTLAGNLAYVSL
                     LSLVPLIAVVFALFAAFPMFSEVSVQIRHFIFANFIPATGDVIQGYIEQFVANSSRMT
                     AVGAFGLIVTSLLLMYSIDSALNTIWRSTRSRPKVYSFAVYWMILTLGPLLAGASLAI
                     SSYLLSLRWASDLDGVIDNLLRLFPLILSWAAFWLLYSIVPTTQVRNRDAVIGALVAA
                     LLFEAGKKAFALYITTFPSYQLIYGVISVVPILFVWVYWTWCIVLLGAEITVTLGEYR
                     KLETEETEQP"
     misc_feature    39560..40393
                     /locus_tag="KPHS_00310"
                     /note="hypothetical protein; Reviewed; Region: PRK01637"
                     /db_xref="CDD:179313"
     gene            40393..40830
                     /locus_tag="KPHS_00320"
                     /db_xref="GeneID:11845010"
     CDS             40393..40830
                     /locus_tag="KPHS_00320"
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA deacylase"
                     /protein_id="YP_005224332.1"
                     /db_xref="GeneID:11845010"
                     /translation="MIALIQRVSRASVTVADEVTGEIGPGLLVLLGVEKDDDEQKANR
                     LCERVLGYRIFSDAEGKMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGAAPDRA
                     EALYEYFVARCRQQEMHTQTGRFAADMQVSLVNDGPVTFWLQV"
     misc_feature    40393..40827
                     /locus_tag="KPHS_00320"
                     /note="D-tyrosyl-tRNA(Tyr) deacylase; Provisional; Region:
                     PRK05273"
                     /db_xref="CDD:235383"
     misc_feature    order(40411..40413,40621..40635,40669..40671,40813..40815)
                     /locus_tag="KPHS_00320"
                     /note="putative active site [active]"
                     /db_xref="CDD:238316"
     misc_feature    order(40522..40524,40531..40539,40543..40554,40621..40626,
                     40630..40635,40639..40647,40651..40665,40669..40671,
                     40771..40824)
                     /locus_tag="KPHS_00320"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238316"
     misc_feature    order(40534..40536,40549..40551,40651..40653,40660..40662)
                     /locus_tag="KPHS_00320"
                     /note="putative tRNAtyr binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238316"
     gene            40815..41816
                     /locus_tag="KPHS_00330"
                     /db_xref="GeneID:11845011"
     CDS             40815..41816
                     /locus_tag="KPHS_00330"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="YP_005224333.1"
                     /db_xref="GeneID:11845011"
                     /translation="MVAGMTQLPGRLRVTKESTTMYHLRVPQTAEELESYYQFRWEML
                     RKPLHQPKGSERDAWDAMAHHQMVVDEEGNLVAVGRLYINAENEASIRFMAVHPSVQD
                     KGLGTLMAMTLESVARQEGVKRVTCSAREDAVEFFAKLGFVNQGEITTPTTTPIRHFL
                     MIKPVASLDDILHRGDWCAQLQQAWYQHIPLSEKMGVRIQQYTGQKFITTMPEAGNQN
                     PHHTLFAGSLFSLATLTGWGLIWLMLRERHLGGTIILADAHIRYSQPISGRPSAIADL
                     GSLSGDLDRLARGRKARVQMQVELFGDDKQGAVFEGIYIVLPAKPFGSYEEGGNEEE"
     misc_feature    <41016..>41240
                     /locus_tag="KPHS_00330"
                     /note="N-Acyltransferase superfamily: Various enyzmes that
                     characteristicly catalyze the transfer of an acyl group to
                     a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:302625"
     misc_feature    order(41094..41102,41130..41135)
                     /locus_tag="KPHS_00330"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    41346..41768
                     /locus_tag="KPHS_00330"
                     /note="Putative thioesterase (yiiD_Cterm); Region: YiiD_C;
                     pfam09500"
                     /db_xref="CDD:286575"
     gene            complement(41830..42747)
                     /locus_tag="KPHS_00340"
                     /db_xref="GeneID:11845012"
     CDS             complement(41830..42747)
                     /locus_tag="KPHS_00340"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl esterase"
                     /protein_id="YP_005224334.1"
                     /db_xref="GeneID:11845012"
                     /translation="MALEKGIASLVEAFIAAGRPSSRDQHIDDRRAGYIASAVLAGET
                     ETRVRVEDITLEGMHFRVVSPPTADGLLPTLIYYHGGCFVSGGFATHDNQLRQLAWFS
                     GCRVIAVQYRLAPEYPFPAAHDDAERGATIIHQHAKQLGVDVSRITLAGDSAGGHLAL
                     VTALRLKAKAAWQPAQLILIYPMLDPTASMASYLSNGDDYVITRDTLLSGYEMYLAST
                     PANHPDACPLWREDFNGLPPVHILTAEFDPLRDEGEVLYRRLTEQGVESSCQRYLGVI
                     HGFFQLGGVSNAARDAMRDIAWRVASPGR"
     misc_feature    complement(41908..42525)
                     /locus_tag="KPHS_00340"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
                     pfam07859"
                     /db_xref="CDD:336840"
     gene            42952..43194
                     /locus_tag="KPHS_00350"
                     /db_xref="GeneID:11845013"
     CDS             42952..43194
                     /locus_tag="KPHS_00350"
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix domain-containing protein"
                     /protein_id="YP_005224335.1"
                     /db_xref="GeneID:11845013"
                     /translation="MMAERDMGRILLDLSDDVIQRLDDLKVQRNIPRAELLREAVEQY
                     LEKQDRAKDTISSALGLWQDCEEDGMEYQRQLRKEW"
     misc_feature    42976..43092
                     /locus_tag="KPHS_00350"
                     /note="Ribbon-helix-helix domain; Region: RHH_3;
                     pfam12651"
                     /db_xref="CDD:289422"
     gene            43194..43577
                     /locus_tag="KPHS_00360"
                     /db_xref="GeneID:11845014"
     CDS             43194..43577
                     /locus_tag="KPHS_00360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-component transcriptional regulator"
                     /protein_id="YP_005224336.1"
                     /db_xref="GeneID:11845014"
                     /translation="MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEV
                     MVGAKKYHQEQRTRMALSTFNIINISQDIAERSVALRQEYKLKLPDAIILATAQLHRL
                     ELITRNTKDFAGIPGVVTPYEIHPE"
     misc_feature    43212..43559
                     /locus_tag="KPHS_00360"
                     /note="uncharacterized subgroup of the
                     PIN_VapC4-5_FitB-like subfamily of the PIN domain
                     superfamily; Region: PIN_VapC4-5_FitB-like; cd18737"
                     /db_xref="CDD:350304"
     misc_feature    order(43215..43247,43266..43277,43293..43298,43305..43310,
                     43314..43322,43326..43334,43338..43340,43347..43361,
                     43365..43373,43377..43379,43386..43391,43395..43403,
                     43413..43418,43422..43430,43434..43439,43446..43472,
                     43494..43499,43512..43517)
                     /locus_tag="KPHS_00360"
                     /note="oligomeric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:350304"
     misc_feature    order(43215..43247,43266..43277,43293..43298,43320..43322,
                     43326..43334,43347..43361,43365..43373,43377..43379,
                     43386..43391,43395..43397,43401..43403,43434..43436,
                     43449..43472,43494..43499,43512..43517)
                     /locus_tag="KPHS_00360"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:350304"
     misc_feature    order(43218..43220,43320..43322,43461..43463,43515..43517,
                     43524..43526)
                     /locus_tag="KPHS_00360"
                     /note="active site"
                     /db_xref="CDD:350304"
     misc_feature    order(43305..43310,43314..43322,43326..43331,43338..43340,
                     43353..43355,43365..43367,43395..43403,43413..43418,
                     43422..43430,43434..43439,43446..43448,43455..43460,
                     43467..43469)
                     /locus_tag="KPHS_00360"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:350304"
     gene            complement(43751..44680)
                     /locus_tag="KPHS_00370"
                     /db_xref="GeneID:11845015"
     CDS             complement(43751..44680)
                     /locus_tag="KPHS_00370"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="YP_005224337.1"
                     /db_xref="GeneID:11845015"
                     /translation="MSIRIIPQDELGSSEKRTAEAIPPLLFPRLKNLYNRRAERLREL
                     AANNPLGDYLRFAALIAHAQEVVLYDHPLQMDLTARIKAASEQGKPPLDIHVLPRDKH
                     WHKLLHSLIAELKPEMSGPALAVIENLEKASEQELEQMASALFVSDFASVSSDKAPFI
                     WAALSLYWAQMASLIPGKARAEYGEQRQFCPVCGSMPVSSIVQIGTTQGLRYLHCNLC
                     ETEWHVVRVKCSNCEQSRDLHYWSLDNEQAAVKAESCGDCGTYLKIMYQEKDPKVEAV
                     ADDLASLVLDARMEQEGFARSSINPFMFPGEGE"
     misc_feature    complement(43754..44680)
                     /locus_tag="KPHS_00370"
                     /note="formate dehydrogenase accessory protein FdhE;
                     Provisional; Region: PRK03564"
                     /db_xref="CDD:179595"
     gene            complement(44677..45312)
                     /locus_tag="KPHS_00380"
                     /db_xref="GeneID:11845016"
     CDS             complement(44677..45312)
                     /locus_tag="KPHS_00380"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-O subunit gamma"
                     /protein_id="YP_005224338.1"
                     /db_xref="GeneID:11845016"
                     /translation="MKRRDTIVRYTAPERINHWVTAFCFVLAAVSGLGFFFPSFNWLM
                     HILGTPQLARILHPFVGVVMFASFIIMFFRYWHHNLINRDDIFWAKNIRKIVVNEEVG
                     DTGRYNFGQKCVFWAAIIFLVLLLVSGVIIWRPYFAPAFSIPVIRFALMLHSFAAVAL
                     IVVIMVHIYAALWVKGTITAMVEGWVTKTWAKKHHPRWYREVRQKQEKSSE"
     misc_feature    complement(44680..45312)
                     /locus_tag="KPHS_00380"
                     /note="formate dehydrogenase-O subunit gamma; Provisional;
                     Region: PRK10639"
                     /db_xref="CDD:182608"
     gene            complement(45309..46211)
                     /locus_tag="KPHS_00390"
                     /db_xref="GeneID:11845017"
     CDS             complement(45309..46211)
                     /locus_tag="KPHS_00390"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-O, Fe-S subunit"
                     /protein_id="YP_005224339.1"
                     /db_xref="GeneID:11845017"
                     /translation="MAYQSQDIIRRSATNGFTPAPQARDHQQEVAKLIDVTTCIGCKA
                     CQVACSEWNDIRDEVGHNVGVYDNPADLTAKSWTVMRFSEVEQNDKLEWLIRKDGCMH
                     CADPGCLKACPSEGAIIQYANGIVDFQSEQCIGCGYCIAGCPFDVPRLNPEDNRVYKC
                     TLCVDRVTVGQEPACVKTCPTGAIHFGSKEDMKTLAGERVAELKTRGYDNAGLYDPAG
                     VGGTHVMYVLHHADKPNLYHGLPENPEISQTVKFWKGIWKPLAAVGFAATFAASIFHY
                     VGVGPNRAEEEEDNLHEEKDEVRK"
     misc_feature    complement(45363..46193)
                     /locus_tag="KPHS_00390"
                     /note="formate dehydrogenase, beta subunit, Fe-S
                     containing; Region: FDH-beta; TIGR01582"
                     /db_xref="CDD:273705"
     gene            complement(46224..48638)
                     /locus_tag="KPHS_00400"
                     /db_xref="GeneID:11845018"
     CDS             complement(46224..48638)
                     /locus_tag="KPHS_00400"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-O alpha subunit"
                     /protein_id="YP_005224340.1"
                     /db_xref="GeneID:11845018"
                     /translation="MTNHWVDIKNANLVVVMGGNAAEAHPVGFRWAMEAKIHNGAKLI
                     VIDPRFTRTASVADFYTPIRSGTDITFLSGVILYLLNNEKFNREYTEAYTNASLIVRE
                     DYSFDDGLFSGYDAEKRQYDKTSWNYELDENGFAKRDTTLQHPRCVWNLLKQHVSRYT
                     PDVVENICGTPKADFLKVCEYIAETSAPDKTASFLYALGWTQHSIGAQNIRTMAMIQL
                     LLGNMGMAGGGVNALRGHSNIQGLTDLGLLSTSLPGYMSLPNEKQADLQTYLTANTPK
                     PLLKDQVNYWGNYPKFFVSMMKAFFGDKATAENSWGYDWLPKWDKSYDVLQYFEMMNQ
                     GKVNGYICQGFNPVASFPNKNKVVASLSKLKFLVTIDPLNTETSTFWQNHGESNDVDP
                     AKIQTEVFRLPSTCFAEENGSIVNSGRWLQWHWKGADAPGIAVTDGEILAGIFTRLRK
                     MYAEEGGPAPEPVLNMTWNYSTPHEPASEEVAMESNGKALADITDPATGAVIVKKGQQ
                     LSSFAQLRDDGTTSSGCWIFAGSWTPEGNQMARRDNADPSGLGNTLGWAWAWPLNRRI
                     LYNRASADPQGKPWDPKRQLLKWDGAKWGGVDIPDYSAAAPGSDVGPFIMQPEGMGRL
                     FAIDKMAEGPFPEHYEPFETPLGTNPLHPNVVSNPAARVFKGDLEQMGKAEKFPYVGT
                     TYRLTEHFHYWTKHALLNAIAQPEQFVEIGEKLANKLGIGHGDTVKVSSNRGYIKAKA
                     VVTKRIRTLKVDGKDIDTIGIPIHWGYEGVAKKGFIANTLTPFVGDANTQTPEFKAFL
                     VNVEKV"
     misc_feature    complement(46230..>48638)
                     /locus_tag="KPHS_00400"
                     /note="formate dehydrogenase-N alpha subunit; Region:
                     formate-DH-alph; TIGR01553"
                     /db_xref="CDD:273689"
     gene            complement(48687..49274)
                     /locus_tag="KPHS_00410"
                     /db_xref="GeneID:11845019"
     CDS             complement(48687..49274)
                     /locus_tag="KPHS_00410"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-O alpha subunit"
                     /protein_id="YP_005224341.1"
                     /db_xref="GeneID:11845019"
                     /translation="MQVSRRQFFKICAGGMAGTTAAALGFAPATALAETRQYKLLRTR
                     ETRNTCTYCSVGCGLLMYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFI
                     HSESRLKFPEYRAPGSDKWQQISWDEAFDRIAKLMKEDRDANFIAQNDAGTTVNRWLT
                     TGMLCASASSNETGYLTQKFTRALGMLAVDNQARV"
     misc_feature    complement(<48690..49271)
                     /locus_tag="KPHS_00410"
                     /note="formate dehydrogenase-N alpha subunit; Region:
                     formate-DH-alph; TIGR01553"
                     /db_xref="CDD:273689"
     gene            49431..50267
                     /locus_tag="KPHS_00420"
                     /db_xref="GeneID:11845020"
     CDS             49431..50267
                     /locus_tag="KPHS_00420"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein"
                     /protein_id="YP_005224342.1"
                     /db_xref="GeneID:11845020"
                     /translation="MNKKPLEQIKNVTNVTGYRQVSLWKREDLQHPQPDELAEEVPVA
                     LVYNGISHVVMMASPKDLEQFAVGFSLSEGIIEHRREIFGMDVVAVCNGLEVQIELSS
                     RRFMGLKARRRALAGRTGCGVCGVEQLNDIGKPVQPLPFTQSFDLANLDQALAHLNDF
                     QPVGRLTGCTHAAAWVRLTGELAGGFEDVGRHVALDKLLGRRAEVGEGWQHGAALVSS
                     RASYEMVQKAAMCGVEILFAVSAATTLAVEVAERCNLTLVGFCKPGRATVYTHPQRLI
                     AG"
     misc_feature    49464..50252
                     /locus_tag="KPHS_00420"
                     /note="formate dehydrogenase accessory protein; Reviewed;
                     Region: PRK00724"
                     /db_xref="CDD:234823"
     gene            50396..50608
                     /locus_tag="KPHS_00430"
                     /db_xref="GeneID:11845021"
     CDS             50396..50608
                     /locus_tag="KPHS_00430"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="YP_005224343.1"
                     /db_xref="GeneID:11845021"
                     /translation="MKSIKTFVAVIAMAASFASFAAETVTATASTMDGAEAKIAAQAQ
                     AAGASSYKITEAFTGNRVHMTAELNK"
     gene            51011..51991
                     /locus_tag="KPHS_00440"
                     /db_xref="GeneID:11845022"
     CDS             51011..51991
                     /locus_tag="KPHS_00440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 6-phosphofructokinase"
                     /protein_id="YP_005224344.1"
                     /db_xref="GeneID:11845022"
                     /translation="MKIGIVISGGDVSGMNNFIFQIARQANADITLFNGGIPGLLEKS
                     HQDMAWRDLVDYSITAVPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMAGGDGSL
                     QFLNTLSEFEINCFGVGMTIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRALPGRV
                     FMVEILGGYCGELTLQSAIKCNADIALIPEAQMPLAVLAERITRKLSTQNSVVILCSE
                     GYTKEYSPGFQGAIDTMIKQLEPQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEV
                     VRCIQSGMKNKAIIINSSNKPIPIDLVSMKKRLVDTEGHHYKLAKQLNII"
     misc_feature    51014..51844
                     /locus_tag="KPHS_00440"
                     /note="Phosphofructokinase; Region: PFK; pfam00365"
                     /db_xref="CDD:334036"
     misc_feature    order(51038..51040,51119..51121,51212..51214,51305..51313,
                     51317..51322,51371..51373,51377..51379,51383..51385,
                     51506..51514,51662..51664,51770..51772,51779..51781)
                     /locus_tag="KPHS_00440"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    order(51038..51040,51119..51121,51212..51214,51305..51313,
                     51317..51322)
                     /locus_tag="KPHS_00440"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    order(51068..51070,51080..51082,51158..51160,51173..51175,
                     51182..51184,51401..51403,51437..51439,51449..51451,
                     51458..51460,51545..51550,51554..51556,51635..51637,
                     51806..51811,51821..51823,51842..51844,51854..51856,
                     51974..51976)
                     /locus_tag="KPHS_00440"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    order(51068..51070,51080..51082,51158..51163,51170..51175,
                     51458..51460,51554..51556,51560..51562,51629..51631,
                     51635..51643)
                     /locus_tag="KPHS_00440"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    order(51371..51373,51377..51379,51383..51385,51485..51487,
                     51506..51514,51662..51664,51752..51754,51770..51772,
                     51779..51781)
                     /locus_tag="KPHS_00440"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            52003..52317
                     /locus_tag="KPHS_00450"
                     /db_xref="GeneID:11845023"
     CDS             52003..52317
                     /locus_tag="KPHS_00450"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS family protein II component"
                     /protein_id="YP_005224345.1"
                     /db_xref="GeneID:11845023"
                     /translation="MLKILCVCGCGLGSSFAIEMTAKAVLKKLEIPAHIEHTTVSEAG
                     AFKSDMILTQKTFADILTADASEEEIKRVVVLNKLTDKEEIETKIVAFLKERHLKVAD
                     YE"
     misc_feature    52009..52281
                     /locus_tag="KPHS_00450"
                     /note="subunit IIB of enzyme II (EII) of the
                     L-ascorbate-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In this system, EII is an
                     L-ascorbate-specific permease with two cytoplasmic
                     subunits (IIA and IIB) and a transmembrane channel...;
                     Region: PTS_IIB_ascorbate; cd05563"
                     /db_xref="CDD:99905"
     misc_feature    order(52024..52035,52039..52047)
                     /locus_tag="KPHS_00450"
                     /note="P-loop; other site"
                     /db_xref="CDD:99905"
     misc_feature    order(52024..52026,52030..52035,52042..52047)
                     /locus_tag="KPHS_00450"
                     /note="active site"
                     /db_xref="CDD:99905"
     misc_feature    52024..52026
                     /locus_tag="KPHS_00450"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99905"
     gene            52310..53677
                     /locus_tag="KPHS_00460"
                     /db_xref="GeneID:11845024"
     CDS             52310..53677
                     /locus_tag="KPHS_00460"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar phosphotransferase component IIC"
                     /protein_id="YP_005224346.1"
                     /db_xref="GeneID:11845024"
                     /translation="MNSFVAFIVKDLLGQASILIAFIAMLGLILQKKSPGKTAEGTFK
                     TLLGFLIMMAGINIIVATLTFLNDIFTQGFGMKGYITDVAAIAGLANRELGSEVALTL
                     LVIFAVNIIIARLTPLKYIFLTGQALLWMATIGAVIGYKSGLTGVPLILTGGIFGGVM
                     AVLMPALAQPVVRRIIGSDDVALGHFCTIGYLVQAAVAKVVGKGSRSTEDLELPDNFK
                     FLQDTYLAMAVVMVPMYLIPAIAAGPQYIAQFSGGINYLMYAFMQSIQFVAGVFVLYS
                     GVRLLLNELVPAFRGIAMRIVPDAKPALDCPVLFPYAPNAVIVGFLATTVGSIIGMLV
                     FPMFGLAMILPGLLTNFFAGGTAGVFGNALGGRRGAMIGGVIHGLFITLLPAILVPML
                     ESYGFTGVTFSDSDVISSGLVLGHAFQNNWLFVALFIVFVAALAWFVNGKSAKPKGES
                     VHESV"
     misc_feature    52310..53650
                     /locus_tag="KPHS_00460"
                     /note="PTS system ascorbate-specific transporter subunit
                     IIC; Reviewed; Region: PRK12997"
                     /db_xref="CDD:237262"
     gene            53664..54506
                     /locus_tag="KPHS_00470"
                     /db_xref="GeneID:11845025"
     CDS             53664..54506
                     /locus_tag="KPHS_00470"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ketose-bisphosphate aldolase, class-II"
                     /protein_id="YP_005224347.1"
                     /db_xref="GeneID:11845025"
                     /translation="MSLYNFNEILKIAQERDFKAIGSFNLHCIEMLPAFFKAAQNSRS
                     PLMIQISTGTAEYLGYRLLVDAVRSLADSENIPTCLHLDHCSDIKAIETAMNAGFSSV
                     MYDGSHLSLEENIGNTRIVVEMARPRNITVEGELGAIGGSEDGKAVAAEDICFTTVED
                     ATRFVKETQVDMLAVSVGTVHGLYTGKAQIQHARLKAISEATGVPLVLHGGTGVSDED
                     MRLAVTEGINKVNVGTEMNVQWVDRCKSTFEKGKVNDSVRKFLIPANQAVTAVLMEKM
                     ALFK"
     misc_feature    53676..54503
                     /locus_tag="KPHS_00470"
                     /note="Fructose-bisphosphate aldolase class-II; Region:
                     F_bP_aldolase; pfam01116"
                     /db_xref="CDD:334390"
     gene            54565..54834
                     /locus_tag="KPHS_00480"
                     /db_xref="GeneID:11845026"
     CDS             54565..54834
                     /locus_tag="KPHS_00480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224348.1"
                     /db_xref="GeneID:11845026"
                     /translation="MFESLKTLWKKEQNPLQDYDQQSRQLAEEIARLEGELQRQPDNS
                     DVQKTLMLTYNRALSVYAKSKSHRQDIDALFLQIDNLRNIIRRNI"
     gene            54844..55281
                     /locus_tag="KPHS_00490"
                     /db_xref="GeneID:11845027"
     CDS             54844..55281
                     /locus_tag="KPHS_00490"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS family protein IIA component"
                     /protein_id="YP_005224349.1"
                     /db_xref="GeneID:11845027"
                     /translation="MTIKELLIEADAIQVGVVESDWQRVIKLAARPLEAKGFISTEYS
                     QAVIDNTLNHGAYYVFDEGIAIPHARPECGVRRNCFSLVVLEKPIPFADSEKADIVIM
                     FGARDSNAHIEEGIRSIVALLDNNDTMAKLRTARSREEVVALL"
     misc_feature    54844..55278
                     /locus_tag="KPHS_00490"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cl00163"
                     /db_xref="CDD:350927"
     misc_feature    order(54991..54993,55045..55047)
                     /locus_tag="KPHS_00490"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    55045..55047
                     /locus_tag="KPHS_00490"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            55278..55871
                     /locus_tag="KPHS_00500"
                     /db_xref="GeneID:11845028"
     CDS             55278..55871
                     /locus_tag="KPHS_00500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine protease"
                     /protein_id="YP_005224350.1"
                     /db_xref="GeneID:11845028"
                     /translation="MNRHLTPGCKTAILINGIPASGKSTITRLLAETFSLPVLTIDGI
                     KEPFMARLAPVDRPMNRQLGCAAYEVIWSIVGASPASMVWLIDAWFGFQPRETLQRLL
                     QQAGVEQVIEVWNHISPELAVARYASRLATRPPGHPGEEYLPELAQLAGRAQPMSLGP
                     VLTIDQRHPLQIEPVIQWLEGTIAGQHSGFTDYAYSS"
     misc_feature    55314..>55685
                     /locus_tag="KPHS_00500"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:354320"
     misc_feature    55314..>55373
                     /locus_tag="KPHS_00500"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:354812"
     misc_feature    order(55326..55328,55341..55352)
                     /locus_tag="KPHS_00500"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            complement(55868..56191)
                     /locus_tag="KPHS_00510"
                     /db_xref="GeneID:11845029"
     CDS             complement(55868..56191)
                     /locus_tag="KPHS_00510"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_005224351.1"
                     /db_xref="GeneID:11845029"
                     /translation="MGNMTLFIAGIAILSLGTYLMRLGGAKLGNRLAFSERSQALLSD
                     AATVLLFSVALATTFYEGAHFAGMARVLGVAFAVFLAWRKVPLIGVIIAAAVVTALLR
                     LAGMP"
     misc_feature    complement(55886..56161)
                     /locus_tag="KPHS_00510"
                     /note="Branched-chain amino acid transport protein (AzlD);
                     Region: AzlD; pfam05437"
                     /db_xref="CDD:310205"
     gene            complement(56191..56769)
                     /locus_tag="KPHS_00520"
                     /db_xref="GeneID:11845030"
     CDS             complement(56191..56769)
                     /locus_tag="KPHS_00520"
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC family ABC transporter permease"
                     /protein_id="YP_005224352.1"
                     /db_xref="GeneID:11845030"
                     /translation="MSYGSLAVAYGFPLWVPLLLSVSVLAGASEFMFIGIVASGGSPL
                     AAAAAGLLVNARHIPFGVTVRELVGRRALSFIGCHIMNDESVVFGLSQPTPAQRKAAY
                     WLCGAGVALIWPLGTLTGAAVGKLLPAPETIGLDAVFPAILLALVIPAFKNRTTLIRA
                     ASGAALALAAVPFVPTGLPVLLSLFGLLSRKK"
     misc_feature    complement(56206..56769)
                     /locus_tag="KPHS_00520"
                     /note="Predicted branched-chain amino acid permease
                     (azaleucine resistance) [Amino acid transport and
                     metabolism]; Region: AzlC; COG1296"
                     /db_xref="CDD:224215"
     gene            56896..57498
                     /locus_tag="KPHS_00530"
                     /db_xref="GeneID:11845031"
     CDS             56896..57498
                     /locus_tag="KPHS_00530"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helix-turn-helix regulatory protein"
                     /protein_id="YP_005224353.1"
                     /db_xref="GeneID:11845031"
                     /translation="MIVFQGERIVRYKKQGAGMTQPISVIAKSLVRERARTGLSLAEV
                     ARRAGIAKSTLSQLESGNGNPSLETLWSLCVALDIPFARLLEPQVNKTQVIRRGEGTK
                     VVAEQANYQAILLAACPPGARRDIYLLLTQPGADRISHPHPPGSVEHIIVTQGRARVG
                     LTSAPEELGEGDYICYPADQEHVFQALEPDTQALLIAEQN"
     misc_feature    56974..57147
                     /locus_tag="KPHS_00530"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(56986..56988,56998..57000,57073..57075)
                     /locus_tag="KPHS_00530"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(56995..56997,57070..57072)
                     /locus_tag="KPHS_00530"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(57016..57021,57052..57054,57061..57063,57073..57078)
                     /locus_tag="KPHS_00530"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    <57289..57480
                     /locus_tag="KPHS_00530"
                     /note="Conserved domain found in cupin and related
                     proteins; Region: cupin_like; cl21464"
                     /db_xref="CDD:328732"
     gene            57586..58581
                     /locus_tag="KPHS_00540"
                     /db_xref="GeneID:11845032"
     CDS             57586..58581
                     /locus_tag="KPHS_00540"
                     /codon_start=1
                     /transl_table=11
                     /product="galETK operon repressor"
                     /protein_id="YP_005224354.1"
                     /db_xref="GeneID:11845032"
                     /translation="MSLKAIAKQLGISVTTVSRALNGYDDVSQETRARVEAEAQRRGY
                     RPNTFARRLKMGTIDAVGLVFPVRPAPLNNNVFLEMVGEISHELARHDIDLLLIADDE
                     QADKHGYMRMVQGRRVDALIVAHTLDDDPRLAQLQASGFPFLALGRSRLAQPYAWFDF
                     DNYAGTCRATRHLIQQGHQRIALLGENNNQAFILQRRNGYLDALREAGLSDAWLRSVP
                     ATRRGGYQATLELLRLPEPPTAIITDCNTHGDGAAMALAHLGRLTGDNRVALVVYDGL
                     PQDSIIETDVAAVIQSTRQGVGRQIADMVRRLIAGEDLATLQVLWQPEFIPGETA"
     misc_feature    57586..57783
                     /locus_tag="KPHS_00540"
                     /note="helix_turn _helix lactose operon repressor; Region:
                     HTH_LACI; smart00354"
                     /db_xref="CDD:197675"
     misc_feature    order(57595..57597,57619..57633,57637..57642,57649..57651,
                     57664..57669,57676..57678,57715..57717,57724..57726,
                     57733..57738,57742..57747)
                     /locus_tag="KPHS_00540"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    57715..57744
                     /locus_tag="KPHS_00540"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    57763..58563
                     /locus_tag="KPHS_00540"
                     /note="Ligand-binding domain of DNA transcription
                     repressors specific for raffinose (RafR) and
                     alpha-glucosides (AglR) which are members of the LacI-GalR
                     family of bacterial transcription regulators; Region:
                     PBP1_AglR_RafR_like; cd06271"
                     /db_xref="CDD:107266"
     misc_feature    order(57811..57813,57823..57825,58018..58023,58054..58065,
                     58171..58173,58318..58320,58405..58407)
                     /locus_tag="KPHS_00540"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107266"
     gene            58697..60820
                     /locus_tag="KPHS_00550"
                     /db_xref="GeneID:11845033"
     CDS             58697..60820
                     /locus_tag="KPHS_00550"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glycoprotein"
                     /protein_id="YP_005224355.1"
                     /db_xref="GeneID:11845033"
                     /translation="MSDSLIHLQSAGADVVIKTRPFAEIVYWGPHLSHFSPQDADSLT
                     RPVANGRLDVDSPVTLMAELGHGLFGAPGIEGHRQGLDASPLFTTSEVRHEGQTLTLV
                     SEDPQAGLRLQSEIALDASGVLSVRHGVTNLRASPWQVDRLAVTLPVAERAREVMAFH
                     GRWIREFQPHRLTLEHDSFVLENRRGRTSHEHFPALITGSRAFSEMQGEVWGVHLAWS
                     GNHRLRAEVKTDGRRYLQAEALYLPGEMALAEGETLWTPYLYASYSANGLNGMSQQFH
                     RYLRERIIRFPGNKPRPVHLNTWEGIYFDHDPDYIMRMADEAAALGVERFIIDDGWFK
                     GRNDDWAALGDWYLDEKKYPYGLTPVIDHVKSLGMEFGIWVEPEMINPDSDLYRAHPD
                     WVLALPGYTPLTGRHQFVLNLNIPEAFDYLLERMSWLLGEHAVDYVKWDMNRELVQPG
                     HQGRAAADAQTRQFYRLLDTLVARFPHIEFESCSSGGGRIDYEVLKRSHRFWASDNND
                     ALERNTIQRGMSYFFPPEVMGAHIGNRHCHATFRQHSIAFRGLTALFGHMGLELDPVS
                     ADEEERAGYRKYAALHKQWRDVIHHGVQWRIDMPDATTLAHGVVSPDKAQAIFLVSQL
                     AMPDYTLMAPLRLAGLEASARYQVTLLDHPNIQITGEGGHTMRKLPAWMTTPQTVSGE
                     WLQQAGLALPILDPESAILIGLQRV"
     misc_feature    58709..60775
                     /locus_tag="KPHS_00550"
                     /note="Alpha-galactosidase [Carbohydrate transport and
                     metabolism]; Region: GalA; COG3345"
                     /db_xref="CDD:225882"
     gene            60862..62127
                     /locus_tag="KPHS_00560"
                     /db_xref="GeneID:11845034"
     CDS             60862..62127
                     /locus_tag="KPHS_00560"
                     /codon_start=1
                     /transl_table=11
                     /product="raffinose permease"
                     /protein_id="YP_005224356.1"
                     /db_xref="GeneID:11845034"
                     /translation="MNPTVCTHKNNPNFWIFGLFFFLYFFIMATCFPFLPIWLSDVIG
                     LNKTETGLVFSSLSLFAICFQPILGVISDKLGLKKHLMWIVTVLLVLIAPFFLYVFAP
                     LLKTNIWLGALSGGAYIGFAFSAGAGAMEAYIERVSRNSGFEYGKARTFGCLGWALCA
                     TTAGMLFSINPEWVFWMGSAAALLLVVLVAIAKPQASQSAQVMDSLGANRPAIDLKTA
                     VRMFRQRKMWMFILYVIGVACVYDVFDQQFATFFKSFFATPEAGTRAFGFATTAGEIC
                     NAIIMFSSPWIINRIGAKNTLLIAGMVMAARMIGSSFATTAAEVVALKMLHALEVPFL
                     LVGAFKYITGVFDVRLSATIYLVGFQFAKQVAAIFLSAFAGNMYDRIGFQDTYMILGG
                     IALTVTLISAFTLAGKTKTEPLRDNAMTV"
     misc_feature    60868..62115
                     /locus_tag="KPHS_00560"
                     /note="galactoside permease; Reviewed; Region: lacY;
                     PRK09528"
                     /db_xref="CDD:236549"
     gene            complement(62165..62479)
                     /locus_tag="KPHS_00570"
                     /db_xref="GeneID:11845035"
     CDS             complement(62165..62479)
                     /locus_tag="KPHS_00570"
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose 1-epimerase"
                     /protein_id="YP_005224357.1"
                     /db_xref="GeneID:11845035"
                     /translation="MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKDHGAHHYAIY
                     LDKERHLLFATVEIESEARWEAVASTEVCQRWWKYMREVMPSNPDNSPLSAELKEVFY
                     LA"
     misc_feature    complement(62168..62473)
                     /locus_tag="KPHS_00570"
                     /note="L-rhamnose mutarotase; Region: YiiL_rotase;
                     TIGR02625"
                     /db_xref="CDD:131674"
     gene            complement(62476..63624)
                     /locus_tag="KPHS_00580"
                     /db_xref="GeneID:11845036"
     CDS             complement(62476..63624)
                     /locus_tag="KPHS_00580"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_005224358.1"
                     /db_xref="GeneID:11845036"
                     /translation="MSFMLALPKISLHGAGAIGDMVKLVAGKQWGKALIVTDGQLVKL
                     GLLDSLFAALDEQQMAYQLFDEVFPNPTEALVQQGYAAYQAARCDYLIAFGGGSPIDT
                     AKAIKILTANPGPSTAYSGVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSERQVKE
                     VIIDPNLIPDIAVDDASVMLDIPPAVTAATGMDALTHAIEAFVSVGAHPLTDANALEA
                     IRLINLWLPKAVDDGHDLQAREQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPH
                     GVCNAILLPIIENFNRPNAVARFARVAQAMGVDTRGMSDEAASMEAINAIRTLSKRVG
                     IPQGFSQLGVSKADIEGWLDKALADPCAPCNPRPASRDEVRELYLEAL"
     misc_feature    complement(62491..63621)
                     /locus_tag="KPHS_00580"
                     /note="lactaldehyde reductase; Region: lactal_redase;
                     TIGR02638"
                     /db_xref="CDD:131686"
     misc_feature    complement(order(62797..62799,62827..62829,62839..62841,
                     63034..63036,63046..63048,63067..63069,63091..63093,
                     63145..63150,63205..63207,63211..63216,63313..63315,
                     63322..63324,63331..63339,63511..63513))
                     /locus_tag="KPHS_00580"
                     /note="putative active site [active]"
                     /db_xref="CDD:341467"
     misc_feature    complement(order(62785..62787,62797..62799,62839..62841,
                     63034..63036,63046..63048))
                     /locus_tag="KPHS_00580"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:341467"
     gene            complement(63714..64718)
                     /locus_tag="KPHS_00590"
                     /db_xref="GeneID:11845037"
     CDS             complement(63714..64718)
                     /locus_tag="KPHS_00590"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnose ABC transport system permease
                     component"
                     /protein_id="YP_005224359.1"
                     /db_xref="GeneID:11845037"
                     /translation="MSKMMVSEEMKNAPAAPSPLRRLLCWEGFLLAVTLAVFIGNAVA
                     SPYFLNIWNLSDATFTFTEKAIVVLPMAMLIIAREIDLSVASTMALSSTVMGFCAAAG
                     MDTPLLVVIGLGVGLLCGLFNGLLVTRFNLSSIVITIGTMSLYRGITYILLGDQALNH
                     YPESFAWFGQGYVWGALSFEFALFILLAAAFTFLLHKTNFGRRTYAIGNNPTGAWFSG
                     INVKRHNLVLFALVGLMAGLAAVLLTSRLGSTRPTLAMGWELAVVTMAVLGGVNILGG
                     SGSMPGVIIAAFLMGLVTFGLSLLNVPGIVMSVIIGAMLIVVISLPIITRRMMQRRRC
                     "
     misc_feature    complement(63756..64538)
                     /locus_tag="KPHS_00590"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(64029..64085)
                     /locus_tag="KPHS_00590"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(64715..65722)
                     /locus_tag="KPHS_00600"
                     /db_xref="GeneID:11845038"
     CDS             complement(64715..65722)
                     /locus_tag="KPHS_00600"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner-membrane translocator"
                     /protein_id="YP_005224360.1"
                     /db_xref="GeneID:11845038"
                     /translation="MMGHAWLKHREALLAVVIILMIGAIGSRAPSFVSPGNLVEMFND
                     TAILIILALGQMMVLLTKGIDLSMAANLALTGMIVALLNAHYPGIPVVALLALATLLG
                     LLMGVINGLLVWRLGIPAIVVTLGTMSIYRGIIFLLTDGGWVNSHQMSADFLSLPRSP
                     LLGLPLLSWCAIAALLLVGYFLRYSRTGRALYTAGGNATAAYYTGINAGKMQFVSFCL
                     SGALAGFCGYLWISRFAVAYVDVANGFELQVVAACVIGGISTMGGSGRVLGCLCGALF
                     LGVINNALPVIGISPFWQMAISGAVIVMAVLLNERGNRGHGRLILRNAALARQKQAVK
                     S"
     misc_feature    complement(64781..65722)
                     /locus_tag="KPHS_00600"
                     /note="Ribose/xylose/arabinose/galactoside ABC-type
                     transport system, permease component [Carbohydrate
                     transport and metabolism]; Region: AraH; COG1172"
                     /db_xref="CDD:224093"
     misc_feature    complement(65072..65128)
                     /locus_tag="KPHS_00600"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(65719..67230)
                     /locus_tag="KPHS_00610"
                     /db_xref="GeneID:11845039"
     CDS             complement(65719..67230)
                     /locus_tag="KPHS_00610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter"
                     /protein_id="YP_005224361.1"
                     /db_xref="GeneID:11845039"
                     /translation="MSASTPLLSLKGITKIFPGVRALENVQLDLWPGKVTALIGENGA
                     GKSTLVKVMTGIYQPEEGEILYKAIPIHLPTPESAHKVGITAIHQETVLFDELSVSEN
                     IFVGQYLYKGLLKTLDWPAMHRRANEILTRLEVQIDPRATLKTLSIAQRHMVAIARAL
                     AFDAQVVILDEPTAALSQHEILEFYHIVERLKQDGKAILFISHKFDEIFELADYYTIL
                     RDGVYVSSGAISDITEERMVSMMVGRAISQTYPKVDCTPGETVLEVTDLCHPTEFAHI
                     SFRLRKGEILGFYGLVGAGRTELMQALSGVSRPSSGEIRLNGRTMRFHQPADAIRAGI
                     VCVPEERQKQGAIIALPIAQNISLPQLSKLNPNGVLNDAREWRLADEYASRLQVKAFS
                     WRQPVETLSGGNQQKVVIGKWLATQPEVIILDEPTKGIDIGSKAAVHQFMSELVSQGL
                     AVIMVSSELPEVMGMADRIIVMHEGQMVAEYRAGEATAETIVSAASGIGQEAA"
     misc_feature    complement(65740..67230)
                     /locus_tag="KPHS_00610"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     gene            complement(67376..68362)
                     /locus_tag="KPHS_00620"
                     /db_xref="GeneID:11845040"
     CDS             complement(67376..68362)
                     /locus_tag="KPHS_00620"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnose transport system substrate-binding
                     component"
                     /protein_id="YP_005224362.1"
                     /db_xref="GeneID:11845040"
                     /translation="MKTKTSLILTVAALALSGSALAEVKIALVAKSLGNGFFEAANVG
                     AQQAAKELGDVKVIYTGPTTTTAEAQIDVLNGLIAQGVDAIAISANDPDAVVPVLKKA
                     MQRGIKVVSWDSGVAPAGRQIHLNPSNNALIGETNVKLAADALQALNVEKGEVAVLSA
                     TPTSTNQNIWIEEMKKVLPQYPSVQLVTVAYGDDLSDKSYREAVGLLKSYPDLKVIVS
                     PSSVGIVAAAQAVKDQGKIGKVYVTGLGLPSEMAGAIKSGASKSFAIWNPIDLGYAAT
                     YLADDLVKGTATKTEASMGKLGKVKLDAEGNGAMAKPFVYDASNIDKFSKIF"
     misc_feature    complement(67385..68287)
                     /locus_tag="KPHS_00620"
                     /note="rhamnose ABC transporter, rhamnose-binding protein;
                     Region: RhaS; TIGR02637"
                     /db_xref="CDD:131685"
     gene            complement(68444..69274)
                     /locus_tag="KPHS_00630"
                     /db_xref="GeneID:11845041"
     CDS             complement(68444..69274)
                     /locus_tag="KPHS_00630"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulose-1-phosphate aldolase"
                     /protein_id="YP_005224363.1"
                     /db_xref="GeneID:11845041"
                     /translation="MQTIIDAWFVQGMIKATSDAWLKGWDERNGGNLTLRLDEADIEP
                     YAADFHAKPRYIALSQPMPTLANQPFIVTGSGKFFRNVQLDPAANLGVVKVDSDGAGY
                     HILWGLTEDAVPTSELPAHFLSHSERIKLTGGKDRVIMHCHATNLIALTYVLENHSDL
                     FTRKLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAETMQKHSLVLWPFHGVFGSG
                     PTLDETFGLIDTAEKSAEVLVKVLSMGGMKQTITRDELIALGKRFNVQPLQSALDLYP
                     "
     misc_feature    complement(68453..69274)
                     /locus_tag="KPHS_00630"
                     /note="rhamnulose-1-phosphate aldolase; Provisional;
                     Region: PRK03634"
                     /db_xref="CDD:179615"
     misc_feature    complement(order(68495..68497,68555..68557,68576..68578,
                     68588..68590,68609..68611,68642..68644,68720..68722,
                     68762..68767,68771..68773,68795..68797,68819..68824,
                     68837..68842,68846..68848,69032..69037,69041..69043,
                     69194..69196,69218..69220,69230..69232))
                     /locus_tag="KPHS_00630"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(68639..68641,68846..68848,68852..68854,
                     68924..68932,69047..69052,69179..69181))
                     /locus_tag="KPHS_00630"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(68639..68641,68846..68848,68852..68854))
                     /locus_tag="KPHS_00630"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(69424..70683)
                     /locus_tag="KPHS_00640"
                     /db_xref="GeneID:11845042"
     CDS             complement(69424..70683)
                     /locus_tag="KPHS_00640"
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose isomerase"
                     /protein_id="YP_005224364.1"
                     /db_xref="GeneID:11845042"
                     /translation="MTTQLEQAWEIAKQRYAAVGVDVEEALRQLDRLPVSMHCWQGDD
                     VAGFENPAGSLTGGIQATGNYPGKARNAEELRADLEQALSLIPGPKRLNLHAIYLESD
                     APVARNEIKPEHFKNWVTWAKANKLGLDFNPSCFSHPLSADGFTLSHANDEIRQFWID
                     HCKASRRVSAYFGEQLGTPSVMNIWVPDGMKDITVDRFAPRQRLLNALDEVISEKLDP
                     AHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAA
                     MLYIPRLLLHVSRPVRWDSDHVVLLDDETQAIASEIIRHNLFDRVHIGLDFFDASINR
                     IAAWVIGTRNMKKALLRALLEPTAQLRQLENDGDYTARLALLEEQKSLPWQAIWEMYC
                     QRHDTPAGSQWLDSVRAYENAVLSQRG"
     misc_feature    complement(69427..70683)
                     /locus_tag="KPHS_00640"
                     /note="L-rhamnose isomerase; Provisional; Region:
                     PRK01076"
                     /db_xref="CDD:179217"
     gene            complement(70680..72146)
                     /locus_tag="KPHS_00650"
                     /db_xref="GeneID:11845043"
     CDS             complement(70680..72146)
                     /locus_tag="KPHS_00650"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulokinase"
                     /protein_id="YP_005224365.1"
                     /db_xref="GeneID:11845043"
                     /translation="MSIRHCVAVDLGASSGRVMLASYQPGPRALTLREIHRFTNSLQK
                     VDGFDCWDVDSLEGEIRRGLEKVCEQGILIDSIGIDTWGVDYVLLDKQGQRVGLPISY
                     RDDRTQGLLRHAEAQLGRAEIYRRSGIQFLPFNTLYQLRALVEQQPELVSQAAHALLI
                     PDYFSFRLTGNLNWEYTNATTTQLVNINSDSWDETLLNWTGAPLAWFGKPTHPGNVIG
                     HWICPQGNRIPVVAVASHDTASAVIASPLADRHAAYLSSGTWSLMGFESLTPYTCDAA
                     LQANITNEGGAEGRYRVLKNIMGLWLLQRVLKEQNVSDLQGLIARTAALPACRFIIDC
                     NDDRFINPASMSAEIQAACRDAGQPVPESDAELARCIFDSLALLYARVLNELAALRGH
                     PFSQLHIVGGGCQNTLLNQLCADACGIAVVAGPIEASTLGNIGIQLMTLDELANVDEF
                     RQVVRGNAALTTFTPNPDSEIARFVAQFQPQQTKELCA"
     misc_feature    complement(70683..72092)
                     /locus_tag="KPHS_00650"
                     /note="rhamnulokinase; Provisional; Region: rhaB;
                     PRK10640"
                     /db_xref="CDD:182609"
     gene            72457..73293
                     /locus_tag="KPHS_00660"
                     /db_xref="GeneID:11845044"
     CDS             72457..73293
                     /locus_tag="KPHS_00660"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator RhaS"
                     /protein_id="YP_005224366.1"
                     /db_xref="GeneID:11845044"
                     /translation="MTILHSTDFFKAGISTVAIEPRLPQSAFPEHHHDFHEIVIVEQG
                     SGIHVFNGQPYTIGGGSVCFIRDHDRHLYEHTDNLCLTNVLYRAPDAFRFLAGVSQLL
                     PQEQEGNYPSHWRVNQTVLQQVRHIVAQIEAVGSDTDTHAVASREILFMQLLVLLRKS
                     SLAEEATNNDARLNQLLAWLEDHFAQEICWEEVAAQFSLSLRTLHRQLKQQTGLTPQR
                     YLNRVRLMKARHLLRHSDESVTDIAYRCGFGDSNHFSTLFRREFDWSPRDIRQGRDAI
                     LQ"
     misc_feature    72457..73290
                     /locus_tag="KPHS_00660"
                     /note="transcriptional activator RhaS; Provisional;
                     Region: PRK13503"
                     /db_xref="CDD:184094"
     gene            73367..74212
                     /locus_tag="KPHS_00670"
                     /db_xref="GeneID:11845045"
     CDS             73367..74212
                     /locus_tag="KPHS_00670"
                     /codon_start=1
                     /transl_table=11
                     /product="rhaRS operon positive regulator"
                     /protein_id="YP_005224367.1"
                     /db_xref="GeneID:11845045"
                     /translation="MAGLILRKEEFFPSATQAVAVADRYPQNVFAEHTHEFCELVLVW
                     RGNGLHVLNDRPWRITRGDLFYIRAEDKHSYASVNDLVLQNIIYCPERLQLNFDWAGA
                     IPGLFGTPWKPHWRMGSTGMAQARQVISQLEHECARRDAQGNAMAELLFAQLALTLQR
                     HRYATDDPAATQREALLDKLLAALAASLSRPFVLERFCEQEGGSERALRQQFRQQTGM
                     TINHYLRQLRICHAQYLLQHTERLIGDIAMQCGFEDSNYFSVVFSREIGMSPGQWRQR
                     SRAAA"
     misc_feature    73376..74197
                     /locus_tag="KPHS_00670"
                     /note="transcriptional activator RhaR; Provisional;
                     Region: PRK13502"
                     /db_xref="CDD:184093"
     gene            complement(74245..75279)
                     /locus_tag="KPHS_00680"
                     /db_xref="GeneID:11845046"
     CDS             complement(74245..75279)
                     /locus_tag="KPHS_00680"
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnose-proton symporter"
                     /protein_id="YP_005224368.1"
                     /db_xref="GeneID:11845046"
                     /translation="MNHAITMGIFWHLIGAASAACFYAPFKKVKHWSWETMWSVGGIV
                     SWLILPWAISATLLPDFWAYYRSFSASTLLPVFLFGAMWGIGNINYGLTMRYLGMSMG
                     IGIAIGITLIVGTLMTPIINGQFAVLMHTQGGQMTLLGVLVAVIGVGIVTRAGQLKER
                     KMGIKAEEFNLKKGLLLAVMCGIFSAGMSFAMNAAKPMHDAAAALGVDPLYAALPSYV
                     VIMGGGALVNLGFCFIRLAKVKNLSVKADFSLAKPLIISNLLLSALGGLMWYLQFFFY
                     AWGHASIPAQYDYMSWMLHMSFYVLCGGVVGLVLKEWNNAGRRPVSVLSLGCVVIIIA
                     ANIVGLGMAS"
     misc_feature    complement(74248..75279)
                     /locus_tag="KPHS_00680"
                     /note="L-rhamnose-proton symport protein (RhaT); Region:
                     RhaT; cl19288"
                     /db_xref="CDD:302813"
     gene            75569..76189
                     /locus_tag="KPHS_00690"
                     /db_xref="GeneID:11845047"
     CDS             75569..76189
                     /locus_tag="KPHS_00690"
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="YP_005224369.1"
                     /db_xref="GeneID:11845047"
                     /translation="MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALE
                     SLPEFANLSAEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAA
                     IERDFGSVENFKAEFEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGAS
                     GFPIIGLDVWEHAYYLKFQNRRPDYIKAFWDVVNWDEAAARFAAKK"
     misc_feature    75569..76186
                     /locus_tag="KPHS_00690"
                     /note="superoxide dismutase; Provisional; Region:
                     PRK10925"
                     /db_xref="CDD:182843"
     gene            76262..76936
                     /locus_tag="KPHS_00700"
                     /db_xref="GeneID:11845048"
     CDS             76262..76936
                     /locus_tag="KPHS_00700"
                     /codon_start=1
                     /transl_table=11
                     /product="6-N-hydroxylaminopurine resistance protein"
                     /protein_id="YP_005224370.1"
                     /db_xref="GeneID:11845048"
                     /translation="MHYPVNVFVGKIRDYAGSRPSAIDKIQVDGELQLGDLGLDGDQQ
                     AEKKIHGGPDRALCHYPREHYADWIRDFPQQAERFCAPAFGENLSTTGLTEQNVYIGD
                     IFRWGEALIQVTQPRSPCFKLNFHFAINDMAQLMQNSGKTGWLYRVIAGGQVSSDAPL
                     ELVSRLSDVSVHEAGAIAWQMPFDDDQYHRLLSAAGLSVSWSRTMQKRRLSGKIEDSS
                     RRLWGK"
     misc_feature    76262..76930
                     /locus_tag="KPHS_00700"
                     /note="6-N-hydroxylaminopurine resistance protein;
                     Provisional; Region: PRK11536"
                     /db_xref="CDD:183182"
     gene            complement(77004..78365)
                     /locus_tag="KPHS_00710"
                     /db_xref="GeneID:11845049"
     CDS             complement(77004..78365)
                     /locus_tag="KPHS_00710"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor protein"
                     /protein_id="YP_005224371.1"
                     /db_xref="GeneID:11845049"
                     /translation="MTARIFAIFWLTLALVLMLVLMLPKLDSRQMTELLESEQRQGIM
                     IEQHVEAELANDPPNDLMWWRRLFRAIDKWAPPGQRLLLVTSEGRVIGAERNEMQIIR
                     NFIGQADNADHPQKKRYGRLEMVGPFSVRDGEDNYQLYLIRPASTSQSDFINLLFDRP
                     LLLLIVTMLVSAPLLLWLAWSLAKPARKLKNAADEVAQGNLRQHPELEAGPQEFLAAG
                     ASFNQMVTALERMMTSQQRLLSDISHELRTPLTRLQLGTALLRRRSGESKELERIETE
                     AHRLDSMINDLLVMSRNQAKNALVSETVKANQLWNEVLDNAAFEAEQMGKSFTVEYPP
                     GPWPLYGNPNALESALENIVRNALRYSHTKISVSFSVDKDGITVNVDDDGPGVSPEDR
                     EQIFRPFYRTDEARDRESGGTGLGLAIVETAIQQHRGWVKADDSPLGGLRLTIWLPLY
                     KRT"
     misc_feature    complement(77010..78365)
                     /locus_tag="KPHS_00710"
                     /note="two-component sensor protein; Provisional; Region:
                     cpxA; PRK09470"
                     /db_xref="CDD:236532"
     gene            complement(78374..79072)
                     /locus_tag="KPHS_00720"
                     /db_xref="GeneID:11845050"
     CDS             complement(78374..79072)
                     /locus_tag="KPHS_00720"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator CpxR"
                     /protein_id="YP_005224372.1"
                     /db_xref="GeneID:11845050"
                     /translation="MNKILLVDDDRELTSLLKELLDMEGFNVLVAHDGEQALALLDDS
                     VDLLLLDVMMPKKNGIDTLKELRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPF
                     NDRELVARIRAILRRSHWSEQQQTTEAGSPTLEVDALSLNPGRQEANFDGQTLELTGT
                     EFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGHPWF
                     KTLRGRGYLMVSAS"
     misc_feature    complement(78377..79072)
                     /locus_tag="KPHS_00720"
                     /note="DNA-binding transcriptional regulator CpxR;
                     Provisional; Region: PRK10955"
                     /db_xref="CDD:182864"
     gene            79222..79725
                     /locus_tag="KPHS_00730"
                     /db_xref="GeneID:11845051"
     CDS             79222..79725
                     /locus_tag="KPHS_00730"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic repressor of stress-related
                     two-component regulatory system"
                     /protein_id="YP_005224373.1"
                     /db_xref="GeneID:11845051"
                     /translation="MRNVIAAVMASTLALSAYSQAAEVVTSVNWLPGDDGGQRGSQSH
                     MFDGISLTEQQRQQLRDLMQRARHDRLPVNVSEMETMHRLVTAENFDENAVRAQAEKM
                     AQEQVARQVEMAKVRNQMYHLLTPEQQAVLNAKHQQRMDQLREVARMQKGSAMMLSSS
                     SNTLQPQ"
     misc_feature    79222..79719
                     /locus_tag="KPHS_00730"
                     /note="periplasmic repressor CpxP; Reviewed; Region: cpxP;
                     PRK10363"
                     /db_xref="CDD:182410"
     misc_feature    order(79453..79455,79465..79467,79474..79479,79489..79491,
                     79495..79497,79507..79509,79516..79518,79528..79530,
                     79540..79542,79552..79554,79561..79566,79573..79575,
                     79582..79584,79615..79620,79627..79629)
                     /locus_tag="KPHS_00730"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:197366"
     gene            79884..80786
                     /locus_tag="KPHS_00740"
                     /db_xref="GeneID:11845052"
     CDS             79884..80786
                     /locus_tag="KPHS_00740"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron efflux protein F"
                     /protein_id="YP_005224374.1"
                     /db_xref="GeneID:11845052"
                     /translation="MNQSYGRLVSRAAIAATAMASALLLIKIFAWWYTGSVSILAALV
                     DSLVDIAASLTNLLVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGI
                     QHLVRPEPLQAAGVGVVVTLIALVSTLALVTFQRWVVRKTQSQAVRADMLHYQSDVMM
                     NGAILVALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQDI
                     ITIVTAWPGIRGAHDLRTRQSGPTRFIQIHLEMEDNLPLVQAHVIADQVEQAILRRFP
                     GSDVIIHQDPSSVVPAAQQGFFER"
     misc_feature    79884..80780
                     /locus_tag="KPHS_00740"
                     /note="ferrous iron efflux protein F; Reviewed; Region:
                     fieF; PRK09509"
                     /db_xref="CDD:181919"
     gene            80983..81945
                     /locus_tag="KPHS_00750"
                     /db_xref="GeneID:11845053"
     CDS             80983..81945
                     /locus_tag="KPHS_00750"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_005224375.1"
                     /db_xref="GeneID:11845053"
                     /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLG
                     LYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIG
                     GDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSS
                     HQRISVVEVMGRYCGDLTLAAAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAI
                     VAITEHMCDVDELASYIEKETGRETRATVLGHIQRGGSPVPYDRILASRMGAYAIELL
                     LQGHGGRCVGIQNEKLVHHDIIDAIENMKRPFKNDWLDCAKKLY"
     misc_feature    80986..81939
                     /locus_tag="KPHS_00750"
                     /note="6-phosphofructokinase; Provisional; Region:
                     PRK03202"
                     /db_xref="CDD:235111"
     misc_feature    order(81016..81018,81106..81108,81199..81201,81292..81300,
                     81304..81309,81358..81360,81364..81366,81370..81372,
                     81490..81498,81649..81651,81730..81732,81739..81741)
                     /locus_tag="KPHS_00750"
                     /note="active site"
                     /db_xref="CDD:238388"
     misc_feature    order(81016..81018,81106..81108,81199..81201,81292..81300,
                     81304..81309)
                     /locus_tag="KPHS_00750"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238388"
     misc_feature    order(81046..81048,81058..81060,81145..81147,81160..81162,
                     81169..81171,81388..81390,81424..81426,81436..81438,
                     81445..81447,81529..81534,81538..81540,81622..81624,
                     81766..81771,81781..81783,81802..81804,81847..81849,
                     81934..81942)
                     /locus_tag="KPHS_00750"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238388"
     misc_feature    order(81046..81048,81058..81060,81145..81150,81157..81162,
                     81445..81447,81538..81540,81544..81546,81616..81618,
                     81622..81630)
                     /locus_tag="KPHS_00750"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238388"
     misc_feature    order(81358..81360,81364..81366,81370..81372,81469..81471,
                     81490..81498,81649..81651,81712..81714,81730..81732,
                     81739..81741)
                     /locus_tag="KPHS_00750"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238388"
     gene            complement(82007..82354)
                     /locus_tag="KPHS_00760"
                     /db_xref="GeneID:11845054"
     CDS             complement(82007..82354)
                     /locus_tag="KPHS_00760"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease activity regulator protein RraA"
                     /protein_id="YP_005224376.1"
                     /db_xref="GeneID:11845054"
                     /translation="MLYDLLEQNGRGHILLIDGGGSVRRALIDADLARLAVQNEWEGL
                     VVYGAVRQVDDLEELDIGIQALAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADN
                     TGMILSEDPLDIE"
     misc_feature    complement(82016..>82351)
                     /locus_tag="KPHS_00760"
                     /note="ribonuclease activity regulator RraA family;
                     Region: RraA_family; cl00480"
                     /db_xref="CDD:320996"
     gene            complement(82585..83505)
                     /locus_tag="KPHS_00770"
                     /db_xref="GeneID:11845055"
     CDS             complement(82585..83505)
                     /locus_tag="KPHS_00770"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="YP_005224377.1"
                     /db_xref="GeneID:11845055"
                     /translation="MTDISRSQAWLESLRPKTLPLAFAAIIVGTVLAWEQGHFDPWVA
                     LLALITAGLLQILSNLANDYGDAVKGSDKPDRIGPLRGMQKGVITPQQMKRALIVTVV
                     LICLFGLALLCAAWQSVGDFIGFLALGGLSIVAAITYTVGTRPYGYIGLGDISVLVFF
                     GWLSVLGSWYLQAHNVEAAIFLPATACGLLATAVLNINNLRDIDSDRQNGKNTLAVRL
                     GPVNARRYHACLLLGALLCLALFNLLALHSAWGWLFILATPLLVKQARYVLRESDPLA
                     MRPMLEKTVKGALLTNLLFVIGIIASKLMA"
     misc_feature    complement(82612..83463)
                     /locus_tag="KPHS_00770"
                     /note="1,4-dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: menA; TIGR00751"
                     /db_xref="CDD:129834"
     misc_feature    complement(order(82888..82890,82900..82902,82909..82914,
                     83308..83310,83317..83322))
                     /locus_tag="KPHS_00770"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     gene            complement(83575..84909)
                     /locus_tag="KPHS_00780"
                     /db_xref="GeneID:11845056"
     CDS             complement(83575..84909)
                     /locus_tag="KPHS_00780"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATP-binding subunit"
                     /protein_id="YP_005224378.1"
                     /db_xref="GeneID:11845056"
                     /translation="MSEMTPREIVSELDKHIIGQDAAKRSVAIALRNRWRRMQLNEEL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDAAIKMVRMQSIDKNRYRAEELAEERVLDVLIPPAKNNWGQTEPSQEPSAARQAFR
                     KKLREGQLDDKEIEIDLAAAPMGVEIMSPPGMEEMTSQLQSMFQNLGGQKQKPRKLKI
                     KDAMKLLIEEEAAKLVNPEELKQEAIDAVEQHGIVFIDEIDKICKRGGNTSGPDVSRE
                     GVQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELK
                     ALTTHDFERILTEPNASITVQYKALMATEGVNIEFTEDGIKRIAQAAWQVNETTENIG
                     ARRLHTVLERLVEDISYDASEMNGQTVTIDAEYVSKHLDVLVADEDLSRFIL"
     misc_feature    complement(83578..84909)
                     /locus_tag="KPHS_00780"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     gene            complement(84919..85449)
                     /locus_tag="KPHS_00790"
                     /db_xref="GeneID:11845057"
     CDS             complement(84919..85449)
                     /locus_tag="KPHS_00790"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease peptidase subunit"
                     /protein_id="YP_005224379.1"
                     /db_xref="GeneID:11845057"
                     /translation="MTTIVSVRRNGHVVIAGDGQATLGNTVMKGNVKKVRRLYNDKVI
                     AGFAGGTADAFTLFELFERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADEN
                     ASLIITGNGDVVQPENDLIAIGSGGPYAQAAARALLENTDMGARDIAEKALDIAGDIC
                     IYTNHFHTIEELPSKA"
     misc_feature    complement(84934..85449)
                     /locus_tag="KPHS_00790"
                     /note="ATP-dependent protease subunit HslV; Provisional;
                     Region: PRK05456"
                     /db_xref="CDD:235477"
     misc_feature    complement(order(85075..85077,85348..85350,85390..85392,
                     85396..85398,85444..85446))
                     /locus_tag="KPHS_00790"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(84967..84969,84973..84978,84985..84987,
                     84997..84999,85030..85032,85054..85056,85063..85068,
                     85105..85107,85117..85119,85198..85200,85369..85377))
                     /locus_tag="KPHS_00790"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     gene            complement(85541..86395)
                     /locus_tag="KPHS_00800"
                     /db_xref="GeneID:11845058"
     CDS             complement(85541..86395)
                     /locus_tag="KPHS_00800"
                     /codon_start=1
                     /transl_table=11
                     /product="essential cell division protein"
                     /protein_id="YP_005224380.1"
                     /db_xref="GeneID:11845058"
                     /translation="MVAIAAAVLVAFIGGLYFITHHKKEEAEAMQNRQAAGNGLPPKP
                     EERWRYIKELESRQPGVRAPTEPTAGGEVMKPEQLTDEQRQLLAQMQADMRQQPTQLT
                     EVPWNEQTPAQRQQTLQRQRLAQQQQQAQQQQWAQTQAQTVQQQPPRVQQPKPVQQQQ
                     PKQTASNQQPYQDLLQTPAHTNTTQPRTQAAAPVTRVEEAPKTTAEKKDDRSWMIQCG
                     SFKGAEQAETVRAQLAFEGFASHITTNNGWNRVVIGPLKGKESANEMITRLKMAGHAN
                     CIRLAARG"
     misc_feature    complement(85544..86362)
                     /locus_tag="KPHS_00800"
                     /note="essential cell division protein FtsN; Provisional;
                     Region: PRK10927"
                     /db_xref="CDD:236797"
     gene            complement(86603..87631)
                     /locus_tag="KPHS_00810"
                     /db_xref="GeneID:11845059"
     CDS             complement(86603..87631)
                     /locus_tag="KPHS_00810"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional dual regulator"
                     /protein_id="YP_005224381.1"
                     /db_xref="GeneID:11845059"
                     /translation="MKPKKQVVAATMKDVALKANVSTATVSRALMNPDKVSQATRNRV
                     EQAALEVGYLPQSLGRNMKRNESRTILVIVPDICDPFFSEVIRGIEVTAAEHGYLVLI
                     GDCAHQNQKEKTFIDLIITKQIDGMVLLSSRLPFDASVEEQRNLPPMVMSNEFAPELE
                     LPTVHIDNLTAAFNAVNYLHELGHQRIGCIAGPEDMPLCHYRLQGYVQALRRSGITVD
                     PHYIARGNFTFEAGANALEQLLAQPVPPTAVFCHSDVMALGALSLAKRRGLKVPDDLS
                     IVGFDNIALSEFCDPPLTTVSQPRFDIGREGMLLLLEQMQGHNVNSGSRLLDCELIVR
                     GSTQKIRR"
     misc_feature    complement(86618..87535)
                     /locus_tag="KPHS_00810"
                     /note="DNA-binding transcriptional regulator CytR;
                     Provisional; Region: PRK11041"
                     /db_xref="CDD:182923"
     gene            87621..87752
                     /locus_tag="KPHS_00820"
                     /db_xref="GeneID:11845060"
     CDS             87621..87752
                     /locus_tag="KPHS_00820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224382.1"
                     /db_xref="GeneID:11845060"
                     /translation="MGFTWFLLAEWRWHFPWALTAASFLSDSRGSELQNFHEKRDAC"
     gene            complement(87782..89977)
                     /locus_tag="KPHS_00830"
                     /db_xref="GeneID:11845061"
     CDS             complement(87782..89977)
                     /locus_tag="KPHS_00830"
                     /codon_start=1
                     /transl_table=11
                     /product="primosome assembly protein PriA"
                     /protein_id="YP_005224383.1"
                     /db_xref="GeneID:11845061"
                     /translation="MSVAHVALPVPLPRTFDYLLPEGMAVKAGCRVRVPFGKQERIGI
                     VAAVSERSELPLDELKPVAEALDNEPVFSTTVWRLLMWAAEYYHHPIGDVLFHALPVM
                     LRQGKPASATPLWYWFATEQGQVVDLNGLKRSRKQQQALAALRQGKIWRHQVGELEFN
                     EAALQALRGKGLAELACEAPALTDWRSAYSVAGERLRLNTEQATAVGAIHSAADRFSA
                     WLLAGITGSGKTEVYLSVLENVLAQGRQALVMVPEIGLTPQTIARFRQRFNAPVEVLH
                     SGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTPFKDLGVIVIDEEHDSSYKQQEGWRY
                     HARDLAVWRAHSEQIPIILGSATPALETLHNVRQGKYRQLTLSKRAGNARPAQQHVLD
                     LKGQPLQAGLSPALISRMRQHLQADNQVILFLNRRGFAPALLCHDCGWIAECPRCDSY
                     YTLHQAQHHLRCHHCDSQRPIPRQCPSCGSTHLVPVGIGTEQLEQALAPLFPEVPISR
                     IDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGHHFPDVTLVSLLDVDGALFSAD
                     FRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLLQTLLYKGYDAFAEQALAER
                     QTMQLPPWTSHVLIRAEDHNNQQAPLFLQQLRNLLQASPLADEKLWVLGPVPALAPKR
                     GGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWVLDVDPIEG"
     misc_feature    complement(87788..89977)
                     /locus_tag="KPHS_00830"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     gene            90293..90442
                     /locus_tag="KPHS_00840"
                     /db_xref="GeneID:11845062"
     CDS             90293..90442
                     /locus_tag="KPHS_00840"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="YP_005224384.1"
                     /db_xref="GeneID:11845062"
                     /translation="MKIRSTVGHDLNLDVCGKCHPFFTGKQRDVATGGRVDRFNKRFS
                     IPGSK"
     misc_feature    <90296..90439
                     /locus_tag="KPHS_00840"
                     /note="Ribosomal protein L31; Region: Ribosomal_L31;
                     cl00377"
                     /db_xref="CDD:320940"
     gene            complement(90544..90861)
                     /locus_tag="KPHS_00850"
                     /db_xref="GeneID:11845063"
     CDS             complement(90544..90861)
                     /locus_tag="KPHS_00850"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor for methionine
                     biosynthesis"
                     /protein_id="YP_005224385.1"
                     /db_xref="GeneID:11845063"
                     /translation="MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKAIMRELGIDPDT
                     WEY"
     misc_feature    complement(90547..90861)
                     /locus_tag="KPHS_00850"
                     /note="transcriptional repressor protein MetJ;
                     Provisional; Region: PRK05264"
                     /db_xref="CDD:179982"
     misc_feature    complement(order(90649..90651,90664..90672,90676..90681,
                     90685..90690,90697..90699,90742..90744,90751..90756,
                     90760..90765,90769..90804,90823..90825,90829..90834))
                     /locus_tag="KPHS_00850"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(90697..90705,90739..90741,90778..90780,
                     90784..90798,90808..90810))
                     /locus_tag="KPHS_00850"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(90646..90651,90658..90660,90664..90672,
                     90676..90684,90691..90693,90730..90735,90742..90744))
                     /locus_tag="KPHS_00850"
                     /note="corepressor binding sites; other site"
                     /db_xref="CDD:119402"
     gene            91129..92289
                     /locus_tag="KPHS_00860"
                     /db_xref="GeneID:11845064"
     CDS             91129..92289
                     /locus_tag="KPHS_00860"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="YP_005224386.1"
                     /db_xref="GeneID:11845064"
                     /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAH
                     DYSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAILLVTTVFLKPGDLLVAPHDCYG
                     GSYRLFDSLAKRGCYRVQFVDQSDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKIC
                     GLAREAGAISVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPTT
                     VTELAWWANNIGVTGSAFDSYLLLRGLRTLSPRMEVAQRNALAIVEYLKTQPLVKKLY
                     HPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLSGLSLFTLAESLGGVESLI
                     SHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAANEE"
     misc_feature    91129..92286
                     /locus_tag="KPHS_00860"
                     /note="cystathionine gamma-synthase; Provisional; Region:
                     PRK08045"
                     /db_xref="CDD:169194"
     gene            92292..94724
                     /locus_tag="KPHS_00870"
                     /db_xref="GeneID:11845065"
     CDS             92292..94724
                     /locus_tag="KPHS_00870"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II"
                     /protein_id="YP_005224387.1"
                     /db_xref="GeneID:11845065"
                     /translation="MSVIAQAGAKGRQLHKFGGSSLADAKCYLRVAGIMKEYSQAGDM
                     MVVSAAGSTTNQLISWLKLSQSDRLAAHQVQQSLRRYHTELIGGLLEPAAADTLIAAF
                     IHDLERLAGLLDGGVSEAVYAEVVGHGEVWSARLMAAVLNQLGMEAAWLDARAFLRAE
                     RAAQPQVDEGLSYPLLQQLMAQHPNKRLVVTGFISRNQAGETVLLGRNGSDYSATQIG
                     ALAGASRVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPV
                     SASDIDLQLRCSYTPEQGSTRIERVLASGTGARIVTSHDDVCLVEFQVPAGHDFKLAH
                     KELDALLKRAQLRPLAVGVHADRKLLQFCYTSEVADSALKLLDEAGLPGELRLRQKLA
                     LVAMVGAGVTRNPLHCHRFWQQLKGQPVEFTWQSEEGISLVAVLRAGPTESLIQGLHQ
                     SLFRAEKRIGLMLFGKGNIGSRWLELFAREQTTLSARTGFEFILAGVVDSKRSLLNYD
                     GLDASRALAFFNDEAVEQDEESLFLWMRAHPYDDLVVLDVTASEQLADQYLDFASHGF
                     HVISANKLAGASSSDKYRQIHDAFEKTGRHWLYNATVGAGLPVNHTVRDLIDSGDTIL
                     GLSGIFSGTLSWLFLQFDGTVPFTDLVDQAWQQGLTEPDPRVDLSGKDVMRKLVILAR
                     EAGYDIEPDQVRVESLVPAHCEEGSVDHFFENGEELNEQMLQRLEAAREMGLVLRYVA
                     RFDANGKARVGVEAVREEHPLAALLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGA
                     IQSDINRLAQLL"
     misc_feature    92292..94721
                     /locus_tag="KPHS_00870"
                     /note="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II; Provisional; Region: metL; PRK09466"
                     /db_xref="CDD:236530"
     gene            complement(94699..95835)
                     /locus_tag="KPHS_00880"
                     /db_xref="GeneID:11845066"
     CDS             complement(94699..95835)
                     /locus_tag="KPHS_00880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224388.1"
                     /db_xref="GeneID:11845066"
                     /translation="MDTLFTINACKTFGCRNLGLPSAAEYHFPNFRLGYPALYCAACG
                     SYPPLFNEREFRPWLAAYLTDHARRYGYFCPVCYQRDIIRYGRNPQGTQRLQCRHCKK
                     VWTPKFPHIAPIEAPRRICSVPLIALFQGNAAGQKLYFLLSFDAVRGNVIHLTSNFTP
                     FAVGESLRYHWRGGQADREETDDIIQRISLTEMRFLQRSQFDEIQYGSAMQKRHARGN
                     ILRPVIAAHGHFKLLSQRFPEVKTHVIAHECFLRGAAIVAWAPLFRQRQGDLWYVEEE
                     IRNPASPAPWQLQGKTHHGWWQNSWQRWTQEENQKMVCRLAGTAEENAFLPDLAASRR
                     FTIWLKNRPAFAQSALYSAGRVTQIVVSLVQEYNATLTAAAPGG"
     misc_feature    complement(95533..95616)
                     /locus_tag="KPHS_00880"
                     /note="InsA N-terminal domain; Region: Zn_Tnp_IS1;
                     pfam03811"
                     /db_xref="CDD:281762"
     gene            95974..97530
                     /locus_tag="KPHS_00890"
                     /db_xref="GeneID:11845067"
     CDS             95974..97530
                     /locus_tag="KPHS_00890"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional metallophosphatase/5'-nucleotidase"
                     /protein_id="YP_005224389.1"
                     /db_xref="GeneID:11845067"
                     /translation="MKLKTMSAALLLTLPFWACAKDVTIIYTNDLHAHVEPYKVPWIA
                     DGKRDIGGWANITTMVKQEKAKNNATWFFDAGDYFSGPYISSLTKGKAIIDIMNTMSY
                     DAVTIGNHEFDHGWDNTLLQLSQATFPIVQGNIFYQNSDKSFWDKPYTIIEKDGVKIG
                     VIGLHGVFAFNDTVSAATRVGIEARDEVKWLQHYIDELNGKVDLTVALIHEGVPARQS
                     SQGGTDVRRALDKDIQTAGQVKSLDVLITGHAHVGTPEPIKVGNTLILSTDSGGIDVG
                     KLVLDYQEKPHQFTVKHFELKTLYADEWKPDPQTKQVIDGWNKQLDQLVQQVITQSPV
                     ELTRAYGISSPLGNLAADALLLAAGRSTQMALTNSGGIRNEIPAGAVSMGAVISTFPF
                     PNELVTMDLTGKQLRSLMEHGAGLSNGVLQVSRGLEMMYDSSKPVGQRVVLFRLNGKP
                     IDDTTVYHIATNSFLADGGDGFVAFTEGQARNTSGGYYVSNAVVDYFKAGQKITDEQL
                     NGQRVVDVKK"
     misc_feature    95974..97488
                     /locus_tag="KPHS_00890"
                     /note="2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or
                     3'-nucleotidase, 5'-nucleotidase family [Nucleotide
                     transport and metabolism, Defense mechanisms]; Region:
                     UshA; COG0737"
                     /db_xref="CDD:223808"
     gene            complement(97568..97939)
                     /locus_tag="KPHS_00900"
                     /db_xref="GeneID:11845068"
     CDS             complement(97568..97939)
                     /locus_tag="KPHS_00900"
                     /codon_start=1
                     /transl_table=11
                     /product="putative gamma-carboxymuconolactone
                     decarboxylase subunit"
                     /protein_id="YP_005224390.1"
                     /db_xref="GeneID:11845068"
                     /translation="MSSERYIIGQEMLQRVDGKGGEAVVDSLRDIAPDFARYLIEFPF
                     GDIYARPGLDLRSREIATIAALTALGNAEPQLKVHIAAGLNVGLTQEEITEAIMQMAV
                     YAGFPAALNGLFAARAVFAAH"
     misc_feature    complement(97574..97930)
                     /locus_tag="KPHS_00900"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; cl00460"
                     /db_xref="CDD:320985"
     gene            98031..98939
                     /locus_tag="KPHS_00910"
                     /db_xref="GeneID:11845069"
     CDS             98031..98939
                     /locus_tag="KPHS_00910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LysR-family transcriptional regulator"
                     /protein_id="YP_005224391.1"
                     /db_xref="GeneID:11845069"
                     /translation="MTTSRLHSLDIRLLRAFAVVAEENNISRAAQRLFISQPPLTRHI
                     RHLEAQLGVTLFQRHSKGLILTDAGKEVLEMIQPLLALQERTLAALSELAVHSPQALR
                     LGVTTAFEQGIFAAVEAALSEHTRALHITRHASPALAQQVRKGKLDAALVALPLNTEG
                     LHLHPLPYHEPLIAALPASWPEAGRPGLTLSALNHRPLFWFKRERNPGFFDYTRRIFD
                     RAGYAPTYVEEPAEHDVLLARIARGEGMILLPASFSAIQRQGVAFCPVAEGDAMPLSL
                     GVIYPPHQAESVQQWLSLLDGILATG"
     misc_feature    98043..98915
                     /locus_tag="KPHS_00910"
                     /note="DNA-binding transcriptional activator XapR;
                     Provisional; Region: PRK09986"
                     /db_xref="CDD:182183"
     gene            99168..100055
                     /locus_tag="KPHS_00920"
                     /db_xref="GeneID:11845070"
     CDS             99168..100055
                     /locus_tag="KPHS_00920"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_005224392.1"
                     /db_xref="GeneID:11845070"
                     /translation="MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWKS
                     IDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASRDELRTI
                     AQDYWNNGIRHIVALRGDLPPGSGKPDMYAADLVTLLKEVGDFDISVAAYPEVHPEAK
                     SAQADLLNLKRKVEAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFK
                     QAKKFADMTNVRIPVWMSKMFEGLDNDAETRQLVGANIAMDMVKILSREGVKDFHFYT
                     LNRAEMSYAICHTLGVRPA"
     misc_feature    99168..100049
                     /locus_tag="KPHS_00920"
                     /note="5,10-methylenetetrahydrofolate reductase;
                     Provisional; Region: metF; PRK09432"
                     /db_xref="CDD:181852"
     misc_feature    order(99345..99347,99429..99431,99516..99524,99558..99563,
                     99615..99617,99621..99623,99633..99635,99639..99641,
                     99660..99662,99669..99671,99678..99683,99708..99710,
                     99714..99716,99990..99992)
                     /locus_tag="KPHS_00920"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            100199..101080
                     /locus_tag="KPHS_00930"
                     /db_xref="GeneID:11845071"
     CDS             100199..101080
                     /locus_tag="KPHS_00930"
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="YP_005224393.1"
                     /db_xref="GeneID:11845071"
                     /translation="MARKSDPLAFGGLALLTLIWSFSWIAMKQVTSYIGAFDFTALRC
                     IFGAVVLWIVMLIRGKALKPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
                     TMPFWVVVMAALFLGERMRRWQYIAIGVACVGLILVLQPWQLDFTSLKSALLAILSGV
                     SWGAGAIVAKRMYTRYPQVDLLALTTWQMLYAAVVMSVVAWLVPQRAVDWQPDVFWAL
                     AYSAILATALAWSLWLFVLRNLPASIAGLSTLAVPVCGVLFSWWPLHENPGKVEGCGI
                     ALIVLALAMISIKRRGA"
     misc_feature    100205..101071
                     /locus_tag="KPHS_00930"
                     /note="Permease of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism, Amino
                     acid transport and metabolism, General function prediction
                     only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     gene            complement(101144..102247)
                     /locus_tag="KPHS_00940"
                     /db_xref="GeneID:11845072"
     CDS             complement(101144..102247)
                     /locus_tag="KPHS_00940"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol dehydrogenase"
                     /protein_id="YP_005224394.1"
                     /db_xref="GeneID:11845072"
                     /translation="MDRIIQSPGKYIQGAGAIKRLGDYLKPLAERWLVVGDKFVLGFA
                     EEMLRKSLADAGLAAEIAPFGGECSHNEINRLRDIAGNAKCTAVLGIGGGKTLDTAKA
                     LAHFMNVPVAIAPTIASTDAPCSALSVIYTDEGEFDSYLMLPRNPNMVIVDTQIVAGA
                     PARLLAAGIGDALATWFEARACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAM
                     LAAEQHVVTPALERVVEANTYLSGVGFESGGLAAAHAIHNGMTAIPDAHHYYHGEKVA
                     FGTLTQLVLENAPVDEIETVAALCHSVGLPITLAQLDIKGDIPTKMRLVAEAACAEGE
                     TIHNMPGGVDSDQVYAALLVADQYGQRFLQEWE"
     misc_feature    complement(101150..102247)
                     /locus_tag="KPHS_00940"
                     /note="glycerol dehydrogenase; Provisional; Region: gldA;
                     PRK09423"
                     /db_xref="CDD:181843"
     misc_feature    complement(order(101543..101545,101552..101557,
                     101624..101626,101633..101635,102206..102211,
                     102215..102223))
                     /locus_tag="KPHS_00940"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:341449"
     misc_feature    complement(order(101435..101437,101474..101476,
                     101486..101488,101723..101725,101735..101737,
                     101756..101758,101780..101782,101831..101836,
                     101891..101893,101897..101902,101945..101947,
                     101954..101956,101963..101971,102137..102139))
                     /locus_tag="KPHS_00940"
                     /note="active site"
                     /db_xref="CDD:341449"
     misc_feature    complement(order(101435..101437,101486..101488,
                     101735..101737))
                     /locus_tag="KPHS_00940"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:341449"
     gene            complement(102302..102964)
                     /locus_tag="KPHS_00950"
                     /db_xref="GeneID:11845073"
     CDS             complement(102302..102964)
                     /locus_tag="KPHS_00950"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-6-phosphate aldolase"
                     /protein_id="YP_005224395.1"
                     /db_xref="GeneID:11845073"
                     /translation="MELYLDTANVAEVERLARIYPLAGVTTNPSIIAAGKVPVWDVLP
                     RLQKAVGPKGTLFAQTMSRDAQGMVEEAKRLSNSVPGIVVKIPVTAEGLAAIKLLKKE
                     GIPTLGTAVYSASQGLLAALAGAKYVAPYVNRVDAQGGDGIRMVQELQSLLEMHAPES
                     KVLAASFKTPRQALDCLLAGCEAITLPLDVAQQMLGTPAVESAIEKFEQDWNNAFGTL
                     NL"
     misc_feature    complement(102305..102964)
                     /locus_tag="KPHS_00950"
                     /note="fructose-6-phosphate aldolase; Reviewed; Region:
                     PRK12655"
                     /db_xref="CDD:183655"
     misc_feature    complement(order(102470..102472,102572..102574,
                     102710..102712,102881..102886,102947..102949))
                     /locus_tag="KPHS_00950"
                     /note="active site"
                     /db_xref="CDD:188643"
     misc_feature    complement(order(102332..102337,102341..102346,
                     102356..102358,102365..102370,102374..102376,
                     102422..102424,102431..102436,102452..102454,
                     102458..102460,102497..102502,102551..102553,
                     102557..102559,102566..102568,102572..102574,
                     102617..102619,102674..102676,102683..102688,
                     102692..102694,102752..102754,102770..102772,
                     102788..102790,102848..102850,102860..102862,
                     102866..102868,102875..102880,102905..102907,
                     102914..102916))
                     /locus_tag="KPHS_00950"
                     /note="intersubunit interactions; other site"
                     /db_xref="CDD:188643"
     misc_feature    complement(102710..102712)
                     /locus_tag="KPHS_00950"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188643"
     gene            complement(103170..104156)
                     /locus_tag="KPHS_00960"
                     /db_xref="GeneID:11845074"
     CDS             complement(103170..104156)
                     /locus_tag="KPHS_00960"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="YP_005224396.1"
                     /db_xref="GeneID:11845074"
                     /translation="MATNCYDITYLIWEARATGKRFYRWNNVRYDEKGDALNGRMMDN
                     DINQLIDALLKKQTSLGRVYFAGETRSPAEPVVQVDFPRLNILLDGQLPDQALGDNAP
                     LLEAHDVLYIPGDSWNCPQWQAPCLLLSILFAKQQLECSLQHWNGKAITVVDKRQALR
                     RGPRVGSFLLQALNELRMQPQEQQTARSIVVSLLSHCHDLLGSQAQTSSRSQALFEAI
                     RQYMDIHYAEPLSRESVAQAFYLSPNYLSHLFQKCGPMGFNEYLNHIRLEQARMLLKG
                     HDMKVKDIAHACGFADSNYFCRLFRKTTERSPSEYRRQYHSQLTEKASPVKN"
     misc_feature    complement(103206..103550)
                     /locus_tag="KPHS_00960"
                     /note="AraC-type DNA-binding domain and AraC-containing
                     proteins [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     gene            104181..104831
                     /locus_tag="KPHS_00970"
                     /db_xref="GeneID:11845075"
     CDS             104181..104831
                     /locus_tag="KPHS_00970"
                     /codon_start=1
                     /transl_table=11
                     /product="metal-binding protein ZinT"
                     /protein_id="YP_005224397.1"
                     /db_xref="GeneID:11845075"
                     /translation="MTRKIPLLALGFGMALASAQAFAHGNHSHGPALTEVERQASEGI
                     FADKDVQDRALSDWEGVWQSVNPYLLNGDLDPVLEQKAKKPGGKSVEEYRAYYKKGYA
                     TDVEQIGIEDDVIEFHVGQTVNSCKYRYSGYKILHYASGKKGVRYLFECQQGDANAPK
                     FVQFSDHIIDPRKSQHFHIFMGNESQEALLKEMDNWPTYYPYALHKEQIVDEMLHH"
     misc_feature    104181..104828
                     /locus_tag="KPHS_00970"
                     /note="zinc/cadmium-binding protein; Provisional; Region:
                     PRK10306"
                     /db_xref="CDD:182368"
     gene            complement(104875..107526)
                     /locus_tag="KPHS_00980"
                     /db_xref="GeneID:11845076"
     CDS             complement(104875..107526)
                     /locus_tag="KPHS_00980"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="YP_005224398.1"
                     /db_xref="GeneID:11845076"
                     /translation="MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKS
                     SRAGNEANRQELLTTLQNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPE
                     VIARTLRKLKDQPNLNEETIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQ
                     LDNKDIADYEHHQLMRRLRQLIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVP
                     NYLRELNEQLEANLGYQLPVDFVPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKAT
                     DLFLKDVQVLISELSMVECTDELRALAGAEGAQEPYRYLMKKLRSQLMETQAWLEARL
                     KGQKLPKPAGLITQNEQLWEPLYACYKSLQACGMGIIANGELLDTLRRVKSFGVPLVR
                     IDIRQESTRHTEALGEMTRYLGIGDYESWSEADKQAFLIRELNSKRPLLPRQWEPSEE
                     TREVLDTCKVIAEAPRGSIAAYVISMAKTPSDVLAVHLLLKEAGIGFALPVAPLFETL
                     DDLNNANDVMTQLLNIDWYRGFIQGKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIK
                     TCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKYGLP
                     EVTISSLSLYTSAILEANLLPPPEPKAEWRDIMAELSDVSCKMYRGYVRENKDFVPYF
                     RSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFAWTQNRLMLPAWLGAGAALQK
                     VVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAEYYDQRLVKPELWALGSEL
                     RKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLNVLQAELLHRSRQAEEE
                     GKDPDPRVEQALMVTIAGVAAGMRNTG"
     misc_feature    complement(104878..107526)
                     /locus_tag="KPHS_00980"
                     /note="phosphoenolpyruvate carboxylase; Reviewed; Region:
                     PRK00009"
                     /db_xref="CDD:234570"
     gene            complement(107785..108936)
                     /locus_tag="KPHS_00990"
                     /db_xref="GeneID:11845077"
     CDS             complement(107785..108936)
                     /locus_tag="KPHS_00990"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="YP_005224399.1"
                     /db_xref="GeneID:11845077"
                     /translation="MKNNLPPFIEIYRALIATPSISATEEALDQSNESLINLLAGWFR
                     DLGFNVEVQPVPDTRHKFNLLASTGHGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHD
                     NKLYGLGTADMKGFFAFILDALRDVDVTTLKKPLYILATADEETSMAGARYFAETTQL
                     RPDCAIIGEPTSLQPIRAHKGHMSNAIRIQGQSGHSSDPARGVNAIELMHDAIGRIMQ
                     LRDLLKERYHFEAFTVPYPTLNLGAIHGGDASNRICACCELHMDIRPLPGMTLNDLNG
                     LLGEALAPVSERWPGRLTFSELHPPIPGYECPPDHKLVQVVEKLLGAQTDVVNYCTEA
                     PFIQTLCPTLVLGPGSINQAHQPDEFLETRFIKPTRELISQVVHHFCWH"
     misc_feature    complement(107788..108933)
                     /locus_tag="KPHS_00990"
                     /note="acetylornithine deacetylase; Provisional; Region:
                     PRK05111"
                     /db_xref="CDD:235346"
     gene            109050..110054
                     /locus_tag="KPHS_01000"
                     /db_xref="GeneID:11845078"
     CDS             109050..110054
                     /locus_tag="KPHS_01000"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="YP_005224400.1"
                     /db_xref="GeneID:11845078"
                     /translation="MLNTLIVGASGYAGAELVTYINRHPHMNITALTVSAQSNDAGKL
                     ISDLHPQLKGIVDMPLQPMSDISEFSAGVDVVFLATAHEVSHDLAPQFLAAGCVVFDL
                     SGAFRVNDGAFYEKYYGFTHQHPELLKQAVYGLAEWSADALKEAQLIAVPGCYPTAAQ
                     LSLKPLIDAGLLDLNQWPVINATSGVSGAGRKAAIGNSFCEVSLQPYGIFNHRHQPEI
                     ASHLGAKVIFTPHLGNFKRGILETITCRLKPGVGHAQIAAVYQQAYADKPLVRLYDKG
                     VPAVKSVEGLPFCDIGFAVQDDHLIVVAAEDNLLKGAAAQAVQCANIRFGFAETQSLI
                     "
     misc_feature    109050..110048
                     /locus_tag="KPHS_01000"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Validated; Region: argC; PRK00436"
                     /db_xref="CDD:234761"
     gene            110064..110837
                     /locus_tag="KPHS_01010"
                     /db_xref="GeneID:11845079"
     CDS             110064..110837
                     /locus_tag="KPHS_01010"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="YP_005224401.1"
                     /db_xref="GeneID:11845079"
                     /translation="MNPLIIKLGGVLLDSEEALERLFTALVNYREAHQRPLIIVHGGG
                     CVVDELMKQLNLPVQKKNGLRVTPAEQIDIITGALAGTANKTLLAWAKKHGLASVGLF
                     LGDGDSVKVTQLDAELGHVGLAQPGSPTLINTLLAGGYLPVVSSIGVTDEGQLMNVNA
                     DQAATALAATLGADLILLSDVSGILDGKGQRIAEMTAEKAEQLIEQGIITDGMIVKVN
                     AALDAARALGRPVDIASWRHAEQLPALFNGTPIGTRILA"
     misc_feature    110073..110828
                     /locus_tag="KPHS_01010"
                     /note="N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC)
                     catalyzes the phosphorylation of the gamma-COOH group of
                     N-acetyl-L-glutamate (NAG) by ATP in the second step of
                     microbial arginine biosynthesis using the acetylated,
                     noncyclic route of ornithine...; Region: AAK_NAGK-NC;
                     cd04249"
                     /db_xref="CDD:239782"
     misc_feature    order(110082..110084,110088..110093,110190..110195,
                     110598..110600,110616..110618,110685..110687,
                     110691..110693,110709..110711)
                     /locus_tag="KPHS_01010"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239782"
     misc_feature    order(110190..110195,110256..110258,110532..110537,
                     110541..110543)
                     /locus_tag="KPHS_01010"
                     /note="N-acetyl-L-glutamate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239782"
     gene            110937..112310
                     /locus_tag="KPHS_01020"
                     /db_xref="GeneID:11845080"
     CDS             110937..112310
                     /locus_tag="KPHS_01020"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="YP_005224402.1"
                     /db_xref="GeneID:11845080"
                     /translation="MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKAL
                     VTVGVLSAAEQQQLEEALNVLLEEVRANPQQILASDAEDIHSWVEGKLIDKVGQLGKK
                     LHTGRSRNDQVATDLKLWCKDTVVELLSANRQLQSALVETAQQNQDAVMPGYTHLQRA
                     QPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGF
                     ASATRNSLDSVSDRDHVLELLSDAAIGMVHLSRFAEDLIFFNSGEANFVELSDRVTSG
                     SSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDT
                     WLDCLHMAALVLDGIQVKRPRCAEAAQQGYANATELADYLVAKGVPFREAHHIVGEAV
                     VEAIAQGKPLEALTLADLQKFSPVIADDVYPILSLQSCLEKRAAKGGVSPQQVAQAIN
                     EAKARLS"
     misc_feature    110937..112301
                     /locus_tag="KPHS_01020"
                     /note="argininosuccinate lyase; Provisional; Region:
                     PRK04833"
                     /db_xref="CDD:179883"
     gene            112569..113486
                     /locus_tag="KPHS_01030"
                     /db_xref="GeneID:11845081"
     CDS             112569..113486
                     /locus_tag="KPHS_01030"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator OxyR"
                     /protein_id="YP_005224403.1"
                     /db_xref="GeneID:11845081"
                     /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     VMLLERTSRKVLFTQAGLLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTIG
                     PYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILALVKESEAFIEVPL
                     FDEPMMLAIYEDHPWANRDRVPMSDLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPALAVPQERKRDGVVYLPCIKPEPRRTIGLVYRPGS
                     PLRSRYEHLAEAIRGTMDGHFDKALKQAV"
     misc_feature    112569..113483
                     /locus_tag="KPHS_01030"
                     /note="DNA-binding transcriptional regulator OxyR;
                     Provisional; Region: PRK11151"
                     /db_xref="CDD:182999"
     gene            complement(113469..114803)
                     /locus_tag="KPHS_01040"
                     /db_xref="GeneID:11845082"
     CDS             complement(113469..114803)
                     /locus_tag="KPHS_01040"
                     /codon_start=1
                     /transl_table=11
                     /product="soluble pyridine nucleotide transhydrogenase"
                     /protein_id="YP_005224404.1"
                     /db_xref="GeneID:11845082"
                     /translation="MGLVKQGARVAVIERYHNVGGGCTHWGTIPSKALRHAVSRIIEF
                     NQNPLYSDHSRLLRSSFADILNHADSVINQQTHMRQGFYERNHCEILQGNAHFVDEHT
                     LALECHDGTVETVTAEKFVIACGSRPYHPADVDFHHPRIYDSDSILSLQHEPRHVIIY
                     GAGVIGCEYASIFRGMEVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
                     EKIEGVDDGVIMHLKSGKKLKADCLLYANGRTGNTDTLALENIGLQTDSRGQLKVNSM
                     YQTALPHIYAVGDVIGYPSLASAAYDQGRIAAQALVKGEASAHLIEDIPTGIYTIPEI
                     SSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMSVGTLKILFHRETKEILGIHCFG
                     ERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF"
     misc_feature    complement(113472..114803)
                     /locus_tag="KPHS_01040"
                     /note="soluble pyridine nucleotide transhydrogenase;
                     Provisional; Region: PRK05249"
                     /db_xref="CDD:235373"
     gene            115066..115701
                     /locus_tag="KPHS_01050"
                     /db_xref="GeneID:11845083"
     CDS             115066..115701
                     /locus_tag="KPHS_01050"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid biosynthesis regulator"
                     /protein_id="YP_005224405.1"
                     /db_xref="GeneID:11845083"
                     /translation="MMGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGI
                     APTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGN
                     NPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRAFTEAQAEAMVT
                     IVFSAGAEALDVGPEQRRQLEERLVLQLRMISKGAYYWYRREQEKMSHHSE"
     misc_feature    115066..115668
                     /locus_tag="KPHS_01050"
                     /note="DNA-binding transcriptional repressor FabR;
                     Provisional; Region: PRK11202"
                     /db_xref="CDD:236881"
     gene            115717..116076
                     /locus_tag="KPHS_01060"
                     /db_xref="GeneID:11845084"
     CDS             115717..116076
                     /locus_tag="KPHS_01060"
                     /codon_start=1
                     /transl_table=11
                     /product="YijD family membrane protein"
                     /protein_id="YP_005224406.1"
                     /db_xref="GeneID:11845084"
                     /translation="MKHSVQDKGTLLLALIAGLSINGAFAALFSSIVPFSVFPILSLL
                     LTVYCLHQRYQNRSMPVGLPGLAAAFFILGVLLYSTVVRAEYPDIGSNFFPAVLSVAM
                     VFWIGYKMRNRKDTAAE"
     misc_feature    115717..116073
                     /locus_tag="KPHS_01060"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11056"
                     /db_xref="CDD:236832"
     gene            complement(116128..117228)
                     /locus_tag="KPHS_01070"
                     /db_xref="GeneID:11845085"
     CDS             complement(116128..117228)
                     /locus_tag="KPHS_01070"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="YP_005224407.1"
                     /db_xref="GeneID:11845085"
                     /translation="MTPEHLPTEQYEAQLAEKVVRLQTMMAPFAAPVPEVFRSPVSHY
                     RMRAEFRLWHDGDDLYHIIFDQQTRSRIRVDSFPAASALINQLMTAMLEGVRNNPVLR
                     QKLFQIDYLTTLSNQAVVSLLYHKKLDDAWREQAEALRDALRAQGLNVHLIGRATKTK
                     IELDQDYIDERLPVGGREMIYRQVENSFTQPNAAMNIQMLEWALDVTKGATGDLLELY
                     CGNGNFSLALARNFDRVLATEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNG
                     VRQFNRLQGIDLHSYQCETIFVDPPRSGLDSETEKMVQAYPRILYISCNPETLCRNLE
                     TLSQTHNVTRLALFDQFPYTHHMECGVLLTRK"
     misc_feature    complement(116131..117228)
                     /locus_tag="KPHS_01070"
                     /note="tRNA (uracil-5-)-methyltransferase; Validated;
                     Region: PRK05031"
                     /db_xref="CDD:235332"
     gene            117595..119433
                     /locus_tag="KPHS_01080"
                     /db_xref="GeneID:11845086"
     CDS             117595..119433
                     /locus_tag="KPHS_01080"
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12/cobalamin outer membrane
                     transporter"
                     /protein_id="YP_005224408.1"
                     /db_xref="GeneID:11845086"
                     /translation="MIKKASLMTALSVTAFSGWAQDSNSDTLVVTANRFQQPVNTVLA
                     PTDIVTRDDIDRWQSKDLNDVMRRLPGVDISRNGGMGQSASLYVRGTEARHVLVLIDG
                     VPMARPGISNGVDISQIPISLVQRVEYIRGPRSAVYGSGAIGGVVNIITMTDAERSQI
                     NAGAGTNGYQSYDGAFNKRFGDTLVTAAGAYQTTKGFNVQPNSSYSGDSDRDGYRNKM
                     LWGGVQHQFDDNFSGFFRGYGYSANADYDQGNWGYAGGNDEDQSYTQSWDTGLHYHSG
                     IYSSQLIANYQRIKDYNYSSDAGRYAAGTTLDDMEQRYIQWGNNVVVGHGAVSGGVDW
                     KQEKLKSSGTTSTDVYKRDTTGLYLTGQQQIDSVTLEASGREDHDEQFGWHGTWQTAA
                     GWEFIDGYRTTLSYGTGFLAPSLGQQYGAERFGIASNPNLKPEESKQWEAGLEGLTGP
                     VDWRLSAYRYEIQNLIDYDNNAYYNVKSATIKGLEWTGNITTGPVEHHLTLQYVDPRD
                     DETNKILYRRAKQQVKYELNGQVYDLGWDVTYHYIGKRYDYDYDNSRTVNMGGLSLWD
                     VGLSYPVTSHLTVRGKIANLFDKDYETVYGYQSAGREYTLSGSYTF"
     misc_feature    117595..119430
                     /locus_tag="KPHS_01080"
                     /note="vitamin B12/cobalamin outer membrane transporter;
                     Provisional; Region: btuB; PRK10641"
                     /db_xref="CDD:236730"
     gene            119447..120229
                     /locus_tag="KPHS_01090"
                     /db_xref="GeneID:11845087"
     CDS             119447..120229
                     /locus_tag="KPHS_01090"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_005224409.1"
                     /db_xref="GeneID:11845087"
                     /translation="MLVFDSGVGGLSVYNEIRQLLPNLHYIYAFDNVAFPYGEKSEEF
                     IVERVVEIVTAVQQRYPLALAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLT
                     ANGIVGLLATRGTVKRPYTRELIDRFANECRIEMLGSAELVELAEAKLHGEPVPLEEL
                     RRILRPWLRMQEPPDTVVLGCTHFPLLQEELQRVLPEGTRLIDSGAAIARRTAWLLEH
                     EAPDAKSSDENKAFCMALTAETEQLLPVLRRYGFSTLEKLPL"
     misc_feature    119450..120220
                     /locus_tag="KPHS_01090"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            120633..122159
                     /locus_tag="KPHS_r00220"
                     /db_xref="GeneID:11845088"
     rRNA            120633..122159
                     /locus_tag="KPHS_r00220"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11845088"
     gene            122594..125492
                     /locus_tag="KPHS_r00140"
                     /db_xref="GeneID:11845089"
     rRNA            122594..125492
                     /locus_tag="KPHS_r00140"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11845089"
     gene            125591..125705
                     /locus_tag="KPHS_r00050"
                     /db_xref="GeneID:11845090"
     rRNA            125591..125705
                     /locus_tag="KPHS_r00050"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11845090"
     gene            complement(126077..126898)
                     /locus_tag="KPHS_01100"
                     /db_xref="GeneID:11845091"
     CDS             complement(126077..126898)
                     /locus_tag="KPHS_01100"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator HdfR"
                     /protein_id="YP_005224410.1"
                     /db_xref="GeneID:11845091"
                     /translation="MDTELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLENQLG
                     VNLFTRHRNNIRLTTAGEKLLPYAETLMNTWQAARKEVAHSSRHNEFSIGASASLWEC
                     MLNSWLGTLYSAPYNLQFEARIAQRQSLVKQLHERQLDLLITTESPKMDELSSQLLGN
                     FTLALYCASPAKNRNELNYLRLEWGPDFQQNEVGLIGSDDVPLLTTSSAELIYQQLSR
                     LNGCCWLPARWAKEKHGLHTVMDSATLSRPLYAIWLQNSDKQAQIHEILKNPILE"
     misc_feature    complement(126080..126898)
                     /locus_tag="KPHS_01100"
                     /note="transcriptional regulator HdfR; Provisional;
                     Region: PRK03601"
                     /db_xref="CDD:235137"
     gene            127017..127355
                     /locus_tag="KPHS_01110"
                     /db_xref="GeneID:11845092"
     CDS             127017..127355
                     /locus_tag="KPHS_01110"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF413 domain-containing protein"
                     /protein_id="YP_005224411.1"
                     /db_xref="GeneID:11845092"
                     /translation="MAESFTTTNRFFDNKNYPRGFSRHGDFTIKEAQLLERHGYAFNE
                     LELGKREPVTEDEKQFVSVCRGEREPVTEAERVWIKYMARIKRPKRFHTLSGGKPQME
                     GADDYTESDD"
     misc_feature    127017..127352
                     /locus_tag="KPHS_01110"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11027"
                     /db_xref="CDD:236825"
     gene            complement(127380..128900)
                     /locus_tag="KPHS_01120"
                     /db_xref="GeneID:11845093"
     CDS             complement(127380..128900)
                     /locus_tag="KPHS_01120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-component regulator"
                     /protein_id="YP_005224412.1"
                     /db_xref="GeneID:11845093"
                     /translation="MSLAIVYTRAALGIEAPLITVEVHLSNGLPGLTMVGLPETTVKE
                     ARDRVRSALINSGYAFPAKKITINLAPADLPKEGGRYDLPIALALLVASEQLNTTRLN
                     QYEFVGELALTGGLRGVPGAIPSAMEAIKAGRRIVVSSDNAAEVGLIGGSDCLVADHL
                     QEVCAFLAGQTSLSPPLAEAPARDERYEDLLDVIGQQQGKRALEIVAAGGHNLLLIGP
                     PGTGKTMLASRLPGLLPPLSNQEALESAAIQSLVNLHTAKTRWRQRPFRAPHHSASLA
                     AMVGGGSIPVPGEISLAHNGVLFLDELPEFERRVLDALREPIESGKIHISRSRAKIDY
                     PARFQLIAAMNPSPTGHYQGKHNRASPEQTLRYLGRLSGPFLDRFDLSLEIPLPPPGI
                     LSQGSQGEESSATVRQRVLAARERQMLRQNKLNAHLENREMKNCCRLRREDAVWLEQT
                     LTQLGLSIRAWQRLLKVARTIADLAEVEEIERCHLQEALSYRAIDRMLNHLQKMMA"
     misc_feature    complement(127383..128900)
                     /locus_tag="KPHS_01120"
                     /note="putative ATP-dependent protease; Provisional;
                     Region: PRK09862"
                     /db_xref="CDD:182120"
     gene            complement(129103..129234)
                     /locus_tag="KPHS_01130"
                     /db_xref="GeneID:11845094"
     CDS             complement(129103..129234)
                     /locus_tag="KPHS_01130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224413.1"
                     /db_xref="GeneID:11845094"
                     /translation="MFEGIPKELPQTSHKAQDFFISSLLISLTVSIKIIVLYEKNQK"
     gene            129494..131140
                     /locus_tag="KPHS_01140"
                     /db_xref="GeneID:11845095"
     CDS             129494..131140
                     /locus_tag="KPHS_01140"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 2 catalytic subunit"
                     /protein_id="YP_005224414.1"
                     /db_xref="GeneID:11845095"
                     /translation="MNGAQWVVHALRTQGVDTVFGYPGGAIMPVYDALYDGGVEHLLC
                     RHEQGAAMAAIGYARATGKTGVCIATSGPGATNLITGLADALLDSIPIVAITGQVAAP
                     FIGTDAFQEVDVLGLSLACTKHSFLVQSLDELPRVIAEAFQVANSGRPGPVLVDIPKD
                     IQMAQGDLDPHFSTVADEMAFPQAEVAQALQMLAQSQQPMLYVGGGVGMAQAVPALRE
                     FLAVTRMPATCTLKGLGVVDADYPYYLGMLGMHGTKAANLAVQECDLLIAVGARFDDR
                     VTGKLNTFAPHAKVIHMDIDPAELNKLRQAHIGLTGDLNCLLPALQQPLAIDGWRERS
                     AALRAEHAWRYDHPGEAIYAPLLLKQLSDRKPADSVVTTDVGQHQMWSAQHMTYTRPE
                     NFITSSGLGTMGFGLPAAVGAQVARPNDTVICISGDGSFMMNVQELGTVKRKQLPLKI
                     VLLDNQRLGMVRQWQQLFFQERYSETTLTDNPDFLTLASAFGIPGQHITRKDQVEAAL
                     DTMLSSQGPYLLHVSIDELENVWPLVPPGASNSEMLEKLS"
     misc_feature    129494..131137
                     /locus_tag="KPHS_01140"
                     /note="acetolactate synthase 2 catalytic subunit;
                     Reviewed; Region: PRK08978"
                     /db_xref="CDD:181601"
     gene            131137..131394
                     /locus_tag="KPHS_01150"
                     /db_xref="GeneID:11845096"
     CDS             131137..131394
                     /locus_tag="KPHS_01150"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 2 regulatory subunit"
                     /protein_id="YP_005224415.1"
                     /db_xref="GeneID:11845096"
                     /translation="MMQHQVALQARFNPETLERVLRVVRHRGFHICAMNMETAPDAQN
                     INIELTVASPRPVELLFSQLSKLVDVACVEIQQPTSQQIRA"
     misc_feature    131137..131364
                     /locus_tag="KPHS_01150"
                     /note="acetolactate synthase 2 regulatory subunit;
                     Provisional; Region: ilvM; PRK11152"
                     /db_xref="CDD:236862"
     gene            131411..132340
                     /locus_tag="KPHS_01160"
                     /db_xref="GeneID:11845097"
     CDS             131411..132340
                     /locus_tag="KPHS_01160"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="YP_005224416.1"
                     /db_xref="GeneID:11845097"
                     /translation="MTTKKADYIWFNGEMVPWGEAKVHVMSHALHYGTSVFEGIRCYD
                     SHKGPVVFRHREHMQRLHDSAKIYRFPVSQSVDELMEACREVIRTNNLTSAYIRPLVF
                     VGDVGMGVNPPPGYNTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAK
                     AGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSAL
                     PGITRDAIIKLAKDLGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGAG
                     RRGPVTKRIQEAFFGLFTGETEDKWGWLDPVSK"
     misc_feature    131411..132331
                     /locus_tag="KPHS_01160"
                     /note="branched-chain amino acid aminotransferase;
                     Validated; Region: PRK06606"
                     /db_xref="CDD:235841"
     misc_feature    order(131474..131488,131495..131509,131513..131515,
                     131519..131521,131609..131611,131702..131704,
                     131708..131710,131726..131734,131744..131746,
                     131771..131773,131894..131896,131909..131911,
                     131915..131917,131927..131929,131969..131971)
                     /locus_tag="KPHS_01160"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238798"
     misc_feature    order(131504..131506,131519..131521,131588..131590,
                     131738..131740,131888..131890,131903..131905,
                     131990..131992,132071..132076,132182..132184)
                     /locus_tag="KPHS_01160"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238798"
     misc_feature    131888..131890
                     /locus_tag="KPHS_01160"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238798"
     gene            132401..134251
                     /locus_tag="KPHS_01170"
                     /db_xref="GeneID:11845098"
     CDS             132401..134251
                     /locus_tag="KPHS_01170"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_005224417.1"
                     /db_xref="GeneID:11845098"
                     /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFT
                     QFVPGHVHLRDLGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKII
                     KLDLVDAMIQGADPKVSDEQSNQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGN
                     GSLLATHADRKELFLNAGKRIVELTKRYYEQDDASALPRNIASKAAFENAMTLDIAMG
                     GSTNTVLHLLAAAQEAEIDFTMSDIDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVLG
                     ILGELDRAGLLNREVKNVLGLTLPQTLEQYDVMVTQDDAVKKMFRAGPAGIRTTQAFS
                     QDCRWDTLDDDRAEGCIRSLEHAYSKDGGLAVLYGNFAENGCIVKTAGVDDSILKFTG
                     PAKVYESQDDAVEAILGGKVVEGDVVVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKAC
                     ALITDGRFSGGTSGLSIGHVSPEAASGGNIALIEDGDMIAIDIPNRSIQLQLSDAEIA
                     ARREAQEARGDQAWTPKNRQRQVSFALRAYASLATSADKGAVRDKSKLGG"
     misc_feature    132404..134248
                     /locus_tag="KPHS_01170"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK12448"
                     /db_xref="CDD:237104"
     gene            134311..135798
                     /locus_tag="KPHS_01180"
                     /db_xref="GeneID:11845099"
     CDS             134311..135798
                     /locus_tag="KPHS_01180"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="YP_005224418.1"
                     /db_xref="GeneID:11845099"
                     /translation="MLRAPVYEAVQKTPLQKMDKLSSRLDNVILVKREDRQPVHSFKL
                     RGAYAMMSSLTAEQKSHGVITASAGNHAQGVAFSASRLGVKALIVMPVATADIKVDAV
                     RGFGGEVLLHGANFDEAKARAIELAQQQGFTWVPPFDHPMVIAGQGTLALELLQQDAH
                     IDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGL
                     FAEGVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFEDVRAVAEPSGALALAG
                     MKKYIAQHNIRGERLAHILSGANVNFHGLRYVSERCELGEQREALLAVTIPEEKGSFL
                     KFCQLLGGRSVTEFNYRFADAKDACIFVGVRLSRGLEERKEILQLLNDGGYSVVDLSD
                     DEMAKLHVRYMVGGRPSKALQERLFSFEFPESPGALLKFLHTLGTHWNISLFHYRSHG
                     TDYGRVLAAFELGEHEPDFETRLNELGYECHDETHNPAFRFFLAG"
     misc_feature    134314..135792
                     /locus_tag="KPHS_01180"
                     /note="threonine dehydratase; Reviewed; Region: PRK09224"
                     /db_xref="CDD:236417"
     gene            complement(135795..136685)
                     /locus_tag="KPHS_01190"
                     /db_xref="GeneID:11845100"
     CDS             complement(135795..136685)
                     /locus_tag="KPHS_01190"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator protein"
                     /protein_id="YP_005224419.1"
                     /db_xref="GeneID:11845100"
                     /translation="MDLRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLG
                     QPLFVRDNRTVTLTEAGEELRTFAQQTLLQYQQLRHVIDQQGPSLSGELHIFCSVTAA
                     YSHLPPILDRFRAAHPSVEIKLSTGDAADAMEKVVTGEADLAIAGKPETLPGSVAFSM
                     LENLAVVLIAPALPCPVRNQVTVERPDWSTVPFIMADQGPVRRRIELWFRRHKISNPS
                     IYATVGGHEAMVSMVALGCGVALLPEVVLENSPEPVRNRVMILERSDEQTPFELGVCA
                     QKKRLHEPLIDAFWKILPNH"
     misc_feature    complement(135798..136613)
                     /locus_tag="KPHS_01190"
                     /note="DNA-binding transcriptional regulator IlvY;
                     Provisional; Region: PRK11716"
                     /db_xref="CDD:236961"
     gene            136838..138313
                     /locus_tag="KPHS_01200"
                     /db_xref="GeneID:11845101"
     CDS             136838..138313
                     /locus_tag="KPHS_01200"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="YP_005224420.1"
                     /db_xref="GeneID:11845101"
                     /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADGASYLQGKKVVIVG
                     CGAQGLNQGLNMRDSGLDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLV
                     VNLTPDKQHSDVVRSVQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTE
                     VREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDL
                     MGEQTILCGMLQAGSLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDR
                     LSNPAKLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREET
                     GKTAFETAPQYEGKIGEQEYFDKGVLMIAMVKAGVELAFETMVASGIIEESAYYESLH
                     ELPLIANTIARKRLYEMNVVISDTAEYGNYLFSYACVPLLKEFMTTLQTGDLGTAIAE
                     GAVDNAQLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG"
     misc_feature    136841..138301
                     /locus_tag="KPHS_01200"
                     /note="ketol-acid reductoisomerase; Validated; Region:
                     PRK05225"
                     /db_xref="CDD:235368"
     gene            complement(138517..138798)
                     /locus_tag="KPHS_01210"
                     /db_xref="GeneID:11845102"
     CDS             complement(138517..138798)
                     /locus_tag="KPHS_01210"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase C"
                     /protein_id="YP_005224421.1"
                     /db_xref="GeneID:11845102"
                     /translation="MAKTAAALHILVKEEKLALDLLEQLKNGADFGKLAKKHSICPSG
                     KRGGDLGEFRQGQMVPAFDKVVFSCPELEPTGPLHTQFGYHIIKVLYRK"
     misc_feature    complement(138520..138798)
                     /locus_tag="KPHS_01210"
                     /note="peptidyl-prolyl cis-trans isomerase C; Provisional;
                     Region: PRK15441"
                     /db_xref="CDD:185338"
     gene            complement(138850..139131)
                     /locus_tag="KPHS_01220"
                     /db_xref="GeneID:11845103"
     CDS             complement(138850..139131)
                     /locus_tag="KPHS_01220"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase C"
                     /protein_id="YP_005224422.1"
                     /db_xref="GeneID:11845103"
                     /translation="MAKSAAALHILVKEEKLALEILAKLERGVSFDHLAKRYSKCPSG
                     RNGGDLGEFQQGAMVGPFDQAVFSCPLLKPYGPVKTKFGYHIIKVLYRR"
     misc_feature    complement(138853..139131)
                     /locus_tag="KPHS_01220"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     cl29122"
                     /db_xref="CDD:355998"
     gene            139244..141265
                     /locus_tag="KPHS_01230"
                     /db_xref="GeneID:11845104"
     CDS             139244..141265
                     /locus_tag="KPHS_01230"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase Rep"
                     /protein_id="YP_005224423.1"
                     /db_xref="GeneID:11845104"
                     /translation="MRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCG
                     YQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMISTFHTLGLDIIKREYAALGMK
                     SNFSLFDDTDQVALLKELTEGLIEDDKVVLQQLISTISNWKNDLKTPAQAAAGAKGER
                     DRIFAHCYGLYDAHMKACNVLDFDDLILLPTLLLQRNEEVRERWQNKIRYLLVDEYQD
                     TNTSQYELVKLLVGQRARFTVVGDDDQSIYSWRGARPQNLVLLSQDFPALRVIKLEQN
                     YRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEDHEAERVAGELIAH
                     HFINKTNYKDYAILYRGNHQSRVFEKMLMQNRIPYKISGGTSFFSRPEIKDLLAYLRV
                     LTNPDDDSAFLRIVNTPKREIGPATLQKLGEWAMGRNKGLFTASFDMGLSQTLTGRGY
                     ESLTRFTHWLREIQQLAEREPVNAVRDLIRGIDYESWLYETSPSPKAAEMRMKNVNQL
                     FTWMTEMLEGSEIDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFP
                     YVYLVGMEEGLLPHQSSIDEDNVDEERRLAYVGITRAQKELTFTLCKERRQYGELVRP
                     EPSRFLLELPQDDLIWEQARKTITPEERMQKGQANVANIRAMLAKAKKA"
     misc_feature    139244..141259
                     /locus_tag="KPHS_01230"
                     /note="ATP-dependent DNA helicase Rep; Provisional;
                     Region: PRK10919"
                     /db_xref="CDD:182838"
     gene            complement(141270..141992)
                     /locus_tag="KPHS_01240"
                     /db_xref="GeneID:11845105"
     CDS             complement(141270..141992)
                     /locus_tag="KPHS_01240"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transport protein"
                     /protein_id="YP_005224424.1"
                     /db_xref="GeneID:11845105"
                     /translation="MAIGIFVCSGSLLVGALAGASLNRFIPEHFKKTLPLIAGLISIS
                     MGIFFVNKLHNLPPIALAIIVGTIIGGLLNIEKWIERAGTTLRSPIERIFPAQSSASV
                     GAEDFMNQFIAVLILFCASGTGIFGALTEGMTGDPTILLTKSILDFFTAAIFASTLGY
                     IITVIFIPQLIVFVILFFAATFIMALINPSMIADFTACGGIIMLATGFRLCGIRAFPT
                     ANMLPSLILVMPFSAAWQQFIA"
     misc_feature    complement(141294..141986)
                     /locus_tag="KPHS_01240"
                     /note="Protein of unknown function (DUF554); Region:
                     DUF554; pfam04474"
                     /db_xref="CDD:335806"
     gene            complement(142055..143053)
                     /locus_tag="KPHS_01250"
                     /db_xref="GeneID:11845106"
     CDS             complement(142055..143053)
                     /locus_tag="KPHS_01250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amidohydrolase 2"
                     /protein_id="YP_005224425.1"
                     /db_xref="GeneID:11845106"
                     /translation="MRGKIALEEHVSTPENNRLWDSSGEAGRNGTEYMKDVERRLLDR
                     SIQLEEMAQRHIDHVILSLTSPGAQSILDKAKAVSFARDTNDFIVENYVKPNPDKFSA
                     FATLALQNPEAAAEELERAVKKLGMKGALINGYTNVKDSEHGLYLDDESMLVFWDKVN
                     ELNVPVYLHPREPLEGPARGIYTGYESLIGSAWGFAQETAVHAIRLMMSGLFDRYPNL
                     NLVLGHLGEGLVHMLPRTQHRLYRQRFGCGLGKAEKPLMHYLQNNFIVTTSGHFNTHS
                     LNNAIEVMGADRVMFSVDYPYEDIHQACDWFDPLELEAGLKEKIAWGNASRVFNIK"
     misc_feature    complement(142061..143047)
                     /locus_tag="KPHS_01250"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:351001"
     gene            complement(143184..144110)
                     /locus_tag="KPHS_01260"
                     /db_xref="GeneID:11845107"
     CDS             complement(143184..144110)
                     /locus_tag="KPHS_01260"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LysR family regulatory protein"
                     /protein_id="YP_005224426.1"
                     /db_xref="GeneID:11845107"
                     /translation="MREELDFKSLRFFSALYRLGNVSPAADALDISQPTGSLLLKKLR
                     DHFADPLFVRVGQRMIPTPRADAIAPTISTLLQLADNDLAVKPEFLPQQSQRNFTIGM
                     TDISQMTLLPLLQIALQQQAADGITFTVQNLDEQTLNALESGKCDLAIGYLTQLPESV
                     YQQHLFDQSYVCLAAENHPRIRAQLRAEDWRQEKHLAIRVEGTAHGDMDKLLDEHHMP
                     RRIALTLPSFLGTGELVAESDMIAVVPEQVARHITRRYPCRSWPLPFPLAKIAIRQVW
                     HQRLHRDPGHIWLRSLIATLADPAQQSTSIKI"
     misc_feature    complement(143916..144092)
                     /locus_tag="KPHS_01260"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:333860"
     misc_feature    complement(143223..143822)
                     /locus_tag="KPHS_01260"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that are involved in
                     the catabolism of dinitrotoluene, naphthalene and
                     gamma-hexachlorohexane; contains the type 2 periplasmic
                     binding fold; Region: PBP2_DntR_NahR_LinR_like; cd08459"
                     /db_xref="CDD:176148"
     misc_feature    complement(order(143295..143297,143496..143498,
                     143607..143609,143781..143783,143793..143798,
                     143802..143804))
                     /locus_tag="KPHS_01260"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176148"
     misc_feature    complement(order(143358..143360,143400..143402,
                     143409..143414,143421..143426,143433..143447,
                     143529..143531,143715..143717,143721..143735,
                     143742..143747,143754..143759,143763..143768,
                     143775..143780,143787..143792,143799..143801))
                     /locus_tag="KPHS_01260"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176148"
     gene            complement(144130..145638)
                     /locus_tag="KPHS_01270"
                     /db_xref="GeneID:11845108"
     CDS             complement(144130..145638)
                     /locus_tag="KPHS_01270"
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine pentaphosphatase"
                     /protein_id="YP_005224427.1"
                     /db_xref="GeneID:11845108"
                     /translation="MKSMSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLSRIKRKVRL
                     AAGLNSDNTLSAEAMERGWQCLRLFAERLQDIPPTQIRVVATATLRLAVNAGEFLAKA
                     QEILGTPVQVISGEEEARLIYQGVAHTTGGADQRLVVDIGGASTELVTGTGAQTTSLF
                     SLSMGCVTWLERYFADRSLTKENFDLAEAAAREVLLPVADVLRYHGWKVCVGASGTVQ
                     ALQEIMMAQGMDERITLAKLQQLKQRAIQCGRLEELEIEGLTLERALVFPSGLAILIA
                     IFSELNIQCMTLAGGALREGLVYGMLHLSVEQDIRSRTLRNIQRRFMIDTEQAQRVGG
                     LASHLLSQLDGSWELDPLSRDLLLSACALHEIGLSVDFKRAPQHAAYLVNNLDLPGFT
                     PAQKKLIATLLLNQTNAIDLSSLHQQNAVPPRVAEHLCRLLRLAILFASRRRDDLLPA
                     IQLTAQDEQLTLILPGNWLDEHPLGREMVDQECQWQSYVHWILRVASGDTLK"
     misc_feature    complement(144148..145629)
                     /locus_tag="KPHS_01270"
                     /note="guanosine pentaphosphate phosphohydrolase;
                     Provisional; Region: PRK11031"
                     /db_xref="CDD:236826"
     gene            complement(145757..147022)
                     /locus_tag="KPHS_01280"
                     /db_xref="GeneID:11845109"
     CDS             complement(145757..147022)
                     /locus_tag="KPHS_01280"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase RhlB"
                     /protein_id="YP_005224428.1"
                     /db_xref="GeneID:11845109"
                     /translation="MSKTHLTEQKFSDFALHPAVIEALEKKGFHNCTPIQALALPLTL
                     EGRDVAGQAQTGTGKTMAFLTSTFHYLLSHPAIADRQVNQPRALIMAPTRELAVQIHA
                     DAEPLAQATGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQ
                     VVVLDEADRMYDLGFIKDIRWLFRRMPPATQRLNMLFSATLSYRVRELAFEQMNNAEY
                     VEVEPEQKTGHRIKEELFYPSNEEKMRLLQTLLEEEWPDRAIVFANTKHRCEDIWGHL
                     AADGHRVGLLTGDVAQKKRLRILEEFTRGDLDILVATDVAARGLHIPAVTHVFNYDLP
                     DDCEDYVHRIGRTGRAGASGHSISLACEEYALNLPAIETYIGHSIPVSKYNPDALMTD
                     LPKPLRLTRARPGNGPRRNGPPRNRRRSG"
     misc_feature    complement(145817..147019)
                     /locus_tag="KPHS_01280"
                     /note="ATP-dependent RNA helicase RhlB; Provisional;
                     Region: PRK04837"
                     /db_xref="CDD:235314"
     gene            147364..147693
                     /locus_tag="KPHS_01290"
                     /db_xref="GeneID:11845110"
     CDS             147364..147693
                     /locus_tag="KPHS_01290"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_005224429.1"
                     /db_xref="GeneID:11845110"
                     /translation="MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILD
                     EIAEEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKE
                     FLDANLA"
     misc_feature    147364..147690
                     /locus_tag="KPHS_01290"
                     /note="thioredoxin; Provisional; Region: trxA; PRK09381"
                     /db_xref="CDD:181812"
     misc_feature    order(147460..147462,147469..147471)
                     /locus_tag="KPHS_01290"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            148024..149283
                     /locus_tag="KPHS_01300"
                     /db_xref="GeneID:11845111"
     CDS             148024..149283
                     /locus_tag="KPHS_01300"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="YP_005224430.1"
                     /db_xref="GeneID:11845111"
                     /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHSK
                     SGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIR
                     PPKEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTAR
                     VLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTE
                     MQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNT
                     VVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEE
                     FKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGE
                     IDAMEFLINKLAMTKTNDDFFDMMKRS"
     misc_feature    148024..149277
                     /locus_tag="KPHS_01300"
                     /note="transcription termination factor Rho; Provisional;
                     Region: rho; PRK09376"
                     /db_xref="CDD:236490"
     gene            149524..150627
                     /locus_tag="KPHS_01310"
                     /db_xref="GeneID:11845112"
     CDS             149524..150627
                     /locus_tag="KPHS_01310"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-GlcNAc:undecaprenylphosphate
                     GlcNAc-1-phosphate transferase"
                     /protein_id="YP_005224431.1"
                     /db_xref="GeneID:11845112"
                     /translation="MNLLTAITELISIFLFTTLFIFVARKVAKKIGLVDKPNYRKRHQ
                     GLIPLVGGISVYAGICFTFAIADYYIPHASLYLACAGVLVLVGALDDRFDISVKIRAV
                     IQAAIAVIMMMAGNLHLSSLGFIFGSWELVLGPFGFFLTLFAVWAAINAFNMVDGIDG
                     LLGGLSSVSFAATGIILWFDGQYSLAMWCFAMIAAILPYILLNLGALGRRYKVFMGDA
                     GSTMIGFTIIWILLETTQGKTHPISPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPD
                     RQHIHHLIMRAGFTSRQAFVLITLAAALLALVGVVAEYTRIVPEWVMLILFLVAFFLY
                     GYCIKRAWKVARLVKRIRRRIRRHSGNNPKLTK"
     misc_feature    149524..150618
                     /locus_tag="KPHS_01310"
                     /note="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
                     1-phosphate transferase; Provisional; Region: PRK15119"
                     /db_xref="CDD:237913"
     misc_feature    149791..149796
                     /locus_tag="KPHS_01310"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133463"
     misc_feature    150163..150174
                     /locus_tag="KPHS_01310"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133463"
     misc_feature    order(150316..150318,150358..150369)
                     /locus_tag="KPHS_01310"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133463"
     gene            150671..151687
                     /locus_tag="KPHS_01320"
                     /db_xref="GeneID:11845113"
     CDS             150671..151687
                     /locus_tag="KPHS_01320"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein WzzE"
                     /protein_id="YP_005224432.1"
                     /db_xref="GeneID:11845113"
                     /translation="MNVENELDIRGLFRALWAGKGWIVGGAVLFAAIVLVYTFFARQE
                     WSATAITDRPTVNMLGGYYSQQQFLRNLDIKADLASVDQPSAMDEAYKEFIMQLASWD
                     TRRDFWLQTDYYKQRQSGNARADAAMLDDLINNIQFMPGDAAKSINDSVKLTAETGQD
                     ANNLLRQYVAFASQRAAGHLNDELKGAWAARTVQMKAQVKRQEEVAEAIFNRRTHSVE
                     QALKVAQQHNISRSETDVPADQLPDSELFLLGRPMLQARLENLQAVGPEYDLDYDQNR
                     AMLSTLNVGPTLDPRFQTYRYLRTPEEPVKRDSPRRVFLMVMWGIVGALIGAGVALSR
                     RRVL"
     misc_feature    150671..151678
                     /locus_tag="KPHS_01320"
                     /note="lipopolysaccharide biosynthesis protein WzzE;
                     Provisional; Region: PRK11638"
                     /db_xref="CDD:236943"
     gene            151789..152874
                     /locus_tag="KPHS_01330"
                     /db_xref="GeneID:11845114"
     CDS             151789..152874
                     /locus_tag="KPHS_01330"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="YP_005224433.1"
                     /db_xref="GeneID:11845114"
                     /translation="MAPLVHALAKDPHFEAKVCVTAQHREMLDQVLKLFSIVPDYDLN
                     IMKPGQGLTEITCRILEGLKPVLESFKPDVVLVHGDTTTTMAASLAAFYQRIPVGHVE
                     AGLRTGDLSSPWPEEGNRTLTGHLATYHFAPTETSRQNLLRENIADSRITVTGNTVID
                     ALFWVRDRVLGDEALRETLLQRYPFISHGKKMILVTGHRRESFGLGFEQICQALAEIA
                     HTHPEVQIVYPVHLNPNVSEPVNRILGHIDNVMLIEPQDYLPFVWLMDRAWLILTDSG
                     GIQEEAPSLGKPVLVMRDMTERPEAVAAGTVCLVGTDSQRIVAEVTRLLEDDAAYQAM
                     SRAHNPYGDGEACRRILSALKNNQVTL"
     misc_feature    151789..152859
                     /locus_tag="KPHS_01330"
                     /note="UDP-N-acetylglucosamine 2-epimerase; Region: wecB;
                     TIGR00236"
                     /db_xref="CDD:272978"
     gene            152871..154133
                     /locus_tag="KPHS_01340"
                     /db_xref="GeneID:11845115"
     CDS             152871..154133
                     /locus_tag="KPHS_01340"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosaminuronic acid
                     dehydrogenase"
                     /protein_id="YP_005224434.1"
                     /db_xref="GeneID:11845115"
                     /translation="MSFSTISVIGLGYIGLPTAAAFASRQKRVVGVDVNQHAVETINR
                     GEIHIVEPDLASVVKTAVEQGYLSATTTPVEADAYLIAVPTPFKDRHEPDMVFVESAA
                     KSIAPTLKKGSLVILESTSPVGSTEQMAEWLAEMRPDLSFPQQVGEAADVNIAYCPER
                     VLPGQVMVELIKNDRVIGGMSPVCSARASELYKIFLEGECVVTNSRTAEMCKLTENSF
                     RDVNIAFANELSLICADQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVA
                     QNPQQARLIRTAREVNDHKPEWVIEQVKAQVADCLNATNKRASELTIACFGLAFKPNI
                     DDLRESPAMEIAAQIARWHSGTTQVVEPNIHALPKKLDGLCTLATLEAALASADVLVM
                     LVDHNEFKAVSGDSVTQAFIVDTKGVWR"
     misc_feature    152871..154115
                     /locus_tag="KPHS_01340"
                     /note="UDP-N-acetyl-D-mannosamine dehydrogenase;
                     Provisional; Region: wecC; PRK11064"
                     /db_xref="CDD:182940"
     gene            154130..155197
                     /locus_tag="KPHS_01350"
                     /db_xref="GeneID:11845116"
     CDS             154130..155197
                     /locus_tag="KPHS_01350"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="YP_005224435.1"
                     /db_xref="GeneID:11845116"
                     /translation="MRTILVTGGAGFIGSAVVREIIQHTADRVVVVDKLTYAGNLMSL
                     APVAQDARFAFEQVDICDRAELDRIFRQHQPDTVMHLAAESHVDRSIDGPAAFIETNI
                     VGTYTLLEAARSWWNTLATAQKSAFRFHHISTDEVYGDLHGSDDFFTETTPYAPSSPY
                     SASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLTILNALAGKPLPVYG
                     NGQQIRDWLYVEDHARALYLVATRGEPGETYNIGGHNERKNIEVVETICQLLEELAPD
                     KPQGVAHYRDLIAFVADRPGHDLRYAIDASKIARELGWTPAETFTSGMRKTVAWYLAN
                     EAWWRQVQDGSYQGERLGLQS"
     misc_feature    154130..155194
                     /locus_tag="KPHS_01350"
                     /note="dTDP-glucose 4,6-dehydratase; Provisional; Region:
                     PRK10217"
                     /db_xref="CDD:182313"
     gene            155216..156097
                     /locus_tag="KPHS_01360"
                     /db_xref="GeneID:11845117"
     CDS             155216..156097
                     /locus_tag="KPHS_01360"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="YP_005224436.1"
                     /db_xref="GeneID:11845117"
                     /translation="MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLA
                     GIREILIITTPDDLRDFQRLLGDGSEFGIALHYAVQPTPDGLAQAFIIGEAFLNGEPA
                     CLVLGDNIFFGQSFSPKLRSVAARTEGATIFGYQVMDPERFGVVEFDDNFRALSLEEK
                     PKQPKSNWAVTGLYFYDGKVTEYAKRVKPSERGELEITSINQMYLEDGALTVELLGRG
                     FAWLDTGTHDSLIEASMFVQTVEKRQGFKIACLEEIGWRNGWLDDDGVKRAAKRLEKT
                     GYGQYLLDLLRARPRQY"
     misc_feature    155219..156076
                     /locus_tag="KPHS_01360"
                     /note="glucose-1-phosphate thymidylyltransferase, short
                     form; Region: rmlA; TIGR01207"
                     /db_xref="CDD:130274"
     gene            156075..156749
                     /locus_tag="KPHS_01370"
                     /db_xref="GeneID:11845118"
     CDS             156075..156749
                     /locus_tag="KPHS_01370"
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-fucosamine acetyltransferase"
                     /protein_id="YP_005224437.1"
                     /db_xref="GeneID:11845118"
                     /translation="MPVRASIDPLEWENRFFAVNSAIVRFDEHAPRLTPEALAGWSRV
                     QAKIAASDTVRLDALQRLGFQLVEGEVDLALPVGSPADAGADVAVEADIAPLREQAAQ
                     AFAMSRFRAPWYAADASGRFYAQWIENAVRGTFDHQCLIYRHPEGDIRAFVSLRQITA
                     TEARIGLLAGRGAGAQLMQAARYWAASRGLSTLRVATQMGNTAALKRYILSGANVEST
                     AYWLYR"
     misc_feature    156186..156746
                     /locus_tag="KPHS_01370"
                     /note="TDP-fucosamine acetyltransferase; Provisional;
                     Region: PRK10975"
                     /db_xref="CDD:182877"
     gene            156755..157885
                     /locus_tag="KPHS_01380"
                     /db_xref="GeneID:11845119"
     CDS             156755..157885
                     /locus_tag="KPHS_01380"
                     /codon_start=1
                     /transl_table=11
                     /product="TDP-4-oxo-6-deoxy-D-glucose transaminase"
                     /protein_id="YP_005224438.1"
                     /db_xref="GeneID:11845119"
                     /translation="MIPFNAPPVVGTELDYMQSAMNSGKLCGDGGFTRRCQQWMEQRF
                     GTAKALLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDIRR
                     DTMNIDETLIEAAITDKTRAIVPVHYAGVACEMDTIMAIADKYNLFVVEDAAQGVMST
                     YKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDRTLVERAEIIREKGTNRSQFFR
                     GLVDKYTWRDIGSSYLMSDLQAAYLWAQLEAAERINQQRLALWQNYYDALLPLARAGR
                     IELPTVPADCGQNAHMFYIKLRDIEDRSRLIAWLKEAEILAVFHYIPLHSCPAGEQFG
                     EFRGEDRYTTQESERLVRLPLFYNLSVVNQRTVINSLLSYFS"
     misc_feature    156755..157882
                     /locus_tag="KPHS_01380"
                     /note="TDP-4-oxo-6-deoxy-D-glucose transaminase;
                     Provisional; Region: PRK11706"
                     /db_xref="CDD:183283"
     gene            157887..159137
                     /locus_tag="KPHS_01390"
                     /db_xref="GeneID:11845120"
     CDS             157887..159137
                     /locus_tag="KPHS_01390"
                     /codon_start=1
                     /transl_table=11
                     /product="entero common antigen translocase"
                     /protein_id="YP_005224439.1"
                     /db_xref="GeneID:11845120"
                     /translation="MSLAKASLWTAASTLVKIGAGLLVVKLLAVSFGPAGVGQAGNFR
                     QLVTVLGVLAGAGIFNGVTKLVAQHHDDPPRLKQVVGTSSAMVLGFSTLLALVFLLAA
                     APISQGLFGHTHYQGLVRLVALVQMGIAWANFLLALMKGFRDAAGNAFSLIAGSLIGV
                     AAYYACYVLGGYQGALLGLALVPALVVVPAGIMLWRRGNIPLSALRPRWDNGLAGQLS
                     KFTLMALITSVTLPVAYVMMRNLLAAHYGWEAVGIWQGVSSISDAYLQFITASFSVYL
                     LPTLSRLSAKTDITREIVKSLKFVLPAVAAASLTVWLLRDFAIWLLFSDRFTAMRDLF
                     AWQLVGDVLKVGAYVYGYLVIAKASLRFYILTEISQFALLTAFSHWLIPAHGAVGAAQ
                     AYMATYIVYFALCSGVFLLWRKRA"
     misc_feature    157887..159134
                     /locus_tag="KPHS_01390"
                     /note="O-antigen translocase; Provisional; Region:
                     PRK15099"
                     /db_xref="CDD:185054"
     gene            159134..160210
                     /locus_tag="KPHS_01400"
                     /db_xref="GeneID:11845121"
     CDS             159134..160210
                     /locus_tag="KPHS_01400"
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-L-fucosyltransferase"
                     /protein_id="YP_005224440.1"
                     /db_xref="GeneID:11845121"
                     /translation="MTALIHVLGSDIPHHNQTVLRFFNDELAADPQARRFMIVGDEAS
                     VRDGYPALDVTCYPGKKSLAQAVIATAKANRQQRFFFHGQFNTGLWLALLSGGIRPSQ
                     FNWHIWGADLYENSASLKFRLFYPLRRMAQGRVGRVFATRGDLSWFANRHPRVPGELL
                     YFPTRMDPALNTLADNAPRGDTLTILVGNSGDRSNEHIAALKAIHQQFGDTVNVIVPM
                     GYPAKNDAYINEVREAGAALFSGEHLQILSEKLEFHDYLALLRRCDLGYFLFARQQGI
                     GTLCLLIQAGIPCVLNRENPFWQDMAEQHVPVLFTSDALDVSVVREAQRQLASVDKSA
                     IAFFRPNYLTGWRRALRLAAEGQA"
     misc_feature    159134..160189
                     /locus_tag="KPHS_01400"
                     /note="4-alpha-L-fucosyltransferase glycosyl transferase
                     group 56; Region: Glyco_transf_56; pfam07429"
                     /db_xref="CDD:336700"
     gene            160207..161553
                     /locus_tag="KPHS_01410"
                     /db_xref="GeneID:11845122"
     CDS             160207..161553
                     /locus_tag="KPHS_01410"
                     /codon_start=1
                     /transl_table=11
                     /product="common antigen polymerase"
                     /protein_id="YP_005224441.1"
                     /db_xref="GeneID:11845122"
                     /translation="MTLMQFSGLLVVWLLSTLFIVTATWFEFRRVRFNFNVFFSLLFL
                     LTFFFGFPLTSILVFRFDVSVAPPEILLQTLLIAVCFYAVYYVTYKTRLRSASREVAH
                     RPLFTMNRVETHLAWGILMGLALLCVGIFFAHNGFLLFKLNSYSQIFSAEVSGVALKR
                     FFYFFIPAMLVVYFLRQDYKAWIFFLVSTVAFGLLTYAIVGGTRANIIIAFAIFLFIG
                     IIRGWISLWMLAAAGVLGIVGMFWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLA
                     LLLQNYDKIDFQGLAPMIRDFYVFIPSWMWHGRPTMVLNTANYFTWEVLNNHSGLAIS
                     PTLIGSLVVMGGVWFVPLGAVAVGLIIKWFDWLYELGNRESNRYKAAILHSFCFGAIF
                     NMIVLAREGLDSFGSRVVFFLVIFGICLLAAKLLYWFLDSVGLIHKRVKPLSQPQV"
     misc_feature    160207..161550
                     /locus_tag="KPHS_01410"
                     /note="putative common antigen polymerase; Provisional;
                     Region: PRK02975"
                     /db_xref="CDD:179518"
     gene            161565..162305
                     /locus_tag="KPHS_01420"
                     /db_xref="GeneID:11845123"
     CDS             161565..162305
                     /locus_tag="KPHS_01420"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /protein_id="YP_005224442.1"
                     /db_xref="GeneID:11845123"
                     /translation="MTGTISAPLYLLRGLQLIGWRDMPHALDYLFADGVLREGTLVAI
                     NAEKMLAAEDNPEVRALIEAAEFKYADGISVVRSLRKKYPQAQVSRVAGADLWEALMQ
                     RAGAEGTPVFLVGGKPEVLAQTESRLRQRWQVNIVGSQDGYFTPEQRQALFERIRDSG
                     AKIVTVAMGSPRQEIFMRDCRRLYPHALYMGVGGTYDVFTGHVHRAPKFWQDLGLEWF
                     YRLLLQPSRIKRQFRLLRYLRWHYSGKL"
     misc_feature    161574..162302
                     /locus_tag="KPHS_01420"
                     /note="putative UDP-N-acetyl-D-mannosaminuronic acid
                     transferase; Provisional; Region: PRK03692"
                     /db_xref="CDD:179631"
     gene            162511..163896
                     /locus_tag="KPHS_01430"
                     /db_xref="GeneID:11845124"
     CDS             162511..163896
                     /locus_tag="KPHS_01430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amino acid/amine transport protein"
                     /protein_id="YP_005224443.1"
                     /db_xref="GeneID:11845124"
                     /translation="MTEKKAELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPS
                     VLLAYIIAGLFVFFIMRSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMA
                     VGISEITAIGVYVQFWFPEMAQWIPALIAVGLVALANLAAVRLYGEIEFWFAMIKVTT
                     IIVMIVVGLGVIFFGFGNGGHSIGFGNLTEHGGFFAGGWKGFLTALCIVVASYQGVEL
                     IGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWDQIGSNGSPFVLTFA
                     KIGITAAAGIINFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAIGKVSRNGVPSV
                     GVALSILILLVGSCLNYIIPNPQRVFVYVYSASVLPGMVPWFVILISQLRFRRVHQAA
                     IASHPFRSLLFPWANYFTMAFLICVLVGMGLNDETRMSLFVGIIFLAAVTLIYKVFGL
                     GRQGQVNNTAE"
     misc_feature    162511..163893
                     /locus_tag="KPHS_01430"
                     /note="putative transport protein YifK; Provisional;
                     Region: PRK10746"
                     /db_xref="CDD:182694"
     gene            complement(164717..164890)
                     /locus_tag="KPHS_01440"
                     /db_xref="GeneID:11845125"
     CDS             complement(164717..164890)
                     /locus_tag="KPHS_01440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224444.1"
                     /db_xref="GeneID:11845125"
                     /translation="MAIASCGAIALLPRLHIDGSPKEKNACAEIRAGVKTGLFDNKLG
                     ASLNVMSMVFDEA"
     gene            complement(164897..166093)
                     /locus_tag="KPHS_01450"
                     /db_xref="GeneID:11845126"
     CDS             complement(164897..166093)
                     /locus_tag="KPHS_01450"
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX biogenesis protein HemY"
                     /protein_id="YP_005224445.1"
                     /db_xref="GeneID:11845126"
                     /translation="MLKILLLFALLIAGIVLGPMIAGHQGYVLIQTDNYNIETSVTGL
                     VIILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQ
                     VEKLMAKNADHAEQPVVNYLLAAEAAQQRGDEARANQHLERATELAGDDLIPVEITRV
                     RLQLARNENHAARHGIDKLLEITPRHPEVLRLAEQAYTRTGAWQSLLDIIPSMAKANV
                     GDEAHRAALEQLAWVGLMDKALADGGSEGLREWWRNQSRKTRALVPLQVAMAERLIES
                     DDHDTAQQIIIDGLKKQYDDRLVMPIPRLKTNNPEQLEKVLRQQIKAVGDRPLLWSTL
                     GQSLMRHGEWQEASIAFRAALKQRPDAFDYAWLADVLDRLHQPEEAAAMRRDGLLLTL
                     QNNPQP"
     misc_feature    complement(164900..166054)
                     /locus_tag="KPHS_01450"
                     /note="putative protoheme IX biogenesis protein;
                     Provisional; Region: PRK10747"
                     /db_xref="CDD:182695"
     misc_feature    complement(165023..165115)
                     /locus_tag="KPHS_01450"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276809"
     misc_feature    complement(164930..165013)
                     /locus_tag="KPHS_01450"
                     /note="TPR repeat [structural motif]; Region: TPR repeat"
                     /db_xref="CDD:276809"
     gene            complement(166097..167278)
                     /locus_tag="KPHS_01460"
                     /db_xref="GeneID:11845127"
     CDS             complement(166097..167278)
                     /locus_tag="KPHS_01460"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III methylase"
                     /protein_id="YP_005224446.1"
                     /db_xref="GeneID:11845127"
                     /translation="MTEQQNQSAVVEETREAVETTPQPENTEKKKAGNKTSLALSAIA
                     IAIAIAAGIGLYGLNKQQATRQNATTSELASQVAALQKAQENQKSELEGVIKQQADQL
                     NEAKHQQETLAKQLDELQQKVAVISGSDAKTWLLAQADFLVKLAGRKLWSDQDVTTAA
                     ALLKSADASLADMNDPSLIGARRAITDDIATLSAVSQVDYDGMILKVNQLANQIDNLR
                     LADNNDDDSPMDADSDELSSSISEWRVNLQKSWQNFMDSFITVRRRDETAVPLLAPNQ
                     DIYLRENIRSRLLVAAQAVPRHQEETWKQSLDNVSTWVRAYYDTDDATTKAFLDEVDK
                     LSQQSITMTVPETLQSQALLEKLMQTRVRNLMAQPAVTAGGAPSPAPAAPAAPAAPQG
                     E"
     misc_feature    complement(166100..167278)
                     /locus_tag="KPHS_01460"
                     /note="putative uroporphyrinogen III C-methyltransferase;
                     Provisional; Region: PRK10920"
                     /db_xref="CDD:236795"
     gene            complement(167300..168040)
                     /locus_tag="KPHS_01470"
                     /db_xref="GeneID:11845128"
     CDS             complement(167300..168040)
                     /locus_tag="KPHS_01470"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="YP_005224447.1"
                     /db_xref="GeneID:11845128"
                     /translation="MSILVTRPLPQGEALVSRLRAMGRVAWSFPLIEFTPGRELPALG
                     DALARLGPDDLLFALSQHAVEFAHARLQQQGLPWPTSPRYFAIGRTTALALHTVSGQH
                     IHYPLDREISEVLLQLPELQNIAGKNALILRGNGGRELLGATLTERGARVTFCECYQR
                     SAKHYDGAEEAMRWQSRGVTTLVVTSGEMLQQLWSLIPQWYREQWLLHCRVVVVSERL
                     ALQARELGWQEIQVADSADNDALLRALQ"
     misc_feature    complement(167303..168040)
                     /locus_tag="KPHS_01470"
                     /note="uroporphyrinogen-III synthase; Reviewed; Region:
                     hemD; PRK05928"
                     /db_xref="CDD:235647"
     misc_feature    complement(order(167474..167488,167561..167563,
                     167567..167569,167639..167641,167771..167773,
                     167855..167863,168020..168022))
                     /locus_tag="KPHS_01470"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            complement(168037..168978)
                     /locus_tag="KPHS_01480"
                     /db_xref="GeneID:11845129"
     CDS             complement(168037..168978)
                     /locus_tag="KPHS_01480"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="YP_005224448.1"
                     /db_xref="GeneID:11845129"
                     /translation="MLDKVLKIATRQSPLALWQAQYVKARLEQAHPGLKVELVPMVTR
                     GDVILDTPLAKVGGKGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERD
                     DPRDAFVSNRYASIDELPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLD
                     NGEYDAIILAAAGLKRLQLEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAP
                     LNHTETAVRVRAERAMNTRLEGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGER
                     RGPAEQAEALGISLAEELLDNGAREILAAVYDGEAPR"
     misc_feature    complement(168091..168969)
                     /locus_tag="KPHS_01480"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     gene            complement(169203..169322)
                     /locus_tag="KPHS_01490"
                     /db_xref="GeneID:11845130"
     CDS             complement(169203..169322)
                     /locus_tag="KPHS_01490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224449.1"
                     /db_xref="GeneID:11845130"
                     /translation="MFKNPRYNSTEDFSISTKTVTIRRRCGCDEQRTDKWFKT"
     gene            169336..171888
                     /locus_tag="KPHS_01500"
                     /db_xref="GeneID:11845131"
     CDS             169336..171888
                     /locus_tag="KPHS_01500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adenylate cyclase"
                     /protein_id="YP_005224450.1"
                     /db_xref="GeneID:11845131"
                     /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHY
                     HHPLMPGYLDGNVPRGICLYTPDETQRHYLEELELHRGMQTQEPPKGELPITGVYSMG
                     STSSVGQSCSSDLDIWVCHQAWLDSEERQLLQRKCSLLESWAASLGVEVSFFLIDENR
                     FRHNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMGL
                     YAQGVLTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYP
                     NNRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTTYLQAIEDETRLDLVRRCFYLKVC
                     EKLSRERACVGWRREVVSQLVNAWGWDEKRLMMLDNRANWKIDEVRKAHNELLDAMMQ
                     SYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLT
                     FIHVPPGRANRTGWYLYNRAPDMESIISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLF
                     IKGNGIVDLAKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIVNLEYDPTAAF
                     RNQVVHFDFRKLDVFSFGEEQKCLIGSVDLLYRNSWNEVRTLHFNGEQAMIEALKTIL
                     GKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQMISECIELRLSSTRQDTGRFKALRVS
                     GQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSVQVETNHVKLPAVVDGFASEG
                     IIQFFFEDADNNDSGFNIYILDESNRAEVYHHCEGSKEELVRDVSRFYSSSHDRFTYG
                     SSFINFNLPQFYQIVEVDGRTQVIPFRTQAIAAAIPTSQDVTASPVLQQRYS"
     misc_feature    169336..171885
                     /locus_tag="KPHS_01500"
                     /note="Adenylate cyclase [Nucleotide transport and
                     metabolism]; Region: CyaA; COG3072"
                     /db_xref="CDD:225614"
     gene            complement(172022..172342)
                     /locus_tag="KPHS_01510"
                     /db_xref="GeneID:11845132"
     CDS             complement(172022..172342)
                     /locus_tag="KPHS_01510"
                     /codon_start=1
                     /transl_table=11
                     /product="frataxin-like protein"
                     /protein_id="YP_005224451.1"
                     /db_xref="GeneID:11845132"
                     /translation="MNDSEFHRLADSLWMTIEERLDDWDGDSDIDCEINGGVLTISFE
                     NGSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAASQQAGET
                     VKFR"
     misc_feature    complement(172025..172342)
                     /locus_tag="KPHS_01510"
                     /note="frataxin-like protein; Provisional; Region: cyaY;
                     PRK00446"
                     /db_xref="CDD:234765"
     misc_feature    complement(order(172250..172252,172256..172258,
                     172274..172279,172286..172288,172298..172300,
                     172307..172312,172334..172336))
                     /locus_tag="KPHS_01510"
                     /note="putative iron binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238280"
     gene            172489..172692
                     /locus_tag="KPHS_01520"
                     /db_xref="GeneID:11845133"
     CDS             172489..172692
                     /locus_tag="KPHS_01520"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_005224452.1"
                     /db_xref="GeneID:11845133"
                     /translation="MKNVFPTLAVLFAIFSLTGCGLKGPLYFPPADKTAPPPTKPVNP
                     GIQSATPDRNDRGDTGGPSQVNY"
     misc_feature    172489..172677
                     /locus_tag="KPHS_01520"
                     /note="Predicted small periplasmic lipoprotein YifL
                     (function unknown0 [Function unknown]; Region: YifL;
                     COG5567"
                     /db_xref="CDD:227854"
     gene            172728..173552
                     /locus_tag="KPHS_01530"
                     /db_xref="GeneID:11845134"
     CDS             172728..173552
                     /locus_tag="KPHS_01530"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="YP_005224453.1"
                     /db_xref="GeneID:11845134"
                     /translation="MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQ
                     LLVVEPPYDPDLDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANG
                     RMVLSVTEDDLVRVNMGEPNFEPSQVPFRANKAEKTYIMRAAEQTVLCGVVSMGNPHC
                     VIQVDDVDTAAVETLGPVMESHERFPERANIGFMQVVGRSHIRLRVYERGAGETQACG
                     SGACAAVAVGIQQGLLAETVRVELPGGRLDIAWKGPGQPLFMTGPAAHVYDGFIHL"
     misc_feature    172728..173549
                     /locus_tag="KPHS_01530"
                     /note="diaminopimelate epimerase; Provisional; Region:
                     dapF; PRK00450"
                     /db_xref="CDD:234768"
     gene            173549..174256
                     /locus_tag="KPHS_01540"
                     /db_xref="GeneID:11845135"
     CDS             173549..174256
                     /locus_tag="KPHS_01540"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF484 domain-containing protein"
                     /protein_id="YP_005224454.1"
                     /db_xref="GeneID:11845135"
                     /translation="MKPIGEEQQEVASALNDRAVVDYLLQHPEFFIRNAAQVEHLRVP
                     HPVRGTISLVEWHMMRARNHIHVLEENMSLLMEQAVANESLFQRLLQLQTRLAAAESL
                     DDMLNRLHRWARELGLAGATVRLFPDCWRLGAPSKFTHLALNRQAFEPIRIQRLGQAR
                     HYLGPLNGPELLVVLPEAKAIGSVAISLLGGDNAPGVMLFSSRDAQHYQPGQGTQLLQ
                     EIAQMLPGLLERWIERA"
     misc_feature    173588..174253
                     /locus_tag="KPHS_01540"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10963"
                     /db_xref="CDD:236808"
     gene            174253..175155
                     /locus_tag="KPHS_01550"
                     /db_xref="GeneID:11845136"
     CDS             174253..175155
                     /locus_tag="KPHS_01550"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase"
                     /protein_id="YP_005224455.1"
                     /db_xref="GeneID:11845136"
                     /translation="MTDSPLFSAVARFLRHLGVERQLSPITLLNYQRQLDALIALADE
                     AGLKSWSQCDAAQVRSFAVRSRRAGLGPASLALRLSALRSFFDWLVGQGELSANPAKG
                     IAAPKIPRHLPKNIDVDDVNRLLDIDLNDPLAVRDRAMLEVMYGAGLRLSELVNLDIK
                     HLDLESGEVWVMGKGSKERRLPIGRNAVAWIEHWLDLRGLFGTDDDALFLSKLGKRIS
                     ARNVQKRFAEWGIKQGLNSHVHPHKLRHSFATHMLESSGDLRGVQELLGHANLSTTQI
                     YTHLDFQHLASVYDAAHPRAKRGK"
     misc_feature    174265..175149
                     /locus_tag="KPHS_01550"
                     /note="Site-specific recombinase XerC [Replication,
                     recombination and repair]; Region: XerC; COG4973"
                     /db_xref="CDD:227307"
     gene            175155..175871
                     /locus_tag="KPHS_01560"
                     /db_xref="GeneID:11845137"
     CDS             175155..175871
                     /locus_tag="KPHS_01560"
                     /codon_start=1
                     /transl_table=11
                     /product="flavin mononucleotide phosphatase"
                     /protein_id="YP_005224456.1"
                     /db_xref="GeneID:11845137"
                     /translation="MRFYRPLGQISALTFDLDDTLYDNRPVIDRTMHESLAFVRSYHP
                     SLSQFDAHELNQLRQTLLAAEPEIYHDVTVWRHRALELGMRNAGLSAEAAKAGADAAM
                     EHFAHWRSRVDVPQETHDTLAKLAKKWPLVAITNGNARPELFGLSDYFRFVLRAGPDG
                     RSKPFADMYHLAAERLNVPLGQILHVGDDLTTDVAGAIRCGMQACWIKPQGADLMHTA
                     DSRLLPHIEISRLASLTSLI"
     misc_feature    175155..175868
                     /locus_tag="KPHS_01560"
                     /note="flavin mononucleotide phosphatase; Provisional;
                     Region: PRK10748"
                     /db_xref="CDD:182696"
     misc_feature    175557..175559
                     /locus_tag="KPHS_01560"
                     /note="HAD signature motif II; other site"
                     /db_xref="CDD:319763"
     misc_feature    175641..175643
                     /locus_tag="KPHS_01560"
                     /note="HAD signature motif III; other site"
                     /db_xref="CDD:319763"
     misc_feature    order(175713..175718,175731..175733)
                     /locus_tag="KPHS_01560"
                     /note="HAD signature motif IV; other site"
                     /db_xref="CDD:319763"
     gene            175935..178097
                     /locus_tag="KPHS_01570"
                     /db_xref="GeneID:11845138"
     CDS             175935..178097
                     /locus_tag="KPHS_01570"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent helicase II"
                     /protein_id="YP_005224457.1"
                     /db_xref="GeneID:11845138"
                     /translation="MDVSYLLDSLNDKQREAVAASRTNMLVLAGAGSGKTRVLVHRIA
                     WLLSVENCSPYSIMAVTFTNKAAAEMRHRIGQLMGTTQGGMWVGTFHGLAHRLLRAHH
                     LDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQ
                     SYGNPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNIL
                     VDEFQDTNNIQYAWIRLLAGDTGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAET
                     IRLEQNYRSTSNILSAANALIENNNGRLGKKLWTDGADGEPISLYCAFNDLDEARFVV
                     NRIKTWQENGGALEQCAILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDAL
                     SYLRLIANRNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQASRELLKEKAL
                     AGRAASALQRFMELIDALAQETTDMPLHVQTDRVIKDSGLRAMYEQEKGEKGQTRIEN
                     LEELVTATRQFSYNEEDEDLMPLQAFLSHAALEAGEGQADTWQDAVQLMTLHSAKGLE
                     FPQVFIVGVEEGMFPSQMALDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKE
                     VYHRPSRFIGELPQECVEEVRLRATVSRPVNHQRLGAPIAESDTGYKLGQRVRHPKFG
                     EGTIVNLEGSGEHSRLQVAFQGQGIKWLVAAYARLEAV"
     misc_feature    175935..178094
                     /locus_tag="KPHS_01570"
                     /note="DNA-dependent helicase II; Provisional; Region:
                     uvrD; PRK11773"
                     /db_xref="CDD:236976"
     gene            178058..178210
                     /locus_tag="KPHS_01580"
                     /db_xref="GeneID:11845139"
     CDS             178058..178210
                     /locus_tag="KPHS_01580"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="YP_005224458.1"
                     /db_xref="GeneID:11845139"
                     /translation="MAGGGLRPAGGSVTLRKISLFCNILLPLYVKAPDLRFRVPLRVD
                     ADFALA"
     gene            178453..179403
                     /locus_tag="KPHS_01590"
                     /db_xref="GeneID:11845140"
     CDS             178453..179403
                     /locus_tag="KPHS_01590"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt transport protein"
                     /protein_id="YP_005224459.1"
                     /db_xref="GeneID:11845140"
                     /translation="MLSAFQLENNRLTRLEADEIKHLASSVWVDLVEPDDDERSRVQT
                     ELGQNLATRPELEDIEASARFFEDEDGLHIHSFFFFEDADDHAGNSTVAFTIREGRLF
                     TLRERELPAFRLYRMRVRNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSR
                     VIMEGHQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPAGQLEQARE
                     ILRDIESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSY
                     GMNFEFMPELHWSFGYPGAIVFMMLAGLAPYLYFKRKNWL"
     misc_feature    178453..179400
                     /locus_tag="KPHS_01590"
                     /note="magnesium/nickel/cobalt transporter CorA;
                     Provisional; Region: PRK11085"
                     /db_xref="CDD:182951"
     misc_feature    order(178540..178542,178639..178641,178675..178677,
                     178681..178683,178723..178725,178765..178776,
                     178780..178785,178870..178872,178879..178881,
                     179038..179043,179050..179052,179110..179112)
                     /locus_tag="KPHS_01590"
                     /note="Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213369"
     misc_feature    order(178612..178614,178621..178626,178642..178644,
                     178648..178650,178792..178794,178804..178806,
                     178843..178845,178852..178854,178864..178866,
                     178876..178878,178885..178890,178897..178899,
                     178906..178911,178915..178920,178927..178929,
                     178975..178980,178984..178989,178996..179001,
                     179008..179013,179017..179022,179032..179034,
                     179038..179043,179050..179055,179062..179067,
                     179092..179097,179101..179106,179113..179118,
                     179122..179127,179134..179139,179143..179148,
                     179152..179160,179167..179190,179194..179232,
                     179236..179244,179248..179265,179269..179292,
                     179326..179331,179338..179343,179377..179379,
                     179386..179388)
                     /locus_tag="KPHS_01590"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213369"
     gene            complement(179446..180339)
                     /locus_tag="KPHS_01600"
                     /db_xref="GeneID:11845141"
     CDS             complement(179446..180339)
                     /locus_tag="KPHS_01600"
                     /codon_start=1
                     /transl_table=11
                     /product="chloramphenicol resistance"
                     /protein_id="YP_005224460.1"
                     /db_xref="GeneID:11845141"
                     /translation="MDAKQTRLGIILALAAYFIWGIAPAYFKLIYYVPADEILTHRVI
                     WSFFFMVALISVSRQWPQVKKLLKTPRKIFLLALSAVLVGGNWLLFIWAVNNHHMLEA
                     SLGYFINPLVNILLGMIFLGERFRRLQWLAVILAFCGVLVQLWTFGSLPIIGLGLAFS
                     FAFYGLVRKKIAVDAQTGMLVETLWLLPVAAIWLFGITDSPTSHMGENPWSLNLLLMA
                     AGVVTTIPLLCFTGAATRLRLSTLGFFQYIGPTLMFLLAVTFYGEVPGKDKMVTFGFI
                     WVALAVFIVDALYTQRRLRRG"
     misc_feature    complement(179452..180339)
                     /locus_tag="KPHS_01600"
                     /note="putative chloramphenical resistance permease RarD;
                     Provisional; Region: PRK15430"
                     /db_xref="CDD:185328"
     gene            complement(180388..180852)
                     /locus_tag="KPHS_01610"
                     /db_xref="GeneID:11845142"
     CDS             complement(180388..180852)
                     /locus_tag="KPHS_01610"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase family protein"
                     /protein_id="YP_005224461.1"
                     /db_xref="GeneID:11845142"
                     /translation="MSELTAEAALKLVGEIFVYHMPFNRALGLELERYEKAFAQLSFN
                     NQPMMVGNWAQSILHGGVIASALDVAAGLVCVGSTLTRHDTINEEELRQRLSRMGTID
                     LRVDYLRPGRGERFTATSTLLRAGNKVAVARVELHNEAQVYIASATATYMVG"
     misc_feature    complement(180391..180852)
                     /locus_tag="KPHS_01610"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11688"
                     /db_xref="CDD:183276"
     misc_feature    complement(order(180523..180534,180553..180555,
                     180679..180681))
                     /locus_tag="KPHS_01610"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(180532..180534,180538..180552,
                     180661..180663,180670..180672,180676..180678))
                     /locus_tag="KPHS_01610"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(180553..180555,180634..180639,
                     180646..180651,180673..180675))
                     /locus_tag="KPHS_01610"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            181005..181865
                     /locus_tag="KPHS_01620"
                     /db_xref="GeneID:11845143"
     CDS             181005..181865
                     /locus_tag="KPHS_01620"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase A"
                     /protein_id="YP_005224462.1"
                     /db_xref="GeneID:11845143"
                     /translation="MRISLACLVALCALPAGVMAQDASVHDKPAVRGSIIANLLQDHD
                     NPFLLYPYESNYLLYTWTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGDN
                     SLLGASYTQKSWWQLSNSKESAPFRETNYEPQLFLGFATDYQFAGWTLRDIEMGYNHD
                     SNGRSDPTSRSWNRLYARLMAQNGNWLVEVKPWYVVGNTDDNPDITKYMGYYRLKVGY
                     QLGEAILSAQGQYNWNTGYGGAELGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRV
                     GVGLMLNDLF"
     misc_feature    181005..181862
                     /locus_tag="KPHS_01620"
                     /note="phospholipase A; Provisional; Region: PRK10763"
                     /db_xref="CDD:182708"
     misc_feature    order(181149..181151,181266..181268,181272..181274,
                     181335..181337,181380..181382)
                     /locus_tag="KPHS_01620"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238302"
     misc_feature    order(181173..181175,181266..181268,181272..181274,
                     181278..181280,181284..181286,181329..181331,
                     181347..181349,181371..181373,181380..181382,
                     181479..181481,181485..181487,181491..181493,
                     181758..181760)
                     /locus_tag="KPHS_01620"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238302"
     misc_feature    order(181479..181481,181485..181487,181521..181523)
                     /locus_tag="KPHS_01620"
                     /note="active site"
                     /db_xref="CDD:238302"
     misc_feature    order(181500..181502,181509..181511,181605..181607)
                     /locus_tag="KPHS_01620"
                     /note="calcium binding site [ion binding]; other site"
                     /db_xref="CDD:238302"
     gene            181933..183759
                     /locus_tag="KPHS_01630"
                     /db_xref="GeneID:11845144"
     CDS             181933..183759
                     /locus_tag="KPHS_01630"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="YP_005224463.1"
                     /db_xref="GeneID:11845144"
                     /translation="MAQAEVLNQESLAKQVLQETFGYQQFRPGQETIIETALEGRDCL
                     VVMPTGGGKSLCYQVPALVMGGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQSRE
                     QQQEVMAGCRSGQVRLLYIAPERLMLDNFLEHLANWNLAMLAVDEAHCISQWGHDFRP
                     EYAALGQLRQRMPQIPFMALTATADDTTRRDIVRLLGLNDPLIQVSSFDRPNIRYMLM
                     EKFKPLDQLMRYVQDQRGKSGIIYCNSRSKVEDTAARLQSRGISAAAYHAGLENDVRA
                     EVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPA
                     EAMLFYDPADMAWLRRCLEEKPAGPLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEG
                     RQEPCGNCDICLDPPKQYDGLMDARKALSTIYRVNQRFGMGYVVEVLRGANNQRIREM
                     GHDKLPVYGIGREQSHEHWVSVIRQLIHLGLVTQNIAQHSALQLTEAARPVLRGEVPL
                     QLAVPRIVALKPKAMQKSFGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLIEM
                     AEQSPLTAGEMLSVNGVGTRKLERFGKPFMALIRAHVDGDDE"
     misc_feature    181933..183753
                     /locus_tag="KPHS_01630"
                     /note="ATP-dependent DNA helicase RecQ; Provisional;
                     Region: PRK11057"
                     /db_xref="CDD:182933"
     gene            183821..184441
                     /locus_tag="KPHS_01640"
                     /db_xref="GeneID:11845145"
     CDS             183821..184441
                     /locus_tag="KPHS_01640"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine efflux system"
                     /protein_id="YP_005224464.1"
                     /db_xref="GeneID:11845145"
                     /translation="MLMLFLTVALVHIIALMSPGPDFFFVSQTAISRSRREAMMGVLG
                     ITCGVMVWAGVALLGLNLILARMAWLHNIIMVGGGLYLCWMGYQMLRGALKKEKVASA
                     EPQVELARSGRSFVKGLLTNLANPKAIIYFGSVFSLFVGDSVGAGARWGIFLLIIVET
                     LAWFMVVASLFALPGMRRGYQRMAKWIDGIAGTLFAGFGIHLIISR"
     misc_feature    183821..184438
                     /locus_tag="KPHS_01640"
                     /note="threonine efflux system; Provisional; Region:
                     PRK10229"
                     /db_xref="CDD:236665"
     gene            complement(184486..185394)
                     /locus_tag="KPHS_01650"
                     /db_xref="GeneID:11845146"
     CDS             complement(184486..185394)
                     /locus_tag="KPHS_01650"
                     /codon_start=1
                     /transl_table=11
                     /product="ISNCY family transposase"
                     /protein_id="YP_005224465.1"
                     /db_xref="GeneID:11845146"
                     /translation="MAETATPHDAVFKTFLSRVETARDFIELHLPPSLTQICKLDTLR
                     LESGSFLEDDLRPYYSDILYSLETTRGAGYVHVLIEHQSAPDKLMAFRLMRYAIAAMQ
                     RHLESGHKTLPLVIPILFYQGRRSPYPWSMRWLDNFADPETASQLYSGAFPLVDITVI
                     PDDDIMQHRSMAALTLVQKHIRQRDMAQLLDKLTQLLMLEQMSGQQITVLVNYMAQAG
                     DAEDTRTLLYGLAQRVPQHGGLLMTLAETWLAEGMEKGVQQGIKEGKHQALVQVAEAM
                     RSRGIDDQAIMEMTGLSEDELQRLRH"
     misc_feature    complement(184771..185379)
                     /locus_tag="KPHS_01650"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; pfam04754"
                     /db_xref="CDD:335885"
     gene            complement(185557..186177)
                     /locus_tag="KPHS_01660"
                     /db_xref="GeneID:11845147"
     CDS             complement(185557..186177)
                     /locus_tag="KPHS_01660"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine/homoserine lactone efflux protein"
                     /protein_id="YP_005224466.1"
                     /db_xref="GeneID:11845147"
                     /translation="MTIEWWFAYLLTSIILSLSPGSGAINTMTTSINHGYRGAAASIA
                     GLQTGLAIHIVLVGVGLGTLFSRSVLAFEVLKWAGAAYLIWLGIQQWRAAGAIDLNTL
                     AKAQTRGKLFQRAVFVNLTNPKSIVFLAALFPQFILPHQPQVMQYLVLGVTTIVVDII
                     VMIGYATLAQRISAWIKGPKQMKALNKVFGSLFMLVGALLASARHA"
     misc_feature    complement(185563..186177)
                     /locus_tag="KPHS_01660"
                     /note="homoserine/homoserine lactone efflux protein;
                     Provisional; Region: rhtB; PRK10520"
                     /db_xref="CDD:182514"
     gene            186287..187279
                     /locus_tag="KPHS_01670"
                     /db_xref="GeneID:11845148"
     CDS             186287..187279
                     /locus_tag="KPHS_01670"
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase L2"
                     /protein_id="YP_005224467.1"
                     /db_xref="GeneID:11845148"
                     /translation="MFGQKKDWETRENAFAAFSMGPLTDFWRQREEAEFKGVDDVPVR
                     FVRFCAQHNDRLVLICPGRIESYVKYAEVAYDLFHCGFDVMIIDHRGQGRSGRLLSDT
                     HRGHVVNFSDYVDDLAALWQQQVVPGHWRKRFILAHSMGGAIATLFLQRYRAHCDAIA
                     LCAPMFGIIIRLPDWMVRHILDWAEGHQRIREEYAIGTGRWRALPFAVNVLTHSRQRY
                     RRNLRFYADEPRLQVGGPTWHWVREGMLAGDEVLANVEKDTAPTLLLQAEEERVVDNL
                     MHDRYCELRAAAGHPCEGGKPLVIEGAYHEILFEKDAMRSVALNAIVEFFNRHT"
     misc_feature    186287..187276
                     /locus_tag="KPHS_01670"
                     /note="lysophospholipase L2; Provisional; Region:
                     PRK10749"
                     /db_xref="CDD:182697"
     gene            187324..188124
                     /locus_tag="KPHS_01680"
                     /db_xref="GeneID:11845149"
     CDS             187324..188124
                     /locus_tag="KPHS_01680"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar phosphatase"
                     /protein_id="YP_005224468.1"
                     /db_xref="GeneID:11845149"
                     /translation="MYQVVASDLDGTLLSPDHFLTPYAKETLKLLTARGINFVFATGR
                     HYIDVGQIRDNLGIRSYMITSNGARVHDSDGQQIFAHNLDRDIAADLFEIVRNDPKIV
                     TNVYREDEWYMNRHRPEEMRFFKEAVFNYKLYEPGELDPQGISKVFFTCEDHEHLLPL
                     EQAMNARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKMLGYTLSDCIAFGDGMND
                     AEMLSMAGKGCIMANAHQRLKDLHPELEVIGSNADDAVPNYLRKLYLD"
     misc_feature    187324..188121
                     /locus_tag="KPHS_01680"
                     /note="putative hydrolase; Provisional; Region: PRK10976"
                     /db_xref="CDD:182878"
     gene            188213..189112
                     /locus_tag="KPHS_01690"
                     /db_xref="GeneID:11845150"
     CDS             188213..189112
                     /locus_tag="KPHS_01690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transport protein"
                     /protein_id="YP_005224469.1"
                     /db_xref="GeneID:11845150"
                     /translation="MALLIITTILWAFSFSLIGEYLAGSVDSYFSVLMRVGLAALVFL
                     PFLRTRGQSPRTIVLYMLVGAMQLGIMYLLAFRAYLYLTVSEFLLFTVFTPLYITLIY
                     DLLSGRKLRWGYLLSAALAVLGAAIIRYDKVSDHFWTGLLLVQLSNLCFAIGMVGYKR
                     LMEVRPMPQHNAFAWFYVGAFIVAVAAWFMLGNAQKLPTTTLQWSVLVWLGVVASGLG
                     YFMWNYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEQPHWPSFISGALVILASLWVH
                     RRWVAPHSGQTADDRRRGSAQSE"
     misc_feature    188243..189031
                     /locus_tag="KPHS_01690"
                     /note="Carboxylate/Amino Acid/Amine Transporter; Region:
                     2A78; TIGR00950"
                     /db_xref="CDD:273359"
     gene            190201..192465
                     /locus_tag="KPHS_01700"
                     /db_xref="GeneID:11845151"
     CDS             190201..192465
                     /locus_tag="KPHS_01700"
                     /codon_start=1
                     /transl_table=11
                     /product="5-
                     methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase"
                     /protein_id="YP_005224470.1"
                     /db_xref="GeneID:11845151"
                     /translation="MTIINHTLGFPRVGLRRELKKAQESYWAGNATREELLAVGRELR
                     ARHWEQQKQAGVDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGSIDIDTLFRIGRG
                     RAPTGEPAAAAEMTKWFNTNYHYMVPEFVKGQQFKLSWTQLLDEVDEALALGHKIKPV
                     LLGPVTYLWLGKVKGEPFDRLTLLNAILPVYQQVLAELAKRGIDWVQIDEPALVLELP
                     PAWLEAFQPAYDALQGQVKLLLTTYFEGVSDNLATIAALPVQGLHVDLVHGKDDVAEL
                     HNRLPADWLLSAGLINGRNVWRADLTEKYAQIKDLVGKRELWVASSCSLLHSPIDLSV
                     ETRLDAEVKSWFAFALQKCGELALLRDALNSGDTAAITEWSAPIQARRHSTRVHNAEV
                     EKRLAAITAQDSQRASPYEVRAQAQRQRFNLPKWPTTTIGSFPQTTEIRGLRLDFKKG
                     NLDASHYRTGIAEHIKQAIVEQERLGLDVLVHGEAERNDMVEYFGEHLDGFIFTQNGW
                     VQSYGSRCVKPPVVIGDVSRPQAITVDWAKYAQSLTDKPVKGMLTGPVTILCWSFPRE
                     DVSRETIAKQIALALRDEVADLEAAGIGIIQIDEPALREGLPLKRSDWDAYLQWGVEA
                     FRLNAAVAKDDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEAFEY
                     PNEIGPGVYDIHSPNVPSVEWIEALLKKAAQRIPVERLWVNPDCGLKTRGWPETRAAL
                     ANMVQAARNLRQSA"
     misc_feature    190204..192462
                     /locus_tag="KPHS_01700"
                     /note="5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase; Provisional; Region: PRK05222"
                     /db_xref="CDD:235367"
     gene            complement(192524..193336)
                     /locus_tag="KPHS_01710"
                     /db_xref="GeneID:11845152"
     CDS             complement(192524..193336)
                     /locus_tag="KPHS_01710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dienelactone hydrolase"
                     /protein_id="YP_005224471.1"
                     /db_xref="GeneID:11845152"
                     /translation="MTTTKQPGFAPAASPHAATAVHTPEEHIIAGETSIPSQGENMPA
                     YHARPKNADGPLPIVIVVQEIFGVHEHIRDLCRRLAQEGYLAIAPELYFRQGDPNEYH
                     DIPTLFKELVSKVPDAQVLADLDHVASWAARHGGDAHRLLITGFCWGGRITWLYAAHN
                     PQLKAAVAWYGKLVGEKSLNSPKHPVDIAVDLNAPVLGLYGAKDASIPQDTVETMRQA
                     LRAANATAEIVVYPEADHAFNADYRASYHEESAKDGWQRMLAWFAQYGGKKG"
     misc_feature    complement(192545..193210)
                     /locus_tag="KPHS_01710"
                     /note="Dienelactone hydrolase family; Region: DLH;
                     pfam01738"
                     /db_xref="CDD:334658"
     gene            193609..194370
                     /locus_tag="KPHS_01720"
                     /db_xref="GeneID:11845153"
     CDS             193609..194370
                     /locus_tag="KPHS_01720"
                     /codon_start=1
                     /transl_table=11
                     /product="uridine phosphorylase"
                     /protein_id="YP_005224472.1"
                     /db_xref="GeneID:11845153"
                     /translation="MSKSDVFHLGLTKNDLQGATLAIVPGDPERVEKIAALMDKPVKL
                     ASHREFTSWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHI
                     NVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHIGVTASSD
                     TFYPGQERYDTFSGRVVSRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAG
                     VIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL"
     misc_feature    193618..194367
                     /locus_tag="KPHS_01720"
                     /note="uridine phosphorylase; Provisional; Region:
                     PRK11178"
                     /db_xref="CDD:183018"
     gene            194506..195954
                     /locus_tag="KPHS_01730"
                     /db_xref="GeneID:11845154"
     CDS             194506..195954
                     /locus_tag="KPHS_01730"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RmuC"
                     /protein_id="YP_005224473.1"
                     /db_xref="GeneID:11845154"
                     /translation="MDLSIIISAVIALAAGLMVGWLATKARADQIRADLIEERRELDI
                     ELSAARQQLAQEAHWREECELLNNELRSLRDINTSLEADLREVTTRLESTQLHAEDKI
                     RQMMNSEQRLSEQFENLANRIFEHSNRRVDEQNRQSLHGLLTPLREQLDGFRRQVQES
                     FGQEARERHTLAHEIRNLQQLNAQMAQEALNLTKALKGDNKTQGNWGEVVLTRVLEAS
                     GLREGYEYQTQVSIETDNRSRMQPDVIVRLPQGKDVVIDAKMTLVAYERYFNAEDDYT
                     REVALQEHLASVRNHIRLLGRKDYQQLPGLRSLDYVLMFIPVEPAFLLAIDRQPELIS
                     EALQNNIMLVSPTTLLVALRTIANLWRYEHQSRNAQKIAERAGRLYDKMRLFVDDMSA
                     IGQSLDKAQESYRQAMKKLASGRGNLLAQAEAFRGLGVEVKRGINPDLVEQATAQDEQ
                     YRLEDEDNLPENDAFSPDSAETVRSREAAPPR"
     misc_feature    194506..195933
                     /locus_tag="KPHS_01730"
                     /note="DNA recombination protein RmuC; Provisional;
                     Region: PRK10361"
                     /db_xref="CDD:182409"
     gene            196025..196780
                     /locus_tag="KPHS_01740"
                     /db_xref="GeneID:11845155"
     CDS             196025..196780
                     /locus_tag="KPHS_01740"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="YP_005224474.1"
                     /db_xref="GeneID:11845155"
                     /translation="MVEDSQETTHFGFQTVAKEQKADMVAHVFHSVAAKYDVMNDLMS
                     FGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVGETGRVMLADINDSMLK
                     MGREKLRNIGIVGNVEYVQANAEALPFADNTFDCITISFGLRNVTDKEKALRSMYRVL
                     KPGGRLLVLEFSKPIIEPLSKAYDAYSFHILPKVGELVAKDGDSYRYLAESIRMHPDQ
                     ETLKGMMQDAGFENVDYYNLTAGIVALHRGYKF"
     misc_feature    196061..196777
                     /locus_tag="KPHS_01740"
                     /note="ubiquinone/menaquinone biosynthesis
                     methyltransferase; Reviewed; Region: ubiE; PRK00216"
                     /db_xref="CDD:234689"
     misc_feature    order(196232..196252,196307..196312,196388..196396,
                     196439..196441)
                     /locus_tag="KPHS_01740"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            196794..197399
                     /locus_tag="KPHS_01750"
                     /db_xref="GeneID:11845156"
     CDS             196794..197399
                     /locus_tag="KPHS_01750"
                     /codon_start=1
                     /transl_table=11
                     /product="SCP2 domain-containing protein"
                     /protein_id="YP_005224475.1"
                     /db_xref="GeneID:11845156"
                     /translation="MPFTPLVTAGIETALNTFLWRDKALKPARQRLLGKVLRVQLQDF
                     ATPVVLVFSERQVDVLSAWDGEADCTVITRLSVLPKLRNRQQLTALIRSGDLEVQGDL
                     QVVQNMVSLCDLAEFDPAELLAPYTGDIVAEGVGKVLRGGAQFLLKGAERQQRYVAEA
                     ITEEWRLAPGPLELAWFAEETTAIERALAALEKRLETLEGK"
     misc_feature    196794..197396
                     /locus_tag="KPHS_01750"
                     /note="Ubiquinone biosynthesis protein UbiJ, contains SCP2
                     domain [Coenzyme transport and metabolism]; Region: UbiJ;
                     COG3165"
                     /db_xref="CDD:225706"
     gene            197396..199036
                     /locus_tag="KPHS_01760"
                     /db_xref="GeneID:11845157"
     CDS             197396..199036
                     /locus_tag="KPHS_01760"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ubiquinone biosynthesis protein UbiB"
                     /protein_id="YP_005224476.1"
                     /db_xref="GeneID:11845157"
                     /translation="MTPGELRRLYFIIHTFLSYGLDELIPKMRITLPLRIWRRMLFWM
                     PNRHQDQPLGARLRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDRVAPFEG
                     KLAQQQIEKAMGGLPVETWFDDFSVEPLASASIAQVHTARLKENGKEVVIKVIRPDIL
                     PIIKADMKLIYRLARWVPRLLPDGRRLRPQEVVREYEKTLLDELNLLRESANAIQLRR
                     NFEDSPMLYVPEVYPDYCSESMMVMERIYGIPVSDVEALEAQGTNMQLLAERGVQVFF
                     TQVFRDSFFHADMHPGNIFVSYEHPEDPQYIGIDCGIVGSLNKEDKRYLAENFIAFFN
                     RDYRKVAELHVDSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTAR
                     RFNMEVQPQLVLLQKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAF
                     KDKAPFWIERMPEIPELVYQSLQQSKQLQTSVDTIVRDMRVRHVRQGQSRYLFGIGAV
                     LLLSGTLLFIHRPEWGMMPGWLMAGGVVTWLIGWRKTH"
     misc_feature    197402..199030
                     /locus_tag="KPHS_01760"
                     /note="putative ubiquinone biosynthesis protein UbiB;
                     Reviewed; Region: ubiB; PRK04750"
                     /db_xref="CDD:235310"
     misc_feature    order(197822..197827,197831..197839,197843..197845,
                     197873..197875,197879..197881,198065..198067,
                     198122..198133,198257..198259,198269..198274,
                     198278..198280,198320..198325)
                     /locus_tag="KPHS_01760"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:270874"
     gene            199166..199417
                     /locus_tag="KPHS_01770"
                     /db_xref="GeneID:11845158"
     CDS             199166..199417
                     /locus_tag="KPHS_01770"
                     /codon_start=1
                     /transl_table=11
                     /product="twin arginine translocase protein A"
                     /protein_id="YP_005224477.1"
                     /db_xref="GeneID:11845158"
                     /translation="MGGISIWQLLIVVVIVVLLFGTKKLSSLGSDLGASIKGFKKAMS
                     DDDKPEKSAPDADFTAKTIADKQDDAKKDETKRHDKEQV"
     misc_feature    199166..199414
                     /locus_tag="KPHS_01770"
                     /note="twin arginine translocase protein A; Provisional;
                     Region: tatA; PRK03554"
                     /db_xref="CDD:179592"
     gene            199421..199957
                     /locus_tag="KPHS_01780"
                     /db_xref="GeneID:11845159"
     CDS             199421..199957
                     /locus_tag="KPHS_01780"
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent protein translocase TatB"
                     /protein_id="YP_005224478.1"
                     /db_xref="GeneID:11845159"
                     /translation="MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVVGWIRTLRSLAT
                     TVQNELAQELKLQEFQESLKKVEKASLNNLTPELKASMDELREAAESMKRSYSAHDPE
                     KASDEANTILNPVVKGSEAQRQDVTPATAEHQASAPAHAPDPVADEQSASPADLQAEK
                     TSATAAVPHSSPASSDKP"
     misc_feature    199421..199954
                     /locus_tag="KPHS_01780"
                     /note="sec-independent translocase; Provisional; Region:
                     PRK01770"
                     /db_xref="CDD:179334"
     gene            199960..200739
                     /locus_tag="KPHS_01790"
                     /db_xref="GeneID:11845160"
     CDS             199960..200739
                     /locus_tag="KPHS_01790"
                     /codon_start=1
                     /transl_table=11
                     /product="TatABCE protein translocation system subunit"
                     /protein_id="YP_005224479.1"
                     /db_xref="GeneID:11845160"
                     /translation="MGVDDTQPLISHLIELRKRLLNSIIAILVIFLALVYFANDIYQL
                     VSAPLISKMPVGATMIATDVASPFFTPIKLTFMVSVILSVPIILYQVWAFVAPALYKH
                     ERRLVVPLLVSSTLLFYIGMAFAYFVVFPLAFGFLTHAAPEGVLVSTDIRSYLDFVMA
                     LFMAFGVSFEVPVAIVLLCWMGVTTPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLL
                     AIPMYCLFEVGVFFARFYTGKRLTRDDDAAAEAEAAEHREE"
     misc_feature    199960..200688
                     /locus_tag="KPHS_01790"
                     /note="twin-arginine protein translocation system subunit
                     TatC; Provisional; Region: PRK10921"
                     /db_xref="CDD:182840"
     gene            200772..201575
                     /locus_tag="KPHS_01800"
                     /db_xref="GeneID:11845161"
     CDS             200772..201575
                     /locus_tag="KPHS_01800"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease TatD"
                     /protein_id="YP_005224480.1"
                     /db_xref="GeneID:11845161"
                     /translation="MGAIMFDIGVNLTSSQFSRDHDEVVARALAAGVNGMLLTGTNLA
                     ESQQAQKLASRYSGCWSTAGVHPHDGSSWTPAVAEAIYTLAGEPQVVAIGECGLDFNR
                     NFSTPHEQEVAFSAQLALAAELSMPVFLHCRDAHDRFLTLLKPWLEKIPGAVLHCFTG
                     SRSEVQECLDLGLFIGITGWVCDERRGLELRELLPAIPAERLLLETDAPYLLPRDLKP
                     KPASRRNEPAYLPHILASVAAWRGEEAQWLEAQTDANVRALFGVDINGV"
     misc_feature    200784..201557
                     /locus_tag="KPHS_01800"
                     /note="DNase TatD; Provisional; Region: PRK10425"
                     /db_xref="CDD:182449"
     misc_feature    order(200796..200798,200802..200804,201162..201164,
                     201237..201239,201390..201392)
                     /locus_tag="KPHS_01800"
                     /note="active site"
                     /db_xref="CDD:238635"
     gene            complement(201572..202060)
                     /locus_tag="KPHS_01810"
                     /db_xref="GeneID:11845162"
     CDS             complement(201572..202060)
                     /locus_tag="KPHS_01810"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator RfaH"
                     /protein_id="YP_005224481.1"
                     /db_xref="GeneID:11845162"
                     /translation="MQAWYLLYCKRGQLQRAQEHLERQSVNCLMPTIALEKIIRGKRT
                     MVSEPLFPNYLFIEFDPEVIHTTTISATRGVNNFVRFGALPAIVPSAVIHQLSIYKPE
                     GITDPETPHEGDSVLITDGAFEGLEAIFTEPDGEARSMLLLNLLNKQVLQSVKNTDFQ
                     KI"
     misc_feature    complement(201575..202060)
                     /locus_tag="KPHS_01810"
                     /note="transcriptional activator RfaH; Provisional;
                     Region: rfaH; PRK09014"
                     /db_xref="CDD:181611"
     gene            202100..202219
                     /locus_tag="KPHS_01820"
                     /db_xref="GeneID:11845163"
     CDS             202100..202219
                     /locus_tag="KPHS_01820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224482.1"
                     /db_xref="GeneID:11845163"
                     /translation="MAGVIAKAIIIEIQISAFFHANLTKLQHRAVEHRIISRL"
     gene            202239..203714
                     /locus_tag="KPHS_01830"
                     /db_xref="GeneID:11845164"
     CDS             202239..203714
                     /locus_tag="KPHS_01830"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="YP_005224483.1"
                     /db_xref="GeneID:11845164"
                     /translation="MKYHDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRAGG
                     PALLFENPKGYTMPVLCNLFGTPRRVALGMGQEDVSSLREVGKLLAFLKEPEPPKGFR
                     DLFDKLPQFKQVLNMPTKRLRGAPCQQKIIQGDDVDLNKIPIMTCWPEDAAPLITWGL
                     TVTRGPHKERQNLGIYRQQLIGKNKLIMRWLSHRGGALDFQEWCAARPGERFPVSVAL
                     GADPATILGAVTPVPDPLSEYAFAGLLRGTKTEVVKCVSNDLEVPASAEIVLEGYIEA
                     GEMAPEGPYGDHTGYYNEVDQFPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALN
                     EVFVPILQKQFPEIVDFYLPPEGCSYRLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYT
                     KFVIVCDDDVNARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFASPVSGLGSKMGL
                     DATNKWPGETQREWGRPIKKDPAVTARIDAIWDELAIFKQQ"
     misc_feature    202239..203705
                     /locus_tag="KPHS_01830"
                     /note="3-octaprenyl-4-hydroxybenzoate decarboxylase;
                     Provisional; Region: PRK10922"
                     /db_xref="CDD:236796"
     gene            203764..204465
                     /locus_tag="KPHS_01840"
                     /db_xref="GeneID:11845165"
     CDS             203764..204465
                     /locus_tag="KPHS_01840"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="YP_005224484.1"
                     /db_xref="GeneID:11845165"
                     /translation="MTTLSCKVTSVEAITDTVYRVRLVPEAAFSFRAGQYLMVVMDER
                     DKRPFSMASTPAEQEFIELHIGASELNLYAMAVMDRILKEREIEVDIPHGEAWLRDDE
                     DRPLILIAGGTGFSYVRSILLSALARNPDRDIAIYWGGREAKHLYDLAELEALSIKHP
                     NLRIEPVVEQPEEGWRGRSGTVLTAVLQDYGTLAEHDIYIAGRFEMAKIARDLFCNER
                     GAREDRLFGDAFAFI"
     misc_feature    203767..204462
                     /locus_tag="KPHS_01840"
                     /note="FMN reductase; Validated; Region: fre; PRK08051"
                     /db_xref="CDD:236142"
     gene            complement(204573..205736)
                     /locus_tag="KPHS_01850"
                     /db_xref="GeneID:11845166"
     CDS             complement(204573..205736)
                     /locus_tag="KPHS_01850"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="YP_005224485.1"
                     /db_xref="GeneID:11845166"
                     /translation="MEQVVIVDAIRTPMGRSKGGAFRHVRAEDLSAHLMRSLLSRNPS
                     LEASAIDDIYWGCVQQTLEQGFNIARNAALLAEIPHSVPANTVNRLCGSSMQALHDAA
                     RMIMTGDASVCLIGGVEHMGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLARLHGI
                     SREMQDQFAARSHARAWAATQSGAFKAEIIPTGGHDADGVLKSFNYDEVIRPETTVET
                     LSTLKPAFDPVTGTVTAGTSSALSDGAAAMLLMSESRARELGLKPRARVRSMAVVGCD
                     PSIMGYGPVPASKLALKKAGLSTSNIDVFEMNEAFAAQILPCIKDLGLMEQIDEKINL
                     NGGAIALGHPLGCSGARISTTLINQMERKDAQFGLATMCIGLGQGIATVFERV"
     misc_feature    complement(204576..205736)
                     /locus_tag="KPHS_01850"
                     /note="3-ketoacyl-CoA thiolase; Reviewed; Region: fadA;
                     PRK08947"
                     /db_xref="CDD:181592"
     gene            complement(205746..207935)
                     /locus_tag="KPHS_01860"
                     /db_xref="GeneID:11845167"
     CDS             complement(205746..207935)
                     /locus_tag="KPHS_01860"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA
                     dehydrogenase/3-hydroxybutyryl-CoA
                     epimerase/delta(3)-cis-delta(2)-trans-enoyl-CoA
                     isomerase/enoyl-CoA hydratase"
                     /protein_id="YP_005224486.1"
                     /db_xref="GeneID:11845167"
                     /translation="MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALD
                     VLEKQSDLKGLLLRSEKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLP
                     VPTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGA
                     DSALEIIAAGKDVGADQALKIGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPK
                     LEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPITAVKTIEAAARLGREEALVLENKS
                     FVPLAHTNEARALVGIFLNDQYVKAKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAW
                     KGVPVVMKDISDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVISTIQPTLEYSGFDR
                     VDVVVEAVVENPKVKKAVLAETESKVRPDTVLASNTSTIPISELASVLQRPENFCGMH
                     FFNPVHRMPLVEVIRGEKTSDNTIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFA
                     GFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQK
                     DYRDAIDALFDANRFGQKNGLGFWRYKDDSKGKPKKEEDAAVDSLLADVSQSKRDFSD
                     EEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTIGSAK
                     YLDIAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPARPVGALKTA"
     misc_feature    complement(205791..207935)
                     /locus_tag="KPHS_01860"
                     /note="multifunctional fatty acid oxidation complex
                     subunit alpha; Reviewed; Region: fadB; PRK11730"
                     /db_xref="CDD:183293"
     gene            208127..209458
                     /locus_tag="KPHS_01870"
                     /db_xref="GeneID:11845168"
     CDS             208127..209458
                     /locus_tag="KPHS_01870"
                     /codon_start=1
                     /transl_table=11
                     /product="proline dipeptidase"
                     /protein_id="YP_005224487.1"
                     /db_xref="GeneID:11845168"
                     /translation="MESLAALYKNHIVTLQERTRDVLARFQMDALLIHSGELVNVFLD
                     DHPYPFKVNPQFKAWVPVTQVPNCWLLVDGVNKPKLWFYLPVDYWHNVEPLPTSFWTE
                     EIDVIALPKADGIGSQLPAARGNIGYIGPVPERALGLGIAADKINPKGVIDYLHYYRA
                     YKTDYELACMREAQKSAVNGHRAAYEAFQSGMSEFDINQAYLTATGHRDTDVPYSNIV
                     ALNEHASVLHYTKLDHRAPAEMRSFLLDAGAEYNGYAADLTRTWAAHGDNDFAHLIKD
                     VNDEQQALISTMKAGTSYIDYHIQFHQRIAKLLRKHQLVTDMSEEAMVENDLTGPFMP
                     HGIGHPLGLQVHDVAGFMQDDTGTHLAAPSKYPYLRCTRIIEPRMVLTIEPGIYFIES
                     LLAPWREGPFSKHFNWQKIDAMKPFGGIRIEDNVVIHENSIENMTRDLKLA"
     misc_feature    208127..209455
                     /locus_tag="KPHS_01870"
                     /note="proline dipeptidase; Provisional; Region: PRK13607"
                     /db_xref="CDD:237444"
     gene            209458..210072
                     /locus_tag="KPHS_01880"
                     /db_xref="GeneID:11845169"
     CDS             209458..210072
                     /locus_tag="KPHS_01880"
                     /codon_start=1
                     /transl_table=11
                     /product="IMPACT family protein"
                     /protein_id="YP_005224488.1"
                     /db_xref="GeneID:11845169"
                     /translation="MESWLIPAAPVTVVEEIKKSRFITLLAHTDGVAAAKAFVESVRA
                     DHPDARHHCVAWVAGPPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRY
                     YGGILLGTGGLVKAYGGGVHQALAQLTTLRKTPLTAYTLQCEYGQLAGVEALLAQFSG
                     NVVESEYLASVRLRVALPQAEVAAFSARLADFSRGSLQLLKINE"
     misc_feature    209458..210069
                     /locus_tag="KPHS_01880"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11568"
                     /db_xref="CDD:183205"
     gene            210111..211562
                     /locus_tag="KPHS_01890"
                     /db_xref="GeneID:11845170"
     CDS             210111..211562
                     /locus_tag="KPHS_01890"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transport protein"
                     /protein_id="YP_005224489.1"
                     /db_xref="GeneID:11845170"
                     /translation="MHFRAITRIVGLLVILFSGTMIVPGLVALIYRDGAGRAFTQTFF
                     VALAIGSMLWWPNRKQKGELKSREGFLIVVLFWTVLGSVGALPFIFSEQPNLTVTDAF
                     FESFSGLTTTGATTLVGLDSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQL
                     YRAEMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALALWFAGMPAFDAIGHSFATI
                     AIGGFSTHDASVGYFNSPMINSIIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRM
                     FIGVQLTLVIVCTLVLWLHNVYGSVLTTLNQAFFQVVSMATTAGFTTDSIARWPLFLP
                     VLLLCSAFIGGCAGSTGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPER
                     ILEAVWGFFSAYALVFIISMLAIIATGVDDFSAFASVVATLNNLGPGLGVVADNFATM
                     NPVAKWILIANMLFGRLEVFTLLVLFTPTFWRE"
     misc_feature    210111..211559
                     /locus_tag="KPHS_01890"
                     /note="potassium transporter; Provisional; Region:
                     PRK10750"
                     /db_xref="CDD:182698"
     gene            211574..212107
                     /locus_tag="KPHS_01900"
                     /db_xref="GeneID:11845171"
     CDS             211574..212107
                     /locus_tag="KPHS_01900"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_005224490.1"
                     /db_xref="GeneID:11845171"
                     /translation="MKTLILFSTRDGQTREIASFLASELKELGIDADTLNLNRTDVVE
                     WHHYDRVVIGASIRYGHFHPAVDRFVKKHLAALQALPGAFFSVNLVARKPEKRTPQTN
                     SYTRKFLLNSPWQPQSCAVFAGALRYPRYSWYDRFMIRLIMKMTGGETDTRKEVVYTD
                     WQQVSRFAREIAQMARK"
     misc_feature    211574..212104
                     /locus_tag="KPHS_01900"
                     /note="protoporphyrinogen oxidase; Provisional; Region:
                     hemG; PRK11104"
                     /db_xref="CDD:182966"
     gene            212502..214028
                     /locus_tag="KPHS_r00210"
                     /db_xref="GeneID:11845172"
     rRNA            212502..214028
                     /locus_tag="KPHS_r00210"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11845172"
     gene            214464..217362
                     /locus_tag="KPHS_r00130"
                     /db_xref="GeneID:11845173"
     rRNA            214464..217362
                     /locus_tag="KPHS_r00130"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11845173"
     gene            217462..217576
                     /locus_tag="KPHS_r00040"
                     /db_xref="GeneID:11845174"
     rRNA            217462..217576
                     /locus_tag="KPHS_r00040"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11845174"
     gene            217993..219021
                     /locus_tag="KPHS_01910"
                     /db_xref="GeneID:11845175"
     CDS             217993..219021
                     /locus_tag="KPHS_01910"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate dehydrogenase"
                     /protein_id="YP_005224491.1"
                     /db_xref="GeneID:11845175"
                     /translation="MNHSLKPWNTFGIERFAKTIVRAETEQQLLSAWQTAAAAGEPTL
                     ILGEGSNVLFLNDYAGTVILNRIMGIEVSETPEAWRLHVGAGENWHQLVQFTLQHAMP
                     GLENLALIPGCAGSSPIQNIGAYGVELQRVCEYVDCIELETGRKQRLSAAECRFGYRD
                     SIFKHEYQDRYAIVAIGLSLAKTWQPVLSYGDLTRLDPQTVTPQQVFDAVCHMRMTKL
                     PDPKINGNAGSFFKNPIVSAQVAEALLAQFPHAPHYPQANGSVKLAAGWLIDQCELKG
                     QRIGGAAVHRQQALVLINEDRATSEDVVKLAHYVRQRVGAKFDVWLQPEVRFIGTHGE
                     VNAEESIA"
     misc_feature    217993..218979
                     /locus_tag="KPHS_01910"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase;
                     Provisional; Region: murB; PRK00046"
                     /db_xref="CDD:234593"
     gene            219018..219980
                     /locus_tag="KPHS_01920"
                     /db_xref="GeneID:11845176"
     CDS             219018..219980
                     /locus_tag="KPHS_01920"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--protein ligase"
                     /protein_id="YP_005224492.1"
                     /db_xref="GeneID:11845176"
                     /translation="MKDHTIPLTLISILADGEFHSGEQLGEQLGMSRAAINKHIQTLR
                     DWGVDVFTVPGKGYSLPEPIHLLDEKKISQEIDHGRVTVLPVIDSTNQYLLDRLDELT
                     SGDACVAEYQQAGRGRRGRKWFSPFGANLYLSMYWRLEQGPAAAIGLSLVIGIVIAEV
                     LQQLGAEQVRVKWPNDIYLQDRKLSGILVELTGKTGDAAQIVSGAGINLVMRRVESDV
                     VNQGWISLQEAGVVIDRNLLAARLIKELRLGLELFEQEGLAPYLPRWEKLDNFIHRPV
                     KLIIGDKEIYGISRGIDAQGALLLEQDGVIKAWVGGEISLRSAE"
     misc_feature    219021..219977
                     /locus_tag="KPHS_01920"
                     /note="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor; Provisional; Region:
                     PRK11886"
                     /db_xref="CDD:237010"
     gene            complement(220006..220872)
                     /locus_tag="KPHS_01930"
                     /db_xref="GeneID:11845177"
     CDS             complement(220006..220872)
                     /locus_tag="KPHS_01930"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_005224493.1"
                     /db_xref="GeneID:11845177"
                     /translation="MTLTEEEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRR
                     QAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFL
                     HPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPNGDK
                     TVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLK
                     FREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKS
                     ANHSVNQVRLRK"
     misc_feature    complement(220009..220872)
                     /locus_tag="KPHS_01930"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:327404"
     misc_feature    complement(order(220036..220038,220048..220050,
                     220228..220230,220240..220242,220645..220656,
                     220663..220665))
                     /locus_tag="KPHS_01930"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(220036..220038,220216..220218,
                     220228..220230,220426..220428,220639..220641,
                     220651..220656))
                     /locus_tag="KPHS_01930"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(220360..220362,220651..220653))
                     /locus_tag="KPHS_01930"
                     /note="Mg2+-binding site [ion binding]; other site"
                     /db_xref="CDD:238983"
     gene            221942..223126
                     /locus_tag="KPHS_01940"
                     /db_xref="GeneID:11845178"
     CDS             221942..223126
                     /locus_tag="KPHS_01940"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="YP_005224494.1"
                     /db_xref="GeneID:11845178"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPIVRGSALKALEGDAEWEAKIIELAGHLDTYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIIKVGEEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREEIERGQVLAKPGTINPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     LG"
     misc_feature    221942..223120
                     /locus_tag="KPHS_01940"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     gene            223463..223846
                     /locus_tag="KPHS_01950"
                     /db_xref="GeneID:11845179"
     CDS             223463..223846
                     /locus_tag="KPHS_01950"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_005224495.1"
                     /db_xref="GeneID:11845179"
                     /translation="MSANTEAQGSGRGLEAMKWIIVAVLLIVAIVGNFLYRDIMLAVR
                     ALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     misc_feature    223559..223834
                     /locus_tag="KPHS_01950"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     gene            223848..224393
                     /locus_tag="KPHS_01960"
                     /db_xref="GeneID:11845180"
     CDS             223848..224393
                     /locus_tag="KPHS_01960"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusG"
                     /protein_id="YP_005224496.1"
                     /db_xref="GeneID:11845180"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFSQVEKA"
     misc_feature    223851..224387
                     /locus_tag="KPHS_01960"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     gene            224550..224978
                     /locus_tag="KPHS_01970"
                     /db_xref="GeneID:11845181"
     CDS             224550..224978
                     /locus_tag="KPHS_01970"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_005224497.1"
                     /db_xref="GeneID:11845181"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTDSLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKIS
                     RAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED"
     misc_feature    224550..224975
                     /locus_tag="KPHS_01970"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    order(224577..224579,224637..224639,224772..224780,
                     224790..224792,224811..224813,224886..224888,
                     224901..224909,224919..224921,224928..224933,
                     224940..224945,224949..224957)
                     /locus_tag="KPHS_01970"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(224577..224579,224721..224723,224727..224738,
                     224748..224750,224754..224759,224889..224894,
                     224901..224906)
                     /locus_tag="KPHS_01970"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(224625..224627,224637..224639)
                     /locus_tag="KPHS_01970"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(224829..224831,224838..224840)
                     /locus_tag="KPHS_01970"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            224982..225686
                     /locus_tag="KPHS_01980"
                     /db_xref="GeneID:11845182"
     CDS             224982..225686
                     /locus_tag="KPHS_01980"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_005224498.1"
                     /db_xref="GeneID:11845182"
                     /translation="MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFTESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLAE
                     QIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTM
                     GAGVAVDQAGLNASAN"
     misc_feature    224985..225674
                     /locus_tag="KPHS_01980"
                     /note="50S ribosomal protein L1; Validated; Region: rplA;
                     PRK05424"
                     /db_xref="CDD:180071"
     misc_feature    order(225087..225095,225102..225104,225108..225110,
                     225114..225116,225120..225122,225483..225485,
                     225489..225491,225495..225497,225633..225638,
                     225642..225644)
                     /locus_tag="KPHS_01980"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            226100..226597
                     /locus_tag="KPHS_01990"
                     /db_xref="GeneID:11845183"
     CDS             226100..226597
                     /locus_tag="KPHS_01990"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_005224499.1"
                     /db_xref="GeneID:11845183"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRD
                     AKEAA"
     misc_feature    226106..226591
                     /locus_tag="KPHS_01990"
                     /note="50S ribosomal protein L10; Reviewed; Region: rplJ;
                     PRK00099"
                     /db_xref="CDD:234632"
     misc_feature    order(226121..226126,226133..226135,226265..226276,
                     226283..226285)
                     /locus_tag="KPHS_01990"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(226367..226369,226436..226438,226445..226447,
                     226493..226495,226502..226507,226514..226519,
                     226523..226531,226535..226543,226547..226555,
                     226562..226567,226571..226576)
                     /locus_tag="KPHS_01990"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            226664..227029
                     /locus_tag="KPHS_02000"
                     /db_xref="GeneID:11845184"
     CDS             226664..227029
                     /locus_tag="KPHS_02000"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_005224500.1"
                     /db_xref="GeneID:11845184"
                     /translation="MSITKDQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAG
                     PVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKD
                     DAEALKKSLEEAGAEVEVK"
     misc_feature    226664..227026
                     /locus_tag="KPHS_02000"
                     /note="50S ribosomal protein L7/L12; Reviewed; Region:
                     rplL; PRK00157"
                     /db_xref="CDD:234671"
     gene            227354..231382
                     /locus_tag="KPHS_02010"
                     /db_xref="GeneID:11845185"
     CDS             227354..231382
                     /locus_tag="KPHS_02010"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_005224501.1"
                     /db_xref="GeneID:11845185"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTE
                     QILDLFFEKVVFEIRDNKLQMELIPERLRGETASFDIEANGKVYVEKGRRITARHIRQ
                     LEKDDIKHIEVPVEYIAGKVAAKDYIDEATGELICPANMELSLDLLAKLSQSGHKRIE
                     TLFTNDLDHGPYISETVRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRKVTNGVVTDEIHYLSAIEEGNYVIAQANSNLD
                     ENGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDE
                     MYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPIERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLF
                     SRIYAVLVSGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPIEDMPHD
                     ANGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQ
                     RAYDLGADVRQKVDLNTFSDEEVLRLAENLRKGMPIATPVFDGAKEAEIKELLQLGDL
                     PTSGQITLFDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
                     ESFNVLLKEIRSLGINIELEDE"
     misc_feature    227354..231379
                     /locus_tag="KPHS_02010"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     gene            231459..235682
                     /locus_tag="KPHS_02020"
                     /db_xref="GeneID:11845186"
     CDS             231459..235682
                     /locus_tag="KPHS_02020"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_005224502.1"
                     /db_xref="GeneID:11845186"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELACPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERNQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLRNMDLEQECEQLREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDSVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEYEKDDNGEFVAK
                     TSLKDTTVGRAILWMIVPKGLPFSIVNQALGKKAISKMLNTCYRILGLKPTVIFADQT
                     MYTGFAYAARSGASVGIDDMVIPEKKYEIISEAEAEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANDRVSKAMMDNLQTETVINRDGQEEQQVSFNSIYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTLEGITMTPVIEGGDVKEPLRDRVLGRVTAEDVLKPGTADI
                     LVPRNTLLHEHWCDLLEANSVDSVKVRSVVSCDTDFGVCAHCYGRDLARGHLINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKLSNAKSVVNSSGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMAKGDGEQVAGGETVANWDPHTMPVITE
                     VSGFIRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDV
                     LIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVITPVDGSEPYEEMIPKWRQLNVFEGERV
                     ERGDVVSDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLR
                     KATIESAGSSDFLEGEQVEYSRVKIANRELEANGKVGATFSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEL
                     PAAPQVSVEEASANLAELLNAGLGGSDND"
     misc_feature    231504..235601
                     /locus_tag="KPHS_02020"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     gene            236083..237423
                     /locus_tag="KPHS_02030"
                     /db_xref="GeneID:11845187"
     CDS             236083..237423
                     /locus_tag="KPHS_02030"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter"
                     /protein_id="YP_005224503.1"
                     /db_xref="GeneID:11845187"
                     /translation="MEFAIQLIIILICLFYGARKGGIALGLLGGIGLVILVFVFHLQP
                     GKPPVDVMLVIIAVVAASATLQASGGLDVMLQIAEKLLRRNPKYVSIVAPFVTCTLTI
                     LCGTGHVVYTILPIIYDVAIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLVAMLG
                     NFTFNGKHLEFLDLLAITIPSTLLGILAIGIFSWFRGKDLDQDEAFQAFIALPENRHY
                     VYGDTATLLDKKLPTSNWIAMWIFLASIAVVALLGAFSELRPAFDGKPLSMVLVIQMF
                     MLLSGALIIIITKTNPASISKNEVFRSGMIAIVAVYGIAWMAETMFGAHMTEIKGVLG
                     EMVKEYPWAYAIVLLLVSKFVNSQAAALAAIVPVALAIGVDPAYIVASAPACYGYYIL
                     PTYPSDLAAIQFDRSGTTHIGRFVINHSFILPGLIGVGVSCVFGWVFAAMYGFL"
     misc_feature    236194..237414
                     /locus_tag="KPHS_02030"
                     /note="anaerobic C4-dicarboxylate transporter; Reviewed;
                     Region: PRK12489"
                     /db_xref="CDD:237115"
     gene            complement(237466..237783)
                     /locus_tag="KPHS_02040"
                     /db_xref="GeneID:11845188"
     CDS             complement(237466..237783)
                     /locus_tag="KPHS_02040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PEP-dependent phosphotransferase enzyme
                     III"
                     /protein_id="YP_005224504.1"
                     /db_xref="GeneID:11845188"
                     /translation="MEDLETIIMELLVNAGSARSAALTALQLARKGDFVAAEQAMAES
                     HEFVKHAHKIQTQLIGMDEGSGKLPVNLITVHSQDHLMNAMVIQDLATDMIELYRRLP
                     LAQ"
     misc_feature    complement(order(237538..237540,237559..237564,
                     237610..237612,237772..237774))
                     /locus_tag="KPHS_02040"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    complement(237487..237759)
                     /locus_tag="KPHS_02040"
                     /note="PTS system, Lactose/Cellobiose specific IIA
                     subunit; Region: PTS_IIA; pfam02255"
                     /db_xref="CDD:334863"
     misc_feature    complement(order(237544..237552,237556..237558,
                     237727..237729))
                     /locus_tag="KPHS_02040"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    complement(237556..237558)
                     /locus_tag="KPHS_02040"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    complement(237547..237549)
                     /locus_tag="KPHS_02040"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            complement(237787..238047)
                     /locus_tag="KPHS_02050"
                     /db_xref="GeneID:11845189"
     CDS             complement(237787..238047)
                     /locus_tag="KPHS_02050"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose specific
                     transporter subunit IIB"
                     /protein_id="YP_005224505.1"
                     /db_xref="GeneID:11845189"
                     /translation="MLVQRMQDAAQKKGVEVSIKAVPVAEFKDNLAAADIILLGPQVK
                     YEQAKLQALADPFGKKVAVIDMMDYGMMKGDAVLDKALKMLE"
     misc_feature    complement(237799..238047)
                     /locus_tag="KPHS_02050"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     gene            complement(238264..239796)
                     /locus_tag="KPHS_02060"
                     /db_xref="GeneID:11845190"
     CDS             complement(238264..239796)
                     /locus_tag="KPHS_02060"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="YP_005224506.1"
                     /db_xref="GeneID:11845190"
                     /translation="MALHNRKLSFTTPIVVGFAGILLSFMLIAIFVTLAQQKDFLEDY
                     HDINRNFTHNLAINYTETLLRENDFILGRAAAFFARNDELNRAVNVEPEKGLTTLMQL
                     QNMMPSVSSISLADTEGHYLRAPEVLENEDSRAFDPKTRPWFIKQAEASTFSHYTSPY
                     MDYFTHHPTITIFKPIITPEGKLKGSLAFHLDLTSMGFALRQMVAPVQGEFFVVQRDG
                     KVVLHSDPGALFKPFVRDELMDKMTSGEGQLYDPGSDTWYYYYSFTNPDWFVIFRVDN
                     ATLVNLTRHETNLVIGGFTLAAIIIILFGLYLRHASRTVLMNIINAIKTGDVKRAPRL
                     EAMLSKAIETNKQRELSYVRQATIDALTGCKNRRAFDSDIAALMNDHQPFALALVDID
                     NFKSINDTWGHLNGDIVLRNVAREGLQVLQPLEISLYRYGGEEFAVVFPAEHIDNART
                     LLETWRVNVERRTWREDGLTVTFSAGLGEWNMEPLDKLVVSVDEALYKAKQQGKNRIL
                     RA"
     misc_feature    complement(239218..239607)
                     /locus_tag="KPHS_02060"
                     /note="first PDC (PhoQ/DcuS/CitA) domain of
                     methyl-accepting chemotaxis proteins, diguanylate-cyclase
                     and similar domains; Region: PDC1_HK_sensor; cd18773"
                     /db_xref="CDD:350341"
     misc_feature    complement(238276..>239400)
                     /locus_tag="KPHS_02060"
                     /note="putative diguanylate cyclase YedQ; Provisional;
                     Region: PRK15426"
                     /db_xref="CDD:237964"
     misc_feature    complement(238276..238728)
                     /locus_tag="KPHS_02060"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(238495..238497,238627..238629))
                     /locus_tag="KPHS_02060"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(238492..238503,238507..238509,
                     238576..238578,238588..238590,238600..238605,
                     238612..238614))
                     /locus_tag="KPHS_02060"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(238435..238437,238522..238524))
                     /locus_tag="KPHS_02060"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            239909..240031
                     /locus_tag="KPHS_02070"
                     /db_xref="GeneID:11845191"
     CDS             239909..240031
                     /locus_tag="KPHS_02070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224507.1"
                     /db_xref="GeneID:11845191"
                     /translation="MYRDLYSAIMCRPLLSAERQGENEEEKVRPGQRPLLTRAE"
     gene            complement(240113..241246)
                     /locus_tag="KPHS_02080"
                     /db_xref="GeneID:11845192"
     CDS             complement(240113..241246)
                     /locus_tag="KPHS_02080"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein ThiH"
                     /protein_id="YP_005224508.1"
                     /db_xref="GeneID:11845192"
                     /translation="MKTFSDRWRQLEWDDIRLRINSKTAADVERALAAKQLTRDDMMA
                     LLSPAAANYLEPLAQRAQRLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIKR
                     KTLDAAEIARECAAIRNLGFEHLLLVTGEHQGKVGMDYFRQHLPAIRSQFASLHMEVQ
                     PLATEEYAELKTLGLDGVMVYQETYHESMYAKHHLKGKKQDFFWRLDTPDRLGAAGID
                     KIGLGALIGLSDSWRVDCFIVAEHLLWLQQRYWRSRYSVSFPRLRPCAGGIEPASLMD
                     ERQLVQTICAFRLLAPEVELSLSTRESPWFRDRVIPLAINNVSAFSKTQPGGYADDHP
                     ELEQFAPHDDRRPEEVASALAARGLQPVWKDWDSWLGRASQTS"
     misc_feature    complement(240128..241243)
                     /locus_tag="KPHS_02080"
                     /note="thiamine biosynthesis protein ThiH; Reviewed;
                     Region: thiH; PRK09240"
                     /db_xref="CDD:236425"
     gene            complement(241243..242013)
                     /locus_tag="KPHS_02090"
                     /db_xref="GeneID:11845193"
     CDS             complement(241243..242013)
                     /locus_tag="KPHS_02090"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis ThiGH complex subunit for
                     thiazole moiety"
                     /protein_id="YP_005224509.1"
                     /db_xref="GeneID:11845193"
                     /translation="MLRIADKTFESHLFTGTGKFAAPEVMVEAIRASGSQLVTLAMKR
                     VDLRQRNDAILAPLLAAGVNLLPNTSGAKTAEEAVFAARLAREALGTHWLKLEIHPDA
                     RWLLPDPIETLKAAELLVREGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQG
                     LETKAMLEIIIEQATVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVAMAR
                     AFRMAIDAGLLARQAGPGARSTQAQATSPLTGFLEALA"
     misc_feature    complement(241264..242013)
                     /locus_tag="KPHS_02090"
                     /note="thiazole synthase; Reviewed; Region: thiG;
                     PRK00208"
                     /db_xref="CDD:234687"
     gene            complement(242015..242215)
                     /locus_tag="KPHS_02100"
                     /db_xref="GeneID:11845194"
     CDS             complement(242015..242215)
                     /locus_tag="KPHS_02100"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="YP_005224510.1"
                     /db_xref="GeneID:11845194"
                     /translation="MQIWFNDEPLACADNLSVSALLTQLEQQQPGVALALNQHILPRD
                     RWEDHLLQEGDRVLLFQVIAGG"
     misc_feature    complement(242018..242215)
                     /locus_tag="KPHS_02100"
                     /note="sulfur carrier protein ThiS; Provisional; Region:
                     PRK08053"
                     /db_xref="CDD:181210"
     misc_feature    complement(order(242021..242044,242096..242098,
                     242111..242113,242117..242125,242135..242137,
                     242141..242143,242186..242188,242192..242203))
                     /locus_tag="KPHS_02100"
                     /note="thiS-thiG interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340451"
     misc_feature    complement(order(242018..242038,242042..242044,
                     242090..242092,242096..242104,242117..242125,
                     242195..242197))
                     /locus_tag="KPHS_02100"
                     /note="thiS-thiF interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:340451"
     misc_feature    complement(order(242021..242038,242042..242044,
                     242117..242125,242195..242197))
                     /locus_tag="KPHS_02100"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:340451"
     gene            complement(242199..242954)
                     /locus_tag="KPHS_02110"
                     /db_xref="GeneID:11845195"
     CDS             complement(242199..242954)
                     /locus_tag="KPHS_02110"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiF"
                     /protein_id="YP_005224511.1"
                     /db_xref="GeneID:11845195"
                     /translation="MNDHDFMRYSRQLLLEDIAIEGQQKLLASRVLIIGLGGLGSPAA
                     LYLAGAGVGTLTLADDDAVHLSNLQRQILFTSADIDRPKAAAAQTRLSQLNPQIKLVA
                     LQQRLSGEALRAEVAKADVVLDCTDNMVTRQAINAACVALDTPLVTASAVGFGGQLMV
                     LTPPWRQGCYRCLWPESDEPQRNCRTAGIVGPVVGMMGTLQALETIKLLSGMATPRNT
                     LRLFDARTSNWRALALQRSRSCPVCGGRHADLV"
     misc_feature    complement(242253..242933)
                     /locus_tag="KPHS_02110"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(242562..242564,242580..242582,
                     242706..242708,242745..242747,242772..242774,
                     242778..242780,242838..242840,242844..242846,
                     242850..242852))
                     /locus_tag="KPHS_02110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(242256..242261,242265..242267,
                     242286..242288,242298..242300,242484..242486,
                     242490..242492,242502..242507,242559..242561,
                     242571..242579,242838..242840))
                     /locus_tag="KPHS_02110"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            complement(242947..243582)
                     /locus_tag="KPHS_02120"
                     /db_xref="GeneID:11845196"
     CDS             complement(242947..243582)
                     /locus_tag="KPHS_02120"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_005224512.1"
                     /db_xref="GeneID:11845196"
                     /translation="MYQPDFPPVPFRLGLYPVVDSVAWIERLLEAGVRTLQLRIKDRR
                     DSEVEDDVIAAIALGRRYHARLFINDYWQLAIKHQAYGVHLGQEDLETTDLSAIRQAG
                     LRLGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLEQLARHIQRLADYP
                     TVAIGGISLEKAPGVLATGVGSIAVVSAITQAADWRAATDQLLALAGAGDE"
     misc_feature    complement(242950..243582)
                     /locus_tag="KPHS_02120"
                     /note="thiamine-phosphate pyrophosphorylase; Provisional;
                     Region: PRK03512"
                     /db_xref="CDD:179586"
     gene            complement(243582..245477)
                     /locus_tag="KPHS_02130"
                     /db_xref="GeneID:11845197"
     CDS             complement(243582..245477)
                     /locus_tag="KPHS_02130"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis protein for pyrimidine
                     moiety"
                     /protein_id="YP_005224513.1"
                     /db_xref="GeneID:11845197"
                     /translation="MSTTKLTRREQREHAQRFIDTLAGTAFPNSRRIYVHGSQADIRV
                     PMREIQLSPTLVGGDKDNPRYETNEPIPVYDTSGPYGDPDISIDVRQGLAKLRQPWID
                     ARNDCAPLSERSSAYTKARLADDGLDELRFSGLLTPKRAVAGKCVTQLHYARQGIVTP
                     EMEFIAIRENMGRERIRSEVLRQQHAGEGFGAHLPENITPEFVRDEVAAGRAIIPANI
                     NHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYI
                     HETREWILRNSPVPIGTVPIYQALEKVNGIAENLTWQVFRDTLLEQAEQGVDYFTIHA
                     GVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAAYDVSLSL
                     GDGLRPGSIQDANDEAQFSELRTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNITEQ
                     LEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKE
                     DVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPFTARAYH
                     DETLPQESGKVAHFCSMCGPKFCSMKITQEVRDYAAKQSIEAGMADMSNNFRARGGEI
                     YLKQEEA"
     misc_feature    complement(243597..245453)
                     /locus_tag="KPHS_02130"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     gene            complement(245740..246237)
                     /locus_tag="KPHS_02140"
                     /db_xref="GeneID:11845198"
     CDS             complement(245740..246237)
                     /locus_tag="KPHS_02140"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="YP_005224514.1"
                     /db_xref="GeneID:11845198"
                     /translation="MLNQLENLTERVGGSNELVDRWLQVRKHLLVAYYNLVGLKPGKE
                     SFMRLNEKALDDFCQSLVDYLSSGHFSIYERIIGEMEGDTPLLAATRLYPQLEANTQQ
                     MMDYYDTCLENAIDHDNYLEFQQALSDIGESLEARFALEDKLIALAVAHNLSNDVRDN
                     IAPTA"
     misc_feature    complement(245761..246237)
                     /locus_tag="KPHS_02140"
                     /note="anti-RNA polymerase sigma 70 factor; Provisional;
                     Region: PRK11718"
                     /db_xref="CDD:236962"
     gene            246331..247104
                     /locus_tag="KPHS_02150"
                     /db_xref="GeneID:11845199"
     CDS             246331..247104
                     /locus_tag="KPHS_02150"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="YP_005224515.1"
                     /db_xref="GeneID:11845199"
                     /translation="MDRIIEKLDRGWWVVSHEQKLWLPGGELPHGEAVNFDLVGQHAL
                     HIGEWQGESVWMVRQDRRHDMGSLRQVLDQDPGLFQLAGRGIQLAEFYRSHKFCGYCG
                     HPMHASKSEWAMLCSHCRERYYPQIAPCIIVAIRRDDAILLAQHTRHRNGVHTVLAGF
                     VEVGETLEQAVAREVMEESGIRVKNLRYVTSQPWPFPQSLMTAFMADYADGEIVVDKK
                     ELLTADWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEFE"
     misc_feature    246331..247086
                     /locus_tag="KPHS_02150"
                     /note="NADH pyrophosphatase; Reviewed; Region: nudC;
                     PRK00241"
                     /db_xref="CDD:234699"
     gene            247145..248209
                     /locus_tag="KPHS_02160"
                     /db_xref="GeneID:11845200"
     CDS             247145..248209
                     /locus_tag="KPHS_02160"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_005224516.1"
                     /db_xref="GeneID:11845200"
                     /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNAELACEVTLQPLRRYPLDAAILFSDILTIPDAMGLGLYFEAGEGPRFTSP
                     VKSKADVDKLPIPDPEQELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMYAEPQALHALLDKLAKSVTLYLNAQIKAGAQSVMIFDTWGGVLTGRD
                     YQQFSLYYMHKIVDGLLRENEGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTTDIA
                     DARRRVGNKVALQGNMDPSMLYASAPRIEEEVATILAGFGQGEGHVFNLGHGIHQDVD
                     PEHAGVFVEAVHRLSAPYHQ"
     misc_feature    247148..248194
                     /locus_tag="KPHS_02160"
                     /note="uroporphyrinogen decarboxylase; Validated; Region:
                     hemE; PRK00115"
                     /db_xref="CDD:234644"
     misc_feature    order(247220..247237,247250..247252,247262..247264,
                     247280..247282,247361..247381,247415..247417,
                     247430..247432,247574..247576,247604..247606,
                     247622..247624,247763..247765,247769..247774,
                     247886..247888,248123..248125)
                     /locus_tag="KPHS_02160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(247223..247225,247235..247237,247373..247375,
                     247604..247606,247769..247771,248123..248125)
                     /locus_tag="KPHS_02160"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            248222..248893
                     /locus_tag="KPHS_02170"
                     /db_xref="GeneID:11845201"
     CDS             248222..248893
                     /locus_tag="KPHS_02170"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="YP_005224517.1"
                     /db_xref="GeneID:11845201"
                     /translation="MDLAALRTQQQQLAASVERADRLDRDPPALIGGADVGFEQEGEI
                     TRAAMVLLTWPELELVEYQVARVATSMPYIPGFLSFRETPALLAAWEQLSQKPDLLFV
                     DGHGISHPRRLGVASHFGLMIDVPTIGVAKKRLCGKIGDLGDEPGALAPLMDKNEQLA
                     WVWRSKVRCNPLFISTGHRVGMDSALMWVERCMRGYRLPEPTRWADAVASRRPSFVRW
                     QANHS"
     misc_feature    248222..248887
                     /locus_tag="KPHS_02170"
                     /note="endonuclease V; Provisional; Region: PRK11617"
                     /db_xref="CDD:236937"
     misc_feature    order(248324..248326,248330..248335,248438..248440,
                     248444..248455,248528..248536,248546..248548,
                     248561..248566,248612..248626,248837..248839,
                     248849..248851)
                     /locus_tag="KPHS_02170"
                     /note="Active_site [active]"
                     /db_xref="CDD:143472"
     gene            248936..249526
                     /locus_tag="KPHS_02180"
                     /db_xref="GeneID:11845202"
     CDS             248936..249526
                     /locus_tag="KPHS_02180"
                     /codon_start=1
                     /transl_table=11
                     /product="YjaG family protein"
                     /protein_id="YP_005224518.1"
                     /db_xref="GeneID:11845202"
                     /translation="MLQNPIHLRLEKLESWQHVTFMACLCERMYPNYAMFCKQTEFGD
                     GLLYRRILDLIWETLTVKDAKVNFDSQLEKLEEAIPAADDFDMYGVYPAIDACVALSE
                     LIHSRLSGETLEHAIEVSKTSITTVAMLEMTQEGREMTDEELKANPAVEQEWDIQWEI
                     FRLLADCEERDLELIKGLRADLREAGESNIGINFQQ"
     misc_feature    248936..249517
                     /locus_tag="KPHS_02180"
                     /note="Uncharacterized protein YjaG, DUF416 family
                     [Function unknown]; Region: YjaG; COG3068"
                     /db_xref="CDD:225610"
     gene            249713..249985
                     /locus_tag="KPHS_02190"
                     /db_xref="GeneID:11845203"
     CDS             249713..249985
                     /locus_tag="KPHS_02190"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator HU subunit alpha"
                     /protein_id="YP_005224519.1"
                     /db_xref="GeneID:11845203"
                     /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKEGDAVQL
                     VGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     misc_feature    249713..249982
                     /locus_tag="KPHS_02190"
                     /note="transcriptional regulator HU subunit alpha;
                     Provisional; Region: PRK10753"
                     /db_xref="CDD:138142"
     misc_feature    order(249728..249730,249737..249742,249749..249751,
                     249776..249787,249791..249799,249803..249811,
                     249815..249820,249830..249844,249851..249853,
                     249935..249943,249947..249949,249953..249955,
                     249965..249970)
                     /locus_tag="KPHS_02190"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(249869..249871,249875..249880,249884..249886,
                     249890..249901,249914..249919,249923..249925)
                     /locus_tag="KPHS_02190"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            249998..250693
                     /locus_tag="KPHS_02200"
                     /db_xref="GeneID:11845204"
     CDS             249998..250693
                     /locus_tag="KPHS_02200"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1481 domain-containing protein"
                     /protein_id="YP_005224520.1"
                     /db_xref="GeneID:11845204"
                     /translation="MNSFIEGAIKPLLSVWRRPLALAGILLLTACSHDTSLPPFTASG
                     YADNQGAMRIWRKDSGDEVHLLAAFSPWRHGDTSTSEYRWQGDQLALIELNVYGKPPE
                     HIRARFDAQGDLSFMQREVDGQKQQLSSDQVALYRYRAEQIRQTSDALRQGRVVLRQG
                     RWNAAAHTVLTCEGQTVTPDLDSRALAHIERRQSHASAAVSIAWLEAPEGSQLLLVAN
                     ENFCTWQPTEKSF"
     misc_feature    249998..250096
                     /locus_tag="KPHS_02200"
                     /note="Prokaryotic membrane lipoprotein lipid attachment
                     site; Region: LPAM_1; pfam08139"
                     /db_xref="CDD:285366"
     misc_feature    250121..250678
                     /locus_tag="KPHS_02200"
                     /note="Protein of unknown function (DUF1481); Region:
                     DUF1481; pfam07356"
                     /db_xref="CDD:336683"
     gene            complement(250697..251134)
                     /locus_tag="KPHS_02210"
                     /db_xref="GeneID:11845205"
     CDS             complement(250697..251134)
                     /locus_tag="KPHS_02210"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc resistance protein"
                     /protein_id="YP_005224521.1"
                     /db_xref="GeneID:11845205"
                     /translation="MKRNRTLPLALVTFAALTFASNAAWANHHWGNNNGMGNQGYSQL
                     TQEQQATVQKLHNDYYAQTSALRQQLQSKRYEYNALLTAQKPDSGKIEAVAQEMEGLR
                     QKLDQQRVKFDIALAEAGVPRGAGMGYGGCRGSAGGHMGMNHW"
     misc_feature    complement(250700..251134)
                     /locus_tag="KPHS_02210"
                     /note="zinc resistance protein; Provisional; Region: zraP;
                     PRK11546"
                     /db_xref="CDD:183189"
     gene            complement(251285..251404)
                     /locus_tag="KPHS_02220"
                     /db_xref="GeneID:11845206"
     CDS             complement(251285..251404)
                     /locus_tag="KPHS_02220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224522.1"
                     /db_xref="GeneID:11845206"
                     /translation="MIFIGESLSSLFHYLQAPSAEIMPCFRAANPALKHIACA"
     gene            251394..252788
                     /locus_tag="KPHS_02230"
                     /db_xref="GeneID:11845207"
     CDS             251394..252788
                     /locus_tag="KPHS_02230"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor kinase of Zn/Pb responsive two-component
                     regulatory system"
                     /protein_id="YP_005224523.1"
                     /db_xref="GeneID:11845207"
                     /translation="MKIKSLSRDAAAGALSWLLTGTVVLLVMLFSAMIVRDYGRETTA
                     ARQTIEEKGSVLIRALESGTRVGMGMRMHHAQLQALLEEMAWQPGVLWFAVTDENGKI
                     IAHSDPQQVGKTLYSPAQMRALAVGEQARWRRLSEPQPALEIYRHFRPLNPARGHHMG
                     MMNRGNSALAQATVPQVIFIAFDSRELDAAQARGQRNMAIMLGAAALVIAATILAQFW
                     FRRYRRSRKQLLEAMARKEKLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERTSPGGE
                     SHQLAQVMAKEADRLNRVVSELLELVRPAHLNYQTVDINALIRHSLQLVSQDAQSRGI
                     ALQFTPRPELTTISADPDRLNQVLLNLYLNAMQAIGRDGVIRVTASEADRQRVKIVVT
                     DSGKGMSDEELQAIFTPYFTTKADGTGLGLAVVQNIIEQHGGTIRAESQPGAGAIFTL
                     WLPVDAQRREDEQR"
     misc_feature    251409..252782
                     /locus_tag="KPHS_02230"
                     /note="sensor protein ZraS; Provisional; Region: PRK10364"
                     /db_xref="CDD:236674"
     gene            252775..254106
                     /locus_tag="KPHS_02240"
                     /db_xref="GeneID:11845208"
     CDS             252775..254106
                     /locus_tag="KPHS_02240"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator in two-component
                     regulatory system with ZraS"
                     /protein_id="YP_005224524.1"
                     /db_xref="GeneID:11845208"
                     /translation="MSSDKVQILVVDDDISHCTILQALLRGWGYQVGLAHNGLQALEQ
                     IHQQVFDLVLCDIRMAEMDGIATLKEIKAYNPAIPVLIMTAFSSVGTAVEAIKSGALD
                     YLVKPLDFDTLQQTLVQALAHTRQSESDPSVATDSRWGMIGDSPAMQALLNDITLVAP
                     SDATVLIYGESGTGKELVAHAIHACSERRDKPLVTLNCAALNESLLESELFGHEKGAF
                     TGADRRREGRFVEADGGTLFLDEIGDISPVMQVRLLRAIQEREVQRVGSNQTLAVDVR
                     LIAATHRNLAEEVSAGRFRQDLYYRLNVVTIDMPPLRRRREDIPQLAQHFLKRYTERN
                     RKTVKGFTPQAMDLLIHYPWPGNIRELENAVERAVVLLTGNYISERELPLAIAGTPLP
                     SGGSEEGGIQPLVEVEKEVILAALEKTGGNKTEAARQLGITRKTLLAKLSR"
     misc_feature    252775..254103
                     /locus_tag="KPHS_02240"
                     /note="transcriptional regulatory protein ZraR;
                     Provisional; Region: PRK10365"
                     /db_xref="CDD:182412"
     gene            complement(254096..255391)
                     /locus_tag="KPHS_02250"
                     /db_xref="GeneID:11845209"
     CDS             complement(254096..255391)
                     /locus_tag="KPHS_02250"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="YP_005224525.1"
                     /db_xref="GeneID:11845209"
                     /translation="MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQ
                     NVAIGVTDIPALLRFAQDENIDLTIVGPEAPLVIGVVDAFRAAGLNIFGPTEGAAQLE
                     GSKAFTKDFLARHHIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMT
                     LEEAEAAVKDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRV
                     GNGDTGPNTGGMGAYSPAPVVTDEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMI
                     DKQGNPKVIEFNCRFGDPETQPIMLRMKSDLVELCLAACAGKLDEKTSEWDDRASLGV
                     VVAAGGYPGSYNTGDEIYGLPQQEVADGKVFHAGTKLSDDQRVVTNGGRVLCVTALGD
                     SVAQAQQRAYQLLTDIRWDGSFSRSDIGWRAIEREKANG"
     misc_feature    complement(254114..255391)
                     /locus_tag="KPHS_02250"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     gene            complement(255407..257023)
                     /locus_tag="KPHS_02260"
                     /db_xref="GeneID:11845210"
     CDS             complement(255407..257023)
                     /locus_tag="KPHS_02260"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional purine biosynthesis protein PurH"
                     /protein_id="YP_005224526.1"
                     /db_xref="GeneID:11845210"
                     /translation="MFKSWGFNTMQQRRPVRRALLSVSDKAGIVEFAQALSARGVELL
                     STGGTARLLADKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGIMQQH
                     GIAPIDMVVVNLYPFAQTVAREGCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSS
                     DYDAIINEMDANEGSLTLATRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKEAA
                     GRFPRTLNLNFIKKQDMRYGENSHQQAAFYIEENVKEASVATATQLQGKALSYNNIAD
                     TDAALECVKEFNEPACVIVKHANPCGVAVSDSILDAYDRAYKTDPTSAFGGIIAFNRE
                     LDAETAQAIISRQFVEVIIAPSASEEALKITAAKQNVRVLTCGQWDTRVAGLDFKRVN
                     GGLLVQDRDLGMVTAGELRVVSKRQPTEQELRDALFCWKVAKFVKSNAIVYAKDNMTI
                     GIGAGQMSRVYSAKIAGIKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQP
                     GGSIRDDEVIAAADEHGIAMIFTDMRHFRH"
     misc_feature    complement(255410..256987)
                     /locus_tag="KPHS_02260"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     gene            257631..259157
                     /locus_tag="KPHS_r00200"
                     /db_xref="GeneID:11845211"
     rRNA            257631..259157
                     /locus_tag="KPHS_r00200"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11845211"
     gene            259508..262406
                     /locus_tag="KPHS_r00120"
                     /db_xref="GeneID:11845212"
     rRNA            259508..262406
                     /locus_tag="KPHS_r00120"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11845212"
     gene            262506..262620
                     /locus_tag="KPHS_r00030"
                     /db_xref="GeneID:11845213"
     rRNA            262506..262620
                     /locus_tag="KPHS_r00030"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11845213"
     gene            complement(262782..263243)
                     /locus_tag="KPHS_02270"
                     /db_xref="GeneID:11845214"
     CDS             complement(262782..263243)
                     /locus_tag="KPHS_02270"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acyltransferase"
                     /protein_id="YP_005224527.1"
                     /db_xref="GeneID:11845214"
                     /translation="MVINIRRSRPDEGDKLTAIWCRSVDATHDFLTKAYRKELEEMVR
                     AFLPEAPLWVAVNTEDQPIAFMLLTGEHMDALFVDPDVRGCGVGKLLIEHALSLTPKL
                     TTNVNEQNEQAVGFYQKMGFRVTGRSETDDLGQPYPLLNLMYEQQAEADYD"
     misc_feature    complement(262806..263240)
                     /locus_tag="KPHS_02270"
                     /note="putative acetyltransferase; Provisional; Region:
                     PRK10514"
                     /db_xref="CDD:182510"
     misc_feature    complement(order(262977..262982,263010..263018))
                     /locus_tag="KPHS_02270"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            263400..264329
                     /locus_tag="KPHS_02280"
                     /db_xref="GeneID:11845215"
     CDS             263400..264329
                     /locus_tag="KPHS_02280"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="YP_005224528.1"
                     /db_xref="GeneID:11845215"
                     /translation="MPIRVQDELPAVNFLRNENVFVMTTTRATTQEIRPLKVLILNLM
                     PKKIETENQFLRLLSNSPLQVDIQLLRIDARESRNTPAEHLNNFYCNFDEICDQNFDG
                     LIVTGAPLGLVEFNDVAYWPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTR
                     AEKISGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAGLIRDYTDLEILAETEEGD
                     AYLFASKDKRIAFVTGHPEYDANTLASEYFRDVEAGLNPEIPHNYFPQNDPQNKPRAT
                     WRSHGNLLFANWLNYYVYQITPYDLRHMNPTLE"
     misc_feature    263400..264305
                     /locus_tag="KPHS_02280"
                     /note="homoserine O-succinyltransferase; Provisional;
                     Region: PRK05368"
                     /db_xref="CDD:235433"
     misc_feature    263538..263540
                     /locus_tag="KPHS_02280"
                     /note="proposed active site lysine [active]"
                     /db_xref="CDD:153225"
     misc_feature    263823..263825
                     /locus_tag="KPHS_02280"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153225"
     gene            264590..266191
                     /locus_tag="KPHS_02290"
                     /db_xref="GeneID:11845216"
     CDS             264590..266191
                     /locus_tag="KPHS_02290"
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="YP_005224529.1"
                     /db_xref="GeneID:11845216"
                     /translation="MTQQATITDELAFSQPYGEQEKQILTPEAVEFLTELVSRFTPAR
                     NKLLAARLQQQQAIDDGQLPDFISETASIRNGDWTIRGIPADLQDRRVEITGPVERKM
                     VINALNANVKVFMADFEDSLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLQPNP
                     AVLVCRVRGLHLPEKHVTWRNEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQA
                     WQEAAWWNDVFSFTEDRFDLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGR
                     WDYIFSYIKTLKNHPDRVLPDRQVVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFI
                     PSKDTERNRQVLSKVTADKELEANNGHDGTWIAHPGLADTAMAVFDRVLGDKPNQLSV
                     TRSEDAPITAEQLLAPCEGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAAT
                     AEISRTSIWQWIHHQKTLNDGTPVTKALFRQWLAEELMVIQEELGEHRFSHGRFDDAA
                     RLMEQITTSDELIDFLTLPGYRLLA"
     misc_feature    264596..266188
                     /locus_tag="KPHS_02290"
                     /note="malate synthase; Validated; Region: PRK09255"
                     /db_xref="CDD:236432"
     misc_feature    order(265085..265087,265337..265339,265415..265417,
                     265421..265423,265928..265930)
                     /locus_tag="KPHS_02290"
                     /note="active site"
                     /db_xref="CDD:238369"
     gene            266256..267575
                     /locus_tag="KPHS_02300"
                     /db_xref="GeneID:11845217"
     CDS             266256..267575
                     /locus_tag="KPHS_02300"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate lyase"
                     /protein_id="YP_005224530.1"
                     /db_xref="GeneID:11845217"
                     /translation="MEHLHMKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSV
                     NPECTLAQLGAAKLWRLLHGEAKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAA
                     DANLASSMYPDQSLYPANSVPAVVDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIV
                     ADAEAGFGGVLNAFELMKSMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKL
                     VAARLAADVMGVPTLVIARTDADAADLITSDCDPYDREFITGDRTSEGFFRTHAGIEQ
                     AISRGLAYAPYADLVWCETSKPDLEQARRFAEAIHARFPGKLLAYNCSPSFNWKKNLD
                     DKTIASFQQQLSDMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEF
                     AAGPEGYTFVSHQQEVGTGYFDKVTTIIQGGTSSVTALTGSTEEEQF"
     misc_feature    266268..267572
                     /locus_tag="KPHS_02300"
                     /note="isocitrate lyase; Provisional; Region: PRK15063"
                     /db_xref="CDD:237893"
     gene            267678..269462
                     /locus_tag="KPHS_02310"
                     /db_xref="GeneID:11845218"
     CDS             267678..269462
                     /locus_tag="KPHS_02310"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional isocitrate dehydrogenase
                     kinase/phosphatase protein"
                     /protein_id="YP_005224531.1"
                     /db_xref="GeneID:11845218"
                     /translation="MTRGLELLIAQTILQGFDAQYGRFLEVTSGAQQRFEQADWHAVQ
                     QAMKQRIHLYDHHVGLVVEQLRCITEGKSTDVDFLLRVKQQYTQLLPDYPRFEIAESF
                     FNSVYCRLFDHRSLTPERLFIFSSQPERPFRTLPRPLAKDFFPERGWSHLLGKVLSDL
                     PLRLPWQNKARDIGYIIASLQEALGEELLATCHLQVANELFYRNKAAWLVGKLVMPMA
                     TLPFLLPIHRSEEGELFVDTCLTTHAEASIVFGFARSYFMVYAPLPGALVEWLREILP
                     GKTTAELYMAIGCQKHAKTESYREYLHYITRCDEQFIEAPGIRGMVMLVFTLPGFDRV
                     FKVIKDRFAPQKEMTAAHVRACYQLVKEHDRVGRMADTQEFENFVLDKRQIAPALLAL
                     LQAEAGNKLTDLGDRIVISHLYIERRMVPLNLWLEQVNGQALRDAVEEYGNAIRQLAA
                     ANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFREIPPPRYPEDELASEPWYSV
                     SPGDVFPEEFRHWLCADPRIGPLFEEMHADLLRADYWRALQMRIKNGHVEDVYAYRRK
                     QRFSVRYGADSRPDKAFTPPSGKVRRSA"
     misc_feature    267678..269408
                     /locus_tag="KPHS_02310"
                     /note="Isocitrate dehydrogenase kinase/phosphatase [Signal
                     transduction mechanisms]; Region: AceK; COG4579"
                     /db_xref="CDD:226945"
     gene            complement(269513..270406)
                     /locus_tag="KPHS_02320"
                     /db_xref="GeneID:11845219"
     CDS             complement(269513..270406)
                     /locus_tag="KPHS_02320"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_005224532.1"
                     /db_xref="GeneID:11845219"
                     /translation="MIALLPNKTKIISTIQKKEFAMATTPIPAKRGRKPAAATAQQAG
                     GQVQSLTRGLKLLEWIAESHSSVALTELAQQAGLPNSTTHRLLTTMQQLGFVRQVGEL
                     GHWAVGAHAFVVGSSFLQSRNLLAIVHPILRQLMEDSGETVNLAVLDQSDHQAIIIDQ
                     VQCTQLMRMSAPIGGKLPMHASGAGKAFLAQLSEEQVTSLLHRKGLHAYTHATLVSPL
                     HLKEDLAQTRKRGYSFDDEEHALGLRCVAACIYDEHREPFAAISISGPISRMTDDRVT
                     ELGALVIKAAKEVTLAYGGVK"
     misc_feature    complement(269516..270337)
                     /locus_tag="KPHS_02320"
                     /note="transcriptional repressor IclR; Provisional;
                     Region: PRK11569"
                     /db_xref="CDD:183206"
     gene            270538..274221
                     /locus_tag="KPHS_02330"
                     /db_xref="GeneID:11845220"
     CDS             270538..274221
                     /locus_tag="KPHS_02330"
                     /codon_start=1
                     /transl_table=11
                     /product="B12-dependent methionine synthase"
                     /protein_id="YP_005224533.1"
                     /db_xref="GeneID:11845220"
                     /translation="MSSKVEQLHQQLKERILVLDGGMGTMIQGYRLSEQDFRGERFAD
                     WPCDLKGNNDLLVLSKPEVIREIHGAYFEAGADIIETNTFNSTTIAMADYQMESLSAE
                     INFAAAKLARASADAWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDQLV
                     AAYRESTRALVEGGVDLILIETVFDTLNAKAAIYAVKEELEALGVDLPLMISGTITDA
                     SGRTLSGQTTEAFYNSLRHAEALSFGLNCALGPDELRQYVQELSRIAECYVTAHPNAG
                     LPNAFGEYDLDADTMATQIREWAEAGFLNIVGGCCGTTPEHIAAMSRAVAGLPPRQLP
                     EIAVACRLAGLEPLNIGDDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVE
                     SGAQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWEVIEKGLKCIQG
                     KGIVNSISMKEGVESFIHHAKLVRRYGAAVVVMAFDEVGQADTRERKIEICRRAYKIL
                     TEEVGFPPEDIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVS
                     FSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPGELRDAVEDVILNRR
                     DDSTERLLELAEKYRGSKADDGANAQQAEWRTWEVKKRLEYSLVKGITEFIEQDTEEA
                     RQQAARPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASK
                     EQGSSNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPADKILKTAKEVNA
                     DLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVY
                     VQNASRTVGVVSALLSDTQRDEFVARTRKEYETVRIQHGRKKPRTPPVTLAAARENDL
                     AFDWESYTPPVAHRLGVQTVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEE
                     AQRLFKDANELLDKLSAEKTLNPRGVVGLFPANRVGDDIEIYRDETRTHVLTVSHHLR
                     QQTEKVGFANYCLADFVAPKLSGKADYIGAFAVTGGLEEDALADAYEAQHDDYNKIMI
                     KAIADRLAEAFAEYLHEKVRKVYWGYAANENLSNEELIRENYQGIRPAPGYPACPEHT
                     EKGTIWQLLDVEAHTGMKLTESFAMWPGASVSGWYFSHPDSKYFAVAQIQRDQVEDYA
                     LRKGMTPAEVERWLAPNLGYDAD"
     misc_feature    270538..274206
                     /locus_tag="KPHS_02330"
                     /note="B12-dependent methionine synthase; Provisional;
                     Region: metH; PRK09490"
                     /db_xref="CDD:236539"
     gene            274351..275982
                     /locus_tag="KPHS_02340"
                     /db_xref="GeneID:11845221"
     CDS             274351..275982
                     /locus_tag="KPHS_02340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alpha helix protein"
                     /protein_id="YP_005224534.1"
                     /db_xref="GeneID:11845221"
                     /translation="MLTLLHLLSAVALLVWGTHIVRTGVMRVYGARLRTVLSSSVEKK
                     PLAFCAGLGVTALVQSSNATTMLVTSFVAQDLVGLMPALVMVLGADVGTALMARVLTF
                     DLSWLSPLLIFIGVIFFLGRKQTRAGQLGRVGIGLGLILLALELIVQAVHPITQANGV
                     QVIFASLTGDIMLDALIGAVFAIISYSSLAAVLLTATLTAAGAISFPVALCLVIGANL
                     GSGLLAMLNNSAANAAARRVALGSLLFKLVGSLIILPFVHPLAAAMQKLPLAESELVI
                     YFHVFYNLLRCIAMVPFAGPMAKLCQRLIRDEPELDNHLKPKHLDPSALDTPALALAN
                     AARETLRIGDAMEQMLESLHKVMHGEPRQEKELRRMADDINVLYTAIKLYLARMPKDE
                     LAEEESRRWAEIIEMSLNLEQASDIVERMGSEIADKSLAARRAFSVEGLKELDALYDL
                     LLSNLQLAMSVFFSSDVPSARRLRRSKHRFRILNRRYSHAHVDRLHQQNVQSIETSTL
                     HLALLGDMKRLNSLFCSVAYSVMEQPDEDDERDDY"
     misc_feature    274351..275952
                     /locus_tag="KPHS_02340"
                     /note="Na+/phosphate symporter [Inorganic ion transport
                     and metabolism]; Region: NptA; COG1283"
                     /db_xref="CDD:224202"
     gene            complement(276070..276879)
                     /locus_tag="KPHS_02350"
                     /db_xref="GeneID:11845222"
     CDS             complement(276070..276879)
                     /locus_tag="KPHS_02350"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_005224535.1"
                     /db_xref="GeneID:11845222"
                     /translation="MINRDTLLCISLAGRPGNFGTRFHNYLYDKLGLNYLYKAFTTKD
                     IEAAVKGVRALGIRGCAVSMPFKESCIPFLDAIDPSAKVIDSVNTIVNDDGKLTGLNT
                     DYIAVKSLIASHRLDTNARVMIQGSGGMGKAVIAAFRDAGFRDVIIAARNRQRGLALA
                     KQYGFQWQPLPEGIAAEILVNVTPLGMAGGAESNTLAFSEAMVAQASVVFDVVALPAE
                     TPLIRLAQQRGKQTISGAEVIALQAVEQFALYTGVRPDSALVAEASAFARS"
     misc_feature    complement(276073..276879)
                     /locus_tag="KPHS_02350"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region:
                     PRK12550"
                     /db_xref="CDD:183587"
     gene            complement(276872..278104)
                     /locus_tag="KPHS_02360"
                     /db_xref="GeneID:11845223"
     CDS             complement(276872..278104)
                     /locus_tag="KPHS_02360"
                     /codon_start=1
                     /transl_table=11
                     /product="L-sorbose 1-phosphate reductase"
                     /protein_id="YP_005224536.1"
                     /db_xref="GeneID:11845223"
                     /translation="MQTTTALRLYGKRDLRLETFTLPAMQDDEILARVVTDSLCLSSW
                     KEANQGADHKKVPDDVATRPIIIGHEFCGEILAVGKKWQHKFQPGQRYVIQANLQLPD
                     RPDCPGYSFPWIGGEATHVVIPNEVMAQDCLLTWEGDTWFEGSLVEPLSCVIGAFNAN
                     YHLQEGSYNHVMGIRPQGHTLILGGTGPMGLLAIDYALHGPINPSLLVVTDTNKPKLS
                     YARRHYPSEPQTLIHYLDGHEASRDTLLALSGGHGFDDIFVFVPNEQLITLASSLLAP
                     DGCLNFFAGPQDKQFSAPINFYDVHYAFTHYVGTSGGNTDDMRAAVALMQAKKVQTAK
                     VVTHILGLNAAGETTLDLPAVGGGKKLVYTGKAFPLTPLGEIADPELAAIVARHHGIW
                     SQEAEAYLLAHAEDITHD"
     misc_feature    complement(276896..278101)
                     /locus_tag="KPHS_02360"
                     /note="L-sorbose-1-phosphate reductase; Region:
                     sorbose_phosphate_red; cd08238"
                     /db_xref="CDD:176200"
     misc_feature    complement(order(277169..277177,277253..277258,
                     277316..277318,277322..277327,277394..277396,
                     277457..277459,277469..277474,277535..277552,
                     277649..277651,277661..277663,277970..277972,
                     277979..277987))
                     /locus_tag="KPHS_02360"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176200"
     misc_feature    complement(order(277661..277663,277898..277900,
                     277979..277981,277985..277987))
                     /locus_tag="KPHS_02360"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176200"
     gene            complement(278177..279001)
                     /locus_tag="KPHS_02370"
                     /db_xref="GeneID:11845224"
     CDS             complement(278177..279001)
                     /locus_tag="KPHS_02370"
                     /codon_start=1
                     /transl_table=11
                     /product="sorbose permease IID component"
                     /protein_id="YP_005224537.1"
                     /db_xref="GeneID:11845224"
                     /translation="MEQKKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIK
                     RLYPLKADQVAALKRHLVFFNTTPAVCGPVIGVTAAMEEARANGAAIDDGAINGIKVG
                     LMGPLAGVGDPLVWGTLRPITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQL
                     GFRKGVNIVSDMGGNLLQKLTEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGAT
                     VTMTVQNILDQLCPGLLALGLTLLMVRLLNKKVNPVWLIFALFGLGIIGNALGFLS"
     misc_feature    complement(278183..278992)
                     /locus_tag="KPHS_02370"
                     /note="PTS system, mannose/fructose/sorbose family, IID
                     component; Region: EIID-AGA; TIGR00828"
                     /db_xref="CDD:129908"
     gene            complement(279013..279813)
                     /locus_tag="KPHS_02380"
                     /db_xref="GeneID:11845225"
     CDS             complement(279013..279813)
                     /locus_tag="KPHS_02380"
                     /codon_start=1
                     /transl_table=11
                     /product="sorbose permease IIC component"
                     /protein_id="YP_005224538.1"
                     /db_xref="GeneID:11845225"
                     /translation="MEISTLQIIAIFIFSCIAGMGSVLDEFQTHRPLIACTVIGLILG
                     DLKTGVMLGGTLELIALGWMNVGAAQSPDSALASIISAILVIVGHQSIATGIAIALPV
                     AAAGQVLTVFARTITVVFQHAADKAAEEARFRTIDLLHVSALGVQALRVAIPALVVSL
                     FVSADMVSSMLSAIPEFVTRGLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGG
                     YLDFSLLAFGGVGVIIALIYIQLNPQWRKAEPAASTAPSAPALDQLDD"
     misc_feature    complement(279067..279813)
                     /locus_tag="KPHS_02380"
                     /note="PTS system mannose-specific transporter subunit
                     IIC; Provisional; Region: PRK15065"
                     /db_xref="CDD:237895"
     gene            complement(279879..280373)
                     /locus_tag="KPHS_02390"
                     /db_xref="GeneID:11845226"
     CDS             complement(279879..280373)
                     /locus_tag="KPHS_02390"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS enzyme IIAB, mannose-specific"
                     /protein_id="YP_005224539.1"
                     /db_xref="GeneID:11845226"
                     /translation="MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRR
                     TLLRQAAPPGMKVNVVSLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATL
                     NIGGMAWRPGKKQLTKAVSLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINET
                     AFCE"
     misc_feature    complement(279918..280370)
                     /locus_tag="KPHS_02390"
                     /note="PTS system, mannose/fructose/sorbose family, IIB
                     component; Region: pts-sorbose; TIGR00854"
                     /db_xref="CDD:129933"
     misc_feature    complement(order(280332..280334,280341..280343,
                     280353..280355))
                     /locus_tag="KPHS_02390"
                     /note="active site"
                     /db_xref="CDD:237975"
     misc_feature    complement(280332..280334)
                     /locus_tag="KPHS_02390"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237975"
     gene            complement(280373..280780)
                     /locus_tag="KPHS_02400"
                     /db_xref="GeneID:11845227"
     CDS             complement(280373..280780)
                     /locus_tag="KPHS_02400"
                     /codon_start=1
                     /transl_table=11
                     /product="sorbose-specific phosphotransferase enzyme IIA
                     component"
                     /protein_id="YP_005224540.1"
                     /db_xref="GeneID:11845227"
                     /translation="MVHAIFCAHGQLAGAMLDSVCMVYGEVNVSAVAFVPGENAADIA
                     INLEKLVSAHTDEEWVIAVDLQCGSPWNAAAGLAMRHPQIRVISGLSLPLALELVDNQ
                     HTLSADDLCQHLQAIASQCCVVWQQPETVEEEF"
     misc_feature    complement(280439..280780)
                     /locus_tag="KPHS_02400"
                     /note="PTS system, mannose/fructose/sorbose family, IIA
                     component; Region: EIIA-man; TIGR00824"
                     /db_xref="CDD:129904"
     misc_feature    complement(order(280481..280483,280574..280576,
                     280679..280681,280709..280714,280754..280756))
                     /locus_tag="KPHS_02400"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    complement(order(280574..280576,280589..280591,
                     280754..280756))
                     /locus_tag="KPHS_02400"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    complement(280754..280756)
                     /locus_tag="KPHS_02400"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            complement(280790..281593)
                     /locus_tag="KPHS_02410"
                     /db_xref="GeneID:11845228"
     CDS             complement(280790..281593)
                     /locus_tag="KPHS_02410"
                     /codon_start=1
                     /transl_table=11
                     /product="sorbitol-6-phosphate 2-dehydrogenase"
                     /protein_id="YP_005224541.1"
                     /db_xref="GeneID:11845228"
                     /translation="MNTWLNLKDNVIIVTGGASGIGLAIVDELLSQGAHVQMIDIHGG
                     DRHHNGDNYHFWPTDISSATEVQQTIDAIIQRWSRIDGLVNNAGVNFPRLLVDEKAPA
                     GRYELNEAAFEKMVNINQKGVFFMSQAVARQMVKQRAGVIVNVSSESGLEGSEGQSCY
                     AATKAALNSFTRSWSKELGKYGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQL
                     REGYTKNAIPIGRAGKLSEVADFVCYLLSARASYITGVTTNIAGGKTRG"
     misc_feature    complement(280793..281593)
                     /locus_tag="KPHS_02410"
                     /note="sorbitol-6-phosphate 2-dehydrogenase; Provisional;
                     Region: PRK06171"
                     /db_xref="CDD:180439"
     gene            complement(281664..282617)
                     /locus_tag="KPHS_02420"
                     /db_xref="GeneID:11845229"
     CDS             complement(281664..282617)
                     /locus_tag="KPHS_02420"
                     /codon_start=1
                     /transl_table=11
                     /product="SorC family transcriptional regulator"
                     /protein_id="YP_005224542.1"
                     /db_xref="GeneID:11845229"
                     /translation="MTMENSDDIRLIVKIAQLYYEQDMTQAQIARELGIYRTTISRLL
                     KRGREQGIVTIAINYDYNENLWLEQQLKQKFGLKEAVVASSDGLLEEEQLSAMGQHGA
                     LLVDRLLEPGDIIGFSWGRAVRSLVENLPQASQSRQVICVPIIGGPSGKLESRYHVNT
                     LTYGAAARLKAESHLADFPALLDNPLIRNGIMQSQHFKTISSYWDSLDVALVGIGSPA
                     IRDGANWHAFYGSEESDDLNARHVAGDICSRFYDINGGLVDTNMSEKTLSIEMAKLRQ
                     ARYSIGIAMGEEKYSGILGALHGRYINCLVTNRETAELLLK"
     misc_feature    complement(281667..282614)
                     /locus_tag="KPHS_02420"
                     /note="DNA-binding transcriptional regulator LsrR, DeoR
                     family [Transcription]; Region: DeoR; COG2390"
                     /db_xref="CDD:225263"
     gene            282961..283836
                     /locus_tag="KPHS_02430"
                     /db_xref="GeneID:11845230"
     CDS             282961..283836
                     /locus_tag="KPHS_02430"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine synthase F"
                     /protein_id="YP_005224543.1"
                     /db_xref="GeneID:11845230"
                     /translation="MLPDSSTRLNKYISESGICSRREADRFIEQGNVFINGKRATIGD
                     QVKPGDLVKVNGRLIEPREADDLVLIALNKPVGIVSTTEDGERDNIVDFVNHSKRIFP
                     IGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPVTDEFIRGMGAGVPIL
                     GTVTKKCKVKKEAPFVFRITLVQGLNRQIRRMCEHFGYEVTKLERTRIMNVSLTGIPL
                     GEWRDLTDDELIDLFKLIENSSSEAKPKARPKAKAATPGIKRPVVKMENSNDKGRPAG
                     NGKRFTQPGRKKKGR"
     misc_feature    282961..283833
                     /locus_tag="KPHS_02430"
                     /note="23S rRNA pseudouridine synthase F; Provisional;
                     Region: PRK10475"
                     /db_xref="CDD:236698"
     gene            complement(283833..284105)
                     /locus_tag="KPHS_02440"
                     /db_xref="GeneID:11845231"
     CDS             complement(283833..284105)
                     /locus_tag="KPHS_02440"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3811 domain-containing protein"
                     /protein_id="YP_005224544.1"
                     /db_xref="GeneID:11845231"
                     /translation="MALPRITQKEMTEREQRELKTLLDRARIAHGRPLSNAETNSVKK
                     EYIDKLMAQREAEAKKARQVRKQQAYKTDKEATFSWSANTPTRGRR"
     misc_feature    complement(283836..284105)
                     /locus_tag="KPHS_02440"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10515"
                     /db_xref="CDD:170492"
     gene            complement(284222..285151)
                     /locus_tag="KPHS_02450"
                     /db_xref="GeneID:11845232"
     CDS             complement(284222..285151)
                     /locus_tag="KPHS_02450"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytochrome oxidase"
                     /protein_id="YP_005224545.1"
                     /db_xref="GeneID:11845232"
                     /translation="MLATLTRLFPLWALLLSVLAYYTPTTFTPIGPWVTTLLMLIMFG
                     MGVHLKLEDFKRVLSRPAPVAAGIFLHYLVMPLAAWLLALLFHMPPELSAGMVLVGSV
                     ASGTASNVMIFLAKGDVALSVTISSVSTLVGVVATPLLTRLYVDAHIQVDVMGMLLSI
                     LQIVVIPIALGLIVHHLLPKVVKAVEPFLPAFSMVCILAIISAVVAGSAAHIASVGLV
                     VIIAVILHNTIGLLGGYWGGRLFGFDESTCRTLAIEVGMQNSGLAAALGKIYFGPLAA
                     LPGALFSVWHNLSGSLLAGYWSGKPIAKKADKR"
     misc_feature    complement(284249..285139)
                     /locus_tag="KPHS_02450"
                     /note="Predicted Na+-dependent transporter [General
                     function prediction only]; Region: YfeH; COG0385"
                     /db_xref="CDD:223462"
     gene            complement(285290..286639)
                     /locus_tag="KPHS_02460"
                     /db_xref="GeneID:11845233"
     CDS             complement(285290..286639)
                     /locus_tag="KPHS_02460"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase III"
                     /protein_id="YP_005224546.1"
                     /db_xref="GeneID:11845233"
                     /translation="MTDLVVAKFGGTSVADFDAMNRSIDVALLDANTRIVVLSASAGV
                     TNILVALAGGLEPTERFSQLDALRQIQFNILERLRYPNVIREEIERLLENITTLAEAA
                     ALASSTALTDELVSHGELMSTLLFVEILRERGIQAQWFDARKVLRTNDRFGRAEPDIA
                     AVAELTQQQLAPRLAEGLVVTQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNATRVD
                     IWTDVPGIYTTDPRVAPAAKRIDVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFV
                     GSSKEPKAGGTLVCKTTENPPLFRALALRRRQTLLTLHSLNMLHSRGFLAEVFGILAR
                     HNISVDLITTSEVSVALTMDTTGSTSAGDTLLTQALLTELSSLCRVEVEENLALVALI
                     GNELSKACGVGKEVFGVLEPFNIRMICYGASSHNLCFLVPGDDAEKVVQKLHHNLFE"
     misc_feature    complement(285293..286630)
                     /locus_tag="KPHS_02460"
                     /note="aspartate kinase III; Validated; Region: PRK09084"
                     /db_xref="CDD:236376"
     gene            287404..289053
                     /locus_tag="KPHS_02470"
                     /db_xref="GeneID:11845234"
     CDS             287404..289053
                     /locus_tag="KPHS_02470"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_005224547.1"
                     /db_xref="GeneID:11845234"
                     /translation="MKNINPTQTSAWQALQKHFDEMKDVTISELFAKDSDRFSKFSAT
                     FDDLMLVDFSKNRITEETLAKLQDLAKETDLAGAIKSMFSGEKINRTEDRAVLHVALR
                     NRSNTPIVVDGKDVMPEVNAVLEKMKTFSEAIISGSWKGYTGKPITDVVNIGIGGSDL
                     GPFMVTEALRPYKNHLNMHFVSNVDGTHIAEVLKNVNPETTLFLVASKTFTTQETMTN
                     AHSARDWFLATAGDDKHVAKHFAALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSA
                     IGLSIILSVGFDNFVELLSGAHAMDKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEA
                     ILPYDQYMHRFAAYFQQGNMESNGKYVDRNGHAVDYQTGPIIWGEPGTNGQHAFYQLI
                     HQGTKMVPCDFIAPAITHNPLSDHHQKLLSNFFAQTEALAFGKSREVVEQEYRDQGKD
                     PATLEHVVPFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGAILNIFTFDQW
                     GVELGKQLANRILPELKDGSEVSSHDSSTNGLINRYKAWRA"
     misc_feature    287407..289050
                     /locus_tag="KPHS_02470"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     gene            complement(289103..289558)
                     /locus_tag="KPHS_02480"
                     /db_xref="GeneID:11845235"
     CDS             complement(289103..289558)
                     /locus_tag="KPHS_02480"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
                     N-acyltransferase"
                     /protein_id="YP_005224548.1"
                     /db_xref="GeneID:11845235"
                     /translation="MPELRDTGVRNVVCGENVVIYQPANLYDCQLGDNVFVGPFVEIQ
                     RNTRIGANSKIQSHTFICEYVTIGQRCFIGHGVMFANDLFREGKPNADRASWGRIEIG
                     DDVSIGSGATILAVSICDGVVIGAGSVVTKSITEKGVWAGNPARLLRRL"
     misc_feature    complement(289112..289468)
                     /locus_tag="KPHS_02480"
                     /note="WcxM-like, Left-handed parallel beta-Helix (LbH)
                     N-terminal domain: This group is composed of Xanthomonas
                     campestris WcxM and proteins with similarity to the WcxM
                     N-terminal domain. WcxM is thought to be bifunctional,
                     catalyzing both the isomerization...; Region:
                     LbH_WxcM_N_like; cd03358"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(289130..289132,289178..289180,
                     289232..289234,289241..289243,289247..289249,
                     289298..289300,289304..289309,289325..289327,
                     289343..289345,289349..289351,289373..289375,
                     289397..289399,289403..289405))
                     /locus_tag="KPHS_02480"
                     /note="putative trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(289127..289129,289133..289138,
                     289163..289168,289181..289186,289217..289219,
                     289232..289237,289241..289243,289298..289300,
                     289307..289309,289391..289393,289397..289399))
                     /locus_tag="KPHS_02480"
                     /note="putative active site [active]"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(289307..289309,289391..289393,
                     289397..289399))
                     /locus_tag="KPHS_02480"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(289115..289117,289127..289129,
                     289133..289138,289142..289144,289163..289168,
                     289181..289186,289190..289192,289217..289219,
                     289232..289237,289241..289243,289298..289300,
                     289307..289309))
                     /locus_tag="KPHS_02480"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100048"
     gene            complement(289567..290076)
                     /locus_tag="KPHS_02490"
                     /db_xref="GeneID:11845236"
     CDS             complement(289567..290076)
                     /locus_tag="KPHS_02490"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="YP_005224549.1"
                     /db_xref="GeneID:11845236"
                     /translation="MLTIRQACPEDAPQLSAMGYASYHHHFAHLWRDADELALFLKQE
                     YAEDALRRSLADATQHWLIAEAPSPVGFAKYSYQQRMADDGKIGTLLHKLYLMPGKTG
                     HRYGEHIFHAVETRAKTAGESWLWLEVLAANPAARRFYERQGMQHIRDTIFHSASQQS
                     TLHILAKPI"
     misc_feature    complement(289642..289989)
                     /locus_tag="KPHS_02490"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:334159"
     gene            complement(290184..290564)
                     /locus_tag="KPHS_02500"
                     /db_xref="GeneID:11845237"
     CDS             complement(290184..290564)
                     /locus_tag="KPHS_02500"
                     /codon_start=1
                     /transl_table=11
                     /product="reactive intermediate/imine deaminase"
                     /protein_id="YP_005224550.1"
                     /db_xref="GeneID:11845237"
                     /translation="MIITTADAPAAIGPYVQGVNLGAMTITSGQLPINPLDGTMPGDI
                     AEQARQSLENVKAIVEAAGLTVGQIVKTTVFVKDLADFAAINAAYEAFFIEHQAAFPA
                     RSCVEVARLPKDAGVEIEAIAFAR"
     misc_feature    complement(290196..290561)
                     /locus_tag="KPHS_02500"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cl10015"
                     /db_xref="CDD:299145"
     misc_feature    complement(order(290199..290201,290205..290207,
                     290211..290213,290241..290264,290298..290300,
                     290307..290309,290340..290342,290346..290348,
                     290352..290357,290361..290363,290478..290483,
                     290487..290489,290493..290495,290502..290504,
                     290508..290510,290517..290522))
                     /locus_tag="KPHS_02500"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(290211..290213,290256..290258,
                     290307..290309,290319..290321,290520..290522))
                     /locus_tag="KPHS_02500"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     misc_feature    complement(290585..290905)
                     /note="potential frameshift: common BLAST hit:
                     gi|375258435|ref|YP_005017605.1| putative transmembrane
                     protein"
     gene            complement(290585..290716)
                     /locus_tag="KPHS_02510"
                     /db_xref="GeneID:11845238"
     CDS             complement(290585..290716)
                     /locus_tag="KPHS_02510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224551.1"
                     /db_xref="GeneID:11845238"
                     /translation="MEFDLKNPKVIAAIICTLASFRLGLVWVVVSGVGSLVLLNYFM"
     gene            complement(290738..290905)
                     /locus_tag="KPHS_02520"
                     /db_xref="GeneID:11845239"
     CDS             complement(290738..290905)
                     /locus_tag="KPHS_02520"
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparagine permease"
                     /protein_id="YP_005224552.1"
                     /db_xref="GeneID:11845239"
                     /translation="MSNSYFIALTLGMAAVTFLIRFSFIGLAGKIQMSERVTKTLRFV
                     PVTVLPAIITI"
     misc_feature    complement(<290747..290905)
                     /locus_tag="KPHS_02520"
                     /note="Branched-chain amino acid transport protein (AzlD);
                     Region: AzlD; cl00735"
                     /db_xref="CDD:321137"
     gene            complement(290898..291638)
                     /locus_tag="KPHS_02530"
                     /db_xref="GeneID:11845240"
     CDS             complement(290898..291638)
                     /locus_tag="KPHS_02530"
                     /codon_start=1
                     /transl_table=11
                     /product="putative amino acid transport protein"
                     /protein_id="YP_005224553.1"
                     /db_xref="GeneID:11845240"
                     /translation="MNKKVIFRGASAIMPLCIGDFPFSFIVGALSVSAGMSVWQSTAW
                     SAIVIAGSAQMLALNMLKTGATLGVIIFTTLIINLRHVLYSASISGSVREASFFKKCF
                     MSYALTDEVYATTVKEMEGNKKEKYLFYGSAMITFWAIWVLADFLGALVGASFPHIEK
                     YGLDFAMVAAFIAIVVPQIKSQACTVAAVVAAVSGVLLVVLPYSLGIVVASVLGVLAG
                     LCVDLAEERKQMAKTESDMPLVEAMENE"
     misc_feature    complement(290982..291617)
                     /locus_tag="KPHS_02530"
                     /note="Predicted branched-chain amino acid permease
                     (azaleucine resistance) [Amino acid transport and
                     metabolism]; Region: AzlC; COG1296"
                     /db_xref="CDD:224215"
     gene            complement(291722..292999)
                     /locus_tag="KPHS_02540"
                     /db_xref="GeneID:11845241"
     CDS             complement(291722..292999)
                     /locus_tag="KPHS_02540"
                     /codon_start=1
                     /transl_table=11
                     /product="serine dehydratase subunit alpha family protein"
                     /protein_id="YP_005224554.1"
                     /db_xref="GeneID:11845241"
                     /translation="MNTDNASLYVKWLKQEVAPALGCTEPVAISFAAAYAAQYLDQPC
                     TKISGFISANLYKNAMGVTIPGTTVCGVPLAAAIGAFGGDPQKGLKTLEDITPRHVEM
                     AQKLIANNAVDIAVEETPDFIHLDLTLSAGENCCRVVVKGTHTNVVELYINGQPQPLS
                     EKQNTHTQRETLPTFSLQQAYDFINRVDFNDIRFILDAARLNSALAAEGKTKKYGLNI
                     NGTFSDAVKNGLMSNDLLSKVIINTVAASDARMGGAPVVAMSNFGSGNQGITATIPVV
                     VVAEHLGVDEETLARALSLSHLTAISIHSRYTRLSALCAASTAAMGAAAGMAWLFTRD
                     INTINTAIINMVSDITGMICDGGSNSCAMKVSSVVSSAFKAVLMAMQNSCAGANDGIV
                     CADVEQTINNLCRLVIKPMTLTDKEIISIMVAK"
     misc_feature    complement(291725..292978)
                     /locus_tag="KPHS_02540"
                     /note="L-cysteine desulfidase [Amino acid transport and
                     metabolism]; Region: CdsB; COG3681"
                     /db_xref="CDD:226206"
     gene            293373..293783
                     /locus_tag="KPHS_02550"
                     /db_xref="GeneID:11845242"
     CDS             293373..293783
                     /locus_tag="KPHS_02550"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-starvation-inducible protein PsiE"
                     /protein_id="YP_005224555.1"
                     /db_xref="GeneID:11845242"
                     /translation="MPSVYRPLVNFVAKAMQAVLNLALLCLGIILVVFLGKETLHLAH
                     VLFTPEPVSKYKLVEGLVVYFLYFEFIALIVKYFESGFHFPLRYFVYIGITAIVRLII
                     VDHESPLAVLIYSAAILILVITLWLCNSNRLKRE"
     misc_feature    293385..293780
                     /locus_tag="KPHS_02550"
                     /note="phosphate-starvation-inducible protein PsiE;
                     Provisional; Region: PRK02833"
                     /db_xref="CDD:235075"
     gene            complement(293975..294865)
                     /locus_tag="KPHS_02560"
                     /db_xref="GeneID:11845243"
     CDS             complement(293975..294865)
                     /locus_tag="KPHS_02560"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose transporter permease"
                     /protein_id="YP_005224556.1"
                     /db_xref="GeneID:11845243"
                     /translation="MAMVQPKSQKLRLFTTHLLLLIFIAAIMFPLLMVIAISLREGNF
                     ATGSLIPDTISWEHWRLALGFSVEHADGRVTPPPFPVLLWLWNSIKVAGITAIGIVAL
                     STTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGQYIPFVGLNTHG
                     GVIFAYMGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVV
                     FILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITV
                     VFLLAQRWLVNGLTAGGVKG"
     misc_feature    complement(293978..294865)
                     /locus_tag="KPHS_02560"
                     /note="maltose transporter permease; Provisional; Region:
                     malG; PRK10998"
                     /db_xref="CDD:182891"
     misc_feature    complement(order(294044..294046,294053..294058,
                     294065..294070,294074..294079,294086..294091,
                     294119..294124,294161..294166,294173..294184,
                     294203..294205,294212..294217,294257..294259,
                     294308..294310,294317..294322,294332..294334,
                     294338..294343,294350..294352,294356..294358,
                     294362..294367,294443..294445,294449..294454,
                     294461..294490,294494..294505,294533..294535,
                     294548..294553,294560..294565))
                     /locus_tag="KPHS_02560"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(294167..294184,294443..294487))
                     /locus_tag="KPHS_02560"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(294089..294091,294119..294121,
                     294128..294130,294164..294166,294380..294382,
                     294443..294445))
                     /locus_tag="KPHS_02560"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(294236..294238,294248..294253,
                     294269..294307))
                     /locus_tag="KPHS_02560"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(294880..296424)
                     /locus_tag="KPHS_02570"
                     /db_xref="GeneID:11845244"
     CDS             complement(294880..296424)
                     /locus_tag="KPHS_02570"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose transporter membrane protein"
                     /protein_id="YP_005224557.1"
                     /db_xref="GeneID:11845244"
                     /translation="MDAVKKRHWWQSPQLTWSVIGLLCLLVGYLVVLMYAQGEYLFAI
                     MTLILSSVGLYIFANRKAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSSTNQLTF
                     ERAQQVLMDRSFQAGKAYNFTLIPAGDEWKLALTDGESGKNYLSDAFKFGGEQKLALK
                     ETDALPEGERANLRVITQNRTALNQLTAVLPDDSKVIMSSLRQFSGTQPLYTLGEDGV
                     LTNNQTHVKYRPNNDVGFYQSINADGSWGNEKLSPGYTVTIGWDNFTRVFHDEGIQKP
                     FFAIFVWTVVFSVLTVVLTVAVGMILACLVQWEALKGKAIYRVLLILPYAVPSFISIL
                     IFKGLFNQSFGEINMMLSTLFGIKPAWFSDPTTARTMIIIVNTWLGYPYMMILCMGLL
                     KAIPDDLYEASAMDGAGPFQNFFKITFPLLIKPLTPLMIASFAFNFNNFVLIQLLTNG
                     GPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKA
                     TRMKFD"
     misc_feature    complement(294883..296424)
                     /locus_tag="KPHS_02570"
                     /note="maltose transporter membrane protein; Provisional;
                     Region: malF; PRK10999"
                     /db_xref="CDD:236816"
     gene            complement(296542..297732)
                     /locus_tag="KPHS_02580"
                     /db_xref="GeneID:11845245"
     CDS             complement(296542..297732)
                     /locus_tag="KPHS_02580"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter periplasmic protein"
                     /protein_id="YP_005224558.1"
                     /db_xref="GeneID:11845245"
                     /translation="MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYN
                     GLAEVGKKFEKDTGIKVSVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLL
                     AEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPA
                     LDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDSAGAKAGL
                     TFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTF
                     KGKPSKPFVGVLSAGINAASPNKELAKEFLENYLMTDQGLEAVNNDKPLGAVALKSFQ
                     EKLEKDPRIAATMANAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALKDAQS
                     RITK"
     misc_feature    complement(296545..297732)
                     /locus_tag="KPHS_02580"
                     /note="maltose ABC transporter periplasmic protein;
                     Reviewed; Region: malE; PRK09474"
                     /db_xref="CDD:236533"
     gene            298103..299212
                     /locus_tag="KPHS_02590"
                     /db_xref="GeneID:11845246"
     CDS             298103..299212
                     /locus_tag="KPHS_02590"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose/maltodextrin transporter ATP-binding
                     protein"
                     /protein_id="YP_005224559.1"
                     /db_xref="GeneID:11845246"
                     /translation="MASVQLRNVTKAWGDVVVSKDINLDIHEGEFVVFVGPSGCGKST
                     LLRMIAGLETITSGDLFIGDTRMNEIPPAERGVGMVFQSYALYPHLSVAENMSFGLKL
                     AGAKKDLINQRVTQVAEVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPSVFLLDEP
                     LSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP
                     LELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPNRQQIWLPVDSANVQAG
                     ANMSLGIRPEHLLPSDIADVTLEGEVQVVEQLGHETQIHIQIPAIRQNLVYRQNDVVL
                     VEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV"
     misc_feature    298103..299209
                     /locus_tag="KPHS_02590"
                     /note="maltose/maltodextrin transporter ATP-binding
                     protein; Provisional; Region: PRK11000"
                     /db_xref="CDD:182893"
     gene            299296..300585
                     /locus_tag="KPHS_02600"
                     /db_xref="GeneID:11845247"
     CDS             299296..300585
                     /locus_tag="KPHS_02600"
                     /codon_start=1
                     /transl_table=11
                     /product="maltoporin"
                     /protein_id="YP_005224560.1"
                     /db_xref="GeneID:11845247"
                     /translation="MMITLRKLPLAVAVAAGVMSAQALAVDFHGYARSGIGWTGSGGE
                     QQCFKATGAQSKYRLGNECETYAELKLGQELWKEGDKSFYFDTNVAYSVNQEDDWEST
                     SPAFREANIQGKNLIDWLPGSTLWAGKRFYQRHDVHMIDFYYWDISGPGAGLENVDLG
                     FGKLSLAATRNSESGGSYTFSSDDTKKYAAKTANDVFDIRLAGLETNPGGVLELGVDY
                     DRANPQDDYRLEDGASKDGWMWTGEHTQSIWGGFNKFVVQYATDAMTSWNSGHSQGTS
                     IDNNGSMIRVLDHGAMDFNDDWGLMYVAMYQDVDLDSKNGSTWYTVGVRPMYKWTPIM
                     STQLEIGYDNVKSQRTSENNNQYKITLAQQWQAGNSVWSRPAIRIFATYAKWDENWGY
                     SNTSGLQTKDSSGSGAFTSSRGDDSEVTFGAQMEVWW"
     misc_feature    299296..300582
                     /locus_tag="KPHS_02600"
                     /note="maltoporin; Provisional; Region: lamB; PRK09360"
                     /db_xref="CDD:236481"
     gene            300700..301623
                     /locus_tag="KPHS_02610"
                     /db_xref="GeneID:11845248"
     CDS             300700..301623
                     /locus_tag="KPHS_02610"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose operon periplasmic"
                     /protein_id="YP_005224561.1"
                     /db_xref="GeneID:11845248"
                     /translation="MKMKKTLVALCLSAGMLACVPGMSLADVNFVPQNTSAAPAIPAS
                     ALQQLIWTPADQSKTQSVDLTTGGQRLDVPGIVGPVAAWSVPANIGELTLTLDSELNK
                     HKQIFAPNVLILDQNMTPAAFFPSNYFTYQQPGVMTADRLGGVMRLTPALGQQKLYVL
                     VFTTEKDLQQTTTLLDPAKAYAKGAGNAAPDIPDPIAKHTTDGVLKLKVKTNSTSSVL
                     VGPLFGSSGPGPVTVGNTAAPVAAPAAAAAPAAKSEPMLSDTETYFNNGIKQAVKQGD
                     IDKALKLMNEAERLGSKSARSTFISSVKGKG"
     misc_feature    300703..301620
                     /locus_tag="KPHS_02610"
                     /note="maltose regulon periplasmic protein; Provisional;
                     Region: PRK10564"
                     /db_xref="CDD:236716"
     gene            301811..302308
                     /locus_tag="KPHS_02620"
                     /db_xref="GeneID:11845249"
     CDS             301811..302308
                     /locus_tag="KPHS_02620"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate pyruvate lyase"
                     /protein_id="YP_005224562.1"
                     /db_xref="GeneID:11845249"
                     /translation="MSHPALTRLRALRYFAVMPSLPPPLSDWLLLEDSMTQRFEQQGK
                     QVTVTLVNEGYIGRDALTDEAALLPDEPRYWLREIILNADGEPWLAGRTVAPESTLCG
                     PELALQQLGQTPLGRYLFTSSTLTRDFIEIGRDAALWGRRSRLRLSGKPLLLTELFLP
                     ASPLY"
     misc_feature    301811..302305
                     /locus_tag="KPHS_02620"
                     /note="chorismate pyruvate lyase; Provisional; Region:
                     ubiC; PRK11655"
                     /db_xref="CDD:236949"
     gene            302321..303187
                     /locus_tag="KPHS_02630"
                     /db_xref="GeneID:11845250"
     CDS             302321..303187
                     /locus_tag="KPHS_02630"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="YP_005224563.1"
                     /db_xref="GeneID:11845250"
                     /translation="MEWSLSQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVASPGVP
                     PLWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTARRPLPSGDVTEKEARTLFIV
                     LVLLSFLLVLTLNTMTILLSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFSA
                     VSESLPLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGENDRLIIGIL
                     QVAVLALMGAVGWLNGLGWEYYWSLFVAAGLFGWQQKLIFNRDRDNCFKAFMNNNYVG
                     LVLFLGLAMSYL"
     misc_feature    302336..303181
                     /locus_tag="KPHS_02630"
                     /note="4-hydroxybenzoate octaprenyltransferase; Reviewed;
                     Region: ubiA; PRK12848"
                     /db_xref="CDD:237229"
     misc_feature    order(302531..302533,302543..302545,302891..302893,
                     302903..302905)
                     /locus_tag="KPHS_02630"
                     /note="putative active site [active]"
                     /db_xref="CDD:260122"
     gene            complement(303236..305659)
                     /locus_tag="KPHS_02640"
                     /db_xref="GeneID:11845251"
     CDS             complement(303236..305659)
                     /locus_tag="KPHS_02640"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_005224564.1"
                     /db_xref="GeneID:11845251"
                     /translation="MSGWQRIYYKLLNLPLQVLVKSKSIPAEPAQELGLDTSRPVMYV
                     LPYNSKADLLTLRAQCLAHDLPDPLEPLEIDGALLPRYVFIHGGPRVFTYYTPKEESI
                     KLFHDYLDLHRNHPDLDVQMVPVSVMFGRSPGREKGEVNPPLRMLNGIQKFFAVSWLG
                     RDSFVRFSPSVSLRRMADEHGTDKIIAQKLARVARMHFARQRLAAVGPRLPARQDLFN
                     KLLASKAIARAVEDEARSKKISHEKAQQNAIALMEEIAANFSYEMIRLTDRILGFTWN
                     RLYQGINVHNAERVRQLAHDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGIN
                     LNFWPAGPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFVEGGRSRTG
                     RLLDPKTGTLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGATKEKESLP
                     QMVRGLSKLRNLGQGYVNFGEPLPLMTYLNQHVPDWREAIDPIEAVRPSWLTPTVNSI
                     AADLMVRINNAGAANAMNLCCTALLASRQRSLTREQLTQQLECYLALLRNVPYSPDAT
                     APSASASELIDHALQMNKFEVEKDTIGDIIILPREQAVLMTYYRNNITHMLVMPSLLA
                     ALVTQHRHLSRAEVLRHVETLYPFLKAELFLRWEKAELAGVVDALIAEMLRQELIVVD
                     GDVMSLNPSHSRSLQLLAAGARETLQRYAITFWLLSANPAINRSSLEKESRTVAQRLS
                     VLHGINAPEFFDKAVFSTLVLTLRDEGYISDTGDAEPEETLKVYRMLADLITSDVRLT
                     IESVTQDDA"
     misc_feature    complement(303239..305659)
                     /locus_tag="KPHS_02640"
                     /note="glycerol-3-phosphate acyltransferase; Validated;
                     Region: PRK04974"
                     /db_xref="CDD:235325"
     misc_feature    complement(order(304496..304504,304655..304666,
                     304727..304729,304733..304735,304742..304744))
                     /locus_tag="KPHS_02640"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153255"
     gene            305788..306156
                     /locus_tag="KPHS_02650"
                     /db_xref="GeneID:11845252"
     CDS             305788..306156
                     /locus_tag="KPHS_02650"
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="YP_005224565.1"
                     /db_xref="GeneID:11845252"
                     /translation="MANNTTGLTRIIKAAGYSWKGFRAAWINEAAFRQEGVAAIVAVA
                     VACWLDVDAITRVLLIGSVLLVMIVEILNSAIEAVVDRIGSDFHELSGRAKDMGSAAV
                     LLAIIIALITWGTLLWSHYH"
     misc_feature    305812..306138
                     /locus_tag="KPHS_02650"
                     /note="Integral membrane diacylglycerol kinase; Region:
                     DAGK_IM; cd14264"
                     /db_xref="CDD:260133"
     misc_feature    order(305812..305814,305827..305829,305839..305841,
                     305848..305850,305875..305877,305884..305886,
                     305890..305892,305995..305997,306004..306009,
                     306016..306018,306028..306033,306067..306075,
                     306079..306084,306088..306090)
                     /locus_tag="KPHS_02650"
                     /note="putative active site [active]"
                     /db_xref="CDD:260133"
     misc_feature    order(305833..305853,305857..305862,305944..305952,
                     305956..305961,305968..305970,305977..305979,
                     305989..305994,305998..306003,306007..306015,
                     306019..306027,306031..306036,306049..306051,
                     306055..306060,306067..306069,306076..306078,
                     306085..306090,306097..306102,306109..306111,
                     306121..306123,306130..306135)
                     /locus_tag="KPHS_02650"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:260133"
     misc_feature    order(305845..305847,305872..305874,305995..305997,
                     306016..306018,306028..306030,306070..306075)
                     /locus_tag="KPHS_02650"
                     /note="putative active site [active]"
                     /db_xref="CDD:260133"
     misc_feature    order(305872..305874,306016..306018)
                     /locus_tag="KPHS_02650"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:260133"
     gene            306279..306887
                     /locus_tag="KPHS_02660"
                     /db_xref="GeneID:11845253"
     CDS             306279..306887
                     /locus_tag="KPHS_02660"
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="YP_005224566.1"
                     /db_xref="GeneID:11845253"
                     /translation="MKALTTRQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAE
                     EHLKALARKGAIEIVSGASRGIRLLTEEEQGLPLIGRVAAGEPLLAQQHIEGHYQVDP
                     SMFKPNADFLLRVSGMSMKDIGILDGDLLAVHKTQDVRNGQVVVARIDEEVTVKRLKK
                     QGNVVELLPENSEFSPIVVDLRQQSFTIEGLAVGVIRNGEWL"
     misc_feature    306285..306875
                     /locus_tag="KPHS_02660"
                     /note="LexA repressor; Validated; Region: PRK00215"
                     /db_xref="CDD:234688"
     gene            306957..308273
                     /locus_tag="KPHS_02670"
                     /db_xref="GeneID:11845254"
     CDS             306957..308273
                     /locus_tag="KPHS_02670"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein F"
                     /protein_id="YP_005224567.1"
                     /db_xref="GeneID:11845254"
                     /translation="MLLNAADKALWRLALPMIFSNITVPLLGLVDTAVIGHLDSPVYL
                     GGVAVGATATSFLFMLLLFLRMSTTGLTAQAWGAKDPQRLARALVQPLALALGAGVLI
                     ILLRLPLIDLALHIVGGSEAVLEQARRFLEIRWLSAPASLANLVLLGWLLGVQYARAP
                     VILLVVGNLLNIVLDLWLVMGLRMNVQGAALATVTAEYATLIIGLLMAKRVLTLRGVS
                     LAMLKNAWRGDLRRLLALNRDIMLRSLLLQLCFGALTVFGARLGSDIVAVNAVLMTML
                     TFTAYALDGFAYAVEAHSGQAYGARDGSQLLEVWRAACRQSGMVALAFALIYSLAGQY
                     IIALLTSLPSLQQLADRYLIWQTILPVVGVWCYLLDGMFIGATRGAEMRNSMAVAAAG
                     FAVTLLTLPVLGNHGLWLALAVFLALRGLSLALIWRRHWRRGTWFS"
     misc_feature    306957..308270
                     /locus_tag="KPHS_02670"
                     /note="DNA-damage-inducible SOS response protein;
                     Provisional; Region: PRK10367"
                     /db_xref="CDD:182413"
     gene            complement(308293..308442)
                     /locus_tag="KPHS_02680"
                     /db_xref="GeneID:11845255"
     CDS             complement(308293..308442)
                     /locus_tag="KPHS_02680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224568.1"
                     /db_xref="GeneID:11845255"
                     /translation="MRMLASIRYSEFLTIAPRDNAKRMFPACATLSRAIESPCKRSAT
                     GEGHG"
     gene            308508..308717
                     /locus_tag="KPHS_02690"
                     /db_xref="GeneID:11845256"
     CDS             308508..308717
                     /locus_tag="KPHS_02690"
                     /codon_start=1
                     /transl_table=11
                     /product="putative stress-response protein"
                     /protein_id="YP_005224569.1"
                     /db_xref="GeneID:11845256"
                     /translation="MNKDEIGGNWKQFKGKAKEQWGKLTDDDMTVIEGKRDQLVGKIQ
                     ERYGYEKDQAEKEVSDWEHKNDYRW"
     misc_feature    308508..308714
                     /locus_tag="KPHS_02690"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10428"
                     /db_xref="CDD:182452"
     gene            complement(308813..309328)
                     /locus_tag="KPHS_02700"
                     /db_xref="GeneID:11845257"
     CDS             complement(308813..309328)
                     /locus_tag="KPHS_02700"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake transcriptional repressor"
                     /protein_id="YP_005224570.1"
                     /db_xref="GeneID:11845257"
                     /translation="MDKTPSQEMLAHAEKLCAQRGVRLTPQRLEVLRLMSLQQGAISA
                     YDLLDLLREKEPQAKPPTVYRALEFLLEQGFVHKVESTNSYVLCHLFDQPTHSSAMFI
                     CDRCGVVKEEAAEGVEDIMHTLAARMGFALRHNVIEAHGLCAGCVEVEACSTPGHCQH
                     DHTIQLKKKAR"
     misc_feature    complement(308822..309328)
                     /locus_tag="KPHS_02700"
                     /note="zinc uptake transcriptional repressor; Provisional;
                     Region: PRK11639"
                     /db_xref="CDD:183251"
     misc_feature    complement(order(308996..308998,309029..309031,
                     309041..309043,309062..309064,309206..309208))
                     /locus_tag="KPHS_02700"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(309110..309154)
                     /locus_tag="KPHS_02700"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(308924..308926,308975..308977,
                     309032..309034,309044..309046))
                     /locus_tag="KPHS_02700"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(308903..308929,308933..308941,
                     308966..308971,309017..309025))
                     /locus_tag="KPHS_02700"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(308900..308902,309011..309013,
                     309020..309022))
                     /locus_tag="KPHS_02700"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            309327..309485
                     /locus_tag="KPHS_02710"
                     /db_xref="GeneID:11845258"
     CDS             309327..309485
                     /locus_tag="KPHS_02710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224571.1"
                     /db_xref="GeneID:11845258"
                     /translation="MSILGLREFESVTLSRSSENTESRQVIRVILQVVGTGARPERWP
                     LILEQTTP"
     gene            309578..310066
                     /locus_tag="KPHS_02720"
                     /db_xref="GeneID:11845259"
     CDS             309578..310066
                     /locus_tag="KPHS_02720"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="YP_005224572.1"
                     /db_xref="GeneID:11845259"
                     /translation="MKRPDCIRHWRELEGPDDATYPDSPERFSIGAPLGRGLRLNRLG
                     IHHERLPPGRRTSYPHAESDEEEFIYVLEGYPEVWINGYLWKLEPGDSVGFPAGTGIC
                     HTFLNNTEQEVRLLVVGEANKKYNRIYYPLNPGYAATRQDRWVDHPPQFFGPHDGKPR
                     KK"
     misc_feature    309593..310054
                     /locus_tag="KPHS_02720"
                     /note="Conserved domain found in cupin and related
                     proteins; Region: cupin_like; cl21464"
                     /db_xref="CDD:354820"
     gene            310167..311165
                     /locus_tag="KPHS_02730"
                     /db_xref="GeneID:11845260"
     CDS             310167..311165
                     /locus_tag="KPHS_02730"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="YP_005224573.1"
                     /db_xref="GeneID:11845260"
                     /translation="MMPESTSPVFPAHRFSIAPMLDWTDRHCRYFLRLLSRHTLLYTE
                     MVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPQALAQCAKLAEARGYDEINLNVGCP
                     SDRVQNGMFGACLMGNAPLVADCIKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFIET
                     VSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVWQLKRDFPHLTMAINGGIKS
                     LDEARVQLEHMDGVMVGREAYQNPGILASVDREIFGVAGADADPVAVVRAMYPYIERE
                     LSKGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADIAVLEHALKLVADKR"
     misc_feature    310179..311159
                     /locus_tag="KPHS_02730"
                     /note="tRNA-dihydrouridine synthase A; Provisional;
                     Region: PRK11815"
                     /db_xref="CDD:236991"
     gene            311305..311547
                     /locus_tag="KPHS_02740"
                     /db_xref="GeneID:11845261"
     CDS             311305..311547
                     /locus_tag="KPHS_02740"
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein G"
                     /protein_id="YP_005224574.1"
                     /db_xref="GeneID:11845261"
                     /translation="MLELLFVIGFFVMLLVTGVSLLGIIAAIVVATALMFVGGLFALM
                     IKLLPWLLLAVAVVWVIRALKSPNGNAFRDNNRWRY"
     misc_feature    311305..311532
                     /locus_tag="KPHS_02740"
                     /note="phage shock protein G; Reviewed; Region: pspG;
                     PRK09459"
                     /db_xref="CDD:181875"
     gene            complement(311730..312713)
                     /locus_tag="KPHS_02750"
                     /db_xref="GeneID:11845262"
     CDS             complement(311730..312713)
                     /locus_tag="KPHS_02750"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="YP_005224575.1"
                     /db_xref="GeneID:11845262"
                     /translation="MATRIEFSKHGGPEVLQAVEFTPRDPAEHEIQVENKAIGINYID
                     TYVRSGLYPPPSLPSGLGTEAAGIVSKVGHGVTHIKVGDRVVYAQSALGAYSTVHNVL
                     ADKAAVLPDAISFEQAAASFLKGLTVWYLLRKTYEIKPDEMFLFHAAAGGVGLIACQW
                     AKALGAKLIGTVGSAQKAQRAKEAGAWQVINYREESIVERLKALTDGKKVAVVYDSVG
                     KDTWEASLDCLQRRGLMVSFGNSSGPVTGVNLGILNQKGSLYVTRPSLQGYITNREEL
                     EEACSELFSLIASGVIKVDVAESQIYPLSEARRAHEVLESRVTQGSSLLLP"
     misc_feature    complement(311733..312713)
                     /locus_tag="KPHS_02750"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     misc_feature    complement(order(311763..311765,311769..311771,
                     311916..311927,311988..312002,312063..312068,
                     312138..312140,312183..312185,312195..312200,
                     312255..312263,312270..312272,312324..312326,
                     312333..312335,312345..312347,312576..312578,
                     312588..312593))
                     /locus_tag="KPHS_02750"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(311907..311912,311919..311942,
                     311964..311981,312018..312023,312309..312311))
                     /locus_tag="KPHS_02750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176189"
     gene            312883..314298
                     /locus_tag="KPHS_02760"
                     /db_xref="GeneID:11845263"
     CDS             312883..314298
                     /locus_tag="KPHS_02760"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="YP_005224576.1"
                     /db_xref="GeneID:11845263"
                     /translation="MAGNKPFNKPQTETRERDPQLAGLKVPPHSIEAEQSVLGGLMLD
                     NERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGG
                     FAYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDL
                     AESRVFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKT
                     AGLQPSDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASL
                     SRVDQTRIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREH
                     GGIGLIMIDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQR
                     ADKRPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVR
                     LTFNGQWSRFDNYAGPQYDDE"
     misc_feature    312883..314295
                     /locus_tag="KPHS_02760"
                     /note="replicative DNA helicase; Provisional; Region:
                     PRK08006"
                     /db_xref="CDD:181193"
     gene            314330..315409
                     /locus_tag="KPHS_02770"
                     /db_xref="GeneID:11845264"
     CDS             314330..315409
                     /locus_tag="KPHS_02770"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_005224577.1"
                     /db_xref="GeneID:11845264"
                     /translation="MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLE
                     TARTLTDADAFGVARLEEALRLRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSP
                     EQLAALEQADLPEPVTVWMKLDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHF
                     ARADEPTCGATERQLDIFTTFTEGKPGLRSIAASGGILLWPQSHYDWVRPGIILYGVS
                     PLDDRSTGKDFGCQPVMTLTSSLIAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGD
                     GYPRAAPSGTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLPVERI
                     AEITKVSAYELITRLTSRVAMKYLD"
     misc_feature    314336..315400
                     /locus_tag="KPHS_02770"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzymes, Proteobacterial Alanine Racemases; Region:
                     PLPDE_III_AR_proteobact; cd06827"
                     /db_xref="CDD:143500"
     misc_feature    order(314423..314425,314429..314431,314441..314443,
                     314561..314563,314693..314695,314714..314716,
                     314798..314800,314804..314806,314906..314914,
                     314954..314965,315356..315358)
                     /locus_tag="KPHS_02770"
                     /note="active site"
                     /db_xref="CDD:143500"
     misc_feature    order(314423..314425,314429..314431,314441..314443,
                     314561..314563,314804..314806,314906..314911,
                     314954..314956,314960..314965,315356..315358)
                     /locus_tag="KPHS_02770"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143500"
     misc_feature    order(314429..314431,314441..314443,314714..314716,
                     314804..314806,315356..315358)
                     /locus_tag="KPHS_02770"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143500"
     misc_feature    order(314429..314431,315092..315094)
                     /locus_tag="KPHS_02770"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143500"
     misc_feature    order(315053..315055,315062..315064,315080..315085,
                     315089..315097,315134..315136,315149..315151,
                     315167..315169,315233..315235,315239..315241,
                     315350..315352,315356..315361,315374..315376,
                     315383..315385)
                     /locus_tag="KPHS_02770"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143500"
     gene            315586..316779
                     /locus_tag="KPHS_02780"
                     /db_xref="GeneID:11845265"
     CDS             315586..316779
                     /locus_tag="KPHS_02780"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="YP_005224578.1"
                     /db_xref="GeneID:11845265"
                     /translation="MFQKVDAYAGDPILSLMERFKEDPRSDKVNLSIGLYYNDDGIIP
                     QLQAVAEAEARLNAEPHGASLYLPMEGLSGYRQAIAPLLFGAEHTALKQNRIASIQTV
                     GGSGALKVGADFLKRYFPESHVWVSDPTWENHIAIFEGAGFEVSTYPWFDKATNGVRF
                     EDLLATLQTLPARDIVLLHPCCHNPTGADLTPAQWDRVVEVLKARQLIPFLDIAYQGF
                     GGGLEEDAYAIRAIASAGMPMLVSNSFSKIFSLYGERVGGLSVVCEDSETAGRVLGQL
                     KATVRRNYSSPPSFGAQVVATVLNDAALKATWQAEVDAMRAHILTMRQALVDALQQVA
                     PGSKVDYLLKQRGMFSYTGFSAAQVDRLRDEFGVYLIASGRMCVAGLNSRNVQQVAKA
                     FAAVM"
     misc_feature    315586..316776
                     /locus_tag="KPHS_02780"
                     /note="aromatic amino acid aminotransferase; Provisional;
                     Region: PRK09257"
                     /db_xref="CDD:181731"
     gene            316970..317683
                     /locus_tag="KPHS_02790"
                     /db_xref="GeneID:11845266"
     CDS             316970..317683
                     /locus_tag="KPHS_02790"
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase/phosphotransferase"
                     /protein_id="YP_005224579.1"
                     /db_xref="GeneID:11845266"
                     /translation="MRKLTLALAAASLLFTLNSAVVARASTPQPLWVGTNVAQLAEQA
                     PIHWVSVAQIENSLLGRPPMAVGFDIDDTVLFSSPGFWRGQKTFSPGSEDYLKNPQFW
                     EKMNNGWDEFSMPKEVARQLIAMHVKRGDSIWFVTGRSQTKTETVSKTLQDDFLIPAA
                     NMNPVIFAGDKPGQNTKTQWLQAKQIKVFYGDSDNDITAAREAGARGIRVLRAANSSY
                     KPLPMAGALGEEVIVNSEY"
     misc_feature    317021..317680
                     /locus_tag="KPHS_02790"
                     /note="acid phosphatase/phosphotransferase; Provisional;
                     Region: aphA; PRK11009"
                     /db_xref="CDD:236818"
     misc_feature    order(317123..317128,317135..317137,317195..317197,
                     317201..317206,317213..317218,317225..317227,
                     317294..317296,317300..317314,317429..317431,
                     317603..317614,317630..317647,317666..317671,
                     317675..317680)
                     /locus_tag="KPHS_02790"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319802"
     misc_feature    order(317174..317188,317210..317212,317252..317257,
                     317273..317275,317378..317386,317477..317479,
                     317498..317500,317540..317545,317552..317557,
                     317618..317623)
                     /locus_tag="KPHS_02790"
                     /note="active site"
                     /db_xref="CDD:319802"
     misc_feature    317174..317188
                     /locus_tag="KPHS_02790"
                     /note="HAD signature motif I; other site"
                     /db_xref="CDD:319802"
     misc_feature    317378..317380
                     /locus_tag="KPHS_02790"
                     /note="HAD signature motif II; other site"
                     /db_xref="CDD:319802"
     misc_feature    317498..317500
                     /locus_tag="KPHS_02790"
                     /note="HAD signature motif III; other site"
                     /db_xref="CDD:319802"
     misc_feature    order(317540..317545,317555..317557)
                     /locus_tag="KPHS_02790"
                     /note="HAD signature motif IV; other site"
                     /db_xref="CDD:319802"
     gene            317814..318230
                     /locus_tag="KPHS_02800"
                     /db_xref="GeneID:11845267"
     CDS             317814..318230
                     /locus_tag="KPHS_02800"
                     /codon_start=1
                     /transl_table=11
                     /product="YjbQ family protein"
                     /protein_id="YP_005224580.1"
                     /db_xref="GeneID:11845267"
                     /translation="MWYQQTLTLGPKSRGFHLVTDEILGQIRGLSGVKVGLLHLLLQH
                     TSASLTLNENCDPTVRYDMEQYFLNAVPDNAPYEHDYEGPDDMPSHIKSSMLGVSLML
                     PVEDGRVRLGTWQGIWLGEHRIHGGSRRIVATLMGE"
     misc_feature    317814..318224
                     /locus_tag="KPHS_02800"
                     /note="Thiamin phosphate synthase YjbQ, UPF0047 family
                     [Coenzyme transport and metabolism]; Region: YjbQ;
                     COG0432"
                     /db_xref="CDD:223509"
     gene            318234..318590
                     /locus_tag="KPHS_02810"
                     /db_xref="GeneID:11845268"
     CDS             318234..318590
                     /locus_tag="KPHS_02810"
                     /codon_start=1
                     /transl_table=11
                     /product="MmcQ/YjbR family DNA-binding protein"
                     /protein_id="YP_005224581.1"
                     /db_xref="GeneID:11845268"
                     /translation="MTISELLQYCMAKPGAEQSVHSDWKATQIKVSDVLFAMVKEVED
                     QRPAVALKASPELAELLRQQHRDVRPSQHLNKAHWSTVYLDGSLPDSQIYYLVDASYQ
                     QAVKMLPEPVRQQLTR"
     misc_feature    318234..318581
                     /locus_tag="KPHS_02810"
                     /note="Predicted DNA-binding protein with double-wing
                     structural motif, MmcQ/YjbR family [Transcription];
                     Region: MmcQ; COG2315"
                     /db_xref="CDD:225197"
     gene            complement(318591..321416)
                     /locus_tag="KPHS_02820"
                     /db_xref="GeneID:11845269"
     CDS             complement(318591..321416)
                     /locus_tag="KPHS_02820"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="YP_005224582.1"
                     /db_xref="GeneID:11845269"
                     /translation="MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIHDYLRLLYARVGEPRCPDHDVPLAAQTVSQMVDNVLAQPEGLRLMLLAPIIKERKG
                     EHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVIDRFKVRDDLAQRLA
                     ESFETALELSGGTAIVANMDDEKAEELLFSANFACPICGYSMRELEPRLFSFNNPAGA
                     CPTCDGLGVQQYFDPDRVVQNPELSLAGGAIRGWDRRNFYYFQMLKSLAEHYKFDVEA
                     PWGTLSANVQKVVLYGSGKESIEFKYMNDRGDTSVRRHPFEGVLHNMERRYKETESSA
                     VREELAKFISNRPCASCDGTRLRREARHVFVENTPLPTISDMSIGHAMDFFNNLKLSG
                     QRAKIAEKVLKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNERLLGTLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGV
                     HGGQVVAEGPLEAIMAVPESLTGQFMSGKRKIEVPKQRVPANPEKVLKLTGARGNNLK
                     DVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQRQLNGATIAEPAPYRDIQGLEHF
                     DKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPESRSRGYTPGRFSFNVRGGRC
                     EACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEARE
                     FFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYIL
                     DEPTTGLHFADIQQLLEVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGE
                     ILVSGTPETVAECEASHTARFLKPMLK"
     misc_feature    complement(318594..321416)
                     /locus_tag="KPHS_02820"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     gene            321668..322192
                     /locus_tag="KPHS_02830"
                     /db_xref="GeneID:11845270"
     CDS             321668..322192
                     /locus_tag="KPHS_02830"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand DNA-binding protein"
                     /protein_id="YP_005224583.1"
                     /db_xref="GeneID:11845270"
                     /translation="MASRGVNKVILVGNLGQDPEVRYMPSGGAVANFTLATSESWRDK
                     QTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQSGQDKYTTEV
                     VVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQQAPAAP
                     SNEPPMDFDDDIPF"
     misc_feature    321668..322189
                     /locus_tag="KPHS_02830"
                     /note="single-stranded DNA-binding protein; Provisional;
                     Region: PRK09010"
                     /db_xref="CDD:236362"
     misc_feature    order(321692..321703,321776..321784,321827..321829,
                     321833..321835,321896..321898,321923..321925,
                     321956..321958,321965..321967)
                     /locus_tag="KPHS_02830"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(321707..321715,321731..321733,321761..321763,
                     321782..321787,321821..321826,321830..321832,
                     321836..321838,321842..321844,321848..321850,
                     321887..321892,321914..321916,321920..321922,
                     321926..321931,321968..321970,321974..321976)
                     /locus_tag="KPHS_02830"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            complement(322317..323897)
                     /locus_tag="KPHS_02840"
                     /db_xref="GeneID:11845271"
     CDS             complement(322317..323897)
                     /locus_tag="KPHS_02840"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic binding protein of
                     transport system"
                     /protein_id="YP_005224584.1"
                     /db_xref="GeneID:11845271"
                     /translation="MNAYSLSRLFIAWLTCLATLLFAPLLPAVEAEKAPPAAAEDNTL
                     SIHIDDMLRPWRGDLPGMIDRRTIRVLTTYSKTFFFIDKGTQRGATHDIFIALENELN
                     KQLAKDKKLKQRHLKLHIVFVPVSRDNLFIALNEGKGDIAAANLTITPSREAQVDFAQ
                     PLYSNVKELLISGPASPKVDSLEQLSGQTVFVRRSSSYYDSLQALNARFAGESRPPVI
                     LEAAPEALEDEDLLEMLNAGLIPLIVVDQHKALFWKQVFPKIQVHDNVVLRDGGDIAW
                     AVRKDSPQLLTVLNNFVKKNRQGTTLGNTLLLRYLKNAKYVKNAAASKERRKFLAMVD
                     VFRKYGDRYDVDWLLMAAQGYQESRLNQSVRSHVGAIGVMQVMPSTGKELKVGDIKQL
                     DPNIHAGVKYMRWMMDRYYADEPMTRLDKALFTFASYNAGPARIARLRTMTKQRGFDP
                     NVWFGNVENMAAEKIGAETVTYVSNIYKYYIAYRLIVDDMARKQKATAVPRQEPVAQP
                     AKPQPSVATAATAQVPVI"
     misc_feature    complement(322962..323702)
                     /locus_tag="KPHS_02840"
                     /note="The solute binding domain of YfhD proteins, a
                     member of the type 2 periplasmic binding fold protein
                     superfamily; Region: PBP2_YfhD_N; cd01009"
                     /db_xref="CDD:270230"
     misc_feature    complement(322446..322892)
                     /locus_tag="KPHS_02840"
                     /note="Membrane-bound lytic murein transglycosylase F
                     (MLTF) and similar proteins; Region: MLTF_like; cd13403"
                     /db_xref="CDD:340371"
     misc_feature    complement(order(322608..322613,322692..322694,
                     322758..322760,322767..322775,322827..322829))
                     /locus_tag="KPHS_02840"
                     /note="putative sugar binding site [chemical binding];
                     other site"
                     /db_xref="CDD:340371"
     misc_feature    complement(322827..322829)
                     /locus_tag="KPHS_02840"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:340371"
     gene            324159..324323
                     /locus_tag="KPHS_02850"
                     /db_xref="GeneID:11845272"
     CDS             324159..324323
                     /locus_tag="KPHS_02850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224585.1"
                     /db_xref="GeneID:11845272"
                     /translation="MFILFFSDIDYYHLDNESHFYYRNTAHYSNDTLSGLRYQRIARS
                     AFSLMMKQGT"
     gene            324484..326742
                     /locus_tag="KPHS_02860"
                     /db_xref="GeneID:11845273"
     CDS             324484..326742
                     /locus_tag="KPHS_02860"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane ferric enterobactin receptor"
                     /protein_id="YP_005224586.1"
                     /db_xref="GeneID:11845273"
                     /translation="MKYTSHFPLGIVIPLLACSVPLQAAENMTEQSTPDESAATAENH
                     EETMVITAARQNLQAPGVSTITAEEIRKHPPARDVSELIRTQPGVNLTGNSTSGQRGN
                     NRQIDIRGMGPENTLVLVDGKPVTSRNSVRYGWRGDRDSRGDTSWVPAEMIDHIDVIR
                     GPAAARYGNGAMGGVVNIVTKPTTPEWHGSWNTYMNAPQHRKEGATKRTNFSLNGPLS
                     DSVSFNLWGNLSKTQADAQDINAGHEAERTGSYAGSYPAGREGVVNKDIHSKLRWEFA
                     PMQALEFEAGYSRQGNLYAGDTQNTNTSTLVKSMYGKETNRLYRQTYGVTWTGGWDNG
                     VTSNSYAQYEHTRNSRMDEGLAGGTEGIFSSSEFSDIDLADVLLHSEVNIPFTLGVDQ
                     NLTLGTEWNQQRMKDGVSTTQALSYGTIDGVSATGRSPYSSAEIFSLFTEDNMALTDS
                     TMLTPALRFDHHSIVGNNWSPSLNLSQELTDDWTLKLGIARAYKAPNLYQLNPNYILY
                     SNGQGCYASSSACYLMGNSDLKAETSVNKEIGLEYKHDGYQAGITWFRNDYHNKIESG
                     YAAVGTASNGTTNIYQWENVPKALVEGLEGTLNLPVGEAVNWSNNLTWMLQSKNKTTG
                     DRLSVIPQFTLNSTLSWQVREDLSLQSTFTWYGRQKPKRFNYKSEAVSGSELNEVSPY
                     SIVGLSATWDVNKNLSFTSGIDNLFDIRHYRAGNAQTTGNATTGAYLYGAGAETYNES
                     GRTFFMSVNTHF"
     misc_feature    324484..326739
                     /locus_tag="KPHS_02860"
                     /note="outer membrane receptor FepA; Provisional; Region:
                     PRK13524"
                     /db_xref="CDD:237410"
     gene            complement(327006..327374)
                     /locus_tag="KPHS_02870"
                     /db_xref="GeneID:11845274"
     CDS             complement(327006..327374)
                     /locus_tag="KPHS_02870"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="YP_005224587.1"
                     /db_xref="GeneID:11845274"
                     /translation="MGLAAIMRSKTLQQSVLSDLLLWIDNNLDKKLTVDDLSDISGYS
                     PWHLFRLFRHYFDRSPMEYIRQQRMSLCCRLLLTTPGYRIVDICMMVGYDDLSAFNRT
                     FKKYHALTPTQYRYQITRQK"
     misc_feature    complement(327030..327284)
                     /locus_tag="KPHS_02870"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            complement(327408..329168)
                     /locus_tag="KPHS_02880"
                     /db_xref="GeneID:11845275"
     CDS             complement(327408..329168)
                     /locus_tag="KPHS_02880"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase"
                     /protein_id="YP_005224588.1"
                     /db_xref="GeneID:11845275"
                     /translation="MTRLLKTILPIILCALFGLSFASPTQAVASLPIVLPALTCDALS
                     ATDFSAAVGAKVTINHTEMQTSAQGSWCKVSATIAPEIGVQIALPTQRWSQRFLQVGC
                     GGLCGSINLSLSNASGCLPAMNGEFVVAATDMGHHGSMMDASWAEDPQKRIDFAWRAN
                     HLTAVLAKAVMQTLYRQPPKYAYFMGCSDGGREALMEAQRFPQDFDGISAGAPAAFFQ
                     FQNSFFHGWNVAANQRPDGTAILLKNRLPLIHQAVLAHCPTLSGVQDGILQNPYACQF
                     SESWLPRCPADARDRSTCLTQEEIEVVKKLYRGAYDSHGAQFVAGGLPLGSELRWPVP
                     ETPTGHSMSEMMVLPALQSVLLPGEKQKIQSMRDFPLNQQNFDAVAQLAPLYNAANTN
                     LHAYQQRGGKLILWHGLADDSVSPAFSIAYYRGVEAEMGHAATDTFLRLFLLPGVAHC
                     GNGEGYDQIDLLTPLMRWTEEGIAPQEIMAGKRATAAADLPPMTEKPDAQTQFHGVQK
                     VSQPYADAAPAVIATRPVYPFPAIARYNGRGDVNDGENYHAEQTTAFGHLQLAKPASD
                     YIGPDNQKNYQVRHGTLTVQ"
     misc_feature    complement(327528..328955)
                     /locus_tag="KPHS_02880"
                     /note="alpha/beta hydrolases; Region: Abhydrolase;
                     cl21494"
                     /db_xref="CDD:354836"
     gene            329391..329510
                     /locus_tag="KPHS_02890"
                     /db_xref="GeneID:11845276"
     CDS             329391..329510
                     /locus_tag="KPHS_02890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224589.1"
                     /db_xref="GeneID:11845276"
                     /translation="MHNLFNFSSLNLLGCRLFFSLFLVIPESIIPNEILPPFH"
     gene            complement(329542..329772)
                     /locus_tag="KPHS_02900"
                     /db_xref="GeneID:11845277"
     CDS             complement(329542..329772)
                     /locus_tag="KPHS_02900"
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase dependent protein C"
                     /protein_id="YP_005224590.1"
                     /db_xref="GeneID:11845277"
                     /translation="MSNSSVLLALSLFVQDASLKYATENNLSEAQNYMQLWRQNGEKM
                     DIKASLKIYLMMELFLKRIVLMANTSTIFRFS"
     gene            329794..332217
                     /locus_tag="KPHS_02910"
                     /db_xref="GeneID:11845278"
     CDS             329794..332217
                     /locus_tag="KPHS_02910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane antigen"
                     /protein_id="YP_005224591.1"
                     /db_xref="GeneID:11845278"
                     /translation="MLKKTHIISGLLIAPLTLYAATSYQVDDIRFEGLQRVTVGAALL
                     SMPLHAGDAVTPEDVSEAVRALYASGNFENVQILRDGKTLVVQVKERPTIASVSFSGN
                     KVVKDDALKENLTASGISAGSALDRNSLSEIEKGLQDFYYSAGKYSAQVHAVVTPLPR
                     NRVDLTFVFQEGISAKIAQINIIGNQAFREETLLDQLQLRDNVPWWNVVADKKYQKQK
                     LEADLETLRSFYLDRGYARFAIESTQVSMTPDKKSLYITIALNEGERYRVDRTQVTGD
                     LAQHGPEIEALAQPLAGAWYSGAQVTTVENEIKKHFGKYGYAWPQVTSTPEIDDAHHR
                     VVLHIQVNAGRRYSVRQIRFSGNDTSRDAVLRREMRQMEGAWLNNEKVDQGKVRLDRT
                     GFFENVEQQIVPVNGTADQVDVVYKVKERNTGSFNVGLGFGTDSGVSYQLGVTQDNWL
                     GTGNSVSFNGTRNSYQSYLELGATNPWFTVDGISLGGKIFYNSYDASDADAGSYNQQS
                     YGLGSTLGFPISENNSLNLGLDYVHNRLTNMDPELTTWRYLSSRGIEPSVVTKDGDSG
                     AKYSANDYFVSLGWGYNDLDRGFFPRAGNKSSLSGKVTLPGSDNSYYKLSFDTAQYLP
                     LSENKRWVWMERLRAGYAGGLDGKSVPFYDNFYAGGSSSVRGFSSNTIGPKAAYYRCN
                     GSESSYSACPLDASSDAVGGNAMAVLNSEFIIPTPFVNDKYADSLRTSLFVDAGTVWS
                     TSWHNTAQTLAAGIPDYGDPSHIRLSAGIAVQWMSPLGPLVFSWAEPFKKYDGDKAEQ
                     FQFNIGKTW"
     misc_feature    329794..332214
                     /locus_tag="KPHS_02910"
                     /note="outer membrane protein assembly factor YaeT;
                     Provisional; Region: PRK11067"
                     /db_xref="CDD:236834"
     gene            332769..333122
                     /locus_tag="KPHS_02920"
                     /db_xref="GeneID:11845279"
     CDS             332769..333122
                     /locus_tag="KPHS_02920"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-adapter protein IraM"
                     /protein_id="YP_005224592.1"
                     /db_xref="GeneID:11845279"
                     /translation="MKWTILNTLICPQSGIAFSAISSLRFLKFIMWYEADVILLPGES
                     IRLYSSRVLINDQYHSLKIYNITVYDEAQWEKLRERPSCPYHAGGERSDSCFYQSFCT
                     IKRCPNNIPRSEPWR"
     misc_feature    332769..333113
                     /locus_tag="KPHS_02920"
                     /note="Polymyxin resistance protein PmrD; Region: PmrD;
                     cl23862"
                     /db_xref="CDD:329132"
     gene            complement(333161..333922)
                     /locus_tag="KPHS_02930"
                     /db_xref="GeneID:11845280"
     CDS             complement(333161..333922)
                     /locus_tag="KPHS_02930"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="YP_005224593.1"
                     /db_xref="GeneID:11845280"
                     /translation="MTEAQRESLCALIRQAGAHAQALRDAGLQVDKKARQDFVSQADL
                     AVEQEIKGWLQAHFPEEGFLGEESGFEGNDQTVWVLDPVDGTTNFILGMDYWCISLAR
                     VCQGELSLGIIYAPDRDEFFFAARGEGAYLNGRRLTLREPEPDAVVIGMGRSSRAPAS
                     DYARAIDTLLDAGLEYRRFGAGALMLAHVAAGQLHAYYEAHMNSWDALAGMLLIEEAG
                     GTCNAFLANAGLRRGNLVLAGCASVQPRLAALLAK"
     misc_feature    complement(333170..333904)
                     /locus_tag="KPHS_02930"
                     /note="Archaeal fructose-1,6-bisphosphatase or related
                     enzyme of inositol monophosphatase family [Carbohydrate
                     transport and metabolism]; Region: SuhB; COG0483"
                     /db_xref="CDD:223559"
     misc_feature    complement(order(333305..333307,333668..333682,
                     333722..333727,333794..333796))
                     /locus_tag="KPHS_02930"
                     /note="active site"
                     /db_xref="CDD:238814"
     gene            complement(333933..334946)
                     /locus_tag="KPHS_02940"
                     /db_xref="GeneID:11845281"
     CDS             complement(333933..334946)
                     /locus_tag="KPHS_02940"
                     /codon_start=1
                     /transl_table=11
                     /product="mgl repressor, galactose operon inducer"
                     /protein_id="YP_005224594.1"
                     /db_xref="GeneID:11845281"
                     /translation="MNPRKPSVTAQDVARRAGVSRAVVSRALSNNGSISPDARARVLR
                     AAEELGYQVNFLAQGLNRQRSHLIGVIVSRISDPFRSTLLDALLNEIQRQGFQALVSE
                     IHSEQDLAQTLRRFAQFRVSGVIVTSGQPPEALVNECVQQHIPVVGINRQPTIPGVDY
                     VCSDNAAGAELAADQLLRSGCQRFGWLNHHPSTWAGRMRGEAFGRALQTRGVDVERHL
                     AILACQQEGYAGGLQAAALADEALEGIFCANAQLACGFLDGMRQRGREAPADFQLIGF
                     DNTPTTAQYSYQLTTLHQDVAAIARQALARLLERAADPSQPSRTTWVEVTLIHRRTSP
                     FVI"
     misc_feature    complement(334716..334925)
                     /locus_tag="KPHS_02940"
                     /note="helix_turn _helix lactose operon repressor; Region:
                     HTH_LACI; smart00354"
                     /db_xref="CDD:197675"
     misc_feature    complement(order(334764..334769,334773..334778,
                     334785..334787,334794..334796,334833..334835,
                     334842..334847,334860..334862,334869..334874,
                     334878..334892,334914..334916))
                     /locus_tag="KPHS_02940"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(334767..334796)
                     /locus_tag="KPHS_02940"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(333951..334748)
                     /locus_tag="KPHS_02940"
                     /note="Ligand-binding domain of uncharacterized
                     DNA-binding regulatory proteins that are members of the
                     LacI-GalR family of bacterial transcription repressors;
                     Region: PBP1_LacI_like_2; cd06278"
                     /db_xref="CDD:107273"
     misc_feature    complement(order(334161..334166,334173..334175,
                     334185..334187,334269..334271,334587..334595,
                     334602..334604,334611..334613,334641..334643,
                     334647..334661,334680..334685,334689..334694,
                     334701..334709,334746..334748))
                     /locus_tag="KPHS_02940"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107273"
     misc_feature    complement(order(334065..334067,334116..334118,
                     334278..334280,334350..334352,334458..334460,
                     334497..334499,334566..334568,334698..334700,
                     334707..334712))
                     /locus_tag="KPHS_02940"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107273"
     gene            complement(334943..335701)
                     /locus_tag="KPHS_02950"
                     /db_xref="GeneID:11845282"
     CDS             complement(334943..335701)
                     /locus_tag="KPHS_02950"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease Z"
                     /protein_id="YP_005224595.1"
                     /db_xref="GeneID:11845282"
                     /translation="MLGCGSAFSCTQNTSALRVIDADNKQWLIDCGPTVPRALWQRGG
                     EVNDIDAIYFTHVHPDHCTGLTALLNHWKSYSRQKPVIIYCQPAQQPVLMQLAALANW
                     PQADLGFTIDWQECREAWTWQDWQIRTAPTQHELSNRAIRITIAGQTLFYSGDGRPTA
                     DSIALMAGAGLAFQECASVAALDDDASHGDFPSCLMLFRTLQLPAMGLYHCEDASLSA
                     LKQACQPWPGLFVSRDGLTLTLPRPTPTDETYLL"
     misc_feature    complement(335174..335698)
                     /locus_tag="KPHS_02950"
                     /note="Ribonuclease Z; MBL-fold metallo-hydrolase domain;
                     Region: RNaseZ_MBL-fold; cd16272"
                     /db_xref="CDD:293830"
     misc_feature    complement(order(335177..335179,335237..335239,
                     335297..335302,335519..335524,335528..335530,
                     335534..335539,335612..335614))
                     /locus_tag="KPHS_02950"
                     /note="putative active site [active]"
                     /db_xref="CDD:293830"
     misc_feature    complement(order(335237..335239,335300..335302,
                     335519..335524,335528..335530,335534..335536))
                     /locus_tag="KPHS_02950"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:293830"
     misc_feature    complement(order(335237..335239,335300..335302,
                     335528..335530,335534..335536))
                     /locus_tag="KPHS_02950"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:293830"
     misc_feature    complement(order(335237..335239,335519..335524))
                     /locus_tag="KPHS_02950"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:293830"
     gene            335826..336908
                     /locus_tag="KPHS_02960"
                     /db_xref="GeneID:11845283"
     CDS             335826..336908
                     /locus_tag="KPHS_02960"
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine/spermidine ABC transporter ATPase"
                     /protein_id="YP_005224596.1"
                     /db_xref="GeneID:11845283"
                     /translation="MFTLLKKMPQQRFQVANMSYLQISGLKISYGDKVVLHNIDLAVE
                     QGEMIALLGPSGCGKTTLLNALCGFIPVQSGEVAIASRTITHLAPEQRNITMVFQSYA
                     LWPHLTVARNIGYGLKLRKWRGADIARRVAELLRIVNLEGLGEVKVTELSGGQRQRVA
                     LARALAIEPQVLVLDEPLSNLDAKVRLNVRHEIKSLQKRLGFTSLIVTHDQQEALVMA
                     DRIAVLNQGRIEQTGTPEEIYQRPATPFVADFMGADNKIISGELSAAAISGLSAAQQG
                     DNVIYFRSADAALAELTQPAPQEGLALEGVVEQSAFLGNLYRHSVRCHDRLLLADAAQ
                     CWPTKSRVRLHVPTPALHIFPLPLSQ"
     misc_feature    335871..336890
                     /locus_tag="KPHS_02960"
                     /note="ABC-type Fe3+/spermidine/putrescine transport
                     systems, ATPase components [Amino acid transport and
                     metabolism]; Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     gene            336938..338077
                     /locus_tag="KPHS_02970"
                     /db_xref="GeneID:11845284"
     CDS             336938..338077
                     /locus_tag="KPHS_02970"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic maltose-binding protein"
                     /protein_id="YP_005224597.1"
                     /db_xref="GeneID:11845284"
                     /translation="MLTKTKAAIVTTLFLSLGAQADTILNVATAGDQNMVDYVKTWLG
                     PKFEAAHPGVKVRVIGTGPGDAGSNKISEKLTAQQESGAQRWDIDVAVVHQKAGGEQV
                     AKGLLQKYRQDIQTGGMVSSPSAIQALGVNVDGYVMPMFLSQTAIAWNSDLVTTPPTS
                     YDELVAWTQKHPQAFGYNGIKNGMSGVSFVVGWIYAYGTDAQRLSAGPYDKSVEKGWQ
                     QAYEKLKAFNKNVTFTPGNAGTLDMLSRGEIAMGPVWVDMFYSWKDQGKLPPSIKLAL
                     LAPGMPGQPMYYVIPAKAANPQLARDFIALATSPEVQAQGIVKQFNWYPGIDAGQVKP
                     KLDAATWQKLFAEISPEALAKYGKSFPIAPYFDDIKEGYESQVAN"
     misc_feature    336992..338026
                     /locus_tag="KPHS_02970"
                     /note="Type 2 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_2; cl21456"
                     /db_xref="CDD:354813"
     gene            338138..338971
                     /locus_tag="KPHS_02980"
                     /db_xref="GeneID:11845285"
     CDS             338138..338971
                     /locus_tag="KPHS_02980"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005224598.1"
                     /db_xref="GeneID:11845285"
                     /translation="MSSSLKYLLLVAPAALMIAILFLYPLGFSLVSAFTAPGQPFTLD
                     HFRKVYALYASDVLFSLLIVLISVALLALLAITLSAVIALSPCRPVVRLLGFLYRLPL
                     FIPFIVVAQMMRTFLAKNGLMNNALVAADLVTPLETLSWLGWKGIVITFVWKQLAFAT
                     LLICGAMAALESSQILAARNLGASRPRILFDIMLPQVLPTIGVALVLSTVTMMSVLSV
                     PLMIGVGAPTMLTVDMAFRVNSYGDYAVANALGVVSLAICGALSWFYLRHSLQQKGGE
                     S"
     misc_feature    338138..338938
                     /locus_tag="KPHS_02980"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpA;
                     COG1175"
                     /db_xref="CDD:224096"
     misc_feature    order(338387..338389,338417..338428,338432..338461,
                     338468..338473,338477..338479,338591..338596,
                     338603..338605,338609..338611,338618..338623,
                     338627..338629,338639..338644,338651..338653,
                     338702..338704,338744..338749,338756..338758,
                     338777..338788,338795..338800,338837..338839,
                     338864..338869,338876..338881,338885..338890,
                     338897..338902,338909..338911)
                     /locus_tag="KPHS_02980"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(338435..338479,338777..338794)
                     /locus_tag="KPHS_02980"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(338477..338479,338576..338578,338795..338797,
                     338831..338833,338864..338866)
                     /locus_tag="KPHS_02980"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(338654..338692,338708..338713,338723..338725)
                     /locus_tag="KPHS_02980"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            338968..339825
                     /locus_tag="KPHS_02990"
                     /db_xref="GeneID:11845286"
     CDS             338968..339825
                     /locus_tag="KPHS_02990"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC superfamily ATP binding cassette transporter
                     permease protein"
                     /protein_id="YP_005224599.1"
                     /db_xref="GeneID:11845286"
                     /translation="MKALALVSTSAWWVKGRRKVRASPVLQTLLLLFMLLAMFGPLLN
                     LLIWTVAESWYFPHSLPSRWGLKYWYQVFNPYSDVSSSLLTSVLIALLSVGVCLLISV
                     PAGYALSRRKMPLRMLFMLLFLIPQAFPNLTVYMNVARLFYQWGLNGSIAGVVLVHSV
                     HGLMYSVWICVAAFSAIDPLLARASRNLGAGPVYTFWHIVLPQAAPGIVAASIFVFLE
                     SLDEFTGTFFVGAPDITTLPLLLYNASMSGNYQVSSITALILLVPSLLFMVVIHKFMR
                     PEMMAKLGK"
     misc_feature    339079..339795
                     /locus_tag="KPHS_02990"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     gene            complement(339872..340153)
                     /locus_tag="KPHS_03000"
                     /db_xref="GeneID:11845287"
     CDS             complement(339872..340153)
                     /locus_tag="KPHS_03000"
                     /codon_start=1
                     /transl_table=11
                     /product="YjcB family protein"
                     /protein_id="YP_005224600.1"
                     /db_xref="GeneID:11845287"
                     /translation="MASITTSVVLLRWPLVSAVLMFLASSLNIQLRKSDYAGLAVICS
                     CLGLAAACWFATGLLGITLLDIAKIWGNIKDVMIEVMSQTPPEWPMMMT"
     misc_feature    complement(339890..340153)
                     /locus_tag="KPHS_03000"
                     /note="Family of unknown function; Region: YjcB;
                     pfam15940"
                     /db_xref="CDD:318208"
     gene            340660..342264
                     /locus_tag="KPHS_03010"
                     /db_xref="GeneID:11845288"
     CDS             340660..342264
                     /locus_tag="KPHS_03010"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="YP_005224601.1"
                     /db_xref="GeneID:11845288"
                     /translation="MGDSAPHKALRLIGTGLVILLPVVLALWFAQLRAKAETIDQLHS
                     FSQLALQKTEMVIREADQARAKASQYRGELCSADHQRYLLHIVRGLLYVEDLIYANGQ
                     RFICSTSVHQQTGWRMPAANYTKKPDVAIYYYRDTPFYPGFAMNYMQKGPYVVVVNPF
                     SYSSVIASDRDLAYGVFDTKTNLFFSVSNNVEPAELHALIREGDTFFNQNGRVYTIAR
                     SAIRPIAVIMSTSRASYYHNFCDQASLTLPLGIICSILLVLVWSRTRRQYHSPRNMLQ
                     RALSCRQLRLHYQPIIDIKNNRCVGAEALLRWPGFDGPVMNPAEFIPLAENEGMIAQV
                     TDYVVDELFYEMGEFLASHPQLYIAINLSASDFHSARLISQISEKAHSYAVCIGQIKI
                     EVTERGFIDVPKTTPVIQAFREAGYEIAIDDFGTGYSNLHNLHALNVDILKIDKTFVD
                     TLTTNNTSHLIAEHIIEMARGLRLKTIAEGVETPEQVSWLYKRGVQYCQGWLFAKAMP
                     AREFMQWLANAPAPANVPQPPRHAEI"
     misc_feature    340660..342225
                     /locus_tag="KPHS_03010"
                     /note="Environmental sensor c-di-GMP phosphodiesterase,
                     contains periplasmic CSS-motif sensor and cytoplasmic EAL
                     domain [Signal transduction mechanisms]; Region: YjcC;
                     COG4943"
                     /db_xref="CDD:227279"
     gene            complement(342249..342578)
                     /locus_tag="KPHS_03020"
                     /db_xref="GeneID:11845289"
     CDS             complement(342249..342578)
                     /locus_tag="KPHS_03020"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator SoxS"
                     /protein_id="YP_005224602.1"
                     /db_xref="GeneID:11845289"
                     /translation="MSHQDIIQTLIEWIDEHIDQPLNIDIVARKSGYSKWYLQRMFRT
                     VMHQTLGDYIRQRRLLLAAEALRTTQRPIFDIAMDLGYVSQQTFSRVFRREFDRTPSD
                     YRHQISA"
     misc_feature    complement(342258..342578)
                     /locus_tag="KPHS_03020"
                     /note="DNA-binding transcriptional regulator SoxS;
                     Provisional; Region: PRK10219"
                     /db_xref="CDD:182314"
     gene            342663..343121
                     /locus_tag="KPHS_03030"
                     /db_xref="GeneID:11845290"
     CDS             342663..343121
                     /locus_tag="KPHS_03030"
                     /codon_start=1
                     /transl_table=11
                     /product="redox-sensing activator of soxS"
                     /protein_id="YP_005224603.1"
                     /db_xref="GeneID:11845290"
                     /translation="MEKKSPRIKMLLTPGEVAKRTGVAVSALHFYESKGLIHSQRNAG
                     NQRRYRRDVLRAVAIIKIAQRIGIPLATIGDAFGVLPEGHNLSAKEWKMLSSQWREEL
                     DRRIHTLTALRDQLDGCIGCGCLSRRDCPLRNPGDKLGEEGTGARLLEDE"
     misc_feature    342663..343118
                     /locus_tag="KPHS_03030"
                     /note="redox-sensitivie transcriptional activator SoxR;
                     Provisional; Region: PRK15002"
                     /db_xref="CDD:184964"
     gene            343381..344049
                     /locus_tag="KPHS_03040"
                     /db_xref="GeneID:11845291"
     CDS             343381..344049
                     /locus_tag="KPHS_03040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative S-transferase"
                     /protein_id="YP_005224604.1"
                     /db_xref="GeneID:11845291"
                     /translation="MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKTMLAPAALK
                     KIHPLGKSPVLEDNGYVLAESGAILEYLQETWDSGGLLKPQGIDDKLQYRFWLHYAEG
                     SLMPLLLMKLVFASLGKPPVPFGVRSLGSLLGKGIQKTWLDPQLATHARFIDDHLAAR
                     PWFAGERLSMADIQMSFPVMALLARGGMHDLVHIEAWRQRVEQRPAWQRAIERGGPFT
                     LPGA"
     misc_feature    343384..343602
                     /locus_tag="KPHS_03040"
                     /note="GST_N family, Saccharomyces cerevisiae GTT1-like
                     subfamily; composed of predominantly uncharacterized
                     proteins with similarity to the S. cerevisiae GST protein,
                     GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are
                     cytosolic dimeric proteins involved...; Region:
                     GST_N_GTT1_like; cd03046"
                     /db_xref="CDD:239344"
     misc_feature    order(343411..343413,343417..343422,343426..343431,
                     343438..343443,343576..343578,343585..343590)
                     /locus_tag="KPHS_03040"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(343411..343413,343531..343539,343570..343575)
                     /locus_tag="KPHS_03040"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(343531..343533,343567..343572,343576..343581,
                     343588..343590)
                     /locus_tag="KPHS_03040"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239344"
     misc_feature    343627..343995
                     /locus_tag="KPHS_03040"
                     /note="C-terminal, alpha helical domain of GTT1-like
                     Glutathione S-transferases; Region: GST_C_GTT1_like;
                     cd03189"
                     /db_xref="CDD:198298"
     misc_feature    order(343660..343662,343681..343683,343888..343890,
                     343897..343902,343909..343911,343921..343923)
                     /locus_tag="KPHS_03040"
                     /note="putative N-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198298"
     misc_feature    order(343660..343665,343672..343677,343684..343686,
                     343834..343836)
                     /locus_tag="KPHS_03040"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198298"
     misc_feature    order(343681..343683,343693..343698,343705..343710,
                     343912..343914,343921..343923)
                     /locus_tag="KPHS_03040"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198298"
     gene            344438..345787
                     /locus_tag="KPHS_03050"
                     /db_xref="GeneID:11845292"
     CDS             344438..345787
                     /locus_tag="KPHS_03050"
                     /codon_start=1
                     /transl_table=11
                     /product="NCS2 family permease"
                     /protein_id="YP_005224605.1"
                     /db_xref="GeneID:11845292"
                     /translation="MSTPSARTGGSLDAWFKISARGSTVRQEIVAGLTTFLAMVYSVI
                     VVPGMLGKAGFPPAAVFVSTCLVAGVGSLAMGLWANLPMAIGCAISLTAFTAFSLVLG
                     QQISIPVALGAVFLMGVLFTVISATGIRSWILRNLPQGVAHGTGIGIGLFLLLIAANG
                     VGLVIKNPLDGLPVALGNFDSFPVVMSLIGLAVIIGLEKMKVPGGILLTIIGVSIVGL
                     IFDPNVHFSGIFAMPSLSDGQGNSLIGSLDIVGALNPVVLPSVLALVMTAVFDATGTI
                     RAVAGQANLLDKDGQIINGGKALTTDSLSSVFSGLVGAAPAAVYIESAAGTAAGGKTG
                     LTAVTVGVLFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVAKIDFNDFVDAMAGL
                     ITAVFIVLTCNIVTGIMIGFATLVIGRLVSGEWRKLNLGTVIIAVALVVFYAGGWAI"
     misc_feature    344462..345778
                     /locus_tag="KPHS_03050"
                     /note="Xanthine/uracil/vitamin C permease, AzgA family
                     [Nucleotide transport and metabolism]; Region: AzgA;
                     COG2252"
                     /db_xref="CDD:225161"
     gene            345935..347581
                     /locus_tag="KPHS_03060"
                     /db_xref="GeneID:11845293"
     CDS             345935..347581
                     /locus_tag="KPHS_03060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sodium:hydrogen antiporter"
                     /protein_id="YP_005224606.1"
                     /db_xref="GeneID:11845293"
                     /translation="MEIFFTILIMTLVVSLSGVVTRVLPFQVPLPLMQIAIGALLAWP
                     TFGLHVEFDPELFLVLFIPPLLFADGWKTPTREFIEHGREILGLALALVVVTVVGIGF
                     LIYWIVPGIPLIPAFALAAVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGL
                     VSLKFAVAVAMGTMVFTVGGATVEFLKVAIGGVLAGFVVSWSYGRSMRFLSRWGGDEP
                     ATQIVLLFLLPFASYLIAEHIGVSGILAAVAAGMTITRSGVMRTAPLAMRLRANSTWA
                     MLEFVFNGMVFLLLGLQLPDILSSSLVAAEADPNVETWMLFTDIILIYAALMLVRFGW
                     LWSMRKLSQRFLKKKPMEFGSWTTRELLISSVAGVRGAITLAGVLSIPLLLPDGNVFP
                     ARYELIFLAAGVILFSLFVGVIALPILLRHIESSDNVQQRKEERLARAATADVAIVAI
                     QKMEERLAADTKENIDTQLLTEVSSRVIGNLRRRADGRNDVETSMLEESLERRFRLAA
                     LRSERGELYHLRATRQISNETLQKLLHDLDLLEALLIEDQ"
     misc_feature    345953..347572
                     /locus_tag="KPHS_03060"
                     /note="Na+/H+ antiporter, bacterial form; Region: a_cpa1;
                     TIGR00831"
                     /db_xref="CDD:129911"
     gene            complement(347744..348625)
                     /locus_tag="KPHS_03070"
                     /db_xref="GeneID:11845294"
     CDS             complement(347744..348625)
                     /locus_tag="KPHS_03070"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005224607.1"
                     /db_xref="GeneID:11845294"
                     /translation="MDIRTLRYFVEVVRQQSFTRAAEKLFVTQPTISKMLKNLEDELN
                     CTLLIRDGRKLLLTDTGRVVFERGQAILGEFSQLESELSDINHLHKGVLRLGIPPMVG
                     MLMAEPISRFRQRYPGVELKIAEFGGLTVQQAVSNGELDMAMTALPVEEDSSLTILPL
                     FNHPLCVLTPRTAEWEGKTSLSPAELASHPLVIYNEEFALSQQLMRLFAEHDVKPRIA
                     VRSGQWDFLAAMVQAGIGVAILPEPICQRLDRQNFCWIPLQSELRWELGMIWREGVYM
                     SRSAEAWLTCSKAFWLE"
     misc_feature    complement(348440..348619)
                     /locus_tag="KPHS_03070"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:333860"
     misc_feature    complement(347768..348352)
                     /locus_tag="KPHS_03070"
                     /note="The C-terminal substrate binding domain of
                     LysR-like transcriptional regulator CidR, contains the
                     type 2 periplasmic binding fold; Region: PBP2_CidR;
                     cd08438"
                     /db_xref="CDD:176129"
     misc_feature    complement(order(347927..347932,347936..347941,
                     347957..347974,348251..348271,348275..348277,
                     348287..348289,348296..348301,348305..348310))
                     /locus_tag="KPHS_03070"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176129"
     gene            348731..349138
                     /locus_tag="KPHS_03080"
                     /db_xref="GeneID:11845295"
     CDS             348731..349138
                     /locus_tag="KPHS_03080"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_005224608.1"
                     /db_xref="GeneID:11845295"
                     /translation="MAFAPARVAPAVAQRLQIPVQVLLYVGLFIFAQYLVNRWQVPLP
                     ANLVGMVMLLLLIVCRVIPVSWVRAGARWLLAEMLLFFVPAVVAVVNYAQLLMVDGWR
                     IFLVIALSTLMVLGATAWVVDKVYRYEVGRLKK"
     misc_feature    348770..349135
                     /locus_tag="KPHS_03080"
                     /note="LrgA family; Region: LrgA; cl00608"
                     /db_xref="CDD:351175"
     gene            349135..349824
                     /locus_tag="KPHS_03090"
                     /db_xref="GeneID:11845296"
     CDS             349135..349824
                     /locus_tag="KPHS_03090"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_005224609.1"
                     /db_xref="GeneID:11845296"
                     /translation="MSDAVLSILCLVATLVLYYANKKLYRRFHKLPLMPLVFTPILLV
                     LILVVGHISYQSYMGETHWLLWLLGPATIAFAVPVYENVAVIKRHWMSLSAGVVTAVV
                     VAVTSSVWLARGFMLSDEIQRSLAVRSVTTPFALAAAKPLGGQPDLVALFVVITGVFG
                     MAVGDMLFLRLAIREGMAKGAGFGAASHGAGTARSYELGQQEGVVASLVMMLSGVVVV
                     LAAPVVRWLLF"
     misc_feature    349135..349776
                     /locus_tag="KPHS_03090"
                     /note="Putative effector of murein hydrolase [Cell
                     wall/membrane/envelope biogenesis]; Region: LrgB; COG1346"
                     /db_xref="CDD:224265"
     gene            350241..350366
                     /locus_tag="KPHS_03100"
                     /db_xref="GeneID:11845297"
     CDS             350241..350366
                     /locus_tag="KPHS_03100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224610.1"
                     /db_xref="GeneID:11845297"
                     /translation="MSCKYMHDAALLEFHSLISLHKAIDGLIVVYNGYGNKYEDE"
     gene            350335..350892
                     /locus_tag="KPHS_03110"
                     /db_xref="GeneID:11845298"
     CDS             350335..350892
                     /locus_tag="KPHS_03110"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial chaperone protein"
                     /protein_id="YP_005224611.1"
                     /db_xref="GeneID:11845298"
                     /translation="MDMGINMKMSKKFLAGALIFSACSALSTVAQADNTITFNGIVSD
                     TTCTATIDGGVTAIDMGTTSVADLKAYTFGAAKNFSFSLADCPTAEEGGNSIARVTFG
                     GVSDTANSDYFKNQATDEPATGVAVALFDEAGNVMKNNEEGSDVDISSGAATIPFTVK
                     MVKSGDADPTKGTVQTTVTYNVTYH"
     misc_feature    350371..350889
                     /locus_tag="KPHS_03110"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:321493"
     gene            350953..351642
                     /locus_tag="KPHS_03120"
                     /db_xref="GeneID:11845299"
     CDS             350953..351642
                     /locus_tag="KPHS_03120"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chaperone"
                     /protein_id="YP_005224612.1"
                     /db_xref="GeneID:11845299"
                     /translation="MRYPFFAIGLLLSSSFAQASVVVGGTRLVFDGTKNNAVITVENK
                     DQNSNIVQSWLSVVDAASPAKDAFIITPPLFRLKAGEKGFVRVVRSGKKLPDDRESMF
                     WLNIKGIPATEYVPDKNVVQFAINSKIKLIYRPAALKGNTPESYAEKLQWGKERTSVT
                     VKNNSPLYMNFSQVSLNGKNISGAWFAAPFSTLKIPVQSSLSATGKKEITWSVINDYG
                     MSGKKYTAIIQ"
     misc_feature    350953..351636
                     /locus_tag="KPHS_03120"
                     /note="fimbrial assembly chaperone SthB; Provisional;
                     Region: PRK15295"
                     /db_xref="CDD:237936"
     gene            351950..354175
                     /locus_tag="KPHS_03130"
                     /db_xref="GeneID:11845300"
     CDS             351950..354175
                     /locus_tag="KPHS_03130"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane usher protein"
                     /protein_id="YP_005224613.1"
                     /db_xref="GeneID:11845300"
                     /translation="MINTTAYPQLFEAGETCARLSAIPGMTFSVSLAQQRIDFTVPQA
                     AMLNRPRDYIPESQWQQGINAGLLNYSVTGQRNAPRHNGATIDSQFVSLQPGLNLGPW
                     RLRNYSTYSHSDNNSRWESVYSYLARDIHTLRSQLVVGNTYTSSGIFDSLSFTGLQLS
                     SDKEMLPDSLHGFAPTIRGIARTTAEVSVYQNGYSIYKTTVAPGAFEINDLYATGSAG
                     DLYVNIKESDGSEQNFVVPFASLAILQREGQLDYALSSGRTRSGSSDDKEYNFIQSSL
                     AYGATSNITLYTGFQQAEDKYTNLLLGAGFNLGTIGALSFDGSQSWADVKTSDTASST
                     SKEQGQSYRVRFSKSFLQTGTSFSVAGYRYSTSGYYSFQDFVDNSSTQRDCCTQSGRT
                     KGRFDASLSQTLFGYGSLSLSLVNETYWDSSRMESVGVGYSGSIGKASYFINYSYNRN
                     VQSTDDSSNNRPSSDTVVSLTLSIPLGETLSANYTLNHGRHNDTTHSVGLNGSAFEDR
                     SLNWSVLEGYNTQDKSTSGNLSVNYQGSKGDVAGGYGYDRYSNHYNYSLRGGMVAHAG
                     GLTLSRFLGESSALVETPGVSDVTVRGQTNVTTDAAGYAVVPYVRPYHRNSLALDEQE
                     IPGAEVDNVARTVVPTRNAIVKVKYDTRIGYKAMLTLRTRNGVVPFGALVTLDNDHGS
                     ASRSNIVGDEGQVYLTGLQKKGQLLARWGEKSSEQCTVHYDFSGMALGDDILFYQAEC
                     R"
     misc_feature    351953..354172
                     /locus_tag="KPHS_03130"
                     /note="Outer membrane usher protein FimD/PapC [Cell
                     motility, Extracellular structures]; Region: FimD;
                     COG3188"
                     /db_xref="CDD:225729"
     gene            354247..354759
                     /locus_tag="KPHS_03140"
                     /db_xref="GeneID:11845301"
     CDS             354247..354759
                     /locus_tag="KPHS_03140"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial morphology protein"
                     /protein_id="YP_005224614.1"
                     /db_xref="GeneID:11845301"
                     /translation="MAILLLSLPALAYEGSSTVNFNVTGTIEAPSCEVAVEPSNSIDL
                     GTVSSQTFSGHAGASGASVPVKLVFSSCSADASAVTIAFSGTSFDSTHASIYKNFQTG
                     SNGASGVGLQLQSMADQQPLGPGDQYLYTFGDDADIHTFNMVARMFSPYGQVRSGMVG
                     FTATFDVAYK"
     misc_feature    354280..354756
                     /locus_tag="KPHS_03140"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:351496"
     gene            354779..355876
                     /locus_tag="KPHS_03150"
                     /db_xref="GeneID:11845302"
     CDS             354779..355876
                     /locus_tag="KPHS_03150"
                     /codon_start=1
                     /transl_table=11
                     /product="putative adhesin"
                     /protein_id="YP_005224615.1"
                     /db_xref="GeneID:11845302"
                     /translation="MKKLILLLILALCPVYSWAACTGTNYGDVSMTNLPEKILVNAGS
                     YTAGTVLYDSGKITRSQTELLNCEGSTYAVFAWSSNNAGALIGDNIYATSVQGIGIRV
                     KVWLNISGEYGDDTDDFSPDSQVHYIGDVNYYLGKPTGLFDSFASTHYTPAYQLQLVA
                     TGGAIASKSQLSFSDPVATVSAKDKKGTIAISQLHISGTTSIQLIPMGCIVGSNNLSF
                     SMGSINASEFNTATKVGSARQSLSLSCEPGTNVSMRVAAASASGDNPDNTVMALTAEQ
                     NAATGVGVQLNLNGKALPLNTDISLYTSSRATVTNSGADASYSYFTNPDSPGGAAAMQ
                     TLALSTNYYRTGSAVTAGTANATGVITFTYN"
     misc_feature    354779..355873
                     /locus_tag="KPHS_03150"
                     /note="putative major fimbrial protein SthE; Provisional;
                     Region: PRK15292"
                     /db_xref="CDD:237935"
     gene            complement(355924..357579)
                     /locus_tag="KPHS_03160"
                     /db_xref="GeneID:11845303"
     CDS             complement(355924..357579)
                     /locus_tag="KPHS_03160"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate permease"
                     /protein_id="YP_005224616.1"
                     /db_xref="GeneID:11845303"
                     /translation="MIKRVLTALAATLLPLGAHAADAITGAVQRQPTNWQAIVMFLIF
                     VALTLYITYWASKRVRSRSDYYTAGGNITGFQNGLAIAGDFMSAASFLGISALVYTSG
                     YDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQGPIRTLSACGSLVVV
                     ALYLIAQMVGAGKLIQLLFGLNYHVAVVLVGVLMVLYVLFGGMLATTWVQIIKAVLLL
                     CGASFMAFMVMKHVGFSFNNLFTEAMAVHPKGAAIMSPGGLVKDPISALSLGLGLMFG
                     TAGLPHILMRFFTVSDAKEARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPAFKDA
                     AGQLIGGNNMAAVHLADAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYAN
                     VFRKGATERQELKVSKITVLILGVVAILLGILFENQNIAFMVGLAFSIAASCNFPIIL
                     LSMYWSKLTTRGAMVGGWLGLLTAVILMILGPTIWVQILGHEKALFPYEYPALFSIAI
                     AFIGIWVFSATDNSPEGMREREQFRAQFIRSQTGIGIERGQAH"
     misc_feature    complement(355927..357579)
                     /locus_tag="KPHS_03160"
                     /note="acetate permease; Provisional; Region: actP;
                     PRK09395"
                     /db_xref="CDD:236495"
     misc_feature    complement(order(356461..356466,356473..356475,
                     357322..357324,357331..357333))
                     /locus_tag="KPHS_03160"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:271374"
     gene            complement(357576..357887)
                     /locus_tag="KPHS_03170"
                     /db_xref="GeneID:11845304"
     CDS             complement(357576..357887)
                     /locus_tag="KPHS_03170"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF485 domain-containing protein"
                     /protein_id="YP_005224617.1"
                     /db_xref="GeneID:11845304"
                     /translation="MNEQLCQRIENSSHFRELVASRQRFAAILSVIMLVIYVGFILLI
                     AFAPGWLGTPLHAGTSVTRGIPLGIGVIVISFILTGIYVWRANGEFDRLTKSVLNEVK
                     A"
     misc_feature    complement(357579..357887)
                     /locus_tag="KPHS_03170"
                     /note="Uncharacterized membrane protein, DUF485 family
                     [Function unknown]; Region: YjcH; COG3162"
                     /db_xref="CDD:225704"
     gene            complement(358071..360029)
                     /locus_tag="KPHS_03180"
                     /db_xref="GeneID:11845305"
     CDS             complement(358071..360029)
                     /locus_tag="KPHS_03180"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="YP_005224618.1"
                     /db_xref="GeneID:11845305"
                     /translation="MSQIHKHPIPANIAERCLINPDQYKAQYQQSITDPDTFWGEQGK
                     ILDWMRPYTRVKNTSFAPGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDA
                     SQSKHITYRELHADVCRFANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHS
                     VIFGGFSPEAVAGRIIDSSSRLVITADEGLRAGRAIPLKKNVDDALKNPNVKSIEHVV
                     VLKRTGGNIDWQEGRDLWWSDLIANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLH
                     TTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVP
                     NWPTPARMCQVVDKHKVSILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINP
                     EAWEWYWKKIGNEKCPVMDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPVLVD
                     NEGLPLDGATEGNLAIADSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDG
                     YYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYVTLN
                     HGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTS
                     NLGDTSTLADPGVVEKLLEEKQAITMPS"
     misc_feature    complement(358086..360014)
                     /locus_tag="KPHS_03180"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     misc_feature    complement(order(358260..358265,358278..358280,
                     358452..358463,358485..358487,358494..358496,
                     358530..358532,358782..358799,358863..358874,
                     358941..358943,358950..358955,359025..359033,
                     359097..359102,359115..359117,359442..359444,
                     359448..359450,359457..359459,359535..359543))
                     /locus_tag="KPHS_03180"
                     /note="active site"
                     /db_xref="CDD:341270"
     misc_feature    complement(order(358263..358265,358278..358280,
                     358455..358463,358941..358943,358950..358955,
                     359025..359033,359097..359099,359115..359117,
                     359442..359444,359448..359450,359457..359459,
                     359535..359543))
                     /locus_tag="KPHS_03180"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:341270"
     misc_feature    complement(order(359214..359219,359223..359240,
                     359247..359249))
                     /locus_tag="KPHS_03180"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:341270"
     misc_feature    complement(order(358452..358454,358485..358487,
                     358494..358496,358530..358532,358782..358799,
                     358863..358874,359097..359102))
                     /locus_tag="KPHS_03180"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:341270"
     misc_feature    complement(order(358788..358790,358869..358874,
                     359097..359102))
                     /locus_tag="KPHS_03180"
                     /note="acetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:341270"
     gene            360130..360330
                     /locus_tag="KPHS_03190"
                     /db_xref="GeneID:11845306"
     CDS             360130..360330
                     /locus_tag="KPHS_03190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224619.1"
                     /db_xref="GeneID:11845306"
                     /translation="MIKLGEISSNETLKRNNYANEFIETEAVKIFLLQILMQYNWGKF
                     AALCIKAEESPVLKGLRSMPCK"
     gene            360442..361755
                     /locus_tag="KPHS_03200"
                     /db_xref="GeneID:11845307"
     CDS             360442..361755
                     /locus_tag="KPHS_03200"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate:proton symporter"
                     /protein_id="YP_005224620.1"
                     /db_xref="GeneID:11845307"
                     /translation="MKKTKKVSLAWQILLALVLGILLGSYLHYHAESRDWLISNLLTP
                     AGDIFIHLIKMIVVPIVISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIVLGIT
                     LANVFQPGTGIDMSQLAAVDISKYQNTTAEVQSHAHGLMGTILSLVPTNIVASMAKGD
                     MLPIIFFSVLFGLGLSSLPATHREPLVTVFRSISETMFKVTHMVMRYAPVGVFALISV
                     TVATFGFASLWPLAKLVLLVYFAILFFALVVLGIVARLCGLSIWILIRILKDELILAY
                     STASSESVLPRIIEKMEAYGAPASITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGI
                     DLSIWQEITLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDM
                     ARTALNVVGNALAVLVIAKWEHKFDRKKALAYEREVLGKFDKTAQ"
     misc_feature    360448..361752
                     /locus_tag="KPHS_03200"
                     /note="glutamate/aspartate:proton symporter; Provisional;
                     Region: gltP; PRK11283"
                     /db_xref="CDD:183075"
     gene            complement(361792..362478)
                     /locus_tag="KPHS_03210"
                     /db_xref="GeneID:11845308"
     CDS             complement(361792..362478)
                     /locus_tag="KPHS_03210"
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="YP_005224621.1"
                     /db_xref="GeneID:11845308"
                     /translation="MKYLFLFLLVFTSGAAVATEPGSQYQQQAEAGDRRAQYYLADTW
                     VSSGDYQKAEYWAQKAAAQGDGDALALLAQLKIRNPQQADYPQARQLAEKAVEAGSKS
                     GEIVLARVLVNRQAGATDVAHAITLLQDAARDSESDAAVDAQMLLGLIYASGVHGPED
                     DVKASEYFKGSSSLSRTGYAEYWAGMMFQQGEKGFIEPNKQKALHWLNVSCLEGFDTG
                     CEEFDRISKG"
     misc_feature    complement(361795..>362433)
                     /locus_tag="KPHS_03210"
                     /note="TPR repeat [Signal transduction mechanisms];
                     Region: TPR; COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(362245..362334)
                     /locus_tag="KPHS_03210"
                     /note="SLR repeat [structural motif]; Region: SLR repeat"
                     /db_xref="CDD:276807"
     misc_feature    complement(362140..362229)
                     /locus_tag="KPHS_03210"
                     /note="SLR repeat [structural motif]; Region: SLR repeat"
                     /db_xref="CDD:276807"
     misc_feature    complement(362020..362121)
                     /locus_tag="KPHS_03210"
                     /note="SLR repeat [structural motif]; Region: SLR repeat"
                     /db_xref="CDD:276807"
     misc_feature    complement(362708..364855)
                     /note="potential frameshift: common BLAST hit:
                     gi|238892571|ref|YP_002917305.1| formate dehydrogenase-H"
     gene            complement(362708..364387)
                     /locus_tag="KPHS_03220"
                     /db_xref="GeneID:11845309"
     CDS             complement(362708..364387)
                     /locus_tag="KPHS_03220"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-H"
                     /protein_id="YP_005224622.1"
                     /db_xref="GeneID:11845309"
                     /translation="MSNAITEIDNTDLVFIFGYNPADSHPIVANHVINAKRNGAKIIV
                     CDPRKIETARIADMHIALKNGSNIALLNAIGHVIIEEDLYDKSFVASRSEGFEEYRKI
                     VEGYTPESVEEITGVSAQEIRACARMYASAKSAAILWGMGVTQFYQGVETVRSLTSLA
                     ILTGNLGKPNVGVNPVRGQNNVQGACDMGALPDTYPGYQYVKFPENREKFAKAWGVES
                     LPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFDDLELVIVQDIFM
                     TKTASAADVILPSTSWGEHEGVYTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMG
                     YPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGYVMWPCRDESDADQGTSYLFKEKF
                     DTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPG
                     YAQINTADAERLGIEDEELVWVNSRKGRIITRAQVSDRPNKGAVYMTYQWWIGACNEL
                     VSENLSPITKTPEYKYCAVNVERIADQRAAEQYVIDEYNKLKSRLRESAMG"
     misc_feature    complement(362801..>364387)
                     /locus_tag="KPHS_03220"
                     /note="formate dehydrogenase, alpha subunit,
                     archaeal-type; Region: Fdh-alpha; TIGR01591"
                     /db_xref="CDD:130652"
     gene            complement(364436..364855)
                     /locus_tag="KPHS_03230"
                     /db_xref="GeneID:11845310"
     CDS             complement(364436..364855)
                     /locus_tag="KPHS_03230"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-H"
                     /protein_id="YP_005224623.1"
                     /db_xref="GeneID:11845310"
                     /translation="MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLK
                     GYYGWDFINDTQILTPRLKTPMIRRQRGGKLEAVSWDEALDYVATRLSAIKAKYGPDA
                     IQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARV"
     misc_feature    complement(<364439..364840)
                     /locus_tag="KPHS_03230"
                     /note="formate dehydrogenase, alpha subunit,
                     archaeal-type; Region: Fdh-alpha; TIGR01591"
                     /db_xref="CDD:130652"
     gene            364809..364949
                     /locus_tag="KPHS_03240"
                     /db_xref="GeneID:11845311"
     CDS             364809..364949
                     /locus_tag="KPHS_03240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224624.1"
                     /db_xref="GeneID:11845311"
                     /translation="MQPDAQYGQTVTTFFIGLAPVIQWARLRYRAVTMHLLCHIFIVG
                     IP"
     gene            365128..365856
                     /locus_tag="KPHS_03250"
                     /db_xref="GeneID:11845312"
     CDS             365128..365856
                     /locus_tag="KPHS_03250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative response regulator"
                     /protein_id="YP_005224625.1"
                     /db_xref="GeneID:11845312"
                     /translation="MKPVILVVDDDRAMGELLSDVLGAHAFEVLVSQTGNDALTTVAQ
                     RADIALVLLDMILPDTHGLQVLQQLQRTRPELPVVMLSGLGSESDVVVGLEMGADDYI
                     AKPFSSRVVVARVKAVLRRSGALAGEASGAGAGLTFNGWRLDTTRCELYNPQQQAIPL
                     TQGEYGLLLALAQNARRVLNREQLLALTHNESTEVFDRTIDVLIMRLRRKIELNPHQP
                     TLIKTLRGLGYVFSADVTHSEKAA"
     misc_feature    365140..365829
                     /locus_tag="KPHS_03250"
                     /note="DNA-binding response regulator, OmpR family,
                     contains REC and winged-helix (wHTH) domain [Signal
                     transduction mechanisms, Transcription]; Region: OmpR;
                     COG0745"
                     /db_xref="CDD:223816"
     gene            365942..366700
                     /locus_tag="KPHS_03260"
                     /db_xref="GeneID:11845313"
     CDS             365942..366700
                     /locus_tag="KPHS_03260"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV toxin-antitoxin system AbiEi family
                     antitoxin"
                     /protein_id="YP_005224626.1"
                     /db_xref="GeneID:11845313"
                     /translation="MATKLNWLLQNSAPGDVILQSWLSQHAISPSLSFKYAQSGWLKK
                     RGNGVYARAGREPEWNDALACLQNQLAAPVYVAGLSSLVWQGRSHYLQLKQNQCWLSV
                     ENKALLPKWFREFPGVEWIVISGKKLPVLDDRYRVTLDIKGKKLIGSAPELAAYELLS
                     AVPGTLSFNHAAELFQGLVNLNPRKVEYLLSVSQSVQAKRLYLFFASFYEHGWLKRID
                     SQKIDLGAGKRQIVENGKFNAQYQITVPERFQKE"
     misc_feature    365942..366220
                     /locus_tag="KPHS_03260"
                     /note="Transcriptional regulator, AbiEi antitoxin
                     N-terminal domain; Region: AbiEi_3_N; pfam17194"
                     /db_xref="CDD:339928"
     misc_feature    366224..366679
                     /locus_tag="KPHS_03260"
                     /note="Transcriptional regulator, AbiEi antitoxin, Type IV
                     TA system; Region: AbiEi_3; pfam11459"
                     /db_xref="CDD:338014"
     gene            366706..367623
                     /locus_tag="KPHS_03270"
                     /db_xref="GeneID:11845314"
     CDS             366706..367623
                     /locus_tag="KPHS_03270"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase AbiEii/AbiGii toxin
                     family protein"
                     /protein_id="YP_005224627.1"
                     /db_xref="GeneID:11845314"
                     /translation="MDIQAPYYRQVALLMQVLPYVAVEREFALKGGTAINLFIRDFPR
                     LSVDIDLAWVPLESRAIALPHIRDALARIAANLQQQAGMSAVLQANRSDEMRVIVTTD
                     SAQIKIEVSPVARGTLYPPQEREVVGAVEDVFGYASLPVVSLPDLYGGKLCAALDRQH
                     PRDFYDVKLLLDAQELDRPIFNGFIVYLLSHNRPLAEVLNPRWKDIAEPFYREFSGMT
                     FETIALEELTAVPNRMIAALKSCFTQQDVDFLLSFKRGEPDWRLAPEMRIQDLPAVQW
                     KLRNIHQMPAIKRAESLDKLEKVLAEWRS"
     misc_feature    366745..367374
                     /locus_tag="KPHS_03270"
                     /note="Nucleotidyl transferase AbiEii toxin, Type IV TA
                     system; Region: AbiEii; pfam08843"
                     /db_xref="CDD:337224"
     gene            complement(367748..368755)
                     /locus_tag="KPHS_03280"
                     /db_xref="GeneID:11845315"
     CDS             complement(367748..368755)
                     /locus_tag="KPHS_03280"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbohydrate kinase"
                     /protein_id="YP_005224628.1"
                     /db_xref="GeneID:11845315"
                     /translation="MERKGIIAAGNMLVDHVHQIGQWPERGWLVEIVHSERATGGAPL
                     NVLLTLAKMHAGLPLQAVGLIGEDNDGDYITAMLDQYHINRQLVQRTSSAPTSMTQVM
                     TDAEGQRTFFHSPGANRLLDLPAFEPLDAPLKIFHLGYLLLLESLDRPDEVYGTRSAR
                     LLAQMRERGYEVSLDLVSRKGDPRYRPLVLPALKHLDYLTINELEASEFSGLEIRLPN
                     GEPHVANIARAASALLDAGVRQRVVIHCPEGAWGVSRTEAGRWVPSCRLPPEEIIGSV
                     GAGDAFCAGLLYGSHERWPLTASLQLAHACARASLQAANAIDGAKTLPELQAFIQLQD
                     G"
     misc_feature    complement(367754..368740)
                     /locus_tag="KPHS_03280"
                     /note="Sugar or nucleoside kinase, ribokinase family
                     [Carbohydrate transport and metabolism]; Region: RbsK;
                     COG0524"
                     /db_xref="CDD:223598"
     misc_feature    complement(order(367916..367918,367925..367927,
                     368576..368578))
                     /locus_tag="KPHS_03280"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238177"
     misc_feature    complement(order(367910..367912,367919..367924,
                     367931..367933,368024..368026,368150..368152))
                     /locus_tag="KPHS_03280"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238177"
     gene            complement(368830..369771)
                     /locus_tag="KPHS_03290"
                     /db_xref="GeneID:11845316"
     CDS             complement(368830..369771)
                     /locus_tag="KPHS_03290"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter ATP-binding protein"
                     /protein_id="YP_005224629.1"
                     /db_xref="GeneID:11845316"
                     /translation="MRLKPIVTALCAGALLAASPFASAKELKAIGVTVGDLANPFFVQ
                     ITKGAELEARKLAGDNVKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGP
                     AVKRAKEAGIVVVAVDVAAEGADATITSDNTQAGELACKYISDRLNNKGNVVIINGPP
                     VSAVQNRVEGCETEFKKHPDIKILSANQNAKGSREGGLEVMTSLLAANPKIDGVFAIN
                     DPTAIGADLAAKQAQRSEFFIVGVDGSPDGEEALKRKNSLFVATPAQDPQVMAAKAVE
                     IGYDILQGKPAPTAPVLIPVTMIDKNNVSSYKGWTVK"
     misc_feature    complement(368872..369684)
                     /locus_tag="KPHS_03290"
                     /note="Periplasmic sugar-binding domain of uncharacterized
                     ABC-type transport systems; Region:
                     PBP1_ABC_sugar_binding_like_11; cd06321"
                     /db_xref="CDD:107316"
     misc_feature    complement(order(368977..368979,369043..369045,
                     369271..369273,369418..369420,369649..369651))
                     /locus_tag="KPHS_03290"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107316"
     gene            complement(369802..370800)
                     /locus_tag="KPHS_03300"
                     /db_xref="GeneID:11845317"
     CDS             complement(369802..370800)
                     /locus_tag="KPHS_03300"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC superfamily ATP binding cassette
                     transporter, permease protein"
                     /protein_id="YP_005224630.1"
                     /db_xref="GeneID:11845317"
                     /translation="MSIPKETSAPVAKSASAKKMLMGDLMQTVGILPILILIVAVFGF
                     IAPNFFTESNLLNITRQASINIVLAAGMTFIILTGGIDLSVGSILGTTAVAAMVVSLI
                     PAFALLSIPAALMLGLLLGLFNGALVAFAGLPPFIVTLGTYTALRGAAYLLADGTTVI
                     NSDISFEWIGNDYLGPVPWLVVIALAVIAVCWFILRRTTLGVHIYAVGGNMQAARLTG
                     IKVWLVLLFVYGMSGLLSGLGGVMSASRLYSANGNLGVGYELDAIAAVILGGTSFVGG
                     IGTITGTLVGALIIATLNNGMTLMGVSYFWQLVIKGAVIIIAVLIDKYRTRHHQSA"
     misc_feature    complement(369805..370782)
                     /locus_tag="KPHS_03300"
                     /note="Predicted ABC-type sugar transport system, permease
                     component [General function prediction only]; Region:
                     COG4158"
                     /db_xref="CDD:226633"
     misc_feature    complement(370111..370167)
                     /locus_tag="KPHS_03300"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(370797..372317)
                     /locus_tag="KPHS_03310"
                     /db_xref="GeneID:11845318"
     CDS             complement(370797..372317)
                     /locus_tag="KPHS_03310"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter"
                     /protein_id="YP_005224631.1"
                     /db_xref="GeneID:11845318"
                     /translation="MTATPVLEMRHIAKAFGKFYALKGVDLTVWPGEIHALMGENGAG
                     KSTLMKILAGAYTATSGEILIDGKPQTIRGPKDALAAGITLIYQEMQLAPNLTVAENI
                     FLGSELARGGLVQRKAMLSQAQAVIDRLGAQFKASDRVMTLTIAEQQQVEIARALHRQ
                     SRILVMDEPTAALSSRETQRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDG
                     QYVGSLVRDKLNAPELVRMMVGRPLSDLFNKERDIPRGQPRLRVEDLTDGGKIKPSSL
                     VVHAGEIVGLAGLVGAGRSELAQLIFGVRKATAGVIEIDGEPVVIHSPREAIDLGIGF
                     LTENRKEQGLFLELAAQENITMATLERDATWGMLNRRKAQTISDDAIQLLNIRVPHAQ
                     VRAGGLSGGNQQKLLISRWVAIGPRILILDEPTRGVDVGAKSEIYRIMNDMARQGVAI
                     LMISSELPEVVGMSDRVYVMREGVIAGELQAGDISQESIMTLATGVTDSHLKAGQL"
     misc_feature    complement(370833..372317)
                     /locus_tag="KPHS_03310"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     gene            372497..374782
                     /locus_tag="KPHS_03320"
                     /db_xref="GeneID:11845319"
     CDS             372497..374782
                     /locus_tag="KPHS_03320"
                     /codon_start=1
                     /transl_table=11
                     /product="putative histidine protein kinase"
                     /protein_id="YP_005224632.1"
                     /db_xref="GeneID:11845319"
                     /translation="MTARRHPFFTSARGRLLSFNLLMGVVTLLVSGVAVFGFHHASQL
                     QEQVQRQTLNDMRGSMDLARDTANVATAAVRLSQVVGALEYKSEAERLLATQQALKHS
                     LAQLAAAPLAQQEQARVANIIRRSNALQQSVAEMLERGQRRHLQRNALLSSLYQNQSN
                     LRHLADLNDRGGDKAIDPRRLAEMDRLIVAAIHTVTPRSIVLQLDQLRGALPTRSADP
                     ALAFVLPDVTRELATLAPLSAQLEESDLTISWYMYHIKALVALLNEDINQYVTRVAEA
                     SEQRAAQSHRELRSISMFILLSALLALAITGCAGWYIYRNLGSNLTAISRAMSRLAQG
                     EPNVSVPALQRRDELGELARAFNVFARNMASLEHTTRLLKEKTNQMEIDRIKRQELEE
                     ALLHSQKMKAVGQLTGGLAHDFNNLLAVIIGSLELVEPDARDAPRLSRALKAAERGAL
                     LTQRLLAFSRKQALHPQAVAMAPLLENLSELMRHSLPATLSLEIEAQSPAWPAWIDVG
                     QLENALINLVMNARDAMAGRDGVIKIRTWNQRVTRSSGQRQDMVALEVIDHGSGMSQA
                     VKARVFEPFFTTKATGSGSGLGLSMVYGFVRQSGGRVALESAPGQGTTVRLQLPRALT
                     EVEKEVAPAVDEPPPAGERLALVLEDEEDVRQTLCEQLHQLGWLTLETASGEEALQLL
                     EASPDIALLISDLMLPGALSGADVIHTARRRFPALPVLLISGQDLRPAQNPALPEVEW
                     LRKPFTRAQLAQALSAAYARI"
     misc_feature    372536..>374644
                     /locus_tag="KPHS_03320"
                     /note="TMAO reductase sytem sensor TorS; Region:
                     TMAO_torS; TIGR02956"
                     /db_xref="CDD:274362"
     misc_feature    <373631..374737
                     /locus_tag="KPHS_03320"
                     /note="histidine kinase; Provisional; Region: PRK13557"
                     /db_xref="CDD:237425"
     gene            374853..375206
                     /locus_tag="KPHS_03330"
                     /db_xref="GeneID:11845320"
     CDS             374853..375206
                     /locus_tag="KPHS_03330"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_005224633.1"
                     /db_xref="GeneID:11845320"
                     /translation="MKRYATALLFCTLSLTSLAARADIIDDAIGNIQQAINDAYNPGS
                     SRSDDDDRYDDDGRYDDGRYQGSRQQSRDSQRQYDERQRQLDERRRQLDERQRQLDRD
                     RRQLESDQRRLDDSY"
     gene            complement(375228..375986)
                     /locus_tag="KPHS_03340"
                     /db_xref="GeneID:11845321"
     CDS             complement(375228..375986)
                     /locus_tag="KPHS_03340"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex accessory
                     protein"
                     /protein_id="YP_005224634.1"
                     /db_xref="GeneID:11845321"
                     /translation="MSLTLRLTGTGGAQLVPVFGCDCAACRRARREESHRRRPCSGVV
                     TFNSAVTLLDAGRPDLMEHHPAGSFQQVLLTHYHLDHVQGLFPLRWGVGASIPVYGPP
                     DDAGCDDLLKHPGLLDFSHTVTPFVMFNLQGLRVTPLPLNHSKLTFGYLLESAHSRLA
                     WLSDTAGLPDKTLKFLLNNRPQAMIIDCSHEPRAQTPRNHNDLNTVRSLNQVIGCPRV
                     ILTHISHQFDVWMMDNPLPTGFEAGYDGMEIALD"
     misc_feature    complement(375234..375980)
                     /locus_tag="KPHS_03340"
                     /note="carbon-phosphorus lyase complex accessory protein;
                     Provisional; Region: phnP; PRK11244"
                     /db_xref="CDD:183052"
     misc_feature    complement(order(375495..375497,375558..375560,
                     375744..375749,375753..375755,375759..375761))
                     /locus_tag="KPHS_03340"
                     /note="active site"
                     /db_xref="CDD:293822"
     misc_feature    complement(order(375495..375497,375558..375560,
                     375744..375749,375753..375755,375759..375761))
                     /locus_tag="KPHS_03340"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293822"
     misc_feature    complement(order(375495..375497,375558..375560,
                     375753..375755,375759..375761))
                     /locus_tag="KPHS_03340"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293822"
     misc_feature    complement(order(375495..375497,375744..375749))
                     /locus_tag="KPHS_03340"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293822"
     gene            complement(376002..376565)
                     /locus_tag="KPHS_03350"
                     /db_xref="GeneID:11845322"
     CDS             complement(376002..376565)
                     /locus_tag="KPHS_03350"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate transport ATP-binding protein"
                     /protein_id="YP_005224635.1"
                     /db_xref="GeneID:11845322"
                     /translation="MPGKLIWLVGPSGSGKDSLLAALRQREHPQLLVAHRYITRPFNA
                     GSENHIALSEHEFFTRAEQHLFALSWHANNTYYGIGVEIDLWLHAGFDVVANGSRAHL
                     ALARERYGEVLVPICLAVSPPVLRQRLEQRGRENALEIAQRLERAARYKPDNCLTLNN
                     DGSLRQSVDEFFRLLRSHAAREADQLV"
     misc_feature    complement(376005..376562)
                     /locus_tag="KPHS_03350"
                     /note="ribose 1,5-bisphosphokinase; Provisional; Region:
                     PRK10078"
                     /db_xref="CDD:236648"
     misc_feature    complement(order(376512..376523,376536..376538))
                     /locus_tag="KPHS_03350"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            complement(376565..377701)
                     /locus_tag="KPHS_03360"
                     /db_xref="GeneID:11845323"
     CDS             complement(376565..377701)
                     /locus_tag="KPHS_03360"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnM"
                     /protein_id="YP_005224636.1"
                     /db_xref="GeneID:11845323"
                     /translation="MIINNVKLVLDDEVVHGSLEVHDGRILAFAESQSRLPQALDGEG
                     GWLLPGLIELHTDNLDKFFTPRPKVDWPAHSAMSSHDAMMVASGITTVLDAVAIGDVR
                     DGGDRLENLEKMVNAVEETQKRGLNRAEHRLHLRCELPHHTTLPLFEKLIDRESVSMV
                     SLMDHSPGQRQYADRSKYRDYYQGKYHLTHDEMDRFEAEQMALAATWSQPNRQTIAAM
                     CRARRIALASHDDATEAHVAESHQLGSVIAEFPTTLAAAQASRQHGMHVLMGAPNIVR
                     GGSHSGNVAAHQLASHGLLDILSSDYYPASLLDAAFRIADAEDNAFTLPQAIRLVSQH
                     PAQALGLDDRGVIAEGKRADLVLAHRRGEHIQIDHVWRQGKRVF"
     misc_feature    complement(376568..377701)
                     /locus_tag="KPHS_03360"
                     /note="phosphonate metabolism protein PhnM; Provisional;
                     Region: PRK15446"
                     /db_xref="CDD:237967"
     misc_feature    complement(order(376799..376801,377015..377017,
                     377531..377533,377537..377539))
                     /locus_tag="KPHS_03360"
                     /note="active site"
                     /db_xref="CDD:238631"
     gene            complement(377698..378378)
                     /locus_tag="KPHS_03370"
                     /db_xref="GeneID:11845324"
     CDS             complement(377698..378378)
                     /locus_tag="KPHS_03370"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate transport ATP-binding protein"
                     /protein_id="YP_005224637.1"
                     /db_xref="GeneID:11845324"
                     /translation="MIRVENVHKTFVLHQQHGVRLPVLADASLTVNAGECVVLHGHSG
                     SGKSTLLRSLYANYLPDSGHIHIRHGDEWVDLVTATPRKVLEVRKTTIGWVSQFLRVI
                     PRISALEVVMQPLLDLGTPREASAAKAAQLLTRLNVPERLWHLAPSTFSGGEQQRVNI
                     ARGFAVDYPILLLDEPTASLDGKNSAAVVNLIHDAKARGAAIVGIFHDEGVRRQVADR
                     LHSMGMTA"
     misc_feature    complement(377710..378378)
                     /locus_tag="KPHS_03370"
                     /note="Alpha-D-ribose 1-methylphosphonate 5-triphosphate
                     synthase subunit PhnL [Inorganic ion transport and
                     metabolism]; Region: PhnL; COG4778"
                     /db_xref="CDD:227118"
     gene            complement(378486..379244)
                     /locus_tag="KPHS_03380"
                     /db_xref="GeneID:11845325"
     CDS             complement(378486..379244)
                     /locus_tag="KPHS_03380"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonates transport ATP-binding protein"
                     /protein_id="YP_005224638.1"
                     /db_xref="GeneID:11845325"
                     /translation="MNQPLLAVNNLTHLYAPDKGFRDVSLELWPGEVLGIVGESGSGK
                     TTLLKAISARLTPQQGEVLYQQRSLYAMSEAERRRLLRTEWGVVHQHPMDGLRRQVSA
                     GGNIGERLMATGARHYGNIRATAEKWLQEVEIPPSRIDDLPTTFSGGMQQRLQIARNL
                     VTQPKLVFMDEPTGGLDVSVQARLLDLLRGLAVELNLAVVIVTHDLGVARLLANRLLV
                     MKQGQVVESGLTDRVLDDPHHPYTQLLVSSVLQN"
     misc_feature    complement(378489..379244)
                     /locus_tag="KPHS_03380"
                     /note="phosphonate C-P lyase system protein PhnK;
                     Provisional; Region: phnK; PRK11701"
                     /db_xref="CDD:183280"
     gene            complement(379241..380089)
                     /locus_tag="KPHS_03390"
                     /db_xref="GeneID:11845326"
     CDS             complement(379241..380089)
                     /locus_tag="KPHS_03390"
                     /codon_start=1
                     /transl_table=11
                     /product="protein in phn operon"
                     /protein_id="YP_005224639.1"
                     /db_xref="GeneID:11845326"
                     /translation="MANPLTGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMP
                     MPYGWGTGGIQLTASVIGENDVLKVIDQGADDTTNAVSIRQFFKRVTGVATTERTEDA
                     TLIQTRHRIPETPLVEDQILIYQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYE
                     DIARFGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMHMMPALQLFGAGREKRIYAVP
                     PYTPVESLDFDDHPFTVQEWDEPCAICGSRHSYLDEVVLDDSGQRMFVCSDTDYCRQQ
                     SEGQKK"
     misc_feature    complement(379244..380089)
                     /locus_tag="KPHS_03390"
                     /note="Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P
                     lyase [Inorganic ion transport and metabolism]; Region:
                     PhnJ; COG3627"
                     /db_xref="CDD:226154"
     gene            complement(380082..381146)
                     /locus_tag="KPHS_03400"
                     /db_xref="GeneID:11845327"
     CDS             complement(380082..381146)
                     /locus_tag="KPHS_03400"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein"
                     /protein_id="YP_005224640.1"
                     /db_xref="GeneID:11845327"
                     /translation="MYVAVKGGEKAIRAAHALQEQKRRGDGRLPELSVEQIGDQLSLA
                     VDRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLPRLAVSEPINTAEMRLE
                     RRISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGEAPSVQQADGEAEPTPHVFSLLT
                     QQGLAKTEEDRGTPPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRN
                     HPFAGEIRSGYVQVEIVPEELGFSVNIGELLLTECEMVNGFVAPQEEPPHFTRGYGLT
                     FGMSERKAMAMALVDRALQAPDYDEEIAGPAQDEEFVLAHADNVEAAGFVSHLKLPHY
                     VDFQAELALLKHLQRENERG"
     misc_feature    complement(380091..381146)
                     /locus_tag="KPHS_03400"
                     /note="Bacterial phosphonate metabolism protein (PhnI);
                     Region: PhnI; cl01456"
                     /db_xref="CDD:351510"
     gene            complement(381147..381731)
                     /locus_tag="KPHS_03410"
                     /db_xref="GeneID:11845328"
     CDS             complement(381147..381731)
                     /locus_tag="KPHS_03410"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit"
                     /protein_id="YP_005224641.1"
                     /db_xref="GeneID:11845328"
                     /translation="MTLQPAFTLAVQDAQHSFRRLLKAMSEPGVIVSLQQLQHGWQPL
                     NVASTSLLLTLADHETPVWLASALRNDLVGQNLRFHTGAPLVDQPQQAVFAVANDGIS
                     AEQLNVLSAGTVTAPETGVTLIVQLASLSGGRMLRLTGAGIAEERMIAPQLPDCIIDE
                     LTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC"
     misc_feature    complement(381150..381731)
                     /locus_tag="KPHS_03410"
                     /note="carbon-phosphorus lyase complex subunit; Validated;
                     Region: phnH; PRK10147"
                     /db_xref="CDD:236655"
     gene            complement(381728..382180)
                     /locus_tag="KPHS_03420"
                     /db_xref="GeneID:11845329"
     CDS             complement(381728..382180)
                     /locus_tag="KPHS_03420"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein"
                     /protein_id="YP_005224642.1"
                     /db_xref="GeneID:11845329"
                     /translation="MHFDTATRQRWMSVLAHSEPQDLLARMQSLQLAPEYELIRTPET
                     GLVQLQARMGGIGDRFFAGDATLTRAAVRLADGTLGYSWILGRDRPHAERCAAIDALL
                     QSPRHFHTLMETLITPLEALRSARIEARRAEVNASRVDFFTLVRGDNV"
     misc_feature    complement(381740..382165)
                     /locus_tag="KPHS_03420"
                     /note="Phosphonate metabolism protein PhnG; Region: PhnG;
                     pfam06754"
                     /db_xref="CDD:336495"
     gene            complement(382181..382906)
                     /locus_tag="KPHS_03430"
                     /db_xref="GeneID:11845330"
     CDS             complement(382181..382906)
                     /locus_tag="KPHS_03430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005224643.1"
                     /db_xref="GeneID:11845330"
                     /translation="MHLSRHPTSYPTRYQEIAARLEQELRHHYRCGDYLPAEQQLATR
                     FDVNRHTLRRAIDQLVERGWVQRRQGVGVLVLMRPIDYPLNAQARFSQNLLEQGSDPT
                     SEKLLSVLRPASAHVAEAFGINEGENVIHLRTLRRVNGVALCLIDHYFADLRFWPVLQ
                     TFSHGSLHDLLRDRLDVELTRVRTKISARRAQAKESKLLEIPNMAPLLCVRTLNSREG
                     ESVTAEYSVSLTRADMIEFTMEH"
     misc_feature    complement(382184..382906)
                     /locus_tag="KPHS_03430"
                     /note="phosphonate metabolism transcriptional regulator
                     PhnF; Provisional; Region: PRK10079"
                     /db_xref="CDD:182227"
     gene            complement(383062..383661)
                     /locus_tag="KPHS_03440"
                     /db_xref="GeneID:11845331"
     CDS             complement(383062..383661)
                     /locus_tag="KPHS_03440"
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family metalloprotein YjdN"
                     /protein_id="YP_005224644.1"
                     /db_xref="GeneID:11845331"
                     /translation="MAVCHPAHPVISLAGNRYLHCRLPSYFSAPFRPAVWLNRLPGDY
                     ALRVTVTEVFTMSLSPYLAFAGNCAEAIAFYQQTLGAELMFKMTFGEMPPPAQEASDG
                     CPSGQKMADDAIAHASLRINNGELMLSDSAFGPDVHYAGFTLVLDPSDVAEGQRWFDA
                     LAVGGRIEMAWQETFWAHGFGKVVDRFGVPWMINVVKQG"
     misc_feature    complement(383068..383496)
                     /locus_tag="KPHS_03440"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10148"
                     /db_xref="CDD:236656"
     misc_feature    complement(order(383086..383088,383116..383118,
                     383203..383205,383215..383217,383221..383238,
                     383281..383283,383290..383295,383425..383427,
                     383473..383490))
                     /locus_tag="KPHS_03440"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:319899"
     gene            complement(383725..383958)
                     /locus_tag="KPHS_03450"
                     /db_xref="GeneID:11845332"
     CDS             complement(383725..383958)
                     /locus_tag="KPHS_03450"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alkylphosphonate uptake protein in
                     phosphonate metabolism"
                     /protein_id="YP_005224645.1"
                     /db_xref="GeneID:11845332"
                     /translation="MTKESDILIVKDANGNLLADGDSVTVVKDLKVKGSSSMLKIGTK
                     VKNIRLVEGDHNIDCKIDGFGPMKLKSEFVKKN"
     misc_feature    complement(383728..>383955)
                     /locus_tag="KPHS_03450"
                     /note="PhnA domain; Region: PhnA; cl27229"
                     /db_xref="CDD:332050"
     gene            384605..386107
                     /locus_tag="KPHS_03460"
                     /db_xref="GeneID:11845333"
     CDS             384605..386107
                     /locus_tag="KPHS_03460"
                     /codon_start=1
                     /transl_table=11
                     /product="proline/glycine betaine transporter"
                     /protein_id="YP_005224646.1"
                     /db_xref="GeneID:11845333"
                     /translation="MLKRKKIKPITLKDVTIIDDGKLKKAITAASLGNAMEWFDFGVY
                     GFVAYALGKVFFPDANPSVQMIAALGTFSVPFLIRPLGGLFFGMLGDKYGRQKILAIT
                     IVIMSISTFCIGLIPSYATIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRK
                     RGFMGSWLDFGSIAGFVMGAGVVVLISSVVGEQNFLDWGWRIPFFLALPLGIIGLYLR
                     HALEETPAFQQHVDTMEQGDREGLQDGPKVSFKEIATKHWRSLLTCIGLVISTNVTYY
                     MLLTYMPSYLSHNLHYSEDHGVLIIIAIMVGMLFVQPVIGMLSDRFGRRPFILIGSVA
                     LFALSIPAFIMINSNVTSLIFAGLLLLAVVLNCFIGVMASSLPAMFPTHIRFSALASA
                     FNISVLIAGLTPTLAAWLVETTQNLMMPAYYLMVIAVVGMATGLSMKETANRPLKGAT
                     PAASDIQEAKEILGEHYDNIEQKIEDIDQEIADLQAKRSRLVQQHPRIND"
     misc_feature    384632..386101
                     /locus_tag="KPHS_03460"
                     /note="proline/glycine betaine transporter; Provisional;
                     Region: PRK10642"
                     /db_xref="CDD:182611"
     misc_feature    order(384713..384718,384725..384730,384737..384739,
                     384851..384853,385025..385030,385034..385042,
                     385049..385051,385109..385111,385118..385123,
                     385130..385132,385406..385408,385415..385420,
                     385427..385435,385442..385444,385526..385528,
                     385538..385540,385694..385699,385709..385711,
                     385721..385723,385769..385771,385778..385783,
                     385790..385795,385802..385804)
                     /locus_tag="KPHS_03460"
                     /note="putative chemical substrate binding pocket
                     [chemical binding]; other site"
                     /db_xref="CDD:340924"
     gene            complement(386157..387095)
                     /locus_tag="KPHS_03470"
                     /db_xref="GeneID:11845334"
     CDS             complement(386157..387095)
                     /locus_tag="KPHS_03470"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator MelR"
                     /protein_id="YP_005224647.1"
                     /db_xref="GeneID:11845334"
                     /translation="MEHRFTSLPPDPFMCSSDEKQSRSPLALYSEYQRMDIELRPPHA
                     MPTSHWHGQVEVNVPFDGDVEYLINNEVVRIEKGYITLFWACTPHQLTRPGDCQQMAI
                     FNLPMHLFLSWPLDRELINHVTHGMVIKSLAAQQLSAFEVRRWQQELSHENEQIRQLA
                     IDEIALMLKRLSLAGWQPILVNKTSRTHKNSVSRHAQFYVSQMLEFIAAHYDQALTVN
                     AVAEHVKLNPNYAMGVFQRVMQQTMKQYITAMRINHVRALLSDTDKTILDIALTAGFR
                     SSSRFYSTFTRYVGMPPQQYRKLSQQRRHGLALPEA"
     misc_feature    complement(386169..387074)
                     /locus_tag="KPHS_03470"
                     /note="DNA-binding transcriptional regulator MelR;
                     Provisional; Region: PRK10371"
                     /db_xref="CDD:182416"
     gene            387335..388687
                     /locus_tag="KPHS_03480"
                     /db_xref="GeneID:11845335"
     CDS             387335..388687
                     /locus_tag="KPHS_03480"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="YP_005224648.1"
                     /db_xref="GeneID:11845335"
                     /translation="MSAPKITFIGAGSTVFVKNILGDVFQRPALKSAHIALMDIDETR
                     LEESHIVVRKLMDSVGANGEISCHRDRKTALQGADFVVVAFQIGGYEPCTVTDFAVCK
                     RHGLEQTIADTLGPGGIMRALRTIPHLWAICDDMSEVCPDATMLNYVNPMAMNTWAMY
                     ARYPHIKQVGLCHSVQGTAEELARDLDLDPADLRYRCAGINHMAFYLSLEKKLADGSY
                     VSIYPDLLQAYADGRAPKPNLHGNPRCENIVRYEMLKKLGYFVTESSEHFAEYTPWFI
                     KPGRDDLLARYKVPLDEYPKRCVEQLANWHQELESYKRGERIGVKPSREYASTIMNAI
                     WTGEPSVVYGNVRNDNLIDNLPQGCCVEVACLVDANGIQPTKVGALPAHLAALMQTNI
                     NVQTLLTQAILTENRDYVYYATMMDPHTAAVLGIEEIYALVDDLIASHGDWLPAWLHR
                     "
     misc_feature    387341..388678
                     /locus_tag="KPHS_03480"
                     /note="alpha-galactosidase; Provisional; Region: PRK15076"
                     /db_xref="CDD:185035"
     gene            388781..390196
                     /locus_tag="KPHS_03490"
                     /db_xref="GeneID:11845336"
     CDS             388781..390196
                     /locus_tag="KPHS_03490"
                     /codon_start=1
                     /transl_table=11
                     /product="melibiose:sodium symporter"
                     /protein_id="YP_005224649.1"
                     /db_xref="GeneID:11845336"
                     /translation="MSISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDIVGLSVGVV
                     GTLFLVARILDAIADPIMGWIVNCTRSRWGKFKPWILIGTITNSVVLYMLFSAHHFSG
                     GALLAWVWLTYLLWGFTYTIMDVPFWSLVPTITLDKREREQLVPYPRFFASLAGFVTA
                     GVTLPFVNAVGGADRGFGFQMFTLVLIAFFVVSTLVTLRNVHEVYSSDSGVSEDSSHL
                     SLRQMVALIYKNDQLACLLGMALAYNTAANIIAGFAIYYFTYVIGSAEMFPYYMSYAG
                     AANLLTLILFPRLVKGLSRRILWAGASIMPVLGCGVLLLMALGGVYNIALISLAGVLL
                     NIGTALFWVLQVIMVADTVDYGEYTMNIRCESIAYSVQTLVVKAGSAFAAWFIAIVLG
                     IIGYVPNVVQSPHTLLGMQAIMIALPTLFFALTLFLYFRYYKLNGDMLRRIQIHLLDK
                     YRRVPENDVEPERPIVVPNQV"
     misc_feature    388781..390193
                     /locus_tag="KPHS_03490"
                     /note="melibiose:sodium symporter; Provisional; Region:
                     PRK10429"
                     /db_xref="CDD:182453"
     misc_feature    order(388832..388837,388844..388849,388856..388858,
                     388955..388957,389138..389143,389147..389155,
                     389162..389164,389225..389227,389234..389239,
                     389246..389248,389498..389500,389507..389512,
                     389519..389527,389534..389536,389618..389620,
                     389630..389632,389789..389794,389804..389806,
                     389816..389818,389885..389887,389894..389899,
                     389906..389911,389918..389920)
                     /locus_tag="KPHS_03490"
                     /note="putative chemical substrate binding pocket
                     [chemical binding]; other site"
                     /db_xref="CDD:340890"
     gene            390202..390324
                     /locus_tag="KPHS_03500"
                     /db_xref="GeneID:11845337"
     CDS             390202..390324
                     /locus_tag="KPHS_03500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224650.1"
                     /db_xref="GeneID:11845337"
                     /translation="MRKPLTKEGRDALFLSKKQCLKKTEREKFSSLFYLNYFSF"
     gene            390472..391428
                     /locus_tag="KPHS_03510"
                     /db_xref="GeneID:11845338"
     CDS             390472..391428
                     /locus_tag="KPHS_03510"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid segregation protein ParM"
                     /protein_id="YP_005224651.1"
                     /db_xref="GeneID:11845338"
                     /translation="MRIFIDDGSTNIKMLWEQDGETFTHISPNSFKRGWSATFGSGKP
                     FNYTVDDEKYSFDLITPDALPTNNIDWQYSPLNSIAVHHALLTSGLEPQDVEIVVTLP
                     LTEFYDEDAQYRLDNIERKKKSLLRDVKLNKGVVFNITKVTVRPESIPAGISLCDELK
                     PSHSVLIIDLGGTTLDISMVAGQMTSVSRIYGDPKLGVSLVTDAVKLALARANTDTSS
                     YNVDQIIINRHDEEYLTDNINDPDAVSEVKKVINNSIERLTTRVLTAIDSFKGYSHAI
                     VIGGGAPLVADAIRERMGLREDRFVVAEEPQFALVRGLKIIG"
     misc_feature    390472..391413
                     /locus_tag="KPHS_03510"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:354300"
     misc_feature    order(390487..390489,390976..390978)
                     /locus_tag="KPHS_03510"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    order(390493..390504,390508..390510,390979..390987,
                     391306..391311,391321..391323)
                     /locus_tag="KPHS_03510"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    order(390565..390567,390571..390573,390643..390645,
                     390652..390660,390721..390723,390904..390906,
                     390961..390963,391012..391014)
                     /locus_tag="KPHS_03510"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            391438..391809
                     /locus_tag="KPHS_03520"
                     /db_xref="GeneID:11845339"
     CDS             391438..391809
                     /locus_tag="KPHS_03520"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stable inheritance protein"
                     /protein_id="YP_005224652.1"
                     /db_xref="GeneID:11845339"
                     /translation="MTLDRRKVLIYLRPDISASERFADAKIEAHHRGDRGDMSRTALL
                     AGLALGEVDSRLPSMLAALLAEDTKPETLRKMLASFLEIQPASPAPAAAPTAAPAKAP
                     EPPAPVSESVSARNLAGSLPD"
     misc_feature    391453..391668
                     /locus_tag="KPHS_03520"
                     /note="Plasmid stability protein; Region: Plasmid_stab_B;
                     pfam10784"
                     /db_xref="CDD:119304"
     gene            complement(391975..392760)
                     /locus_tag="KPHS_03530"
                     /db_xref="GeneID:11845340"
     CDS             complement(391975..392760)
                     /locus_tag="KPHS_03530"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="YP_005224653.1"
                     /db_xref="GeneID:11845340"
                     /translation="MSRSTWYYNMNALKQGDRYAGLKENIRKIYHYHKGRYGYRRITL
                     ALRKQGLRINHKTVQRLMAELSLRSVIRAKKYRAWKGRTGEAAPNILSRNFGASKANE
                     KWVTDVTEFPVQGKKLYLSSVLDLFNREVIAYSLSERPVMEMVNTMLDGAFPKLRPGD
                     APLLHSDQGWHYRMRSYQERLKAHGMTQSMSRKGNCLDNAVMENFFGTLKSECFYLRE
                     FRSVSALRKAVEDYIHYYNNERISLKLKGLSPVEYRTQALRAA"
     misc_feature    complement(392005..392760)
                     /locus_tag="KPHS_03530"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            complement(392817..393338)
                     /locus_tag="KPHS_03540"
                     /db_xref="GeneID:11845341"
     CDS             complement(392817..393338)
                     /locus_tag="KPHS_03540"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="YP_005224654.1"
                     /db_xref="GeneID:11845341"
                     /translation="MAKPKYSPETKLAVVNHYLSGKDGEQSTADLFGIERTSVRRWVR
                     AWQFHGAEGLTAKNNHYSDEFKLVVVRAVISDRLTMREAAARFNLSAEILVRRWLDVY
                     NDAGAEGLLNIQCGRPGKMTKPKNIPPLTDKELEKLSPEELRAELRYLRAENAYLKKL
                     KALVQSEKNGKKP"
     misc_feature    complement(393009..393338)
                     /locus_tag="KPHS_03540"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            complement(393507..393812)
                     /locus_tag="KPHS_03550"
                     /db_xref="GeneID:11845342"
     CDS             complement(393507..393812)
                     /locus_tag="KPHS_03550"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone-modulator protein CbpM"
                     /protein_id="YP_005224655.1"
                     /db_xref="GeneID:11845342"
                     /translation="MATVTVTFTITELCLRTGVSEEELTEIVGLGMIEPHQPQADTWL
                     FDDSAVTIVHRAVRLRNELELDWPGIAVALTLLDENARLTRENRLLQQRLARFLAHG"
     misc_feature    complement(393510..393812)
                     /locus_tag="KPHS_03550"
                     /note="chaperone-modulator protein CbpM; Provisional;
                     Region: PRK10265"
                     /db_xref="CDD:182346"
     gene            complement(393812..394729)
                     /locus_tag="KPHS_03560"
                     /db_xref="GeneID:11845343"
     CDS             complement(393812..394729)
                     /locus_tag="KPHS_03560"
                     /codon_start=1
                     /transl_table=11
                     /product="curved DNA-binding protein"
                     /protein_id="YP_005224656.1"
                     /db_xref="GeneID:11845343"
                     /translation="MELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEA
                     KFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQRQTHEQSYSQQDFDDIFSSMFG
                     QQAHQRRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYNVFGMIESETPKTLN
                     VKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAP
                     WEAALGAKVTVPTLKESILLTVPPGSQAGQRLRIKGKGLVSKTHTGDLFAVIKIVMPP
                     KPDEKARELWQQLAAAEASFDPRKTWGKA"
     misc_feature    complement(393815..394729)
                     /locus_tag="KPHS_03560"
                     /note="curved DNA-binding protein CbpA; Provisional;
                     Region: PRK10266"
                     /db_xref="CDD:182347"
     gene            394805..394918
                     /locus_tag="KPHS_03570"
                     /db_xref="GeneID:11845344"
     CDS             394805..394918
                     /locus_tag="KPHS_03570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224657.1"
                     /db_xref="GeneID:11845344"
                     /translation="MRPDGEEKWRKLDAVGVDGAVDKISPSPAAVGGGAIR"
     gene            complement(394875..395558)
                     /locus_tag="KPHS_03580"
                     /db_xref="GeneID:11845345"
     CDS             complement(394875..395558)
                     /locus_tag="KPHS_03580"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="YP_005224658.1"
                     /db_xref="GeneID:11845345"
                     /translation="MYAFLQQWDMAVIMLQIVAIDLLLGGDNAVVIAMACRKLPPQKR
                     TKAIIIGTVGAILARVLLLAIALYLLSLPWLKIVGALLLLWIGIKLVRNEEEESEVSS
                     SGSLWRTAITITVADVIMSLDNVLAVAAAGKGHIALVALGVAISIPVIVAGSKLVLVL
                     LTRFPTVVLLGGMLIGWIAGSMLVSDPTIRQLFPSAGEGTARLAGAVGALLVLFTGWR
                     RRPRPQAKD"
     misc_feature    complement(395001..395522)
                     /locus_tag="KPHS_03580"
                     /note="integral membrane protein, YjbE family; Region:
                     R_switched_YjbE; TIGR03717"
                     /db_xref="CDD:163429"
     gene            complement(395522..395752)
                     /locus_tag="KPHS_03590"
                     /db_xref="GeneID:11845346"
     CDS             complement(395522..395752)
                     /locus_tag="KPHS_03590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224659.1"
                     /db_xref="GeneID:11845346"
                     /translation="MSLGDKISPFFAEALPNGALIRNFIFQALSFPRDSAGLRQWSTR
                     PRRSTLRSGFSCSFFRWFLSICMHFFNNGTWQ"
     gene            395784..396569
                     /locus_tag="KPHS_03600"
                     /db_xref="GeneID:11845347"
     CDS             395784..396569
                     /locus_tag="KPHS_03600"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DSBA oxidoreductase"
                     /protein_id="YP_005224660.1"
                     /db_xref="GeneID:11845347"
                     /translation="MSGHKKYLSVALLSAVLLPAMASAADAPATFTPEQEAKIGKIAA
                     DYLVAHPEVLLQASQKLQQIQAEQQASAATQAVLKNAAVLTQDKNTPTYGPANGKVTV
                     IEFFDYQCVYCSRLAPVMEQVIKAHPQTRFAFKEWPIFGGRWESSLEAAKTGLQIYQQ
                     KGADAYLAYHNGIYATGHNEGKLTTADIQQQAKKAGFDAKKAADVEPVLQSINDLAQE
                     IGLSGTPGVIVMPTTGATEASITVFPGLADKASLEAAIKKAGG"
     misc_feature    396063..396554
                     /locus_tag="KPHS_03600"
                     /note="DsbA family, Com1-like subfamily; composed of
                     proteins similar to Com1, a 27-kDa outer
                     membrane-associated immunoreactive protein originally
                     found in both acute and chronic disease strains of the
                     pathogenic bacteria Coxiella burnetti. It contains a
                     CXXC...; Region: DsbA_Com1_like; cd03023"
                     /db_xref="CDD:239321"
     misc_feature    order(396111..396113,396120..396122)
                     /locus_tag="KPHS_03600"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239321"
     gene            complement(396615..397064)
                     /locus_tag="KPHS_03610"
                     /db_xref="GeneID:11845348"
     CDS             complement(396615..397064)
                     /locus_tag="KPHS_03610"
                     /codon_start=1
                     /transl_table=11
                     /product="hemin storage system HmsS protein"
                     /protein_id="YP_005224661.1"
                     /db_xref="GeneID:11845348"
                     /translation="MNENTLILTEHRVLPRLVDAGLTLLAWLGFLFFLYANLLMQFIA
                     PPSPRWESLMDSLNTALVYLLIAALNGWLLILWYHYNRRRAHTRRHTAVLALRDDELA
                     SSFNVAPQIISEMSRYNLLTVYHDQIGQIIDLKSHALPPPQEESDDA"
     misc_feature    complement(396618..397061)
                     /locus_tag="KPHS_03610"
                     /note="hemin storage system protein; Provisional; Region:
                     hmsS; PRK14584"
                     /db_xref="CDD:184756"
     gene            complement(397064..398392)
                     /locus_tag="KPHS_03620"
                     /db_xref="GeneID:11845349"
     CDS             complement(397064..398392)
                     /locus_tag="KPHS_03620"
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm PGA synthesis N-glycosyltransferase
                     PgaC"
                     /protein_id="YP_005224662.1"
                     /db_xref="GeneID:11845349"
                     /translation="MTDRIIALCILCLVFGLPLGVAAVFTGELILDFVFFWPLFMSVL
                     WITGGLYFWFQLERHWPWGEDTPPPTLPGNPLISILIPCFNEEKNARETISAALAQRY
                     ANLEVIAINDGSSDNTAQVLQQLAQEEPRLRVIHLAANQGKAVALKAGAAAARGDLLV
                     CIDGDALLDRDTAAWLVAPLIHYPHVGAVTGNPRIRTRSTLIGRIQVGEFSSIIGLIK
                     RTQRIYGRVFTVSGVIAAFRRQALADVGYWSPDMITEDIDISWKLQLRHWDIFFEPRA
                     LCWILMPETLKGLWKQRLRWAQGGAEVFLVNLRRLFHWQHHRMWPLFLEYACSTLWAF
                     AYAITILLFILSRLMPLPDNLAVHSLFPPEFTGMLLGLMCLLQFVASLYIERRYEKKV
                     AKSLFWVIWFPMVYWMIGLLTTLVAFPKVMVKRQRSRARWVSPDRGKGSL"
     misc_feature    complement(397076..398332)
                     /locus_tag="KPHS_03620"
                     /note="N-glycosyltransferase; Provisional; Region:
                     PRK11204"
                     /db_xref="CDD:236882"
     gene            complement(398385..400400)
                     /locus_tag="KPHS_03630"
                     /db_xref="GeneID:11845350"
     CDS             complement(398385..400400)
                     /locus_tag="KPHS_03630"
                     /codon_start=1
                     /transl_table=11
                     /product="putative polysaccharide deacetylase"
                     /protein_id="YP_005224663.1"
                     /db_xref="GeneID:11845350"
                     /translation="MLNTTLRNGPMLLIWLCLIFSVRAEEVPFLAPQQRPQLEANQPW
                     PADRFLVLAYHDVEDDAADQRYLSVRTSALNEQIAWLLHNGYHAISVQDILDAHYGLK
                     SLPPKAFLLSFDDGYSSFYTRVWPLLKAWNVPALWAPVGSWVDTPAGQPVNFGGLMTP
                     RERFATWEMVRELSRSPLVEIGAHTWASHYGLPANPQGSREPAAANRGWDKTTGRYES
                     DAQFTRRMTDDVQKVTAKIHEVAGKTPRAWVWPYGAASGSTLTIAKQQGYQLAFTLND
                     GLGNVKDLDNIPRLLIAGNPSLKAFASAVTQIQEADPVRVMHVDLDYVYDPNPVQQAK
                     NIDKLVQRVYDMKISHVFLQAFSDPQGDGTVKSLYFPNRWLPMRADLFNFVSWQLQTR
                     GNVKVYAWMPVLAFDLASDLPRVQRWDPQTGKALLARQPYVRLSPWDPRVRQQITDIY
                     EDLARHASFSGILFHDDAVLTDFEDVSPEAVAAWRQTGMAHDAAPVPQRPQERQAWMR
                     FKSQTLTRFTLDLRQAVQAIRGPQVKTARNLFALPILEPQSEAWFAQNLDDFLAAYDW
                     TVPMAMPLMESVPIDASQAWLTRLVQAVARHPGALKKTIFELQARDWNRRQQNAIPDQ
                     QLADWMRLLRLNGVKNYGYYPDDFINNQPDISRIRPQFSSWWYPDHD"
     misc_feature    complement(398388..400400)
                     /locus_tag="KPHS_03630"
                     /note="outer membrane N-deacetylase; Provisional; Region:
                     pgaB; PRK14582"
                     /db_xref="CDD:184754"
     gene            complement(400409..402856)
                     /locus_tag="KPHS_03640"
                     /db_xref="GeneID:11845351"
     CDS             complement(400409..402856)
                     /locus_tag="KPHS_03640"
                     /codon_start=1
                     /transl_table=11
                     /product="poly-beta-1,6 N-acetyl-D-glucosamine export
                     porin PgaA"
                     /protein_id="YP_005224664.1"
                     /db_xref="GeneID:11845351"
                     /translation="MERSPYSNTLLFNRNTKLSLSIGLLLLFPALVQGADSLYDQQIL
                     QARQGQYAPFLSYLQQYQLRHALTPSQVADWLQVALWAGQDDEVVKVWRRYQVYMPLP
                     ARGTAAAAQALRNQKQWQTSLTLWQQALSQAPGSDDYRIGYIKTLADARKDGEALSEA
                     RRLVAEQASVAHLQTLSYVYLRLGKSWDQLLVDTQILDREPQNKTALASLMATLTRNR
                     IDSPALGLANSVELTPAEKRNLQLNAAAELVRLADTPSREEKARYALARTALTQYDAM
                     IAAWHPDPQAAPDIIRARIDRLGALYASAEYAQVIREYQSLIAQQQTVPDWAIGWVIS
                     SFIALKQIEPALTLIHQHPSWLTSQQNEEHELFYALLDTGQYPAAQRYVARLTRNAPY
                     IRRLYGSPTPQPNDDWLTAQSLNVHYLAATNDLPQAEARMQRLAATAPGNQGLQIDYA
                     ALLQERGLPRAAERQLKAAESLEPASLQLERQQAWVALDLQEWRQMDLLADDVVARSP
                     RDLNTQRLARAREIHHLSELRLSVGKGLHSDNPVSGTHDLSFETAIYSPPLADSWRLF
                     GGHRFAEGNFEEGKGSRRQLFAGIEWRPRDYWGELELSSVNFHDENKPGVRLSAAHDV
                     SDRWQLGGELERISQQTPLRALRNGVSANRGEGWLRWSPNERREYRFSAAASRFTDRN
                     RRQEYTLSGKERLWQTPWLTLDLQPGLSASANSRTDTAYYSPARDLAATAALAVDHTL
                     YQRYDTVWSQQLLAGGGSYWQKNHAAGAITVLGYGQRLRWNNVVDTGLMLNWDKRPYD
                     GKRENNLAITLDANIRF"
     misc_feature    complement(400412..402697)
                     /locus_tag="KPHS_03640"
                     /note="outer membrane protein PgaA; Provisional; Region:
                     pgaA; cl26178"
                     /db_xref="CDD:330999"
     gene            403490..404056
                     /locus_tag="KPHS_03650"
                     /db_xref="GeneID:11845352"
     CDS             403490..404056
                     /locus_tag="KPHS_03650"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_005224665.1"
                     /db_xref="GeneID:11845352"
                     /translation="MILVTQDYYLFQGVKNFFPDIIQLDSSGKAILDNEVDEVSLLVD
                     SRSPLCHYDYLVLAAAKSRKRICCIVLDMRHREEHLLSLKSFLNMSLSPADMATLFGL
                     FLEMNSKRLTKEWFDDLRLSLSEQLMLRLLMAGMTMEEVAVNLNTSLKSLYRKRTALY
                     ERLGLDNFNEACLFIFRNKLLEQTERSL"
     misc_feature    <403712..403945
                     /locus_tag="KPHS_03650"
                     /note="colanic acid capsular biosynthesis activation
                     protein A; Provisional; Region: rcsA; PRK15411"
                     /db_xref="CDD:185309"
     misc_feature    403850..404020
                     /locus_tag="KPHS_03650"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:354815"
     misc_feature    order(403853..403861,403898..403906,403928..403933,
                     403937..403942,403946..403960,403991..403993)
                     /locus_tag="KPHS_03650"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(403886..403888,403892..403894,403898..403900,
                     403991..403999,404006..404008,404015..404020)
                     /locus_tag="KPHS_03650"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(404051..404173)
                     /locus_tag="KPHS_03660"
                     /db_xref="GeneID:11845353"
     CDS             complement(404051..404173)
                     /locus_tag="KPHS_03660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224666.1"
                     /db_xref="GeneID:11845353"
                     /translation="MPSSIPPGIDGCTYQYLFNLLYFRQQIPCDNIHSLYSEAS"
     gene            404446..404658
                     /locus_tag="KPHS_03670"
                     /db_xref="GeneID:11845354"
     CDS             404446..404658
                     /locus_tag="KPHS_03670"
                     /codon_start=1
                     /transl_table=11
                     /product="PerC family transcriptional regulator"
                     /protein_id="YP_005224667.1"
                     /db_xref="GeneID:11845354"
                     /translation="MMQRCLDDEDREWIRHHRNQCLKKAQRPPAPKEEFADLHQAAKE
                     TQYRMGIAKPYGEAFRLPGKGKTAAE"
     misc_feature    <404464..404625
                     /locus_tag="KPHS_03670"
                     /note="PerC transcriptional activator; Region: PerC;
                     pfam06069"
                     /db_xref="CDD:310570"
     gene            404932..405069
                     /locus_tag="KPHS_03680"
                     /db_xref="GeneID:11845355"
     CDS             404932..405069
                     /locus_tag="KPHS_03680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224668.1"
                     /db_xref="GeneID:11845355"
                     /translation="MPYPAYESSAGSNSVGPRKRSAAGQRVIERSSMKSPDAEKQKPA
                     F"
     gene            complement(405441..407528)
                     /locus_tag="KPHS_03690"
                     /db_xref="GeneID:11845356"
     CDS             complement(405441..407528)
                     /locus_tag="KPHS_03690"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1176 domain-containing protein"
                     /protein_id="YP_005224669.1"
                     /db_xref="GeneID:11845356"
                     /translation="MRAFFWAAWLGLCSTPLLAAPLQGFSFAQKDWELACDNTGACRA
                     AGYGVRMGEVSVLLTRNAGSEQHLTATVTFAQIEHDIPADSTASLLIDDRDFGALDAL
                     DDSHFRLDSDQTTALLQALTNQRKIEFTLNGQHLPLSSAGSREVLGKMDAFQRRTGTA
                     DALLDKGDAGDDAILPATPAPEIIAAPVLHNAQPVPLSMLQRQKLLPILTPLLNQRCD
                     DWQNQAIPAADRQITLTALDKTHSLAQALCWRAPYNDGYALWLVDNAQLSKPRLLTTE
                     ASSYADGAIVFLHKERGMADCVTGETRVWDGKTFTPSLKYSTGMCREITPGGTWMLPT
                     FVSQVIPRQQKEADNLALRTLYNAVLKAQKSDPELSLNKVAEQFPLTGHITDFTLTYA
                     DDTLITTSKPSPDISDDEWQAFLRSSISADSENGKVSFTLIDLDGDGKRDLIIDSYVG
                     GTGLFSYTGVLKRGDDDFAAVNGSDSDNGDDFDAGVPGALFSINGRGANQWNHWVKIN
                     GQVYALWYNGQFGEDNLYLLRPFSTTSQTPAVTVRYRYTLNSIRSPEKDQPLTPSLSD
                     GDKADLLRSLEVMQGSLLKDRPASDNDAPICPIPPGTSADEADNYYSGVAVNYIYETV
                     AYIPVWLNGKCYIGTIFSHHGAYRHGVDAEITLSSPREDEEVIGDYLISGLRHVIAIT
                     SGWKSREGDNGMQ"
     misc_feature    complement(406518..407453)
                     /locus_tag="KPHS_03690"
                     /note="Protein of unknown function (DUF1176); Region:
                     DUF1176; pfam06674"
                     /db_xref="CDD:310933"
     gene            complement(407596..408186)
                     /locus_tag="KPHS_03700"
                     /db_xref="GeneID:11845357"
     CDS             complement(407596..408186)
                     /locus_tag="KPHS_03700"
                     /codon_start=1
                     /transl_table=11
                     /product="putative TetR/AcrR family transcriptional
                     regulator"
                     /protein_id="YP_005224670.1"
                     /db_xref="GeneID:11845357"
                     /translation="MEENTVLREDVLAEAIKILEIEGIANTSLEMVAERVSCPTSDLK
                     RFWPDREALLYDALRYLSQQVDAWRRQLLLDETLSAEQKLLARYAALTTCVSNQRYPG
                     CLFIAACTFYPDPQHPIHQLAEQQKQASLAYTHELLTQLEVDDPEMVAKQMELIVEGC
                     LSRLLVKRSQTDVDTARRLAEDILRFAQCRMGGALT"
     misc_feature    complement(407599..408165)
                     /locus_tag="KPHS_03700"
                     /note="putative transcriptional regulator; Provisional;
                     Region: PRK11640"
                     /db_xref="CDD:183252"
     gene            complement(408207..410003)
                     /locus_tag="KPHS_03710"
                     /db_xref="GeneID:11845358"
     CDS             complement(408207..410003)
                     /locus_tag="KPHS_03710"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="YP_005224671.1"
                     /db_xref="GeneID:11845358"
                     /translation="MAYRIITLILLLCSTSATAGLFDAPGRSNFVPADQAFAFDFQQQ
                     QHDVNLSWQIKDGYYLYRQQFTFSAAGATIDEPALPAGEWHEDEFYGKSEIFRQRLTV
                     PVTVKEADKEATLTVTWQGCADAGFCYPPETKVIPLSAVRAASNDAQPTAAAPVSSLN
                     HRPAFNPPLPVEPRPMEENAVPQAPAMAPPADVPARLPFTALWALLIGIGIAFTPCVL
                     PMYPLISGIVLGGKQRLSTARALLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQHP
                     YVLVGLSAVFILLALSMFGLFTLQLPSSLQTRLTLLSNKRQGGSPGGVFAMGAIAGLI
                     CSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILVTVFGNRLLPKSGPWM
                     SHVKTAFGFVILALPVFLLERIFGDQWGLRLWSMLGVAFFSWAFITSLGATRPWMRLV
                     QIILLAAALVSARPLQDWAFGAPAVEQQAHLAFTRVSSVAELDQALAQAKGQPVMLDL
                     YADWCVACKEFEKYTFSSPDVQQALKGTVLLQVDVTKNSPQDVALLRHLQVLGLPTIL
                     FFNAEGQEQPERRVTGFMDAAAFSAHLRDWQA"
     misc_feature    complement(408210..409994)
                     /locus_tag="KPHS_03710"
                     /note="thiol:disulfide interchange protein precursor;
                     Provisional; Region: dipZ; PRK00293"
                     /db_xref="CDD:234717"
     gene            complement(409979..410302)
                     /locus_tag="KPHS_03720"
                     /db_xref="GeneID:11845359"
     CDS             complement(409979..410302)
                     /locus_tag="KPHS_03720"
                     /codon_start=1
                     /transl_table=11
                     /product="divalent cation tolerance protein"
                     /protein_id="YP_005224672.1"
                     /db_xref="GeneID:11845359"
                     /translation="MTTPDAVVVLCTAPDEATAQDLAAKALAEKVAACATLLPGATSL
                     YYWEGKLEQEYEVQMLLKTDLAHQQALLDCLKSHHPYQTPELLVLPVTHGDNDYLSWL
                     TASLR"
     misc_feature    complement(409982..410302)
                     /locus_tag="KPHS_03720"
                     /note="divalent-cation tolerance protein CutA;
                     Provisional; Region: PRK10645"
                     /db_xref="CDD:182614"
     gene            complement(410427..411728)
                     /locus_tag="KPHS_03730"
                     /db_xref="GeneID:11845360"
     CDS             complement(410427..411728)
                     /locus_tag="KPHS_03730"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter"
                     /protein_id="YP_005224673.1"
                     /db_xref="GeneID:11845360"
                     /translation="MFGAELVIVLLAIYLGARLGGIGIGFAGGLGVLVLTLIFQIKPG
                     AIPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAERMLRRHPKYITFLAPLVTWFMTVL
                     AGTGHTAFSTLPVITEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFFAGILEP
                     LGVSYLTLLAICIPVTLLAVMLTAIVCNFLGCELKDDPVYQERLAKGEVRLRGSQVFE
                     LQPHAKRSVLLFLIGIVAVMFYATAISDTVGLIKNPVLPRNEAIVVFMLTIATLISIT
                     CKIDTGEVLNASTFKSGMSACVCVLGVAWLGDTFVKAHISDIQAVAGDLLHNYPWLLA
                     VVLFFAATLLYSQAATTKALMPAALLLGVSPLTAIASFAAVSALFVLPTYPTLLAAVE
                     MDDTGSTRIGKYVFNHAFLIPGVIAITLCVILGFIFGGIML"
     misc_feature    complement(410430..411728)
                     /locus_tag="KPHS_03730"
                     /note="anaerobic C4-dicarboxylate transporter; Reviewed;
                     Region: PRK09412"
                     /db_xref="CDD:236503"
     gene            complement(411844..413280)
                     /locus_tag="KPHS_03740"
                     /db_xref="GeneID:11845361"
     CDS             complement(411844..413280)
                     /locus_tag="KPHS_03740"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="YP_005224674.1"
                     /db_xref="GeneID:11845361"
                     /translation="MLNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNSKISDI
                     PEFVRGMVMVKKAAALANKELQTIPKSAANAIIAACDEVLNNGKCMDQFPVDVFQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYASI
                     LKLIDAIKQLGEGFQAKAVEFQDILKMGRTQLQDAVPMTLGQEFHAFNVLLNEETKSI
                     LRTAELLLEVNLGATAIGTRLNTPDGYQQLAVQKLAEVSNLPVVPAEDLIEATSDCGA
                     YVMVHSSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPE
                     VVNQVCFKVIGNDTTVTMASEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCVN
                     GITANKAVCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTA
                     AELDDIFSAQNLMHPAYKAKRYTDESEQ"
     misc_feature    complement(411862..413280)
                     /locus_tag="KPHS_03740"
                     /note="aspartate ammonia-lyase; Provisional; Region: aspA;
                     PRK12273"
                     /db_xref="CDD:237031"
     gene            413305..413463
                     /locus_tag="KPHS_03750"
                     /db_xref="GeneID:11845362"
     CDS             413305..413463
                     /locus_tag="KPHS_03750"
                     /codon_start=1
                     /transl_table=11
                     /product="proline-specific peptidase"
                     /protein_id="YP_005224675.1"
                     /db_xref="GeneID:11845362"
                     /translation="MNSPNTQNIQYSVYFLADDYFLNRPGAQDHMLMIANISKLDHLL
                     HCGYEKIY"
     gene            413618..414094
                     /locus_tag="KPHS_03760"
                     /db_xref="GeneID:11845363"
     CDS             413618..414094
                     /locus_tag="KPHS_03760"
                     /codon_start=1
                     /transl_table=11
                     /product="FxsA protein"
                     /protein_id="YP_005224676.1"
                     /db_xref="GeneID:11845363"
                     /translation="MRWIPFIAFFLYVYIEISIFIQVAHVLGVFMTLILVIFSSVVGM
                     SLVRNQGFKNFLLMQQKMAAGESPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLP
                     PVQKHLTMKLMPHLRFSRMPGGGFSAGTGGGETFEGEFQRKDEQRDRLDHKDDRRD"
     misc_feature    413618..414088
                     /locus_tag="KPHS_03760"
                     /note="Protein affecting phage T7 exclusion by the F
                     plasmid, UPF0716 family [General function prediction
                     only]; Region: FxsA; COG3030"
                     /db_xref="CDD:225574"
     gene            complement(414146..415396)
                     /locus_tag="KPHS_03770"
                     /db_xref="GeneID:11845364"
     CDS             complement(414146..415396)
                     /locus_tag="KPHS_03770"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transport"
                     /protein_id="YP_005224677.1"
                     /db_xref="GeneID:11845364"
                     /translation="MGGLKQELGLGQGVGLLSTSLLGTGVFAVPALAALVAGDNSLWA
                     WPLLILLVFPIAIVFALLGRHFPSAGGVAHFVDMAFGPRLASVTGWLFLSVIPVGLPA
                     ALHIATGFGQALFGWHDAQLLLAELGTLAIVWWVGSRGASSSANLQTLVAVLIVALIV
                     VVWWRGGISPAQIPFPAPAEIDRGQLFSALSVMFWCFVGLEAFAHLASEFKHPERDFP
                     RALMIGLLLAGSVYWACTVLVLHFHAFGEEMAAAASLPNIVVRLFGVEALWVACVIGY
                     LACFASLNIYIQSFARLVWSQAQHKPHSYLARLSPRQIPRNALNAVLGSCVVSTLGIY
                     LLDINLDALIVYANGIFIMIYLLCMLAGCRLLRGRYRLLAVVGSILCLLLLAMVGWKS
                     LYALVMLAGLWLFLPRRKLATGSV"
     misc_feature    complement(414167..415345)
                     /locus_tag="KPHS_03770"
                     /note="putative transporter; Provisional; Region:
                     PRK11021"
                     /db_xref="CDD:236823"
     gene            complement(415448..415594)
                     /locus_tag="KPHS_03780"
                     /db_xref="GeneID:11845365"
     CDS             complement(415448..415594)
                     /locus_tag="KPHS_03780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224678.1"
                     /db_xref="GeneID:11845365"
                     /translation="MGDAGPNAVYRLVQREMGMAIYGFKGKIKKNFYLCAGAQKAAMS
                     GNRS"
     gene            415629..415922
                     /locus_tag="KPHS_03790"
                     /db_xref="GeneID:11845366"
     CDS             415629..415922
                     /locus_tag="KPHS_03790"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin"
                     /protein_id="YP_005224679.1"
                     /db_xref="GeneID:11845366"
                     /translation="MSIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEIIAVG
                     KGRILENGTVQPLDVKVGDIVIFNDGYGVKTEKIDNEEVLIMSESDILAIVEA"
     misc_feature    415629..415916
                     /locus_tag="KPHS_03790"
                     /note="co-chaperonin GroES; Reviewed; Region: groES;
                     PRK00364"
                     /db_xref="CDD:178988"
     misc_feature    order(415632..415634,415638..415640,415644..415646,
                     415653..415655,415734..415739,415800..415802,
                     415830..415832,415845..415847,415854..415856,
                     415902..415910)
                     /locus_tag="KPHS_03790"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    415680..415721
                     /locus_tag="KPHS_03790"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    order(415761..415763,415794..415796)
                     /locus_tag="KPHS_03790"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            415960..417606
                     /locus_tag="KPHS_03800"
                     /db_xref="GeneID:11845367"
     CDS             415960..417606
                     /locus_tag="KPHS_03800"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="YP_005224680.1"
                     /db_xref="GeneID:11845367"
                     /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNE
                     GLKAVAAGMNPMDLKRGIDKAVLAAVEELKALSVPCSDSKAIAQVGTISANSDETVGK
                     LIAEAMDKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPDTGAVELESP
                     FILLADKKISNIREMLPVLEAVAKAGKPLVIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIID
                     GVGEESAIQGRVAQIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KARVDDALHATRAAVEEGVVAGGGVALVRVAAKLAGLTGQNEDQNVGIKVALRAMEAP
                     LRQIVSNAGEEPSVVANNVKAGDGNYGYNAATEEYGNMIDFGILDPTKVTRSALQYAA
                     SVAGLMITTECMVTDLPKGDAPDLGAAGGMGGMGGMGGMM"
     misc_feature    415963..417549
                     /locus_tag="KPHS_03800"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK00013"
                     /db_xref="CDD:234573"
     misc_feature    order(415969..415971,415981..415983,416032..416034,
                     416065..416076,416080..416082,416095..416100,
                     416104..416106,416134..416136,416140..416142,
                     416164..416166,416176..416178,416185..416187,
                     416548..416550,416644..416646,416728..416730,
                     417109..417111,417115..417117,417334..417336,
                     417496..417498,417505..417525)
                     /locus_tag="KPHS_03800"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(416050..416058,416218..416220,416230..416232,
                     416407..416409,417151..417153,417202..417204,
                     417319..417321,417436..417438,417442..417444)
                     /locus_tag="KPHS_03800"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(416284..416286,417259..417261,417313..417315,
                     417340..417342,417346..417351,417358..417360)
                     /locus_tag="KPHS_03800"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(416380..416382,416515..416517,416536..416538,
                     417082..417084,417184..417189)
                     /locus_tag="KPHS_03800"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            417867..418220
                     /locus_tag="KPHS_03810"
                     /db_xref="GeneID:11845368"
     CDS             417867..418220
                     /locus_tag="KPHS_03810"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_005224681.1"
                     /db_xref="GeneID:11845368"
                     /translation="MQVKYLAGIVGAALLLAGCSSSNELTSAGQNVRFVQEKPGAECQ
                     LLGTATGKQSNWLSGQNGDEGGSMRGAANALRNQAAAMGGNVIYGVSSPTQNLLSSFV
                     PTDSEMNGQVYKCPN"
     misc_feature    417936..418211
                     /locus_tag="KPHS_03810"
                     /note="Domain of unknown function (DUF4156); Region:
                     DUF4156; pfam13698"
                     /db_xref="CDD:338906"
     gene            complement(418275..419138)
                     /locus_tag="KPHS_03820"
                     /db_xref="GeneID:11845369"
     CDS             complement(418275..419138)
                     /locus_tag="KPHS_03820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224682.1"
                     /db_xref="GeneID:11845369"
                     /translation="MQGTFIGFNTAGITFEDRFLALLLKIKQQNGPCQQYYLQAPILL
                     DLLLILQNRLLVTYKRLHEQGETYKEELIAYNESLIANIPAVEMAEIQQPNPERRIMS
                     ITLKPGETESTLILVLQNEQICTLCIEDRQVEALLAGVQQALKTINDQEVLKYLSSNM
                     DFLMCYTVDLTTQPNIDYQQHTQEDWKLNLFSHYLGVLYCCETDEGKKIVSGAVVKTS
                     APHLSELENNVVTRIIEKSPKLKAMHAELAPCQIFSTIIPSQPGRMLSLEECLRPLHA
                     FYLEKKAELSA"
     misc_feature    complement(418287..419138)
                     /locus_tag="KPHS_03820"
                     /note="YjeJ-like; Region: YjeJ; pfam15922"
                     /db_xref="CDD:292544"
     gene            complement(419151..421274)
                     /locus_tag="KPHS_03830"
                     /db_xref="GeneID:11845370"
     CDS             complement(419151..421274)
                     /locus_tag="KPHS_03830"
                     /codon_start=1
                     /transl_table=11
                     /product="microcin H47 ABC transporter,
                     permease/ATP-binding protein"
                     /protein_id="YP_005224683.1"
                     /db_xref="GeneID:11845370"
                     /translation="MTNELFEKIIAKVNFSLLKKTPVILQSEAAECGIACLAMVCGHY
                     GLDIDLFNFRQRFGSPSQGVTLMSLSKTAEHAGLKSRALSLDLDEIRQLKLPCVLHWG
                     MNHYVVLTKVRKSSFIVHDPALGKRIIGIQEMSNYFTGVALELWPDQNFQQEKAKSRL
                     RLLDLMRNIVGLKSALLKIFAFSVVVEAIGLLLPIGTQLVTDHVIMAHDQSLLSVICI
                     GLVFFTLFRTFISMLRAWTSLTLNTLTSIQWKTTLFDHLASLPLSFFEKRHLGDIQSR
                     FSSLDTIRSTFTNSIVSGIIDSIMTIGLLIMLTLYGGWLTWVVVGFTLCYAIMRFATY
                     RFYRRVAEEQVIKGARSSSHFMESLYGISTIKALNLKERRSQHWLNINIEACNAGIKQ
                     TRFDMLFSGINTFITAIDQVAVLWLGAIMVIDNNMTLGMFMAFNAYRGQFSQRASSLV
                     DLCMQLRMLSLHNERLSEIVFSEPEQELPTREVFSADSGAKLEVKNLCYQYDPFSQPI
                     FSNLNITVEPGESVALVGPSGVGKTTLLKVMCGLLSPTSGDVLADNLDITKIGLNNYR
                     LGIACVLQEDRLFSGSLIDNISGFEDNADIDFVMECAKRCNIHDEIIKMPMGYETIVG
                     ELGLGISGGQKQRILIARALYRRPSILFMDEATSHLDLKNESVINQSISALSITRIIV
                     AHRPSTIASADRVIDLSQTKTLSPA"
     misc_feature    complement(419169..421217)
                     /locus_tag="KPHS_03830"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; COG2274"
                     /db_xref="CDD:225183"
     gene            complement(421267..422553)
                     /locus_tag="KPHS_03840"
                     /db_xref="GeneID:11845371"
     CDS             complement(421267..422553)
                     /locus_tag="KPHS_03840"
                     /codon_start=1
                     /transl_table=11
                     /product="microcin H47 secretion protein"
                     /protein_id="YP_005224684.1"
                     /db_xref="GeneID:11845371"
                     /translation="MTNSIYRKEAIAYKKLHWKGKALLLAGLPAWLVTCLSLLFLCAL
                     ICALIFCKFTQRIDVKGEVITLPHSVNVFSPQQGFVVNQYVQIGDVVKKGQTLYELDV
                     SRNTTTGNVSAAQIEVINEKIANSEAIIKKLTHNKNETLIALDAQLKNARNSLNETVR
                     MLANTQQGLSKMHENLSSYDKYLKEGLITKDQYNYQHSLYFQQQSAYQSLISQKMQLE
                     TQLTQLSSDKVTKAADFDNQISSQYNQTNDYKNQLVESNANGNIIIKATTEGRIESLA
                     VTKGQMVDKGSSLAQIKPIGNIEYYLILWLPNNSIPYVKVGDTINIRYDAFPSDKFGQ
                     FPGEIISISSLPASRQEMSEYTNVNDGTNQQELALYKAIVKIRDKKFNYDGKELSLSN
                     GLKAQAVVFLEERPLYMWMFTPVYKISQSVSGPVND"
     misc_feature    complement(421525..422400)
                     /locus_tag="KPHS_03840"
                     /note="HlyD membrane-fusion protein of T1SS; Region: HlyD;
                     pfam00529"
                     /db_xref="CDD:306914"
     gene            complement(423082..423447)
                     /locus_tag="KPHS_03850"
                     /db_xref="GeneID:11845372"
     CDS             complement(423082..423447)
                     /locus_tag="KPHS_03850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224685.1"
                     /db_xref="GeneID:11845372"
                     /translation="MKQLTVFEMEAISGGYSWDFSSIQSSITSLVSNGVEAVVSAATM
                     GTLAAVFGTFVGGTQAGANGGVLGFGLFGNLVGMFVGLVGGAILGAGCGLAWGWDGTM
                     AIIEAGAQGLVDGTFVVWK"
     gene            complement(423659..424693)
                     /locus_tag="KPHS_03860"
                     /db_xref="GeneID:11845373"
     CDS             complement(423659..424693)
                     /locus_tag="KPHS_03860"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="YP_005224686.1"
                     /db_xref="GeneID:11845373"
                     /translation="MKKIVILITLLMLGGQAATNCTYKGNTKRQGLTLTNIKIPTDAS
                     IPVGSVLHTHKFGTGAYKTFTCNKNTDDQYIIDVGAAVVPGVTGVQGGPVYETGIDGI
                     GFQVSDLLRSKNGSLIAAEAGSTLVPITSSSENNYQFITVWLIKTKTVIDTSTKSTSN
                     PSVSFSVGNLKTNPVANDRLLYAVTSISIKNINYRTTSCNISTPRSQITLNRIDKGKL
                     MSLSRGATTPSEKTIAMNISCPNDSVGNTLIYWFNPVGGISASGNGIVDNMLSGSDAA
                     NNVGIIFKLSGSPVVFYDTDNYNYKINTSNDLNKTINLTADYYRQSDNSNDVTMGLVK
                     GMMEVVIQEE"
     misc_feature    complement(423662..424111)
                     /locus_tag="KPHS_03860"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:351496"
     gene            complement(424716..427040)
                     /locus_tag="KPHS_03870"
                     /db_xref="GeneID:11845374"
     CDS             complement(424716..427040)
                     /locus_tag="KPHS_03870"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial biogenesis outer membrane
                     usher protein"
                     /protein_id="YP_005224687.1"
                     /db_xref="GeneID:11845374"
                     /translation="MFNGRYLDTRTIKFVANNRASSDNREPALVPCLSLKALAEYGVR
                     IKAFPELAEDQNGCANFSVIPDTKADFDFTAQRLNISIPQAALSTTAQGYIPPDQFDD
                     GINALLVNYQFSGSNDMQANDEYYSLNLQSGLNVGPWRIRNLSTWNKNNSGAGDWDSA
                     YLYMQRSIRSINSNLVMGESSSLNGIFDSVPFTGIQLATDTTMLPESMRGYAPIIRGI
                     ARTNARVIIKQNGYQVYQTYVAPGAFEITDMYPSGGSGDLYVTVEESDGSKQEFVVPF
                     ATLPVMVREDQLEYEITSGKYRPYDGGVDETPFTQATATYGVSSSLTLYGGMQAASRY
                     QALSTGLGYNLGELGAASADVTQAWSKKKEDEKTSGQSWRVRYGKNIVETGTNVTIAG
                     YRYSTRGFNTLSEVLDSYSNDGSYTSRSLRNRTNLTLNQSLGKGLGSLSISGLIEDYW
                     DDKRTNKSISVGYNGGFRNVNYYLGYSYNRYTWSGDNSGKDAQDDQRITLTVTLPLSN
                     WLPGTYTSYQLTNSNPGSTDQSVSIGGNALENDSLEWSLHQGYSNREYYSGDMRATYN
                     GARGSVNAGYSYDNNSQRIDYGANGSILAHADGITLGQDITDAAVLVKAPGLDDVRLA
                     NDNTISTDYRGYAIVPYVTPYRRTDITLDSTTLGEDMELPETTKSVVPTRGAIVRASY
                     DGNIGQRAFVHLKTASGQDVPYGAMVLLVGDSKSQPSIVSDAGMVYMSGLQQTGILNV
                     QWGKSAAQQCNASFTLPTREGKASGIRQIETICR"
     misc_feature    complement(424719..427034)
                     /locus_tag="KPHS_03870"
                     /note="Outer membrane usher protein FimD/PapC [Cell
                     motility, Extracellular structures]; Region: FimD;
                     COG3188"
                     /db_xref="CDD:225729"
     gene            complement(427295..427981)
                     /locus_tag="KPHS_03880"
                     /db_xref="GeneID:11845375"
     CDS             complement(427295..427981)
                     /locus_tag="KPHS_03880"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis periplasmic chaperone"
                     /protein_id="YP_005224688.1"
                     /db_xref="GeneID:11845375"
                     /translation="MFRTLLNLTASCVLLLSSIAHAGIVIESTRYLYKEGAREITAQI
                     ENKDDIPYLIKSWVETPAGKAPSFMATPPLFRLEGKQQNTVRLFSTGNVNAPTDRESL
                     YYFNVMAIPPADDEKASTNTIQLAVRHRMRLVYRPKTLFDLSPNTEAKKLEWRKAGTK
                     LTIKNPTPFFYYFHSIQIGGKEVKPEVNSVAPMTTKEVTLKENISASSITWKIVNDYG
                     GAGSLYSSSL"
     misc_feature    complement(427301..427981)
                     /locus_tag="KPHS_03880"
                     /note="P pilus assembly protein, chaperone PapD
                     [Extracellular structures]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     gene            complement(428039..428602)
                     /locus_tag="KPHS_03890"
                     /db_xref="GeneID:11845376"
     CDS             complement(428039..428602)
                     /locus_tag="KPHS_03890"
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="YP_005224689.1"
                     /db_xref="GeneID:11845376"
                     /translation="MKKTIVAVMVAASAVLSAQAMATNTAQVTVLGEVSDAANSCVVT
                     PTGTLNSGIVQLITVTTAEANAESAGTLFKTQDFGFDVKDCAQGSATPVTGVTVNVSG
                     ITSSDNTILDNTASNGATGIGIGIQRISDSHRVAFDGSDTMTESYSAASGTQLKYTTG
                     YVRTNAATPVTEGPVKGVATFTIDYTL"
     misc_feature    complement(428048..428602)
                     /locus_tag="KPHS_03890"
                     /note="Pilin (type 1 fimbria component protein) [Cell
                     motility]; Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            429083..429727
                     /locus_tag="KPHS_03900"
                     /db_xref="GeneID:11845377"
     CDS             429083..429727
                     /locus_tag="KPHS_03900"
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix domain-containing
                     protein"
                     /protein_id="YP_005224690.1"
                     /db_xref="GeneID:11845377"
                     /translation="MDDAVLFNGCIINQEIIFNANMNELRPLAGDGECISLNAPTARC
                     LLLLLQNCGKVISRDEFLAAVWETRGVVVSQNTFYQNISLLRKSLVKAGLSEDIIITV
                     RQKGFSVAPNTLVIPLSDEECENMNRVTLTHYQNNKVVGFISEDKEKPDTHLNLPLIE
                     NSSNHGSDLMANKPEEGEKVSERLHVTFKIPIWLIALIVVMIVINIIVLVVLNR"
     misc_feature    429113..>429454
                     /locus_tag="KPHS_03900"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:354815"
     misc_feature    order(429194..429196,429251..429256,429311..429313,
                     429320..429322,429344..429349,429383..429385,
                     429398..429400)
                     /locus_tag="KPHS_03900"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:294013"
     gene            complement(429849..430811)
                     /locus_tag="KPHS_03910"
                     /db_xref="GeneID:11845378"
     CDS             complement(429849..430811)
                     /locus_tag="KPHS_03910"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminomutase"
                     /protein_id="YP_005224691.1"
                     /db_xref="GeneID:11845378"
                     /translation="MTSPDELLRLLNVDADEKLLAGREARRLFPLRVPRAFIARMEKG
                     NPNDPLLRQVLTAEEEFIVAPGYSTDPLEEQHSVVPGLLHKYRNRALLLVKGGCAVNC
                     RYCFRRHFPYAENQGTRRNWQTAMDYIAAHPQLDEIIFSGGDPLMAKDHELDWLMTQL
                     EAIPHVKRLRIHSRLPIVIPARITETLASRFQRSSLQVILVNHVNHANEIDGEFRAAM
                     AMLRQAGVTLLNQSVLLRGVNDNAQTLADLSNALFDAGVMPYYLHVLDRVQGAAHFMV
                     SDDEAREIMRELLTLISGYMVPKLAREIGGEPSKTPLDLGLKQR"
     misc_feature    complement(429873..430808)
                     /locus_tag="KPHS_03910"
                     /note="EF-P beta-lysylation protein EpmB; Region:
                     EFP_modif_epmB; TIGR03821"
                     /db_xref="CDD:163533"
     gene            430919..431485
                     /locus_tag="KPHS_03920"
                     /db_xref="GeneID:11845379"
     CDS             430919..431485
                     /locus_tag="KPHS_03920"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="YP_005224692.1"
                     /db_xref="GeneID:11845379"
                     /translation="MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLR
                     RLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGD
                     NAKWLLDQAECIVTLWNGQPIAVTPPNFVELEIIETDPGLKGDTAGTGGKPATLSTGA
                     VVKVPLFVQIGEVIKVDTRSGEYVSRVK"
     misc_feature    430934..431482
                     /locus_tag="KPHS_03920"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     gene            431559..431690
                     /locus_tag="KPHS_03930"
                     /db_xref="GeneID:11845380"
     CDS             431559..431690
                     /locus_tag="KPHS_03930"
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin A"
                     /protein_id="YP_005224693.1"
                     /db_xref="GeneID:11845380"
                     /translation="MKRSVKLLVLLFLSSALLAGCNTARGVGEDIQGLGHAISHAVS"
     misc_feature    431559..431687
                     /locus_tag="KPHS_03930"
                     /note="Predicted small secreted protein [Function
                     unknown]; Region: COG5510; cl22944"
                     /db_xref="CDD:304653"
     gene            431850..431996
                     /locus_tag="KPHS_03940"
                     /db_xref="GeneID:11845381"
     CDS             431850..431996
                     /locus_tag="KPHS_03940"
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin B membrane lipoprotein"
                     /protein_id="YP_005224694.1"
                     /db_xref="GeneID:11845381"
                     /translation="MVKKTIAAFFTVLVLSSALTACNTTRGVGEDISDGGNAISGAAT
                     KAQQ"
     misc_feature    431850..431993
                     /locus_tag="KPHS_03940"
                     /note="entericidin B membrane lipoprotein; Provisional;
                     Region: PRK10081"
                     /db_xref="CDD:170240"
     gene            432140..432457
                     /locus_tag="KPHS_03950"
                     /db_xref="GeneID:11845382"
     CDS             432140..432457
                     /locus_tag="KPHS_03950"
                     /codon_start=1
                     /transl_table=11
                     /product="quarternary ammonium compound transport protein"
                     /protein_id="YP_005224695.1"
                     /db_xref="GeneID:11845382"
                     /translation="MSWIVLFIAGLLEVVWAVGLKYTHGFSRLVPSVITIVAMVASMA
                     LLSWAMKTLPVGTAYAVWTGIGAVGAAVTGIVLLGESASAMRIASLVCIVIGIIGLKI
                     SAH"
     misc_feature    432140..432454
                     /locus_tag="KPHS_03950"
                     /note="multidrug efflux system protein; Provisional;
                     Region: PRK11431"
                     /db_xref="CDD:171110"
     gene            complement(432454..432987)
                     /locus_tag="KPHS_03960"
                     /db_xref="GeneID:11845383"
     CDS             complement(432454..432987)
                     /locus_tag="KPHS_03960"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein Blc"
                     /protein_id="YP_005224696.1"
                     /db_xref="GeneID:11845383"
                     /translation="MRILPIITAIAVSFLSVACSTPAPPPGVTVVSPFDVQRYLGTWY
                     EIARFDHPFESGLEKVTIAWHPRDDGGLDVVNKGYNPDRGMWQKTDGVAYFTGEPSRA
                     ALKISFFGPFYGSYNVIALDKEYRYALVCGPDRDYLWLLARAPTIAPEVRQQMLDIAT
                     RQGFDVGKLVWVNQRYD"
     misc_feature    complement(432460..432987)
                     /locus_tag="KPHS_03960"
                     /note="outer membrane lipoprotein Blc; Provisional;
                     Region: PRK10477"
                     /db_xref="CDD:182489"
     gene            complement(433101..433460)
                     /locus_tag="KPHS_03970"
                     /db_xref="GeneID:11845384"
     CDS             complement(433101..433460)
                     /locus_tag="KPHS_03970"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit D"
                     /protein_id="YP_005224697.1"
                     /db_xref="GeneID:11845384"
                     /translation="MINPNPKRSDEPVFWGLFGAGGMWGAIVAPVMVLLVGILLPLGL
                     APADAFSYERVLAFAQSFIGRAFIFLMIVLPLWCGLHRIHHAMHDLKIHVPNGKWVFY
                     GLAAILSVITLVGVLFI"
     misc_feature    complement(433104..433457)
                     /locus_tag="KPHS_03970"
                     /note="fumarate reductase subunit D; Provisional; Region:
                     PRK05470"
                     /db_xref="CDD:180105"
     misc_feature    complement(order(433194..433196,433416..433418,
                     433425..433427,433434..433439))
                     /locus_tag="KPHS_03970"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(433404..433409,433416..433418))
                     /locus_tag="KPHS_03970"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(433104..433106,433125..433127,
                     433188..433196,433212..433217,433245..433247,
                     433284..433286,433293..433295,433299..433301,
                     433305..433307,433338..433340,433383..433385,
                     433395..433397))
                     /locus_tag="KPHS_03970"
                     /note="C-subunit interface; other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(433287..433289,433296..433301,
                     433353..433355,433365..433367))
                     /locus_tag="KPHS_03970"
                     /note="distal quinone binding site; other site"
                     /db_xref="CDD:238307"
     gene            complement(433471..433866)
                     /locus_tag="KPHS_03980"
                     /db_xref="GeneID:11845385"
     CDS             complement(433471..433866)
                     /locus_tag="KPHS_03980"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase, cytochrome b subunit"
                     /protein_id="YP_005224698.1"
                     /db_xref="GeneID:11845385"
                     /translation="MTTKRKPYVRPMTSTWWKKLPFYRFYMVREGTAVPTVWFSIVLI
                     YGLFALKHGAESWAGYIGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANVIIKGE
                     KMGPEPVIKGLWVVTAVVTVVILFVALFW"
     misc_feature    complement(433477..433866)
                     /locus_tag="KPHS_03980"
                     /note="fumarate reductase subunit C; Provisional; Region:
                     PRK04987"
                     /db_xref="CDD:235327"
     misc_feature    complement(order(433483..433485,433495..433497,
                     433579..433581,433585..433590,433597..433599,
                     433606..433608,433615..433620,433636..433638,
                     433648..433650,433672..433674,433696..433698,
                     433714..433719,433723..433725,433735..433737,
                     433747..433752,433765..433767,433771..433773,
                     433777..433782,433789..433791,433798..433803,
                     433807..433809,433819..433821,433825..433827,
                     433831..433833,433837..433839,433843..433854))
                     /locus_tag="KPHS_03980"
                     /note="D-subunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(433579..433581,433588..433590,
                     433597..433599,433780..433782,433789..433791,
                     433798..433803,433807..433809,433831..433833,
                     433837..433839,433843..433845,433849..433854))
                     /locus_tag="KPHS_03980"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(433597..433599,433606..433608,
                     433777..433782))
                     /locus_tag="KPHS_03980"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238306"
     misc_feature    complement(433483..433485)
                     /locus_tag="KPHS_03980"
                     /note="distal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238306"
     gene            complement(433877..434611)
                     /locus_tag="KPHS_03990"
                     /db_xref="GeneID:11845386"
     CDS             complement(433877..434611)
                     /locus_tag="KPHS_03990"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase iron-sulfur subunit"
                     /protein_id="YP_005224699.1"
                     /db_xref="GeneID:11845386"
                     /translation="MAEMKNLKVEVVRYNPEVDTAPHSAFYDVPYDEQTSLLDALGFI
                     KDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLRDYTKGIKVEALANFPIERD
                     LVVDMTHFIESLEAIKPYIIGNNRTPDQGPNKQTPAQMAKYHQFSGCINCGLCYAACP
                     QFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNGQNGVWTCTFVGYCSEVCPKH
                     VDPAAAIQQGKVESSKDFLIATLKPR"
     misc_feature    complement(433880..434611)
                     /locus_tag="KPHS_03990"
                     /note="fumarate reductase iron-sulfur subunit;
                     Provisional; Region: PRK12385"
                     /db_xref="CDD:183490"
     gene            complement(434604..436394)
                     /locus_tag="KPHS_04000"
                     /db_xref="GeneID:11845387"
     CDS             complement(434604..436394)
                     /locus_tag="KPHS_04000"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="YP_005224700.1"
                     /db_xref="GeneID:11845387"
                     /translation="MQTFQADLAVIGAGGAGLRAAIAAAQANPNAKIALISKVYPMRS
                     HTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLEQWGC
                     PWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLD
                     LLVDDGQARGLVAMNMMEGTLVQIRANAVVLATGGAGRVYRYNTNGGIVTGDGMGMAL
                     GHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLG
                     EPKNKYMELGPRDKVSQAFWHEWRKGNTIPTPRGDVVYLDLRHLGEKKLLERLPFICE
                     LAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQQCETRIKGLFAVGECSSVGLHGANRL
                     GSNSLAELVVFGRLAGEQAMQRAAQAGEANGAALDAQAADVEHRLKDLVKQEGNENWA
                     KIRDEMGLSMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDNSSVFNTDLLYTIE
                     LGHGLNVAECMAHSAIARKESRGAHQRLDEGCTERDDVNFLKHTLAFREADGTTRLEY
                     GDVKITTLPPAKRVYGAEADAAEKKETTHG"
     misc_feature    complement(434646..436391)
                     /locus_tag="KPHS_04000"
                     /note="fumarate reductase flavoprotein subunit; Validated;
                     Region: PRK09231"
                     /db_xref="CDD:236421"
     gene            436670..437647
                     /locus_tag="KPHS_04010"
                     /db_xref="GeneID:11845388"
     CDS             436670..437647
                     /locus_tag="KPHS_04010"
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="YP_005224701.1"
                     /db_xref="GeneID:11845388"
                     /translation="MSETATWQPSAPIPNLLKRAAVMAEIRRFFTDRGVLEVETPCMS
                     QATVTDIHLFPFETRFVGPGHSQGLNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNE
                     EMGRHHNPEFTMLEWYRPCYDMYRLINEVDDLLQQVLECQPAESLSYQQAFQRHLEID
                     PLSADKAQLREVAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKDRPTFIYHFPAT
                     QASLAQISPEDHRVAERFEVYYKGIELANGFHELTDAHEQRLRFEQDNRKRAARGLPQ
                     QPIDNNLLAALEAGLPDCSGVALGVDRVVMLALGAESIGEVIAFTVDRA"
     misc_feature    436703..437620
                     /locus_tag="KPHS_04010"
                     /note="poxB regulator PoxA; Provisional; Region: PRK09350"
                     /db_xref="CDD:236474"
     gene            437830..439332
                     /locus_tag="KPHS_04020"
                     /db_xref="GeneID:11845389"
     CDS             437830..439332
                     /locus_tag="KPHS_04020"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane transporter YjeM"
                     /protein_id="YP_005224702.1"
                     /db_xref="GeneID:11845389"
                     /translation="MHQQLKKMSLIGLILMIFTSVFGFANSPSAFYLMGYSAMPFYLF
                     SALFFFIPFALMMAEMGSAYRREEGGIYSWMNHSVGPRFAFIGTFMWFASYVVWMVST
                     AAKIWVPLSTFLFGADKTQTWALGSLTPTQTVGILAACWMVVVTFIAVKGINKIAKIT
                     AVGGIAVMGLNLVLLLVSGAILLLNGGHFAQPLNFTLSPNPGYQSGMAMLSFVVFAIF
                     AYGGIEAVGGLVDKTDKPEKNFAKGIIIAAIVISIGYSLAIVLWGVSANWQQVLGARS
                     TNLGNITYVLMTSLGATLGQALHLTPAASALTGVWFARITGLSMFLAYTGAFFTLSYS
                     PLKAIIQGTPKALWPSVMTRLNVNGMPAAAMWLQCLLVGVFIVLVSFGGDSASAFYNK
                     LTLMTNVSMTLPYLFLTIAFPFFKAKTHLDRPFVIFKNRPSTLLATGVVLLVVTFANI
                     FTIIQPVIDSGDWNSTLWMVGGPIFFSLLALGIYESYRRRMASGALVMES"
     misc_feature    437830..439305
                     /locus_tag="KPHS_04020"
                     /note="inner membrane transporter YjeM; Provisional;
                     Region: PRK15238"
                     /db_xref="CDD:237929"
     gene            complement(439370..442699)
                     /locus_tag="KPHS_04030"
                     /db_xref="GeneID:11845390"
     CDS             complement(439370..442699)
                     /locus_tag="KPHS_04030"
                     /codon_start=1
                     /transl_table=11
                     /product="putative periplasmic binding protein"
                     /protein_id="YP_005224703.1"
                     /db_xref="GeneID:11845390"
                     /translation="MRLIYTFLLALSLSFGAYAATAPDAKQITQELEQAKAAKPAQPE
                     TVEVLQSALNALEERKSSLERARQYQDVIDNFPKLFQSLRAQLNNLSEEPRQVPTGLT
                     ADALNQEILQVSSQLLESSRQAQQEQDRAREIADSLNQLPQQQTDARRQLNEVERRIG
                     TQTGNNALAQAQNLALQAESARLKALVDELDLAQLSANNRQELSRARSELAQKQSEQL
                     DAYLQALRNLQNSQRQREAEKALESTELLAENSENLPPDITAQFKVNRELSQALNQQA
                     QRMDLVASQQRQATNQTLQVRQALNTLREQSQWLGSSNLLGEALRAQVARLPERPRPQ
                     QLDTEMAQLRVQRLRFEDLLSKQPQLRQIRQADGEPLTSEQNKILQAQLRTQNELLNS
                     LLRGGDTLMLELTKLKVANGQLEDALKEINEATHRYLFWTSDVSPIGFSWPLEIVQDL
                     RRLISLDTISELGKASAMMLTSKETLLPLFAALLLVGFSISSRRHFTRFLERSSARVG
                     KVTQDHFWLTLRTVFWSILVASPLPVLWMTLGYGLQSAWPFPLAVAIGDGVTATVPLL
                     WVVMICATFARPNGLFIAHFGWPRSRVAKAMRYYLMSIGLIVPLIMALIMFDNLNDRE
                     FSASLGRLCFLLICGALAVVTLSLKHAGIPLYLDKEGNGDNMVNRLLWNLMLGAPLVA
                     MLAAAVGYLATAQALLARLETSVAIWFLLLVVYHIIRRWMLIQRRRLAFDRARHRRAE
                     ILAQRARGEDEPVHVSSPEGSVETEVSEVDLDAISTQSLRLVRSLLMLIALLSVIVLW
                     SEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILVLIITTQLVRNLPALLE
                     LAILQHLDLTPGTGYAITTITKYLLMLVGGLVGFSMIGIEWSKLQWLVAALGVGLGFG
                     LQEIFANFISGLIILFEKPIRIGDTVTIRDLTGSVTRINTRATTISDWDRKEIIVPNK
                     AFITEQFINWSLSDSVTRVVLTVPAPVDADTEEVTKILIAAAHRCSLVIDTPAPEAFL
                     VDLQQGIQIFELRIFAAEMGHRMPLRHEMHQLILAGFREHGIDMPFPPFQMRLESIDG
                     RQSSKTMTSAGKTSRRTAGSL"
     misc_feature    complement(439373..442699)
                     /locus_tag="KPHS_04030"
                     /note="putative mechanosensitive channel protein;
                     Provisional; Region: PRK10929"
                     /db_xref="CDD:236798"
     gene            complement(442723..443685)
                     /locus_tag="KPHS_04040"
                     /db_xref="GeneID:11845391"
     CDS             complement(442723..443685)
                     /locus_tag="KPHS_04040"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="YP_005224704.1"
                     /db_xref="GeneID:11845391"
                     /translation="MLNDLKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKY
                     YKVDMKEAQKPDTAAYRTFNDFFVRPLRDDVRPLNTDPNVLVMPADGVISQLGAIEND
                     KILQAKGHDYSLEALLAGNYQMADLFRNGSFATTYLSPRDYHRVHMPCNGILREMIYV
                     PGDLFSVNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWSGTVT
                     PPREGIIKRWTWPAGDNEGSIALLKGQEMGRFKLGSTVINLFAPGQVKLVDTLQSLSV
                     TKIGQPLATAVEATAAAEPAPLPEEEIRAEHRASPLVDDKQDQG"
     misc_feature    complement(442840..443685)
                     /locus_tag="KPHS_04040"
                     /note="phosphatidylserine decarboxylase; Reviewed; Region:
                     psd; PRK00044"
                     /db_xref="CDD:234591"
     gene            complement(443846..444907)
                     /locus_tag="KPHS_04050"
                     /db_xref="GeneID:11845392"
     CDS             complement(443846..444907)
                     /locus_tag="KPHS_04050"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated GTPase"
                     /protein_id="YP_005224705.1"
                     /db_xref="GeneID:11845392"
                     /translation="MSKNKLSKGQQRRVKANHQRRLKTTAEKADYDDNLFGETSEGIV
                     ISRFGMHADVESADGSVHRCNIRRTIRSLVTGDRVVWRPGKDAADGVSVKGIVEAVHD
                     RASVLTRPDFYDGVKPIAANIDQIVVVSAILPELSLNIIDRYLVACEAQDIEPLIVLN
                     KIDLLDDDGLRFVNEQMDIYRNIGYRVLLVSSRTQDGLKPLEAALTDRISIFAGQSGV
                     GKSSLLNALLGLSEDQILTNDVSDVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGL
                     WHLEAEQITNGFVEFHDYLGRCKYRDCKHDTDPGCALREAVENGKIAESRFENYHRIL
                     ESMAQVQVKTRKNFSSSDD"
     misc_feature    complement(443849..444907)
                     /locus_tag="KPHS_04050"
                     /note="GTPase RsgA; Reviewed; Region: PRK12288"
                     /db_xref="CDD:237039"
     gene            445002..445547
                     /locus_tag="KPHS_04060"
                     /db_xref="GeneID:11845393"
     CDS             445002..445547
                     /locus_tag="KPHS_04060"
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="YP_005224706.1"
                     /db_xref="GeneID:11845393"
                     /translation="MSANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGP
                     TIAVHQSDAQLALMDEWNVRTHTGSGLVDRVKASTVSEHDAELATIEFLKQWVPAGKS
                     PICGNSIGQDRRFLFKYMPQLEAYFHYRYLDVSTLKELARRWKPEILDGFKKQGTHQA
                     MDDIRESVAELAYYREHFIKL"
     misc_feature    445011..445544
                     /locus_tag="KPHS_04060"
                     /note="oligoribonuclease; Provisional; Region: PRK05359"
                     /db_xref="CDD:235429"
     misc_feature    order(445035..445046,445050..445052,445320..445325,
                     445329..445337,445473..445475,445488..445490)
                     /locus_tag="KPHS_04060"
                     /note="putative active site [active]"
                     /db_xref="CDD:99838"
     misc_feature    order(445035..445046,445050..445052,445320..445325,
                     445329..445334,445473..445475,445488..445490)
                     /locus_tag="KPHS_04060"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:99838"
     misc_feature    order(445035..445037,445041..445043,445335..445337,
                     445473..445475,445488..445490)
                     /locus_tag="KPHS_04060"
                     /note="catalytic site [active]"
                     /db_xref="CDD:99838"
     misc_feature    order(445104..445106,445329..445334,445341..445343,
                     445350..445352,445389..445394,445398..445400,
                     445407..445409,445416..445418,445431..445436,
                     445527..445529,445533..445538)
                     /locus_tag="KPHS_04060"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99838"
     gene            complement(445591..446322)
                     /locus_tag="KPHS_04070"
                     /db_xref="GeneID:11845394"
     CDS             complement(445591..446322)
                     /locus_tag="KPHS_04070"
                     /codon_start=1
                     /transl_table=11
                     /product="putative arginine-binding periplasmic protein"
                     /protein_id="YP_005224707.1"
                     /db_xref="GeneID:11845394"
                     /translation="MRKVLTVLLLSTLAIGTASAETLHFGTTTANPPFVTANGKNQPV
                     GFDIDLAHALCQQMQAQCQFTAQRFDTLIPALRFKKFDAVIAGIEVIPMREKQVAFSR
                     PYRQALSGVVIVNKDVAHTFADLKAKKVGVVKGTLHQRYLRDKQKAVQAVPYDDVASA
                     LAALKAGQITGVMGDFATLDAWQQENPDYAIMDERATDPAYYGKQYAIAVRKDDPELL
                     NAINDALAAVMATPDFQQMQQKWFK"
     misc_feature    complement(445597..446265)
                     /locus_tag="KPHS_04070"
                     /note="Type 2 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_2; cl21456"
                     /db_xref="CDD:354813"
     gene            446347..446547
                     /locus_tag="KPHS_04080"
                     /db_xref="GeneID:11845395"
     CDS             446347..446547
                     /locus_tag="KPHS_04080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224708.1"
                     /db_xref="GeneID:11845395"
                     /translation="MASLYVAPPLYDASDFASFSRAEKAILPVMTLIYTIQRRRWREN
                     VHLNKKRKKVIVRGLQGHRILV"
     gene            complement(447255..448394)
                     /locus_tag="KPHS_04090"
                     /db_xref="GeneID:11845396"
     CDS             complement(447255..448394)
                     /locus_tag="KPHS_04090"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-like protein"
                     /protein_id="YP_005224709.1"
                     /db_xref="GeneID:11845396"
                     /translation="MSQPLDLVQLAQQIKQWGTELGFQQVGIADTDLSASEPKLQAWL
                     DKQYHGEMEWMARHGMMRARPHELLPGTLRVISVRMNYLPANAAFARTLKDPTLGYVS
                     RYALGRDYHKLLRNRLKKLGEKIQEQCASLNFRPFVDSAPILERPIAEKAGLGWTGKH
                     SLILSRDAGSFFFLGELLIDLPLPVDSPVAEECGRCVACMTICPTGAIVEPYTVDARR
                     CISYLTIELEGAIPEEFRPLIGNRIYGCDDCQLICPWNRFSQLTDEEDFSPRKALHAP
                     LLVELFAWSEAWFLKVTEGSAIRRIGHLRWLRNIAVALGNAPWDEAHLRALESRRGEH
                     PLLDEHIEWAIAQQLKKRNADAVEVQLPKKLRLVRVVEKGLPRDA"
     misc_feature    complement(447351..448355)
                     /locus_tag="KPHS_04090"
                     /note="epoxyqueuosine reductase; Region: TIGR00276"
                     /db_xref="CDD:272993"
     gene            448408..449919
                     /locus_tag="KPHS_04100"
                     /db_xref="GeneID:11845397"
     CDS             448408..449919
                     /locus_tag="KPHS_04100"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional ADP-dependent NAD(P)H-hydrate
                     dehydratase/NAD(P)H-hydrate epimerase"
                     /protein_id="YP_005224710.1"
                     /db_xref="GeneID:11845397"
                     /translation="MTKNPDSIPYNIWPAEALRLAEREAADSLGLTLFELMQRAGEAA
                     FQLASCAYPASAHWLILCGHGNNGGDGYVVARLAQAAGRRVTLLAVESDSPLPEEAQA
                     AREAWLNAGGVIHAATIPWPDDISLIIDGLLGTGLRSAPRDPVAALIHQANHHPAPVV
                     ALDIPSGLNAQTGATPGAVVQADHTLTFIALKPGLLTGKARDVVGQLHHHALGLERWL
                     AGQSTPLTRFCAAHLADWLPPRRATSHKGDHGKLVIVGGDRGTAGAIRMCGEAALRSG
                     AGLVRVLTHPENVAPIVTVRPELMVDELTPQTLKAALEWADVVAIGPGLGQREWGRSA
                     LRTVESFNKPMVWDADALNLLAFNPDKRHNRVLTPHPGEAARLLNVSVAEIESDRLLS
                     AQRLVKRYGGVVVLKGAGTVVASESGAMGIIDAGNAGMASGGMGDVLTGIIAALLGQH
                     LTPYDAACAGCVAHGDAADRLAAREGTRGMLATDLFSTLRRVVNPDVIDVDHD"
     misc_feature    448408..449916
                     /locus_tag="KPHS_04100"
                     /note="putative carbohydrate kinase; Provisional; Region:
                     PRK10565"
                     /db_xref="CDD:182554"
     gene            449924..450373
                     /locus_tag="KPHS_04110"
                     /db_xref="GeneID:11845398"
     CDS             449924..450373
                     /locus_tag="KPHS_04110"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATPase"
                     /protein_id="YP_005224711.1"
                     /db_xref="GeneID:11845398"
                     /translation="MIPLPDEQATLALGDRIAQACTGATVIYLYGDLGAGKTTFSRGF
                     LQALGHRGNVKSPTYTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFADDAICL
                     VEWPQQGAGVLPDPDVEIHLDYQAQGREARITAISSRGESLLARLAF"
     misc_feature    449927..450367
                     /locus_tag="KPHS_04110"
                     /note="ADP-binding protein; Provisional; Region: PRK10646"
                     /db_xref="CDD:182615"
     gene            450390..451745
                     /locus_tag="KPHS_04120"
                     /db_xref="GeneID:11845399"
     CDS             450390..451745
                     /locus_tag="KPHS_04120"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-l-alanine amidase II"
                     /protein_id="YP_005224712.1"
                     /db_xref="GeneID:11845399"
                     /translation="MKYRITTWLAAALMLSSLHATAASLSDIQVSNGDQQARITLSFV
                     GEPEYSFTPQGKRLVALDIKQTGVLQGLPLQFSGSNLVKSIRAGTPQDTQTLRLLVDL
                     TEDGKTRAVKQQNGANYTVVFTINADAPPPPPPPPVVVKRADPPPVMPSRTTTSGRNP
                     FSSSGHERQTVMTSSQPAMTNNQTVTRPAARTVSADDKVIIAIDAGHGGQDPGAIGPN
                     GTKEKNVTIAIARKLRALLNADPQFKPVLTRDGDYFISVMGRSDVARKQNANFLVSIH
                     ADAAPNRDATGASVWVLSNRRANSEMAGWLEQHEKQSELLGGAGDVLANSQADPYLSQ
                     AVLDLQFGHSQRVGYDVATNVLSQLQRIGNLHKRRPEHASLGVLRSPDIPSILVETGF
                     ISNNGEERLLGSDDYQEQIAEAIYNGLRNYFMQHPLQSAPRGEAAQTASAAAPGGMLI
                     N"
     misc_feature    450390..451733
                     /locus_tag="KPHS_04120"
                     /note="N-acetylmuramoyl-l-alanine amidase II; Provisional;
                     Region: PRK10431"
                     /db_xref="CDD:236692"
     misc_feature    451756..453614
                     /note="potential frameshift: common BLAST hit:
                     gi|288937531|ref|YP_003441590.1| DNA mismatch repair
                     protein MutL"
     gene            451756..452079
                     /locus_tag="KPHS_04130"
                     /db_xref="GeneID:11845400"
     CDS             451756..452079
                     /locus_tag="KPHS_04130"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="YP_005224713.1"
                     /db_xref="GeneID:11845400"
                     /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDI
                     DIERGGAKLIRIRDNGSGIKKASWRWPWLVMRPARSPRLTIWRPLSASAFAAKRWPVS
                     VRWRA"
     misc_feature    451822..>452007
                     /locus_tag="KPHS_04130"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cl00075"
                     /db_xref="CDD:294057"
     misc_feature    451852..451854
                     /locus_tag="KPHS_04130"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     gene            452067..453614
                     /locus_tag="KPHS_04140"
                     /db_xref="GeneID:11845401"
     CDS             452067..453614
                     /locus_tag="KPHS_04140"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein"
                     /protein_id="YP_005224714.1"
                     /db_xref="GeneID:11845401"
                     /translation="MARLTLTSRTAEQQEAWQAYAEGRDQAVTVKPAAHPVGTTLEVL
                     DLFYNTPARRKFMRTEKTEFGHIDEVVRRIALARFDVTINLSHNGKVMRQYRAVAQDG
                     QRERRLGTICGAAFLEHALAIEWQHGDLTLRGWVADPLHTTPALAEIQYCYVNGRMMR
                     DRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFI
                     YQGVLSVLQQQLDAPLAEKDDPPAPRPMPENRIAAGGNQFARPAEAREPATRFSITPS
                     REPAASSGKPGGASWPHAQPGYQKQQGALYRQLLDTPTAPKPALQPPAAAELAGHSQS
                     FGRVLTIVGGDCALLEREGGLALLSLTVAERWLRQAQLTPGAEAVCAQPLLIPLRLKV
                     TEGEKQALAAAQPALAQLGIDVHTDALHVTVRAVPLPLRQQNLQILIPELIGYLAQQN
                     AFDVGNIAQWMARNLTSEQTSWNMAQAIALLADVERLCPQLVRTPPGGLLQPVDLHSA
                     MNALKDE"
     misc_feature    452067..453605
                     /locus_tag="KPHS_04140"
                     /note="DNA mismatch repair protein; Reviewed; Region:
                     mutL; PRK00095"
                     /db_xref="CDD:234630"
     misc_feature    452376..452747
                     /locus_tag="KPHS_04140"
                     /note="MutL_Trans_MutL: transducer domain, having a
                     ribosomal S5 domain 2-like fold, found in proteins similar
                     to Escherichia coli MutL. EcMutL belongs to the DNA
                     mismatch repair (MutL/MLH1/PMS2) family. This transducer
                     domain is homologous to the second...; Region:
                     MutL_Trans_MutL; cd03482"
                     /db_xref="CDD:239564"
     misc_feature    452673..452675
                     /locus_tag="KPHS_04140"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:239564"
     misc_feature    453081..453452
                     /locus_tag="KPHS_04140"
                     /note="MutL C terminal dimerization domain; Region:
                     MutL_C; pfam08676"
                     /db_xref="CDD:285839"
     gene            453652..454557
                     /locus_tag="KPHS_04150"
                     /db_xref="GeneID:11845402"
     CDS             453652..454557
                     /locus_tag="KPHS_04150"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="YP_005224715.1"
                     /db_xref="GeneID:11845402"
                     /translation="MGPTASGKTALAIALRKVLPVELISVDSALIYRGMDIGTAKPDA
                     AELSAAPHRLLDILDPAEAYSAADFRRDALAAMADIVAAGRIPLLVGGTMLYFKALLE
                     GLSPLPSADPEVRARIEQQAAEQGWNALHQQLQEIDPVAAARIHPNDPQRLSRALEVF
                     FISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRAL
                     FARGDLHTDMPSIRCVGYRQMWSYLNGEIPYDEMVYRGVCATRQLAKRQVTWLRGWEG
                     VHWLDSEQPEQALNKVLQVVGASQN"
     misc_feature    453652..454545
                     /locus_tag="KPHS_04150"
                     /note="tRNA delta(2)-isopentenylpyrophosphate transferase;
                     Reviewed; Region: miaA; PRK00091"
                     /db_xref="CDD:234626"
     gene            454650..454958
                     /locus_tag="KPHS_04160"
                     /db_xref="GeneID:11845403"
     CDS             454650..454958
                     /locus_tag="KPHS_04160"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein Hfq"
                     /protein_id="YP_005224716.1"
                     /db_xref="GeneID:11845403"
                     /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVI
                     LLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGSSNYHHGGSAQGSSAPQQDSDDAE
                     "
     misc_feature    454650..454877
                     /locus_tag="KPHS_04160"
                     /note="RNA-binding protein Hfq; Provisional; Region: hfq;
                     PRK00395"
                     /db_xref="CDD:179001"
     misc_feature    order(454665..454673,454680..454682,454725..454739,
                     454761..454769,454773..454778,454797..454841)
                     /locus_tag="KPHS_04160"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212463"
     misc_feature    order(454713..454733,454737..454790)
                     /locus_tag="KPHS_04160"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212463"
     misc_feature    order(454722..454724,454734..454748,454785..454787,
                     454803..454805,454827..454832,454836..454838)
                     /locus_tag="KPHS_04160"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:212463"
     misc_feature    454800..454835
                     /locus_tag="KPHS_04160"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212463"
     gene            455034..456314
                     /locus_tag="KPHS_04170"
                     /db_xref="GeneID:11845404"
     CDS             455034..456314
                     /locus_tag="KPHS_04170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GTPase HflX"
                     /protein_id="YP_005224717.1"
                     /db_xref="GeneID:11845404"
                     /translation="MFDRYDAGEQAVLVHIYFSQDKDMEDLQEFETLASSAGVEAMQV
                     ITGSRKAPHPKYFVGEGKAVEIAEAVKATGASVVLFDHALSPAQERNMERLCECRVID
                     RTGLILDIFAQRARTHEGKLQVELAQLRHMATRLVRGWTHLERQKGGIGLRGPGETQL
                     ETDRRLLRNRIMQILSRLEKVEKQREQGRRSRAKADIPTVSLVGYTNAGKSTLFNQIT
                     AAEVYAANQLFATLDPTLRRIDVPDVGETVLADTVGFIRHLPHDLVAAFKATLQETRQ
                     ATLLLHVIDAADVRVQENIDAVNTVLAEIEADEIPALLVMNKIDMLDDFEPRIDRDDE
                     NKPIRVWLSAQTGVGVPLLFQALTERLSGEVAQHTLRLPPKEGRLRSRFYQLQAIEKE
                     WMEDDGSVSLQVRMPIVDWRRLCKQEPTLVDYVV"
     misc_feature    455034..456311
                     /locus_tag="KPHS_04170"
                     /note="GTPase HflX; Provisional; Region: PRK11058"
                     /db_xref="CDD:182934"
     gene            456380..457642
                     /locus_tag="KPHS_04180"
                     /db_xref="GeneID:11845405"
     CDS             456380..457642
                     /locus_tag="KPHS_04180"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsH protease regulator HflK"
                     /protein_id="YP_005224718.1"
                     /db_xref="GeneID:11845405"
                     /translation="MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGREQGPPDLDDI
                     FRKLSKKLGGLGGGKGGVGGGNSAQGPRGPMGGRIVGIVAAAAVIIWAASGFYTIKEA
                     ERGVVTRFGKFSHLVEPGLNWKPTFIDNVQAVNVESVRELAASGVMLTSDENVVRVEM
                     NVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRE
                     LEETIRPYNMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQP
                     RANGQAQRILEEARAYKTQTVLEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVL
                     SHTRKVLVNDSKNGNLMVLPLDQMLKGAAAPAAKSDSSDASDLLRLPPASSSSSASTS
                     STSSSTGGSIMDQRRANAQRNDYQRQGE"
     misc_feature    456380..457639
                     /locus_tag="KPHS_04180"
                     /note="FtsH protease regulator HflK; Provisional; Region:
                     PRK10930"
                     /db_xref="CDD:236799"
     gene            457645..458649
                     /locus_tag="KPHS_04190"
                     /db_xref="GeneID:11845406"
     CDS             457645..458649
                     /locus_tag="KPHS_04190"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsH protease regulator HflC"
                     /protein_id="YP_005224719.1"
                     /db_xref="GeneID:11845406"
                     /translation="MRKSVIAIIVIVLVVLYMSVFVVKEGERGITLRFGKVLRDDENK
                     PLVYAPGLHFKIPFIESVKMLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSR
                     YYLATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTLEVRDALNSGSA
                     GTEDEVSTPAADDAIAKAAERVEAETNGKVQVINPNSMAALGIEVVDVRIKQINLPAE
                     VSEAIYNRMRAEREAVARRHRSQGQEEAEKLRATADYEVTKTLAEAERQGRILRGEGD
                     AESAKLFADAFSQDPGFYSFIRSLRAYEKSFQSNQDVMVLSPDSDFFRYMRSPDSARK
                     "
     misc_feature    457645..458646
                     /locus_tag="KPHS_04190"
                     /note="FtsH protease regulator HflC; Provisional; Region:
                     PRK11029"
                     /db_xref="CDD:182913"
     gene            complement(458732..459022)
                     /locus_tag="KPHS_04200"
                     /db_xref="GeneID:11845407"
     CDS             complement(458732..459022)
                     /locus_tag="KPHS_04200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224720.1"
                     /db_xref="GeneID:11845407"
                     /translation="MRELTAFEIENVSGAGWLQDGLAALGSKVGAAAWTMGTDALSIN
                     LPLLGTLNLADLAPDLGKTLGESVGSTIGGTIESALAGLPVIGGLLNKLLGN"
     gene            complement(459000..459140)
                     /locus_tag="KPHS_04220"
                     /db_xref="GeneID:11845408"
     CDS             complement(459000..459140)
                     /locus_tag="KPHS_04220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224721.1"
                     /db_xref="GeneID:11845408"
                     /translation="MNRKGETKFTTNCIAGYFLNCNYAIAYYNPVRLLNQEDYDERIN
                     RI"
     gene            459245..459442
                     /locus_tag="KPHS_04210"
                     /db_xref="GeneID:11845409"
     CDS             459245..459442
                     /locus_tag="KPHS_04210"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2065 domain-containing protein"
                     /protein_id="YP_005224722.1"
                     /db_xref="GeneID:11845409"
                     /translation="MNSTIWLALALVLVLEGLGPLLYPRAWRKMVASLSQLPDNLLRR
                     FGGGLVVAGIVIYYMLRKSIG"
     misc_feature    459245..459430
                     /locus_tag="KPHS_04210"
                     /note="Uncharacterized conserved protein YjeT, DUF2065
                     family [Function unknown]; Region: yjeT; COG3242"
                     /db_xref="CDD:225782"
     gene            459545..460843
                     /locus_tag="KPHS_04230"
                     /db_xref="GeneID:11845410"
     CDS             459545..460843
                     /locus_tag="KPHS_04230"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="YP_005224723.1"
                     /db_xref="GeneID:11845410"
                     /translation="MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTL
                     VINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVRERLLLSE
                     ACPLILDYHVALDVAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAD
                     KLKEVMEYHNFQLVNFYKAEAVDYQKVLDDVMAIADILTSMVVDVSDLLDQARQRGDF
                     VMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGA
                     GPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLD
                     VLDGLKEVKICVGYRMPDGREVTTTPLAADNWEGIEPIYETMPGWSETTFGVKERSGL
                     PQAALNYIQRIEELTGVPVDIISTGPDRTETMILRDPFDA"
     misc_feature    459548..460840
                     /locus_tag="KPHS_04230"
                     /note="adenylosuccinate synthetase; Provisional; Region:
                     PRK01117"
                     /db_xref="CDD:234904"
     misc_feature    order(459578..459601,459659..459673,459926..459934,
                     460214..460219,460229..460231,460259..460264,
                     460364..460369,460439..460450,460454..460456,
                     460460..460462,460538..460540,460544..460549,
                     460787..460798)
                     /locus_tag="KPHS_04230"
                     /note="active site"
                     /db_xref="CDD:349762"
     misc_feature    order(459755..459757,459851..459853,459857..459859,
                     459896..459898,459923..459925,459947..459949,
                     459956..459982,459986..459988,460160..460165,
                     460172..460174,460235..460246,460250..460255,
                     460259..460261,460265..460267,460283..460288,
                     460292..460297,460304..460309,460496..460498,
                     460505..460516)
                     /locus_tag="KPHS_04230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:349762"
     gene            460994..461419
                     /locus_tag="KPHS_04240"
                     /db_xref="GeneID:11845411"
     CDS             460994..461419
                     /locus_tag="KPHS_04240"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor NsrR"
                     /protein_id="YP_005224724.1"
                     /db_xref="GeneID:11845411"
                     /translation="MQLTSFTDYGLRALIYMASLPEGRMTSISEVTEVYGVSRNHMVK
                     IINQLSRMGYVTAVRGKNGGIRLGKPAGQIRVGDVVRDLEPLSLVNCSSEFCHITPAC
                     RLKQALAEAAQSFLKELDNYTLADLVEKNQPLYKLLLVE"
     misc_feature    460994..461416
                     /locus_tag="KPHS_04240"
                     /note="transcriptional repressor NsrR; Provisional;
                     Region: PRK11014"
                     /db_xref="CDD:236820"
     gene            461456..463888
                     /locus_tag="KPHS_04250"
                     /db_xref="GeneID:11845412"
     CDS             461456..463888
                     /locus_tag="KPHS_04250"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="YP_005224725.1"
                     /db_xref="GeneID:11845412"
                     /translation="MSQDPFQEREAEKYANPIPSREFILEHLTKREKPASRDELAIEL
                     NIEGEEQTEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRVE
                     GRKDDLYLSSEQMKTCIHVDQVLAQPLGADRKGRREARIVRVLVPKTSQIVGRYFTDA
                     GVGFVVPDDSRLSFDILIPPEEIMGARMGYVVVVELTQRPTRRTKAVGKIVEVLGDNM
                     GTGMAVDMALRTHEIPYVWPPAVEKQVSGLKEQVPEEAKAGRVDLRSLPLVTIDGEDA
                     RDFDDAVYCEKKRGGGWRLWVAIADVSYYVRPGTPLDAEARSRGTSVYFPSQVVPMLP
                     EVLSNGLCSLNPQVDRLCMVCEMTISSKGRLTGYKFYEAVMSSHARLTYTKVWHMLQG
                     DQELREHYAPLVKHIEELHNLYKVLESAREERGGISFESEEAKFIFNAERRIERIEQT
                     QRNDAHKLIEECMILANISAARFVEKAQEPALFRIHDKPTTEAITSFRTVLAELGLEL
                     PGGNKPEPRDYAELLTSIADRPDAEMLQTMLLRSMKQAVYDPENRGHFGLALQSYAHF
                     TSPIRRYPDLSLHRAIKYLLAKEQGHKGNSTETGGWHYSMEEMLQLGQHCSMTERRAD
                     EATREVSDWLKCDFMQDQVGNIFSGVIASVTGFGFFVRLNDLFIDGLVHVSSLDNDYY
                     RFDQVGQRLIGESGGQTYRLGDRVEVRVEAVNMDERKIDFTLISSERAPRNVGKTARE
                     KAKKSTSGKPGGRRRQVGKQVNFEPDSAFRKEKETARPKKEKKAKKPSAKTQKIAAAT
                     KAKRAAKKKIAE"
     misc_feature    461456..463777
                     /locus_tag="KPHS_04250"
                     /note="exoribonuclease R; Provisional; Region: PRK11642"
                     /db_xref="CDD:236944"
     gene            463979..464701
                     /locus_tag="KPHS_04260"
                     /db_xref="GeneID:11845413"
     CDS             463979..464701
                     /locus_tag="KPHS_04260"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
                     /protein_id="YP_005224726.1"
                     /db_xref="GeneID:11845413"
                     /translation="MIYGIHAVQALLERAPERFQEVYILKGREDKRLLPLIHALEAQG
                     VVIQLANRQFLDEKSEGAVHQGIIARVKPGRQYQENDLPDLLAQLDQPFLLILDGVTD
                     PHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRL
                     LQEENVWIVGTAGEADHTLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGS
                     VSSLNVSVATGICLFEAVRQRS"
     misc_feature    463979..464698
                     /locus_tag="KPHS_04260"
                     /note="23S rRNA (guanosine-2'-O-)-methyltransferase;
                     Provisional; Region: PRK11181"
                     /db_xref="CDD:183021"
     gene            464827..466464
                     /locus_tag="KPHS_04270"
                     /db_xref="GeneID:11845414"
     CDS             464827..466464
                     /locus_tag="KPHS_04270"
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl CoA dehydrogenase"
                     /protein_id="YP_005224727.1"
                     /db_xref="GeneID:11845414"
                     /translation="MHWQTHTVFNQPTPLNNSNLFLSDTALREAVVREGAGWDGDLLA
                     SIGQQLGTAESLELGRLANSNPPELLRYDATGARLDDVRFHPAWHLLMQGLCANRVHN
                     LAWQEDAREGAFVARAARFLLHAQVEAGTLCPITMTFAATPLLQHALPAPFRDWLSPL
                     LSDRYDPHLAPGGQKRGLLIGMGMTEKQGGSDVLSNTTRAEKTAEGFYRLVGHKWFFS
                     VPQSDAHLVLAQAPAGLSCFFVPRLLPDGQRNSVRLERLKEKLGNRSNASSEVEFYEA
                     CGWLVGDEGDGVRQILRMGGLTRFDCALGSHALMRRAFSVALYHALQRQAFGKNLVEQ
                     PMMRQLLGQMALRLEGQTAFLFRLARAWDRRDDARESAWARLFTPAAKFAICKAGIPF
                     VAEAMEVLGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVMRVLSKQPAAMELLA
                     AECAEVKGQNRHLDRAWRQLQQLLKRPAEEQGREIARLVYRLGAGAQMLRHASPPLAE
                     AWCRMMLDTRGGIRLDAPTLDDLLLRAMGRGRQAPQA"
     misc_feature    464827..466440
                     /locus_tag="KPHS_04270"
                     /note="isovaleryl CoA dehydrogenase; Provisional; Region:
                     PRK11561"
                     /db_xref="CDD:183199"
     gene            complement(466455..466730)
                     /locus_tag="KPHS_04280"
                     /db_xref="GeneID:11845415"
     CDS             complement(466455..466730)
                     /locus_tag="KPHS_04280"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="YP_005224728.1"
                     /db_xref="GeneID:11845415"
                     /translation="MKRSFTLSSLLLTAATANTSAQSAEFASADCVTGLNEIGLISVT
                     NLSGSQQDVEHAIARKADEQGASWYRIIQMYEEQQPDSWRVQAILYA"
     misc_feature    complement(466461..466622)
                     /locus_tag="KPHS_04280"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:336677"
     gene            complement(466868..467176)
                     /locus_tag="KPHS_04290"
                     /db_xref="GeneID:11845416"
     CDS             complement(466868..467176)
                     /locus_tag="KPHS_04290"
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm peroxide resistance protein BsmA"
                     /protein_id="YP_005224729.1"
                     /db_xref="GeneID:11845416"
                     /translation="MVMRRFSPWLLAIVLSGCSALQGTPEAPPPATDHPQEIQRYQTA
                     GLQKMATVSVLMYGSPMDVEAALKAKAEAAKADYYVIIMIDDTMVPGQWYSQAILYRR
                     "
     misc_feature    complement(466871..467176)
                     /locus_tag="KPHS_04290"
                     /note="putative biofilm stress and motility protein A;
                     Provisional; Region: PRK14864"
                     /db_xref="CDD:184866"
     gene            467386..468102
                     /locus_tag="KPHS_04300"
                     /db_xref="GeneID:11845417"
     CDS             467386..468102
                     /locus_tag="KPHS_04300"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrolase"
                     /protein_id="YP_005224730.1"
                     /db_xref="GeneID:11845417"
                     /translation="MIALEMRNLGGGEILHACPQESLDKPLPCIVFYHGFTSSKLVYS
                     YFAVALAEAGFRVIMPDAPEHGARYQGDEAGRMQRFWPILQQNFREFPALREAIIAEG
                     WLEGERLAVAGASMGGMTALGIMTHHPELNSVACLMGSGYFRSLSQTLFPSPGFDADS
                     LREWDVSHQLASLARRPLLLWHGDADDVVPPEETFRLEQALRQADLAARLTCVWQKGV
                     RHRITPEALATTVAFFQQHL"
     misc_feature    467386..468099
                     /locus_tag="KPHS_04300"
                     /note="esterase; Provisional; Region: PRK10566"
                     /db_xref="CDD:182555"
     gene            complement(468099..468854)
                     /locus_tag="KPHS_04310"
                     /db_xref="GeneID:11845418"
     CDS             complement(468099..468854)
                     /locus_tag="KPHS_04310"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor UlaR"
                     /protein_id="YP_005224731.1"
                     /db_xref="GeneID:11845418"
                     /translation="MTEAQRHQILLDLLAQTGFVTVEQVMSRLGISPATARRDINKLD
                     ESGKLKKVRNGAEAISEQRPRWTPMNIHQAQNLDEKVRIARAASQLIAPGESIVINCG
                     STAFLLGRELCGKPVQIITNYLPLANYLIDQEHDSVIIMGGQYNRSHAITLSPHGSEN
                     SLYAGHWMFTSGKGLTAEGLYKTDMLTAMAEQKMLNVVGKLAVLVDSSKIGERAGMLF
                     SQAGQIDVVITGKQADAAILKQLEDQGLSVIRV"
     misc_feature    complement(468102..468854)
                     /locus_tag="KPHS_04310"
                     /note="transcriptional repressor UlaR; Provisional;
                     Region: PRK13509"
                     /db_xref="CDD:184100"
     gene            complement(468962..470026)
                     /locus_tag="KPHS_04320"
                     /db_xref="GeneID:11845419"
     CDS             complement(468962..470026)
                     /locus_tag="KPHS_04320"
                     /codon_start=1
                     /transl_table=11
                     /product="putative L-ascorbate 6-phosphate lactonase"
                     /protein_id="YP_005224732.1"
                     /db_xref="GeneID:11845419"
                     /translation="MSKVQTITRESWILNTFPEWGSWLNEEIEQEQVTPGTFAMWWLG
                     CTGIWLKSEGGANVCVDFWCGTGKQSHGNPLMKTGHQMQRMAGVKKLQPNLRTTPFVL
                     DPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCPADVPFIGPKTCVDLWIGWGVPKAR
                     CIVMKPGDVVKIKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDQRAVNYLFKTPG
                     GNLYHSGDSHYSNYYAKHGNEHRIDVALGSYGENPRGITDKMTSADILRMAESLNAKV
                     VIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHY
                     PRGFDDCFTIEPDLPFKSFL"
     misc_feature    complement(468965..470026)
                     /locus_tag="KPHS_04320"
                     /note="putative L-ascorbate 6-phosphate lactonase;
                     Provisional; Region: PRK11709"
                     /db_xref="CDD:236958"
     misc_feature    complement(order(469280..469282,469349..469351,
                     469412..469417,469661..469666,469670..469672,
                     469676..469678))
                     /locus_tag="KPHS_04320"
                     /note="putative active site [active]"
                     /db_xref="CDD:293842"
     misc_feature    complement(order(469349..469351,469415..469417,
                     469664..469666,469670..469672,469676..469678))
                     /locus_tag="KPHS_04320"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:293842"
     misc_feature    complement(order(469349..469351,469415..469417,
                     469670..469672,469676..469678))
                     /locus_tag="KPHS_04320"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:293842"
     misc_feature    complement(order(469349..469351,469664..469666))
                     /locus_tag="KPHS_04320"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:293842"
     gene            470389..471789
                     /locus_tag="KPHS_04330"
                     /db_xref="GeneID:11845420"
     CDS             470389..471789
                     /locus_tag="KPHS_04330"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system ascorbate-specific transporter
                     subunit IIC"
                     /protein_id="YP_005224733.1"
                     /db_xref="GeneID:11845420"
                     /translation="MAILYNIFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKG
                     TIKTIIGFMLLQAGSGILTSTFKPVVAKMSEVYGINGAISDTYASMMATIDRMGEAYS
                     WVGYAVLLALALNICYVLLRRITGIRTIMLTGHIMFQQAGLIAVSFFIFGYGMWTTII
                     CTAVLVSLYWGITSNMMFKPTQLVTDGCGFSIGHQQQFASWIAYKVAPYLGKKEESVE
                     DLKLPGWLNIFHDNIVSTAIVMTIFFGAILLSFGIDVVQAMAGKTHWTVYILQTGFSF
                     AVAIFIITQGVRMFVAELSEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGT
                     IGQLIAVGILVGIGSSILIIPGFIPMFFSNATIGVFANHFGGWRAALKICLVMGMVEI
                     FGCVWAVKLTGMSAWMGMADWSILAPPMMQGFASIGLAFMAVIILIALAYMFFAGRAL
                     RAEEDAEKQLAEASAQ"
     misc_feature    470389..>471786
                     /locus_tag="KPHS_04330"
                     /note="PTS system ascorbate-specific transporter subunits
                     IICB; Provisional; Region: PRK09548"
                     /db_xref="CDD:236559"
     gene            471850..472107
                     /locus_tag="KPHS_04340"
                     /db_xref="GeneID:11845421"
     CDS             471850..472107
                     /locus_tag="KPHS_04340"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ascorbate-specific enzyme IIB component of
                     PTS"
                     /protein_id="YP_005224734.1"
                     /db_xref="GeneID:11845421"
                     /translation="MIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELNGADIIIASTHI
                     AGEITVSGNKHVVGVRNMLSPADFGPKLLEVIKAHFPQDVK"
     misc_feature    471850..472104
                     /locus_tag="KPHS_04340"
                     /note="PTS system L-ascorbate-specific transporter subunit
                     IIB; Provisional; Region: PRK10222"
                     /db_xref="CDD:182316"
     gene            472117..472584
                     /locus_tag="KPHS_04350"
                     /db_xref="GeneID:11845422"
     CDS             472117..472584
                     /locus_tag="KPHS_04350"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ascorbate-specific enzyme IIA component of
                     PTS"
                     /protein_id="YP_005224735.1"
                     /db_xref="GeneID:11845422"
                     /translation="MKLHESLAQNHSIRLQAEAETWQEAVKIGVDLLVAADVVEPRYY
                     QAILDGVAQHGPYFVIAPGLAMPHGRPEEGVKKTGFALVTLKKPLIFNHEDNDPVDIL
                     ITMAAVDATTHQEVGIMQIVNLFDDEANFDRLRACRSEQEVLDLIKNATAAAV"
     misc_feature    472117..472578
                     /locus_tag="KPHS_04350"
                     /note="PTS system L-ascorbate-specific transporter subunit
                     IIA; Provisional; Region: PRK10372"
                     /db_xref="CDD:182417"
     misc_feature    order(472264..472266,472318..472320)
                     /locus_tag="KPHS_04350"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    472318..472320
                     /locus_tag="KPHS_04350"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            472598..473248
                     /locus_tag="KPHS_04360"
                     /db_xref="GeneID:11845423"
     CDS             472598..473248
                     /locus_tag="KPHS_04360"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydro-L-gulonate-6-phosphate decarboxylase"
                     /protein_id="YP_005224736.1"
                     /db_xref="GeneID:11845423"
                     /translation="MSLPMLQVALDNQTLASAYETTRLIAEEVDIIEVGTILCVGEGV
                     RAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVA
                     KEFNGDVQIELTGFWTWEQAQAWREAGIQQVVYHRSRDAQAAGVAWSEADISAIKRLS
                     DMGFKVTVTGGLALEDLPLFAGIPVHVFIAGRSIRDAASPVEAARQFKRSIAQLWG"
     misc_feature    472598..473245
                     /locus_tag="KPHS_04360"
                     /note="3-keto-L-gulonate-6-phosphate decarboxylase;
                     Provisional; Region: ulaD; PRK13306"
                     /db_xref="CDD:237344"
     gene            473258..474112
                     /locus_tag="KPHS_04370"
                     /db_xref="GeneID:11845424"
     CDS             473258..474112
                     /locus_tag="KPHS_04370"
                     /codon_start=1
                     /transl_table=11
                     /product="L-xylulose 5-phosphate 3-epimerase"
                     /protein_id="YP_005224737.1"
                     /db_xref="GeneID:11845424"
                     /translation="MLAKSIPLGIYEKALPAGECWLERLKLAKALGFDFVEMSLDETD
                     ARLARLDWSPEQRLALVKAVAETGVRVPSMCLSAHRRFPLGSEDDAVRHQGLEIMRKA
                     IRLAQDVGIRVIQLAGYDVYYQQANDETRRRFRDGLKQSVEMASRAQVTLAMEIMDYP
                     LMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELKAGSGHIVAVHVKDTKPG
                     VFKNVPFGEGVVDFERCFETLKQTGYCGPYLIEMWSETSADPLAEVAKARDWVKARMA
                     RAGLMEAA"
     misc_feature    473258..474100
                     /locus_tag="KPHS_04370"
                     /note="L-xylulose 5-phosphate 3-epimerase; Reviewed;
                     Region: PRK13209"
                     /db_xref="CDD:237307"
     gene            474112..474798
                     /locus_tag="KPHS_04380"
                     /db_xref="GeneID:11845425"
     CDS             474112..474798
                     /locus_tag="KPHS_04380"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="YP_005224738.1"
                     /db_xref="GeneID:11845425"
                     /translation="MQQLKQQVFEANMDLPRYGLVTFTWGNVSAIDRQRGLVVIKPSG
                     IAYESMTVDDMSVVDLQGHVVEGRWRPSSDTATHLALYRRYPDLGGVVHTHSTHATAW
                     AQAGLAIPALGTTHADYFFGDIPCTRALSAQEVDEAYELNTGQVIIETLGEANPLHTP
                     GIVVYQHGPFAWGKDAHEAVHNAVVMEEVARMAWIARGINPQLQPIDSWLMNKHFQRK
                     HGPNAYYGQK"
     misc_feature    474112..474795
                     /locus_tag="KPHS_04380"
                     /note="L-ribulose-5-phosphate 4-epimerase; Reviewed;
                     Region: sgaE; PRK12348"
                     /db_xref="CDD:183460"
     misc_feature    order(474139..474141,474151..474153,474175..474177,
                     474247..474249,474253..474258,474394..474396,
                     474400..474405,474418..474426,474445..474447,
                     474451..474456,474496..474498,474607..474609,
                     474640..474642,474661..474663,474673..474675,
                     474694..474696,474754..474756)
                     /locus_tag="KPHS_04380"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    order(474190..474192,474238..474243,474325..474333,
                     474388..474390,474394..474396,474610..474612)
                     /locus_tag="KPHS_04380"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    order(474388..474390,474394..474396,474610..474612)
                     /locus_tag="KPHS_04380"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(474862..476055)
                     /locus_tag="KPHS_04390"
                     /db_xref="GeneID:11845426"
     CDS             complement(474862..476055)
                     /locus_tag="KPHS_04390"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="YP_005224739.1"
                     /db_xref="GeneID:11845426"
                     /translation="MVPRFATLGRIPKGVWVLGGVSLLMDVSSEMIHSLLPLFMATTL
                     GASVIIIGLIEGLAEATALILKVFSGAISDYVGKRKGLALLGYGLGALSKPLFAIAPT
                     AGVVFSARMIDRVGKGIRGAPRDALVADVTPPEIRGAAYGLRQALDTVGAFLGPLLAV
                     LLMFIWANDFHAIFWVAVIPAVLSILLLGFGLQEPKSAIAHKRSNPLKRENLKKLSAA
                     YWWVVAIGSIFTLARFSEAFLVLRAQQMEIPLYTIPLVMVAMNLVYSLTAYPFGKLSD
                     SMSHSKLLQWGLLVLILADIVLALSSHWSTLLIGVALWGIHMGMTQGLLAAMVAHTAP
                     PELRGTAFGMFNLMSGLALLLASTGAGVLWETFGAASTFYAGAIICVVTLIGMRVMPS
                     AYRQD"
     misc_feature    complement(474895..476013)
                     /locus_tag="KPHS_04390"
                     /note="MJ1317 and similar transporters of the Major
                     Facilitator Superfamily; Region: MFS_MJ1317_like; cd17370"
                     /db_xref="CDD:340928"
     misc_feature    complement(order(474997..474999,475006..475011,
                     475018..475023,475030..475032,475078..475080,
                     475090..475092,475102..475107,475252..475254,
                     475264..475266,475345..475347,475354..475362,
                     475369..475374,475381..475383,475600..475602,
                     475609..475614,475621..475623,475681..475683,
                     475690..475698,475702..475707,475858..475860,
                     475957..475959,475966..475971,475978..475983))
                     /locus_tag="KPHS_04390"
                     /note="putative chemical substrate binding pocket
                     [chemical binding]; other site"
                     /db_xref="CDD:340928"
     gene            complement(476205..476480)
                     /locus_tag="KPHS_04400"
                     /db_xref="GeneID:11845427"
     CDS             complement(476205..476480)
                     /locus_tag="KPHS_04400"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="YP_005224740.1"
                     /db_xref="GeneID:11845427"
                     /translation="MKLKIIAMMAALFFSANALAAIQITERQARNMDDVQSLGVIYIN
                     HNMATEHEAEQALSQMSDAQGAKYFQPILMHEPETNGPLRASAVIYR"
     misc_feature    complement(476211..476372)
                     /locus_tag="KPHS_04400"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:336677"
     gene            476821..477216
                     /locus_tag="KPHS_04410"
                     /db_xref="GeneID:11845428"
     CDS             476821..477216
                     /locus_tag="KPHS_04410"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="YP_005224741.1"
                     /db_xref="GeneID:11845428"
                     /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITAAAGTIHRLEDWGR
                     RQLAYPINKLHKAHYVLMNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPM
                     VKAKDERRERREDFANETADDSEAGDSEE"
     misc_feature    476821..477141
                     /locus_tag="KPHS_04410"
                     /note="30S ribosomal protein S6; Reviewed; Region: rpsF;
                     PRK00453"
                     /db_xref="CDD:179034"
     misc_feature    order(476830..476832,476965..476967,476977..476979,
                     477022..477024,477031..477036,477055..477057,
                     477076..477078,477085..477093)
                     /locus_tag="KPHS_04410"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:275385"
     misc_feature    order(476833..476835,476839..476841,476953..476955,
                     476959..476967,476995..476997,477001..477003,
                     477076..477078,477088..477090)
                     /locus_tag="KPHS_04410"
                     /note="S18 interface [polypeptide binding]; other site"
                     /db_xref="CDD:275385"
     gene            477541..477768
                     /locus_tag="KPHS_04420"
                     /db_xref="GeneID:11845429"
     CDS             477541..477768
                     /locus_tag="KPHS_04420"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="YP_005224742.1"
                     /db_xref="GeneID:11845429"
                     /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRI
                     TGTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
     misc_feature    477541..477756
                     /locus_tag="KPHS_04420"
                     /note="30S ribosomal protein S18; Reviewed; Region: rpsR;
                     PRK00391"
                     /db_xref="CDD:178997"
     gene            477810..478259
                     /locus_tag="KPHS_04430"
                     /db_xref="GeneID:11845430"
     CDS             477810..478259
                     /locus_tag="KPHS_04430"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="YP_005224743.1"
                     /db_xref="GeneID:11845430"
                     /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNV
                     EFFEARRAELEAKLADVLAAAEARAEQINALESVTIASKAGDEGKLFGSIGTRDIADA
                     VTAAGVKVAKSEVRLPNGVLRNVGEHEVNFQVHSEVFAKVIINVVAE"
     misc_feature    477810..478256
                     /locus_tag="KPHS_04430"
                     /note="50S ribosomal protein L9; Reviewed; Region: rplI;
                     PRK00137"
                     /db_xref="CDD:234659"
     gene            complement(478368..479042)
                     /locus_tag="KPHS_04440"
                     /db_xref="GeneID:11845431"
     CDS             complement(478368..479042)
                     /locus_tag="KPHS_04440"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cell envelope opacity-associated
                     protein A"
                     /protein_id="YP_005224744.1"
                     /db_xref="GeneID:11845431"
                     /translation="MPGRFELTSTLAKIWHAPDHFRLLDPLPPMHRRGIIAGFLLVII
                     GILLPSDDSQSPASTSREANLNLQSQSQPQAGGNQAVPLPPITNTPTVSDADQMAPVA
                     PEPIQDEQPDQAQTQQPAASQPYQSSSQQSAPGIEQQWRTYRIESGKTLAQLFRDHGL
                     PATDVYAMAQVEGAGKPLSTLQSGQTVQIRQNANGVVTGLTIDTGNGQQVLFTRQSNG
                     SFVRAR"
     misc_feature    complement(478371..479042)
                     /locus_tag="KPHS_04440"
                     /note="Cell envelope opacity-associated protein A
                     (function unknown) [Function unknown]; Region: OapA;
                     COG3061"
                     /db_xref="CDD:225603"
     gene            479261..479881
                     /locus_tag="KPHS_04450"
                     /db_xref="GeneID:11845432"
     CDS             479261..479881
                     /locus_tag="KPHS_04450"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005224745.1"
                     /db_xref="GeneID:11845432"
                     /translation="MATPTFDTIEAQASYGIGLQVGQQLSESGLQGLLPEALVAGIAD
                     ALEGNQPQVPVEAVHRALREIHERADAVRRERFQAMAADGQKYLDENREKEGVNSTES
                     GLQFRVLTQGEGPIPARTDRVRVHYTGKLIDGTVFDSSVARGEPAEFPVTGVIGGWIE
                     ALTLMPVGSKWELTIPHNLAYGERGAGASIPPFSTLIFEVELLDII"
     misc_feature    479261..479878
                     /locus_tag="KPHS_04450"
                     /note="peptidyl-prolyl cis-trans isomerase; Provisional;
                     Region: PRK11570"
                     /db_xref="CDD:183207"
     gene            480186..481589
                     /locus_tag="KPHS_04460"
                     /db_xref="GeneID:11845433"
     CDS             480186..481589
                     /locus_tag="KPHS_04460"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine/D-serine/glycine permease"
                     /protein_id="YP_005224746.1"
                     /db_xref="GeneID:11845433"
                     /translation="MVDQVKVAAVEQEPTEQSLRRNLTNRHIQLIAIGGAIGTGLFMG
                     SGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFSDFAADLLGPWAGYF
                     TGWTYWFCWVVTGMADVVAITAYAQFWFPGLSDWVASLAVILLLLGLNLATVKMFGEM
                     EFWFAMIKIVAIVALIVVGLVMVMMHFKSPTGVEASFAHLWNDGGWFPKGLSGFFAGF
                     QIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPLRIIMFYVFALIVIMSVTPWSSV
                     VPSKSPFVELFVLVGLPAAASLINFVVLTSAASSANSGVFSTSRMLFGLAQDGQAPKM
                     FAKLSKRAVPAKGLTFSCMCLLGGVVMLMVNPSVIAAFTMITTVSAILFMFVWTIILC
                     SYLAYRKNRPQLHEKSSYKMPLGKVMCWVCMAFFVFVLVLLTLEDDTREALMVTPLWF
                     VLLGAGWLFAGKKRLAK"
     misc_feature    480189..481586
                     /locus_tag="KPHS_04460"
                     /note="D-alanine/D-serine/glycine permease; Provisional;
                     Region: PRK11049"
                     /db_xref="CDD:236830"
     gene            complement(481694..482356)
                     /locus_tag="KPHS_04470"
                     /db_xref="GeneID:11845434"
     CDS             complement(481694..482356)
                     /locus_tag="KPHS_04470"
                     /codon_start=1
                     /transl_table=11
                     /product="cell morphogenesis/cell wall metabolism
                     regulator"
                     /protein_id="YP_005224747.1"
                     /db_xref="GeneID:11845434"
                     /translation="MAFRDQPLGELALTIPRASALFRQYDMDYCCGGKQTLARAASRK
                     ALDVAVIEAELAKLAEQPLSRDWRAAPLAEIIDHIIVRYHDRHREQLPELILQATKVE
                     RVHADKPNVPKGLTKYLTMLHQELSSHMMKEEQILFPMIKQGMGAQAGGPISVMESEH
                     DEAGELLEVIKHITHNVTPPPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALG
                     GK"
     misc_feature    complement(481697..482356)
                     /locus_tag="KPHS_04470"
                     /note="iron-sulfur cluster repair di-iron protein;
                     Provisional; Region: PRK10992"
                     /db_xref="CDD:236812"
     gene            complement(482439..483410)
                     /locus_tag="KPHS_04480"
                     /db_xref="GeneID:11845435"
     CDS             complement(482439..483410)
                     /locus_tag="KPHS_04480"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cationic amino acid transport protein"
                     /protein_id="YP_005224748.1"
                     /db_xref="GeneID:11845435"
                     /translation="MISGVLYALLAGLMWGLIFVGPLLVPEYPAMLQSMGRYLALGLI
                     ALPLAWLGRARLRQLSRHDWWTALGLTMMGNLIYYVCLASAIQRTGAPVSTMIIGTLP
                     VVLPVFANLLYSQRDGKLPWRRLFPALICIAVGLICVNVAELRQGLPNFSPWRYGSGI
                     ALALGSVVCWAWYALRNARWLRENPHQPPMMWATAQALVTLPVSLAGYLAACAWLHGQ
                     QAGFPLPFGPRPAVFITLMLAIAVLCSWVGALCWNIASQRLPTVILGPLIVFETLAGL
                     LYTFLLRQSLPPLLTLSGILLLVLGVVSAVRARPEKPMLQPLADEKK"
     misc_feature    complement(482484..483410)
                     /locus_tag="KPHS_04480"
                     /note="Permease of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism, Amino
                     acid transport and metabolism, General function prediction
                     only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     gene            complement(483486..484310)
                     /locus_tag="KPHS_04490"
                     /db_xref="GeneID:11845436"
     CDS             complement(483486..484310)
                     /locus_tag="KPHS_04490"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helix-turn-helix AraC-type
                     transcriptional regulator"
                     /protein_id="YP_005224749.1"
                     /db_xref="GeneID:11845436"
                     /translation="MQGVPLQFSDEKDRARFRHLEQLPGVELYHAHISRYAFEPHTHE
                     AFGIGVIEQGAERFRYRGSQHIAAANSIVTMNPDELHTGEAETADGWRYRMIYLEPDR
                     LEAITGVRDWWFSEVVREDPLRSRQIGQLIYGLWHSDDPLAQQGLLLDLIDAFRPLAH
                     HASAQGEAGHRFDRVRDYLHDNYMRPITLDELAQVAALSPYHFQRQFKAHYHVTPHQM
                     LMAIRLWRAKAFLTHGMPAAEVAIAVGLTDQSHLTRAFTQRYGITPVRYQKQVARR"
     misc_feature    complement(483855..484241)
                     /locus_tag="KPHS_04490"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:334888"
     misc_feature    complement(483489..483860)
                     /locus_tag="KPHS_04490"
                     /note="AraC-type DNA-binding domain and AraC-containing
                     proteins [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     gene            complement(484388..485236)
                     /locus_tag="KPHS_04500"
                     /db_xref="GeneID:11845437"
     CDS             complement(484388..485236)
                     /locus_tag="KPHS_04500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oxidoreductase"
                     /protein_id="YP_005224750.1"
                     /db_xref="GeneID:11845437"
                     /translation="MIALTGATGQLGHYVLQDLLNTVPASQIVAIVRNPAKAQALSQQ
                     GVVVRQADYSDEAALTAALQGVDKLLLISSSEVGQRAVQHRNVINAAKAAGVKFIAYT
                     SLLHADTSPLGLAAEHIETEQMLADSGIAYALLRNGWYTENYLASAPPALEHGVFIGA
                     AGEGKIASATRADYAAAAARVIASEGHEGKIYELAGDNAWTLSDLAAELSKQSGKNVV
                     YQNLSEADFAAALKSVGLPAGLADMLADSDVGASKGGLFDDSRTLSTLIGRPTTSLAE
                     SVKGIL"
     misc_feature    complement(484415..485233)
                     /locus_tag="KPHS_04500"
                     /note="triphenylmethane reductase (TMR)-like proteins,
                     NMRa-like, atypical (a) SDRs; Region: TMR_SDR_a; cd05269"
                     /db_xref="CDD:187578"
     misc_feature    complement(order(484724..484726,484817..484825,
                     485012..485023,485075..485086,485126..485128,
                     485135..485140,485204..485215,485219..485221))
                     /locus_tag="KPHS_04500"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187578"
     gene            485326..485697
                     /locus_tag="KPHS_04510"
                     /db_xref="GeneID:11845438"
     CDS             485326..485697
                     /locus_tag="KPHS_04510"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005224751.1"
                     /db_xref="GeneID:11845438"
                     /translation="MAEPTLSEKLRTGNLFAEQCPSRDVLKHVTSRWGVLILVALREG
                     THRFSDLRRKMGGVSEKMLAQSLQALEQDGFIDRVSYPVVPPHVEYSLTPLGLQVSEK
                     VAALADWIEVNLPSVLANHGE"
     misc_feature    485410..485670
                     /locus_tag="KPHS_04510"
                     /note="HxlR-like helix-turn-helix; Region: HxlR;
                     pfam01638"
                     /db_xref="CDD:334619"
     gene            complement(485752..487695)
                     /locus_tag="KPHS_04520"
                     /db_xref="GeneID:11845439"
     CDS             complement(485752..487695)
                     /locus_tag="KPHS_04520"
                     /codon_start=1
                     /transl_table=11
                     /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
                     /protein_id="YP_005224752.1"
                     /db_xref="GeneID:11845439"
                     /translation="MIKFSATLLATLIAASVNAATVDLRIMETTDLHSNMMDFDYYKD
                     AATEKFGLVRTASLIEQARAEVKNSVLVDNGDVIQGSPLGDYMAAKGLKEGDVHPVYK
                     AMNTLNYAVGNLGNHEFNYGLDFLHKALAGAKFTYVNANIIDAKTGKPMFTPYLIQDT
                     RVVDSDGQIHTLRIGYIGFVPPQIMTWDKANLNGKVTVNDITETARKYIPEMRAKGAD
                     VVVVVAHSGLSADPYQAMAENSVYYLSQVPGVDAIMFGHAHAVFPGKDFANIKGADIA
                     KGTLNGVPAVMPGMWGDHLGVVDLVLNNDSGKWQVTQSKAEARPIYDAVAKKSLAAED
                     GKLVAVLKADHDATREFVSKPIGKSADNMYSYLALVQDDPTVQVVNMAQKAYVEHYIQ
                     GDPDLAKLPVLSAAAPFKVGGRKNDPASFVEVEKGQLTFRNAADLYLYPNTLVVMKVS
                     GKEVKEWLECSAGQFNQIDPASSKPQSLINWDGFRTYNFDVIDGVNYQIDVTQPARYD
                     GECQMIHPQAERIKHLTFNGKPVDPQATFLVATNNYRAYGGKFAGTGESHIAFASPDE
                     NRSVLAAWIGAQSKKEGAIHPAADNNWRLAPIHSNTPLDIRFETSPGDKAAAFIKEKA
                     QYPMRQVATDDIGFAIYQLDLSK"
     misc_feature    complement(485755..487695)
                     /locus_tag="KPHS_04520"
                     /note="bifunctional 2',3'-cyclic nucleotide
                     2'-phosphodiesterase/3'-nucleotidase periplasmic precursor
                     protein; Reviewed; Region: cpdB; PRK09420"
                     /db_xref="CDD:236506"
     gene            487935..488630
                     /locus_tag="KPHS_04530"
                     /db_xref="GeneID:11845440"
     CDS             487935..488630
                     /locus_tag="KPHS_04530"
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="YP_005224753.1"
                     /db_xref="GeneID:11845440"
                     /translation="MEVYDGNQPINVASKKDDSPVTAADIAAHKVIVSGLQALDPDTP
                     ILSEEDPPSWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIENGKPTLGVVYAP
                     VMKVMYSAQNGKAWKEECGVRKQIQVRDARPPLVVISRSHSNDPELQEYLEQLGEHQT
                     TSIGSSLKFCLVAEGQAQLYPRFGPTSTWDTAAGHAVAVAAGAHVHDWQGKTLDYTPR
                     ESFLNPGFRVSIY"
     misc_feature    487935..488627
                     /locus_tag="KPHS_04530"
                     /note="adenosine-3'(2'),5'-bisphosphate nucleotidase;
                     Provisional; Region: PRK10931"
                     /db_xref="CDD:182848"
     misc_feature    order(488007..488009,488076..488081,488133..488150,
                     488154..488156,488349..488351,488358..488360,
                     488436..488438,488472..488474,488499..488504)
                     /locus_tag="KPHS_04530"
                     /note="active site"
                     /db_xref="CDD:238816"
     gene            complement(488620..489177)
                     /locus_tag="KPHS_04540"
                     /db_xref="GeneID:11845441"
     CDS             complement(488620..489177)
                     /locus_tag="KPHS_04540"
                     /codon_start=1
                     /transl_table=11
                     /product="YtfJ family protein"
                     /protein_id="YP_005224754.1"
                     /db_xref="GeneID:11845441"
                     /translation="MTLRSILAASLLLLPLLATAHNFVDGQRVAPVGVADRGELILDK
                     DKFSYKNWNSAQLAGKVRVVQHIAGRSSAKEKNANLIEAIKAAGFPHDRYQTTTIVNT
                     DDAIPGTGMFVRNSIESNKKLFPWSQFIVDSNGLVRKAWQLDEKSSAIVVLDKNGRVQ
                     WAKDGALTQQEVQQVIDLLHKLLNK"
     misc_feature    complement(488629..489177)
                     /locus_tag="KPHS_04540"
                     /note="Bacterial protein of unknown function
                     (YtfJ_HI0045); Region: YtfJ_HI0045; cl17398"
                     /db_xref="CDD:302642"
     gene            489501..489707
                     /locus_tag="KPHS_04550"
                     /db_xref="GeneID:11845442"
     CDS             489501..489707
                     /locus_tag="KPHS_04550"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1107 domain-containing protein"
                     /protein_id="YP_005224755.1"
                     /db_xref="GeneID:11845442"
                     /translation="MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILIPKV
                     KDKLHLSVMSEVNRQVLRLQTEMA"
     misc_feature    489501..489689
                     /locus_tag="KPHS_04550"
                     /note="Protein of unknown function (DUF1107); Region:
                     DUF1107; pfam06526"
                     /db_xref="CDD:310846"
     gene            complement(489970..491307)
                     /locus_tag="KPHS_04560"
                     /db_xref="GeneID:11845443"
     CDS             complement(489970..491307)
                     /locus_tag="KPHS_04560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hemolysin-related membrane protein"
                     /protein_id="YP_005224756.1"
                     /db_xref="GeneID:11845443"
                     /translation="MLNSILVILCLIAVSAFFSISEISLAASRKIKLKLLADEGNVNA
                     QRVLKMQENPGTFFTVVQIGLNAVAILGGIVGDAAFSPAFHSLLSGYLSPELSEQLSF
                     IISFTLVTSLFILFADLTPKRIGMIAPETVALRIINPMRFCLLVFRPLVWLFNGMANM
                     IFRIFKLPMVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTP
                     RESVIWFDLHEDEQSLKNKVAEHPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLV
                     LTGGVQIRNTLIVPDTLTLSEALESFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMG
                     DLVGQGLEEQIVARDENSWLIDGGTPIDDVMRVLDIDEFPQSGNYETIGGFMMFMLRK
                     IPKRTDAVKFSGYKFEVVDIDNYRIDQLLVTRIDNKPTVLVPKQAETAESQNA"
     misc_feature    complement(490021..491307)
                     /locus_tag="KPHS_04560"
                     /note="Hemolysin or related protein, contains CBS domains
                     [General function prediction only]; Region: TlyC; COG1253"
                     /db_xref="CDD:224173"
     gene            complement(491488..492126)
                     /locus_tag="KPHS_04570"
                     /db_xref="GeneID:11845444"
     CDS             complement(491488..492126)
                     /locus_tag="KPHS_04570"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="YP_005224757.1"
                     /db_xref="GeneID:11845444"
                     /translation="MSLFDKTHLVAQADALPGRNTPMPVATLHAVNGHSMTNVPAGME
                     VALFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYD
                     PQVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQTEAAKASLARFQAA
                     MNDAHDTRHITTEIATAKPFYYAEDDHQQYLYKNPHGYCGIGGIGVCLPPQA"
     misc_feature    complement(491491..492126)
                     /locus_tag="KPHS_04570"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK00058"
                     /db_xref="CDD:234604"
     gene            492335..494068
                     /locus_tag="KPHS_04580"
                     /db_xref="GeneID:11845445"
     CDS             492335..494068
                     /locus_tag="KPHS_04580"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="YP_005224758.1"
                     /db_xref="GeneID:11845445"
                     /translation="MLKIRQLCVTSLLLVSGVASAANVRLQVEGLSGELEKNVRAQLS
                     TIQSDEVTPDRRFRARVDDAIREGLKALGYYEPTIEFDLRPPPKRGRQVLIAKVTPGE
                     PVRIGGTEVILRGGARTDSDYLALLKTRPAIGTVLNHGDYDGFKSSLTRVALRKGYFD
                     SEFLKSQLGVSLDRHQAFWDIDYDSGERYRFGHVTFSGSQIRDEYLQNLVPFKEGDYY
                     TSQDLAELNRRLAATGWFSSVVVAPDFAKSRKTKVLPLQGVVSPRKENTVETGVGYST
                     DVGPRVKATWKKPWVNSYGHSLTSSVSLSAPEQQFDFTYKVPLLKSPLEQYYLMQGGF
                     KRTDLNDTQADSTTLGVSRFWEMSSGWQRAINLRWSLDHFTQANVTNTTMLIYPGVSV
                     NRTRSRGGLMPTWGDSQRYSVDYSNTMWGSDINFIVMQAQDVWIRTLYDRHRFVVRGN
                     LGWIEADNFDKVPPDLRFFAGGDRSIRGYKYKSISPKDDDGKLIGASKLATGSLEYQY
                     NVSGKWWGAVFVDSGEAVSDIRESDFKTGAGVGVRWQSPVGPIKLDIARPIGDKEEHG
                     LQFYIGLGPEL"
     misc_feature    492335..494065
                     /locus_tag="KPHS_04580"
                     /note="Outer membrane translocation and assembly module
                     TamA [Cell wall/membrane/envelope biogenesis]; Region:
                     TamA; COG0729"
                     /db_xref="CDD:223801"
     gene            494065..497841
                     /locus_tag="KPHS_04590"
                     /db_xref="GeneID:11845446"
     CDS             494065..497841
                     /locus_tag="KPHS_04590"
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter assembly complex protein TamB"
                     /protein_id="YP_005224759.1"
                     /db_xref="GeneID:11845446"
                     /translation="MSLWKKISLGVLIVLVLLLGTVGFLVGTTTGLHLVFKAADRWVP
                     GLEIGKVTGGWRDLTLDNVRYEQPGVAVTAGQFHLSVRLRCLWDSSLCVNDIALRDIY
                     VAVDTKKMPPSAPVEEEDSGPLNLSTPYPITLSRVALHNVNVKIDDTAVSVRDFSTGL
                     NWQEKNLTLTPTSLQGLLIALPKVAKVAQEQVVEPKIDNPQPQEKPLGETMTDLFSQP
                     VLPAMTDVHLPLNLNIQAFRGEQLRLTGDTDITVYNLLLKVSSIDGQMKLDALDIDSD
                     QGKVSASGSAQLQDNWPVDITLAGTLNVDPMKGEKVQLKVGGEVRKTLKVGVDLSGPV
                     AATLRADAQLAEVGLPLNMELKSKQLAWPFSGEKQFQADDVQLKFSGKMTDYALAFST
                     AVKGQSLPPAKIALNAKGNERQINLDKLTVNALEGKTELKALLDWQQAISWRGELTLD
                     GINTAKEVPDWPSKLNGRIKTQGSLYGGSWQMSVPELKITGNVKQNKVDVAGSLQGNS
                     YLQWKIPGLHLALGPNSADIKGELGVKDLNLDATIDAPHLDNALPGLGGTAKGLVKVR
                     GTVDAPQLLADITARALRWQELTIAQVNVKGDVKSTDQIGGNLDVRVDRISQPGVNIS
                     LVQLNAKGTEKQHELRLRVQGEPVSGQLALAGSFDRQAERWKGSLSDTRFQTPVGPVA
                     LTRSIALDYRNLEQKISIGPHCWTNPNAELCVPETIDAGASGRARVNLNRFDLAMLKP
                     FMPEATQASGVFTGNADVSWDTTKEGLPQGKVTLSGRNVKVTQVVNDAPLPVAFDTLN
                     LSADLHNNRAELGWLIRLTNNGQLDGQVQVTDPQGRRNLGGNVNISNFSLAMINPIFA
                     RGEKAEGRLNARLRLGGNVKSPQLFGQMQLSGVDIDGNFMPFDMQPSQLAMNFNGTRS
                     TLQGTVNTRQGQIALSGNADWTQIDNWRAQIAAKGSRVRITVPPMVRLDVSPDVVFTA
                     TPSLFNLDGKVDVPWARIVVNEVPESAVGVSSDEVMLDKNLKPIKQQSASIPINSNLT
                     IHVGNNVRLEAFGLKARLTGDLKVAQDKQGLGLNGQINIPDGRFHAYGQDLIVRKGEL
                     LFSGPPDQPLLNIEAIRNPDATEDDVIAGVRVTGSADQPKAEIFSDPVMSQQEALSYL
                     LRGQGLSSGQSDSAAMTSMLIGMGVAQSGQVVGKIGETFGVSNLALDTEGVGDSSQVV
                     VSGYVLPGLQVKYGVGIFDSLATLTLRYRLMPKLYVEAVSGIDQALDLLYQFEF"
     misc_feature    494065..497838
                     /locus_tag="KPHS_04590"
                     /note="Autotransporter translocation and assembly factor
                     TamB [Intracellular trafficking, secretion, and vesicular
                     transport]; Region: TamB; COG2911"
                     /db_xref="CDD:225463"
     gene            497898..498188
                     /locus_tag="KPHS_04600"
                     /db_xref="GeneID:11845447"
     CDS             497898..498188
                     /locus_tag="KPHS_04600"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylcyclotransferase"
                     /protein_id="YP_005224760.1"
                     /db_xref="GeneID:11845447"
                     /translation="MTNAQWLGAHSVDDYQLYSLGHYPGAVPGEGTVHGEVYRIDAST
                     LAELDALRTKGGEYARHLIQTPYGSAWMYVYQRSVEGCTLIANGNWLDRDQY"
     misc_feature    497898..498182
                     /locus_tag="KPHS_04600"
                     /note="Uncharacterized conserved protein YtfP,
                     gamma-glutamylcyclotransferase (GGCT)/AIG2-like family
                     [General function prediction only]; Region: YtfP; COG2105"
                     /db_xref="CDD:225016"
     misc_feature    order(497976..497981,497985..497987,498069..498083,
                     498087..498089,498108..498110,498117..498119)
                     /locus_tag="KPHS_04600"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119400"
     misc_feature    498051..498053
                     /locus_tag="KPHS_04600"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:119400"
     gene            complement(498226..499392)
                     /locus_tag="KPHS_04610"
                     /db_xref="GeneID:11845448"
     CDS             complement(498226..499392)
                     /locus_tag="KPHS_04610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224761.1"
                     /db_xref="GeneID:11845448"
                     /translation="MKQTHYFTVNFTGFTTAASEEQSYLRLIAGEHAFYTDKRHFKDP
                     SLFDRLRLGQPLHIGTCRLKDGSYWIHWLSDGHILLEPSRQPLSIKKLLRPVGLVFFV
                     CLIILACAPWLDIFLLLCFITMLVNPFGIFSFCSCNFSLRLRVLNAKMQRTKQGDISF
                     CQRLEILPATSERHPPSANNEIALPKEFALEEGVILNSYYQIWFATRVRPYFIKEGAC
                     FQLATRHSFFSARLTWLSDALNNRCRPPFLADGDWVIAARRHGYDDLQALYNVSDGSV
                     YLKNSPFHPGNQQMASIYKIAYGLVLIVMFFTLTIKLHDPMLNLGSWPFYREMLTRLT
                     GTLLPINLLLIVMEFVRMIAHPLSRRVAGRVKVHQAILRYARRQGARMTPWELK"
     gene            complement(499548..500735)
                     /locus_tag="KPHS_04620"
                     /db_xref="GeneID:11845449"
     CDS             complement(499548..500735)
                     /locus_tag="KPHS_04620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224762.1"
                     /db_xref="GeneID:11845449"
                     /translation="MKSVRYFTLNFSGFTTAACEKQGYLRLIAGDHVFYTDKRYFNDP
                     SLFDRLTINQPLHLGVRRLDNGSYWIHWLSDGETLLEPSQRVKRWARPLLIISLLTLI
                     VALIPLVMSTSEWGRFGFGIIAILAFIALLTGLCELLFHRALKMHPAMRDLLAKMAQA
                     RRRDFSFCQPLPTTAQTLRQSAKPFTQALPERYAVRTGKISNIIFKKWFAGNPTREYH
                     GVGIQCDTAPLAFFWQNGFANFGLHPFFYRRQPPFLAIGDRIVVVYQRKDNDVQALYN
                     VSDGGAFLKNHPCYPGDRQMSLVYNLFYGMVLVIYLLILGMSLNNPYKPARGFGWLIQ
                     DSLDMLSLLLLSFGGILAVLELIGPTAWLLSHRVADWMKMRSAMRHYLQGAARHTALE
                     EIM"
     gene            complement(500810..501340)
                     /locus_tag="KPHS_04630"
                     /db_xref="GeneID:11845450"
     CDS             complement(500810..501340)
                     /locus_tag="KPHS_04630"
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic diphosphatase"
                     /protein_id="YP_005224763.1"
                     /db_xref="GeneID:11845450"
                     /translation="MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEVDKESGALFVDR
                     FMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDESGE
                     DAKLVAVPHTKLSKEYDHINDVNDLPELLKAQITHFFEHYKDLEKGKWVKVDGWDNAE
                     AAKAEIVASFERAKQK"
     misc_feature    complement(500813..501340)
                     /locus_tag="KPHS_04630"
                     /note="inorganic pyrophosphatase; Provisional; Region:
                     PRK01250"
                     /db_xref="CDD:179262"
     misc_feature    complement(order(501104..501109,501266..501271))
                     /locus_tag="KPHS_04630"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238239"
     misc_feature    complement(order(500912..500917,501173..501175,
                     501209..501211,501251..501253))
                     /locus_tag="KPHS_04630"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238239"
     misc_feature    complement(order(501032..501034,501047..501049,
                     501128..501130,501143..501145,501245..501247))
                     /locus_tag="KPHS_04630"
                     /note="metal binding sites [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238239"
     gene            501795..502700
                     /locus_tag="KPHS_04640"
                     /db_xref="GeneID:11845451"
     CDS             501795..502700
                     /locus_tag="KPHS_04640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative D-ribose transport system periplasmic
                     binding component"
                     /protein_id="YP_005224764.1"
                     /db_xref="GeneID:11845451"
                     /translation="MAIAAPLTVGFSQVGSESGWRAAETSVAKEEAAKRGITLKIADG
                     QQKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKEAKIPVFLLDRSIDVKDK
                     DLYMTTVTANNVLEGQLIGDWLVKTVDGKPCNVVELQGTVGASVAIDRKKGFADAIAK
                     ASNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVFAHNDDMAIGAIQAIKEAG
                     LKPGKDILTGSIDGVPDIYKAMIAGEANASVELTPNMAGPAFDALEKYKKDGTLPEKL
                     TITKSTLYLPDTAKEELEKKKNMGY"
     misc_feature    501816..502646
                     /locus_tag="KPHS_04640"
                     /note="Periplasmic binding domain of ABC-type YtfQ-like
                     transport systems; Region: PBP1_YtfQ_like; cd06309"
                     /db_xref="CDD:107304"
     misc_feature    order(501852..501854,502074..502076,502242..502244,
                     502485..502487,502545..502547)
                     /locus_tag="KPHS_04640"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107304"
     gene            complement(502713..502841)
                     /locus_tag="KPHS_04660"
                     /db_xref="GeneID:11845452"
     CDS             complement(502713..502841)
                     /locus_tag="KPHS_04660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224765.1"
                     /db_xref="GeneID:11845452"
                     /translation="MCLGAHNRCHLQMMSGYPGSRLASRGFWNAAFYPLPPGGGME"
     gene            502824..504326
                     /locus_tag="KPHS_04650"
                     /db_xref="GeneID:11845453"
     CDS             502824..504326
                     /locus_tag="KPHS_04650"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="YP_005224766.1"
                     /db_xref="GeneID:11845453"
                     /translation="MSAEAHQEILRTEGLSKFFPGVKALDNVNFSLRRGEIMALLGEN
                     GAGKSTLIKALTGVYHADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVA
                     DNLFIGREPRRFGLLRRKEMEARATALMASYGFSLDVREPLNRFSVAMQQIVAICRAI
                     DLSAKVLILDEPTASLDTQEVEMLFTLMRQLRDNGVSLIFVTHFLDQVYAVSDRITVL
                     RNGSFVGCRETRELPQIELVKMMLGRELDHNALQRAGRTLLSDKPVAAFEGYGKKGTI
                     APFDLQVRPGEIVGLAGLLGSGRTETAEVIFGIKTADSGKAWIKGKPQTLRSPHQASC
                     LGIGFCPEDRKTDGIIAAASVRENIVLALQAQRGWLRPIPRREQNEIAERFIRQLGIR
                     TPSAEQPIEFLSGGNQQKVLLSRWLLTKPQFLILDEPTRGIDVGAHAEIIRLIETLCA
                     DGLALLVISSELEELVGYADRVIILRDRRQVAEIPLAELSVPAIMNAIAA"
     misc_feature    502827..504323
                     /locus_tag="KPHS_04650"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     gene            504337..505362
                     /locus_tag="KPHS_04670"
                     /db_xref="GeneID:11845454"
     CDS             504337..505362
                     /locus_tag="KPHS_04670"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter membrane protein"
                     /protein_id="YP_005224767.1"
                     /db_xref="GeneID:11845454"
                     /translation="MMPRSLSQTGPEKRRFTWPKGTPQIIALLLVLLVDSLVAPHFYQ
                     VVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATAASMTV
                     AGHSLPVVLLAALAAGALAGLWNGILVAVLKIQPFVATLILMVAGRGVAQLITAGQIV
                     TFDSPALAWLGSGSFLLFPTPVIVAAATLLLFWLFTRKTALGMFIEAVGINIRAAKNA
                     GVNTRIVVMLAYVLSGVCAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGASLM
                     GGRFNLLLSVVGALIIQGMNTGILLSGFPPELNQVVKAVVVLCVLIVQSPRFIGLLKG
                     VRGHDKT"
     misc_feature    504505..505266
                     /locus_tag="KPHS_04670"
                     /note="Ribose/xylose/arabinose/galactoside ABC-type
                     transport system, permease component [Carbohydrate
                     transport and metabolism]; Region: AraH; COG1172"
                     /db_xref="CDD:224093"
     misc_feature    504973..505029
                     /locus_tag="KPHS_04670"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            505373..506347
                     /locus_tag="KPHS_04680"
                     /db_xref="GeneID:11845455"
     CDS             505373..506347
                     /locus_tag="KPHS_04680"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane ABC transporter permease YjfF"
                     /protein_id="YP_005224768.1"
                     /db_xref="GeneID:11845455"
                     /translation="MITLAVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGM
                     TFVILSGGIDLSVGSVIAFTGVFLAKAIGFWGISPLVAFPLVLVMGCAFGAFMGLLID
                     ALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPVYDTLSGLAWTIPGGGRLSAMGLL
                     MLLVVVAGIFVAHRTRFGNQVYAIGGNATSANLMGISTRSATIRIYMLSTGLATLAGI
                     VFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINF
                     DGTLSSWWTKIAIGILLFIFIALQRGLTVLWENRQNAAVTRVSGAGSR"
     misc_feature    505373..506299
                     /locus_tag="KPHS_04680"
                     /note="inner membrane ABC transporter permease protein
                     YjfF; Provisional; Region: PRK11618"
                     /db_xref="CDD:183235"
     gene            complement(506390..507388)
                     /locus_tag="KPHS_04690"
                     /db_xref="GeneID:11845456"
     CDS             complement(506390..507388)
                     /locus_tag="KPHS_04690"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="YP_005224769.1"
                     /db_xref="GeneID:11845456"
                     /translation="MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAG
                     LVDILGASGAENVQGEVQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEH
                     AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGNKQVAAGYVV
                     YGSSTMLVYTTGCGVHAFTYDPSLGVFCLCQERMRFPEKGNTYSINEGNYIKFPQGVK
                     KYIKYCQEEDKATQRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPEGKLRLLYEC
                     NPMAFLAEQAGGKASDGKERILDIIPESLHQRRSFFVGNNHMVEDVENFIKAFPDA"
     misc_feature    complement(506399..507388)
                     /locus_tag="KPHS_04690"
                     /note="fructose-1,6-bisphosphatase; Provisional; Region:
                     PRK09293"
                     /db_xref="CDD:236458"
     misc_feature    complement(order(506993..506995,507074..507079,
                     507320..507328,507332..507334,507356..507358,
                     507365..507367))
                     /locus_tag="KPHS_04690"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:238214"
     misc_feature    complement(order(506564..506566,507053..507055,
                     507059..507061,507119..507124,507191..507193))
                     /locus_tag="KPHS_04690"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238214"
     misc_feature    complement(order(506582..506584,506612..506614,
                     506660..506662,506672..506677,506762..506764,
                     507041..507046,507050..507052))
                     /locus_tag="KPHS_04690"
                     /note="active site"
                     /db_xref="CDD:238214"
     gene            507564..508937
                     /locus_tag="KPHS_04700"
                     /db_xref="GeneID:11845457"
     CDS             507564..508937
                     /locus_tag="KPHS_04700"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="YP_005224770.1"
                     /db_xref="GeneID:11845457"
                     /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLEN
                     QGIDLIQGYDPSQLEPRPDLVIIGNAMTRGNPCVEAVLENNIPYMSGPQWLHDFVLRD
                     RWVLAVAGTHGKTTTAGMATWILEACGYKPGFVIGGVPGNFDVSARLGDSPFFVIEAD
                     EYDCAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGKGKII
                     LPENDINLKQVMAMGCWSEQELVGEQGHWQAKKLNADASQWEVLLDGEKVGEVKWALV
                     GEHNMHNGLMAIAAARHVGVLPADAANALGSFINARRRLELRGEANGVTVYDDFAHHP
                     TAILATLQALRGKVGGTARILAVLEPRSNTMKMGVCKDDLAPSLGRADEVFLLQPQHI
                     PWQVAEVAEACVQPAHWSADVDTLAEMVVKTAHPGDHILVMSNGGFGGIHQKLLDKLA
                     QKAAAAE"
     misc_feature    507567..508913
                     /locus_tag="KPHS_04700"
                     /note="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase; Region: mpl; TIGR01081"
                     /db_xref="CDD:130153"
     gene            509006..509533
                     /locus_tag="KPHS_04710"
                     /db_xref="GeneID:11845458"
     CDS             509006..509533
                     /locus_tag="KPHS_04710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acyltransferase domain protein"
                     /protein_id="YP_005224771.1"
                     /db_xref="GeneID:11845458"
                     /translation="MLTCESVRSTDSPHFAMLDALYARAFPWHEQRESEAKRQALSHP
                     RYALEAWFDEGVFVGLSGCWQFAGYGYIEHLAIDDTLRSRGYGKQLLAQILTRAPLTI
                     LEIDPLTTAIAHKRLRFYQSMGFHANPWAHHHPSYHQGIADHELLVLSYPQPIDERQY
                     QQFARDLGHEVMGRE"
     misc_feature    509162..509383
                     /locus_tag="KPHS_04710"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_7; pfam13508"
                     /db_xref="CDD:338785"
     misc_feature    order(509228..509236,509264..509269)
                     /locus_tag="KPHS_04710"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(509577..510785)
                     /locus_tag="KPHS_04720"
                     /db_xref="GeneID:11845459"
     CDS             complement(509577..510785)
                     /locus_tag="KPHS_04720"
                     /codon_start=1
                     /transl_table=11
                     /product="putative thioredoxin-like protein"
                     /protein_id="YP_005224772.1"
                     /db_xref="GeneID:11845459"
                     /translation="MKKTLVLTTIALLVSGSAAAKTWVLTNAEEGMDKGNWQINSDQL
                     KVKDHAFSIEQKVLHGGKQEGSKILTIHSKDGLTITLSPTRGMNLLRIEGFGSRMGWD
                     SPVKEVVNPAFINLESRNGLGWLEGFNEMMVRCGYEWTGHPVTADGQIYTLHGKAGNT
                     PASLVEVEVADSAPYEIRIRGLVKESTFKKADLQTLTELRYVPGSNSFSLHDVLTNHA
                     DYPHDYQIIYHSNFGTPILEEGARFLAPMSSISPFNDYAKSGLKTWQTYQGPTKDFDE
                     MVFNIQPLADENHQTLAAVVNKAGDKGASIQFDTRQLPVLTLWKNTDTVKQGYVTGIE
                     PGTSYAYPVTIERKQKRVKQLQPGASAQFDLTYTLLHDSAQVAAVEQKIAKIQGDNKV
                     AENETPIAKE"
     misc_feature    complement(509682..510599)
                     /locus_tag="KPHS_04720"
                     /note="Domain of unknown function (DUF4432); Region:
                     DUF4432; pfam14486"
                     /db_xref="CDD:316958"
     misc_feature    complement(order(509784..509786,509820..509822,
                     509964..509966,510093..510095,510099..510101,
                     510324..510326))
                     /locus_tag="KPHS_04720"
                     /note="active site"
                     /db_xref="CDD:185700"
     misc_feature    complement(order(509784..509786,510099..510101))
                     /locus_tag="KPHS_04720"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185700"
     gene            510970..511086
                     /locus_tag="KPHS_04730"
                     /db_xref="GeneID:11845460"
     CDS             510970..511086
                     /locus_tag="KPHS_04730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224773.1"
                     /db_xref="GeneID:11845460"
                     /translation="MFLALTIQLDKSGYKQTYRRVDEGIQAMRRESPCWRKP"
     gene            complement(511800..512351)
                     /locus_tag="KPHS_04740"
                     /db_xref="GeneID:11845461"
     CDS             complement(511800..512351)
                     /locus_tag="KPHS_04740"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein"
                     /protein_id="YP_005224774.1"
                     /db_xref="GeneID:11845461"
                     /translation="MTKQPEDWLDDVPGDDVEDEDDEIIWVSKSEIKRDAEELKRLGA
                     ELVDLGKNALDKIPLDTDLRDAIELAQRIKKEGRRRQLQLIGKMLRNRDVDPIRQALD
                     KLKNRHNQQVALFHKLEQIRDRLIDDGDDAIAEVLNLWPDADRQQLRSLIRNAKKEKE
                     GNKPPKSARLIFQYLRELAENEG"
     misc_feature    complement(511812..512321)
                     /locus_tag="KPHS_04740"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05255"
                     /db_xref="CDD:235377"
     gene            512459..513799
                     /locus_tag="KPHS_04750"
                     /db_xref="GeneID:11845462"
     CDS             512459..513799
                     /locus_tag="KPHS_04750"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase PmbA"
                     /protein_id="YP_005224775.1"
                     /db_xref="GeneID:11845462"
                     /translation="MKVISQVAQQRKTLEEAVTTALELAAGKSDGAEVSVSKTTGIGV
                     STRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSPDAIARTVQAALDIARYTSPD
                     PFAGVADKDLLAFDAPDLDLFHPAEVSPDDAIELAARAEQAALKADKRITNTEGGSFN
                     SHYGIKVFGNSHGMLQSYCSTRHSLSSCVIAEDDGDMERDYAYTIGRAIEDLQSPEWV
                     GEECARRTLSRLAPRKLSTMKAPVIFANEVATGLFGHLVGAIAGGAVYRKSTFLLDSL
                     GKQILPEWLTIEEHPHLLKGLASTPFDSEGVRTERRDIVKDGVLTQWLLTNYSARKLG
                     MKSTGHAGGIHNWRINGRGLSFAKMLKEMGTGLVVTELMGQGVSGVTGDYSRGASGFW
                     VENGEIQYPVSEITIAGNLKEMWRNIVTIGDDIETRSNIQCGSVLLPEMKIAGQ"
     misc_feature    512459..513796
                     /locus_tag="KPHS_04750"
                     /note="peptidase PmbA; Provisional; Region: PRK11040"
                     /db_xref="CDD:182922"
     gene            513836..514222
                     /locus_tag="KPHS_04760"
                     /db_xref="GeneID:11845463"
     CDS             513836..514222
                     /locus_tag="KPHS_04760"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b(562)"
                     /protein_id="YP_005224776.1"
                     /db_xref="GeneID:11845463"
                     /translation="MRKKLLAMLAVSAFALGSASAFADLGEDMDTLAENLQVVQKTSD
                     AGELKAALNKMRTAAVDAQKETPPKLEGKAADSAEMKDYRHGLDILIGQIDGALKLAN
                     EGKVKEAQAAAEEFKTTRNTYHKKYR"
     misc_feature    513836..514219
                     /locus_tag="KPHS_04760"
                     /note="Cytochrome b562; Region: Cytochrom_B562; cl01546"
                     /db_xref="CDD:321561"
     gene            complement(514277..514408)
                     /locus_tag="KPHS_04770"
                     /db_xref="GeneID:11845464"
     CDS             complement(514277..514408)
                     /locus_tag="KPHS_04770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224777.1"
                     /db_xref="GeneID:11845464"
                     /translation="MIDPTYSQGKGKNDGYGVRCITTMSVDKAPAAAERPKKESGKM"
     gene            514512..514850
                     /locus_tag="KPHS_04780"
                     /db_xref="GeneID:11845465"
     CDS             514512..514850
                     /locus_tag="KPHS_04780"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase"
                     /protein_id="YP_005224778.1"
                     /db_xref="GeneID:11845465"
                     /translation="MNNGAVINDVGEQAAQTERLADKMLQQVFALLSRHDIVPNDVQE
                     QMLTSHVRAMAHRSISGEPLPEVDASLFEEISEDSMMLAREVVAQFGNLPDEEAWLLS
                     VHFEVAKDNL"
     misc_feature    514536..514844
                     /locus_tag="KPHS_04780"
                     /note="PRD domain protein EF_0829/AHA_3910; Region:
                     EF_0829; TIGR03582"
                     /db_xref="CDD:132621"
     gene            514861..515223
                     /locus_tag="KPHS_04790"
                     /db_xref="GeneID:11845466"
     CDS             514861..515223
                     /locus_tag="KPHS_04790"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="YP_005224779.1"
                     /db_xref="GeneID:11845466"
                     /translation="MEQITVVIGDRLGKGQKVAAGAEKAGARAVVVPGVAADMKLGDI
                     MKAENATFGISFCGSGGAGAITAQTKYGYKAKYGMRSIDEGVTAINEGCNVLGFGFMD
                     KEELGERLVEAWKKKYGA"
     misc_feature    514870..515208
                     /locus_tag="KPHS_04790"
                     /note="Glycine-rich SFCGS; Region: Gly_rich_SFCGS;
                     cl26041"
                     /db_xref="CDD:330862"
     gene            515226..515525
                     /locus_tag="KPHS_04800"
                     /db_xref="GeneID:11845467"
     CDS             515226..515525
                     /locus_tag="KPHS_04800"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="YP_005224780.1"
                     /db_xref="GeneID:11845467"
                     /translation="MKEQFTTTVRVAGKGESKSRAFADALNHVQAAVMKSSSRILLRI
                     EPQDVTVVHAREAVRKEAFLFFFLRRERRTYSVELDVTVNVTAIDLDKVDFVTQT"
     misc_feature    515229..515516
                     /locus_tag="KPHS_04800"
                     /note="Domain of unknown function (DUF4312); Region:
                     DUF4312; cl11917"
                     /db_xref="CDD:353321"
     gene            515547..516323
                     /locus_tag="KPHS_04810"
                     /db_xref="GeneID:11845468"
     CDS             515547..516323
                     /locus_tag="KPHS_04810"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_005224781.1"
                     /db_xref="GeneID:11845468"
                     /translation="MFLIILIKSLIIGGLVGVGVGAGAARMFHAPTTQGMGAFRTLGE
                     LNSCEGDPASHFSFGLGFFFNAWASSVAAGSFTQDVDHRIIPNWGAAALMLKNRNVGE
                     TLHDPKKMAISCGIIGMIVVAFLNLTASSVPEALQVTAVKVLVPAANLLVNTVMPVIF
                     WLAAIDAGKKSGFWATIFGGAAQLIMGNAVPGLVLGILIGKGVEESGWNRVTKVMMVA
                     IVALFVLSGFFRGFDMKMIESFHLTVPNWLDMIHNSLSGK"
     misc_feature    515622..516320
                     /locus_tag="KPHS_04810"
                     /note="conserved hypothetical protein EF_0832/AHA_3913;
                     Region: EF_0832; TIGR03580"
                     /db_xref="CDD:274659"
     gene            516337..516981
                     /locus_tag="KPHS_04820"
                     /db_xref="GeneID:11845469"
     CDS             516337..516981
                     /locus_tag="KPHS_04820"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_005224782.1"
                     /db_xref="GeneID:11845469"
                     /translation="MEQNKGFWYADWSFPIFVGLLSSGVFAGTHMYYLYGIGAFNEVA
                     FVAMLKSGIDTGVYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGIGLGVPALLLG
                     AGFVFPVANFAASLVTGLVLGLAVGYIIILARKFTINQSDSTYGADVMMGAGNASGRF
                     LGPLIILSAMTASIPIGIGSLVGALLFYIWQKPITGGAILGAMILGSIFPVAIS"
     misc_feature    516343..516969
                     /locus_tag="KPHS_04820"
                     /note="Domain of unknown function (DUF4310); Region:
                     DUF4310; pfam14187"
                     /db_xref="CDD:339115"
     gene            517087..518220
                     /locus_tag="KPHS_04830"
                     /db_xref="GeneID:11845470"
     CDS             517087..518220
                     /locus_tag="KPHS_04830"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase dihydroorotase"
                     /protein_id="YP_005224783.1"
                     /db_xref="GeneID:11845470"
                     /translation="MFDLLLRRARLVDDTLTDIAIQDGKIAALGEISAPSRKTIELNG
                     KVYVSAGWIDSHVHCYPNSPIYHDEPDSVGIATGVTTVIDAGSTGADDVDDFYQLTRK
                     AATEVYALLNISRVGLIAQNELANMANIDAAAVKQAVQRHPDFIVGLKARMSSSVVGE
                     NGITPLARAKAIQQENDDLPLMVHIGNNPPNLDEIADLLSSGDIITHCYNGKPNRILN
                     PAGELRSSITRALQRGVRLDVGHGTASFSFEVARRAIALGILPHTISSDIYCRNRIDG
                     PVRSLALVMSKFLAIGMTLPQVIDCVTVSAAEGLRLSRKGRLEVGFDADLTLFRLEHR
                     PTLLVDAEKESLQADNILVPLAAIRAGKGYLTEQGSAEHAFDF"
     misc_feature    517096..518217
                     /locus_tag="KPHS_04830"
                     /note="dihydroorotase; Provisional; Region: PRK09237"
                     /db_xref="CDD:236423"
     misc_feature    order(517252..517254,517258..517260,517636..517638,
                     517705..517707,517885..517887)
                     /locus_tag="KPHS_04830"
                     /note="active site"
                     /db_xref="CDD:238632"
     gene            518204..519322
                     /locus_tag="KPHS_04840"
                     /db_xref="GeneID:11845471"
     CDS             518204..519322
                     /locus_tag="KPHS_04840"
                     /codon_start=1
                     /transl_table=11
                     /product="DgaE family pyridoxal phosphate-dependent
                     ammonia lyase"
                     /protein_id="YP_005224784.1"
                     /db_xref="GeneID:11845471"
                     /translation="MPSIFEKYHLKQVINTSGRMTALGVSTPRPEVVEAAMAGMNQYF
                     EMKDLVNKTGEYIAKLLDVEGATVVSCASAGIAQSVAAVLVKDSDWLLENLHVTPIEN
                     NEIVLPKGHNVNFGAPVGTMVALGGGKLVEAGYANECSAQQLAAAITPRTAAILYIKS
                     HHCVQKSILNVAQAAEVARQHNLPLIVDAAAEEDLQCYYRMGADLVIYSGAKAIEGPT
                     SGLVIGKTQYVEWVKRQSMGIGRAMKVGKEGILGLTCAIEHYLTASKESGQQMVDKMT
                     PFIEQLNTLNGVTARVVWDSAGRDIARAEIKFDEVTTGVKTGDLVNALKQGEYAIYFR
                     GYKANEGIIEADVRSVNAEQLAVVARRIAEVLNKEKQA"
     misc_feature    518213..519301
                     /locus_tag="KPHS_04840"
                     /note="uncharacterized pyridoxal phosphate-dependent
                     enzyme; Region: selA_rel; TIGR01437"
                     /db_xref="CDD:273623"
     gene            519319..520059
                     /locus_tag="KPHS_04850"
                     /db_xref="GeneID:11845472"
     CDS             519319..520059
                     /locus_tag="KPHS_04850"
                     /codon_start=1
                     /transl_table=11
                     /product="KDGP aldolase family protein"
                     /protein_id="YP_005224785.1"
                     /db_xref="GeneID:11845472"
                     /translation="MKLTPNFYRDRVCLNVLAGSKDNAREIYDAAEGHVLVGVLSKNY
                     PDVASAVADMRDYAKLIDNALSVGLGAGDPNQSAMVSEISRQVQPQHVNQVFTGVATS
                     RALLGQNETVVNGLVSPTGTPGMVKISTGPLSSGAADGIVPLETAIALLKDMGGSSIK
                     YFPMGGLKHRAEFEAVAKACAAHDFWLEPTGGIDLENYSEILKIALDAGVSKIIPHIY
                     SSIIDKASGNTRPADVRQLLEMTKQLVK"
     misc_feature    519340..520020
                     /locus_tag="KPHS_04850"
                     /note="conserved hypothetical protein EF_0839/AHA_3917;
                     Region: EF_0839; TIGR03581"
                     /db_xref="CDD:188342"
     gene            520126..521280
                     /locus_tag="KPHS_04860"
                     /db_xref="GeneID:11845473"
     CDS             520126..521280
                     /locus_tag="KPHS_04860"
                     /codon_start=1
                     /transl_table=11
                     /product="putative isomerase"
                     /protein_id="YP_005224786.1"
                     /db_xref="GeneID:11845473"
                     /translation="MPVARHLLVASLSLFAAAAGAAQTHYAWVGTYNPNGEGLYRFTV
                     DAKTGALRDKTLVSSLPNVAQLTVSRDGKTLYAASEVEKGVVQAWRIEKNGELTALSQ
                     VASGGAGPVYLSLTPDGKHLLVANYVSGSIAVLPVQEDGSLAEAVDRHQDEGPAGAER
                     PAAAVEGSFAISDHNGPHAHMIAADPSGKYVYSTDLGLDRIYQYRLDSASGKLTPNDP
                     PFIAASSPGAGPRHFVFTPQGDGLWLINEEASTLTFYHLDKQSGLLREGKTVSALPEG
                     YKGTSFAAGLVLSNDGKQLYVANRLHNSIAHFTVLADGSLSHQEDIWTRGDYPRTLTL
                     DNQGQWLYVMNQRSDNITRFSVAPKDGKLTFASDYTPVGSPSQMVISAQP"
     misc_feature    520201..521253
                     /locus_tag="KPHS_04860"
                     /note="7-bladed beta-propeller; Region: Lactonase;
                     pfam10282"
                     /db_xref="CDD:337692"
     gene            521303..523213
                     /locus_tag="KPHS_04870"
                     /db_xref="GeneID:11845474"
     CDS             521303..523213
                     /locus_tag="KPHS_04870"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mannitol/fructose-specific PTS family
                     enzyme IIA component"
                     /protein_id="YP_005224787.1"
                     /db_xref="GeneID:11845474"
                     /translation="MRFPNQRLAQLFTLLRNETLPQDELAQRLSVSTRTVRADITALN
                     TLLAQYGAQFILNRGSGYQLKIDNPTSFQALEETAPKAQHVPRTAQDRITFLLVRFLT
                     SAFSIKLEDLADEWFVSRATLQNDMVEVRERFQRYQLTLETRPRHGMKLFGSEVSIRA
                     CLTDLLWELTQQGDIAPPIGAEAFAAEVPALLEPVLQETLTRHHIRLTDAGERFVCLY
                     GAVVVRRVSEGYPLADFSAEDVAQNVRDAARELTGELQRLAGKPLSPAEEEWLCVHIA
                     ARQVQDVDPETISADDDEALVNYILRYINSQYNYNLLDDAQLHADLLTHIKTMITRVR
                     YQIMIPNPLLDNIKQHYPMAWDMTLAAVSSWGKYTPYTISENEIGFLVLHIGVGLERH
                     YNIGYQRQPQVLLVCDTSNAMVRMIEAILQRKYPQLEIAATISQREYEQRDAIEADFV
                     ISTVRIGEKDKPVVTIAPFPTDYQLDQIGKLVLVDRTRPWMLNKYFDAAHFRVVDKPM
                     DQQTLFAELCQQLLEEGFVDAEFHASVVEREAIVSTMLGDGIALPHSLGLLAKKTVVY
                     TVIAPQGIAWGDETAHLIFLLAISKREYEEAMAIYDIFVTFLRERAMSRLAATRSFDE
                     FKTVAMECVSRF"
     misc_feature    521303..522745
                     /locus_tag="KPHS_04870"
                     /note="Transcriptional antiterminator [Transcription];
                     Region: BglG; COG3711"
                     /db_xref="CDD:226234"
     misc_feature    522827..523201
                     /locus_tag="KPHS_04870"
                     /note="Mannitol/fructose-specific phosphotransferase
                     system, IIA domain [Carbohydrate transport and
                     metabolism]; Region: MtlA2; COG4668"
                     /db_xref="CDD:227014"
     misc_feature    order(522914..522916,522962..522964)
                     /locus_tag="KPHS_04870"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    522962..522964
                     /locus_tag="KPHS_04870"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            523291..523533
                     /locus_tag="KPHS_04880"
                     /db_xref="GeneID:11845475"
     CDS             523291..523533
                     /locus_tag="KPHS_04880"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional antitoxin/transcriptional repressor
                     RelB"
                     /protein_id="YP_005224788.1"
                     /db_xref="GeneID:11845475"
                     /translation="MATLNVRLDDKLKKEAYAVLEKLDMTPTEAVRLLFQYIAENGRM
                     PVKSMTISDGEAALLRTVRERLENPRPGVKVSLDDL"
     misc_feature    523291..523530
                     /locus_tag="KPHS_04880"
                     /note="bifunctional antitoxin/transcriptional repressor
                     RelB; Provisional; Region: PRK11235"
                     /db_xref="CDD:183047"
     gene            523523..523807
                     /locus_tag="KPHS_04890"
                     /db_xref="GeneID:11845476"
     CDS             523523..523807
                     /locus_tag="KPHS_04890"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_005224789.1"
                     /db_xref="GeneID:11845476"
                     /translation="MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARL
                     SDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGKREKAAVYHQANKRL"
     misc_feature    523523..523786
                     /locus_tag="KPHS_04890"
                     /note="mRNA-degrading endonuclease RelE, toxin component
                     of the RelBE toxin-antitoxin system [Defense mechanisms];
                     Region: RelE; COG2026"
                     /db_xref="CDD:224937"
     gene            complement(523811..524275)
                     /locus_tag="KPHS_04900"
                     /db_xref="GeneID:11845477"
     CDS             complement(523811..524275)
                     /locus_tag="KPHS_04900"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleotide reductase-activating
                     protein"
                     /protein_id="YP_005224790.1"
                     /db_xref="GeneID:11845477"
                     /translation="MNYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRVNSG
                     MPFTAEMADRIIADLNDTRIKRQGLSLSGGDPLHPQNVADILKLVQRVRAECPGKDIW
                     VWTGYKIDELNAEQMEVVNLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR"
     misc_feature    complement(523814..524275)
                     /locus_tag="KPHS_04900"
                     /note="anaerobic ribonucleotide reductase-activating
                     protein; Provisional; Region: nrdG; PRK11121"
                     /db_xref="CDD:236853"
     misc_feature    complement(order(523898..523900,523961..523969,
                     524051..524056,524060..524062,524174..524182,
                     524186..524188,524192..524194,524198..524200))
                     /locus_tag="KPHS_04900"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(524516..526654)
                     /locus_tag="KPHS_04910"
                     /db_xref="GeneID:11845478"
     CDS             complement(524516..526654)
                     /locus_tag="KPHS_04910"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside triphosphate reductase"
                     /protein_id="YP_005224791.1"
                     /db_xref="GeneID:11845478"
                     /translation="MTPHVMKRDGCKVPFNSERIQEAILRAAKAAGVDDADYCATVAE
                     VVSQQMQGRAQVDINEIQTAVENQLMSGPYKQLARAYIEYRHDRDSQREKRGRLNQEI
                     RGLVEQTNSALLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPHDVVMAHERGMIH
                     YHDLDYSPFFPMFNCMLIDLKGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEVLAPFVSESFKKHRKIAEEWQIPDAEGYARARTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGTSWESRLIQQSILRNRIAGLGKNRKTAVFPKLVFAI
                     RDGLNHKFGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVWE
                     NENGEQVHDGRNNLGVISLNLPRIALEAKGDEAAFWALLDERLQLARKALMTRIARLE
                     GVKARVAPILYMEGACGVRLKADDDVSEIFKNGRASISLGYIGIHETINALYGNQHMY
                     DSKALREKGVAIVQRLRDAVDLWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGVVEG
                     VTDKGYYTNSFHLDVEKKVNPYDKIDFEAPYPPLANGGFICYGEYPNIQHNLKALEDV
                     WDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDAARVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRVKHLGNGQIG"
     misc_feature    complement(524522..526654)
                     /locus_tag="KPHS_04910"
                     /note="anaerobic ribonucleoside triphosphate reductase;
                     Provisional; Region: PRK09263"
                     /db_xref="CDD:236436"
     gene            526924..527052
                     /locus_tag="KPHS_04920"
                     /db_xref="GeneID:11845479"
     CDS             526924..527052
                     /locus_tag="KPHS_04920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224792.1"
                     /db_xref="GeneID:11845479"
                     /translation="MMGAGDKCKFRRLKYKQKSSPFRHETGKYSGNQRIVKQIDQQ"
     gene            complement(527011..527754)
                     /locus_tag="KPHS_04930"
                     /db_xref="GeneID:11845480"
     CDS             complement(527011..527754)
                     /locus_tag="KPHS_04930"
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="YP_005224793.1"
                     /db_xref="GeneID:11845480"
                     /translation="MDIVGQLQEGMRRFSAQESRVATFILQNLSFTASASIDELAASA
                     GVSPATITRFARSVGCDDIRDLRKQLAQASERRASWLTPDSAALPVAWRDKLSSLGVT
                     LTRQLGHTAEAAVEKCKSRLLSARAVHCFALGAQDVTLAALLQHQLLPSGIAINLCQD
                     AALMRLTASTLNDDHLLLVLATAEANPVLQSATLQARTQGVTIIALTPEQHALGDMAS
                     AILPLPADPQQARYALLLLVDLLNDTLIA"
     misc_feature    complement(527059..527754)
                     /locus_tag="KPHS_04930"
                     /note="DNA-binding transcriptional regulator, MurR/RpiR
                     family, contains HTH and SIS domains [Transcription];
                     Region: RpiR; COG1737"
                     /db_xref="CDD:224651"
     gene            complement(527757..527930)
                     /locus_tag="KPHS_04940"
                     /db_xref="GeneID:11845481"
     CDS             complement(527757..527930)
                     /locus_tag="KPHS_04940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224794.1"
                     /db_xref="GeneID:11845481"
                     /translation="MKIIFTDVIEAQFLRIFIARVSPFTALTIGNMRRECYKERQSII
                     EKYFQMRVLPKGT"
     gene            528060..528323
                     /locus_tag="KPHS_04950"
                     /db_xref="GeneID:11845482"
     CDS             528060..528323
                     /locus_tag="KPHS_04950"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphotransferase protein"
                     /protein_id="YP_005224795.1"
                     /db_xref="GeneID:11845482"
                     /translation="MLVNKMKAEAQQRALALEIYAVAVAEFERELPHADVILLGPQVK
                     YEAGRLTALAAPQGKAVAVIDMADYGMMRGAAVLDKALALLEH"
     misc_feature    528060..528308
                     /locus_tag="KPHS_04950"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     gene            528414..529721
                     /locus_tag="KPHS_04960"
                     /db_xref="GeneID:11845483"
     CDS             528414..529721
                     /locus_tag="KPHS_04960"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="YP_005224796.1"
                     /db_xref="GeneID:11845483"
                     /translation="MQALKIAVIGGGSSYTPELIEGIIVRYEQLPVTELALVDVESGR
                     EKVEIIAALTRRMLKHKGLEQVAVSVHFTLDEAIRGASFVLTQLRVGQLAARAADERL
                     GLKYHLLGQETTGVGGFAKALRTIPVILEVARKVEQLAPEAFILNFTNPAGIVTEAVS
                     RYSTAKIIGLCNVPINMQHMIVGMLGAQESEVKLRFAGLNHMVWVHKVLQGREDVTGK
                     VIDMLCDGKALSMNNIKELPWPAEFLRALKAIPCPYHRYFWLTPAMLAEEIAAAKTKG
                     TRAEQVMKVEQELFALYADPQLEEKPEQLSFRGGAYYSEVAVELINAIYNNLGAEMVV
                     NTRNNGAIHGLDDDAVVETNSIIDAQGARPLAFGPLPPAMNGLTQQVKAFERLTIEAA
                     VHGCRESALLALVANPLVGNVTDAQALLDEVLTINRQWLTQFN"
     misc_feature    528423..529706
                     /locus_tag="KPHS_04960"
                     /note="Glycoside Hydrolases Family 4;
                     Phospho-beta-glucosidase; Region: GH4_P_beta_glucosidase;
                     cd05296"
                     /db_xref="CDD:133432"
     misc_feature    order(528447..528452,528456..528458,528528..528533,
                     528549..528551,528672..528680,528747..528749,
                     528807..528809,528855..528857,528861..528863,
                     529269..529271,529335..529337,529350..529352)
                     /locus_tag="KPHS_04960"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133432"
     misc_feature    order(528699..528701,528747..528749,528861..528863,
                     528927..528929,529014..529016,529173..529175,
                     529245..529247,529335..529340,529350..529352)
                     /locus_tag="KPHS_04960"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:133432"
     misc_feature    order(528924..528926,529014..529016)
                     /locus_tag="KPHS_04960"
                     /note="divalent metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133432"
     misc_feature    order(528981..528983,528990..528992,529038..529040,
                     529047..529049,529392..529394,529428..529430,
                     529485..529490,529494..529496,529500..529511)
                     /locus_tag="KPHS_04960"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133432"
     misc_feature    order(529131..529133,529137..529139,529146..529154,
                     529188..529190,529194..529199,529524..529529,
                     529548..529550,529560..529562,529581..529583,
                     529605..529607,529614..529619,529647..529652,
                     529656..529658,529662..529664)
                     /locus_tag="KPHS_04960"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133432"
     gene            529748..531100
                     /locus_tag="KPHS_04970"
                     /db_xref="GeneID:11845484"
     CDS             529748..531100
                     /locus_tag="KPHS_04970"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphotransferase protein"
                     /protein_id="YP_005224797.1"
                     /db_xref="GeneID:11845484"
                     /translation="MSNTSWIERYVMPVALRIAGQKHVLSVRDGIILNMPFMLIGSFF
                     LIFAYLPIPGYADMMSGLFGEVWRDKMLYPVKATYDIMALISSFGIAYRLAEKYRTLD
                     PLSAGAMSLVAFMMTIPQNTLFTPVHGAAEVIKGVIPVSMVGSQGLFVAIVISLLSTE
                     IYRLVASRNLVIRMPDGVPPAVAKSFLALIPGFCVLAVVLALRLAVEASPFGDINSMI
                     ATLIGIPMHHVGGTLPGMIISVILIGILWTLGLHGDAIVLVFIQPVWLSNMSENLTAF
                     QNGQPIPHIITQQFYDLWIAPGGTGALLGLVIFMLLRSRSQQMKQLGKIAAPGALFNI
                     SEPMVFGIPLVMNPYFFLPFILTPVLLVIVSYTAMATGLVAPPAGIALPFTTPIFISG
                     YLATGGHISGTVLQVVNLAISLVVYYPFFRAWDRLKAKEEHASAQPQASAAIADADRA
                     "
     misc_feature    529778..531043
                     /locus_tag="KPHS_04970"
                     /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
                     cl21492"
                     /db_xref="CDD:328750"
     gene            complement(531156..532811)
                     /locus_tag="KPHS_04980"
                     /db_xref="GeneID:11845485"
     CDS             complement(531156..532811)
                     /locus_tag="KPHS_04980"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalase 6-P hydrolase"
                     /protein_id="YP_005224798.1"
                     /db_xref="GeneID:11845485"
                     /translation="MNHLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVTARLDYLQK
                     LGVDAIWLTPFYVSPQVDNGYDVANYTAIDPSYGTMADFDALVAEAKARGIRIVLDMV
                     LNHTSTEHEWFRQSLNKESPYRQFYIWRDGEPDALPNNWRSKFGGNAWQWHADSGQYY
                     LHLFAIEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVVNLISKDQTFPCDLDGD
                     GRRFYTDGPRVHEFLQEMSRDVFTPRNLMTVGEMSSTSLEHCQQYAALDGRELSMTFN
                     FHHLKVDYPGGEKWTLARPDYVALKALFRHWQRGMHNRAWNALFWCNHDQPRIVSRFG
                     DEGEYRVTAAKMLAMVLHGMQGTPYIYQGEEIGMTNPHFSSISDYRDVESHNMFIERA
                     AQGQSPDELLAILASKSRDNSRTPMPWHAGENGGFSDGEPWIGLGDNYQEINVEAALA
                     DPDSVFYTYQQLITLRKTLPLLTWGDYEDLLPEHPSLWCYRRQWQGQTLVVAANLSRE
                     LQAWQPAEAPGEWKMIISNYAETTPRPTGLTLRPFEAIWWLQG"
     misc_feature    complement(531159..532811)
                     /locus_tag="KPHS_04980"
                     /note="trehalose-6-phosphate hydrolase; Provisional;
                     Region: PRK10933"
                     /db_xref="CDD:182849"
     gene            complement(532863..534281)
                     /locus_tag="KPHS_04990"
                     /db_xref="GeneID:11845486"
     CDS             complement(532863..534281)
                     /locus_tag="KPHS_04990"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose(maltose)-specific PTS system
                     components IIBC"
                     /protein_id="YP_005224799.1"
                     /db_xref="GeneID:11845486"
                     /translation="MSKVNQQDIDKLIELVGGRGNIATVSHCITRLRFVLNDPAIARP
                     KEIEQLRMVKGCFTNAGQFQVVIGTEVGDYYKALLATTGQTSADKEQVKQAARQNMKW
                     HEQLISHFAEIFFPLLPALISGGLILGFRNVIGDLPMSNGQTLAQMHPSLKTIYDFLW
                     LIGEAIFFYLPVGICWSAVKKMGGTPILGIVLGVTLVSPQLMNAYLLGQQVPEVWNFG
                     LFTIAKVGYQAQVIPALLAGLALGFIETRLKRIVPDYLYLVIVPVCSLILAVFLAHAV
                     IGPFGRLIGDGVAFAVRHLLTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDMQMIQS
                     MGGTPVWPLIALSNIAQASAVVGIIIASRKQNEREISVPAAISAYLGVTEPAMYGINL
                     KYRFPMLCAMIGSGLAGLLCGLNGVLANGIGVGGLPGILSIQPTYWQVYAMAMAIAVV
                     VPIILTSVVYQRKYRQGTLQIV"
     misc_feature    complement(532866..534281)
                     /locus_tag="KPHS_04990"
                     /note="PTS system trehalose(maltose)-specific transporter
                     subunits IIBC; Provisional; Region: PRK11007"
                     /db_xref="CDD:182896"
     gene            complement(534412..535359)
                     /locus_tag="KPHS_05000"
                     /db_xref="GeneID:11845487"
     CDS             complement(534412..535359)
                     /locus_tag="KPHS_05000"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose repressor"
                     /protein_id="YP_005224800.1"
                     /db_xref="GeneID:11845487"
                     /translation="MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSERTRERVEAVMQ
                     QHGFSPSRSARAMRGQSDKVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQF
                     SPALVEEHLGMLARRNIDGVVLFGFTGIDEAMLAPWRDTLVLMARDAPGFASVCYDDE
                     GAITLLMQRLYDRGHRHISFLGVPHSDVTTGERRHLAYLAFCKKHRLTPTAALPGLGM
                     KQGYDTVASVLMAETSALVCATDTLALGASKYLQQQGRDALQLASVGSTPLMKFLHPE
                     ILTVDPGYAESGRRAARQLIEQIAGSVDPRQIVIPAALN"
     misc_feature    complement(534415..535359)
                     /locus_tag="KPHS_05000"
                     /note="trehalose repressor; Provisional; Region: treR;
                     PRK09492"
                     /db_xref="CDD:181905"
     gene            535739..538447
                     /locus_tag="KPHS_05010"
                     /db_xref="GeneID:11845488"
     CDS             535739..538447
                     /locus_tag="KPHS_05010"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-transporting ATPase MgtA"
                     /protein_id="YP_005224801.1"
                     /db_xref="GeneID:11845488"
                     /translation="MLKNYTRQLFAQLSRHLPRRLVQRDPLPDARHLASGPIPESLGQ
                     HCLNVAAMDDQEIWRAFDSHPEGLNEGEVAAKILKHGDNQIPAQKPSPWWVHLWTCYR
                     NPFNLLLTVLGIVSYSTEDLFAAGVIALMVGISTLLNFIQEARSTKAADALKAMVSNT
                     ATVLRVVNEQGESRWLELPIDQLVPGDIIRLSAGDMIPADLRILQARDLFVAQASLTG
                     ESLPVEKVARSRDPLQQNPLECDTLCFMGTNVVSGSAQAIVFATGGRTWFGQLAGRVS
                     EQESEPNAFQKGISRVSMLLIRFMLVMAPVVLLINGYTKGDWWEAALFALSVAVGLTP
                     EMLPMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENH
                     TDVSGKVCERVLHAAWLNSHYQTGLKNLLDTAVLEGVELDAARGLAERWQKVDEIPFD
                     FERRRMSVVVKEDDAAHQLICKGALQEILNVSTQVRYNGDIVPLDDTMLRRIRRVTDT
                     LNRQGLRVVAVATKYLPAREGDYQRADESDLILEGYIAFLDPPKETTAPALKALKASG
                     ITVKILTGDSELVAAKVCHEVGLDAGEVVIGSQIEAMSDDELAALAKRTTLFARLAPL
                     HKERIVTLLKREGHVVGFMGDGINDAPALRAADIGISVDGAVDIAREAADIILLEKSL
                     MVLEEGVIEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLL
                     YDVSQVAIPFDNVDDEQIRKPQRWNPADLGRFMVFFGPISSIFDILTFGLMWWVFHAN
                     TVEMQTLFQSGWFIEGLLSQTLIVHMIRTRRIPFVQSRAAWPLFAMTLVVMAVGIALP
                     FSPLASYLQLQALPLSYFPWLVAILAGYMVLTQAVKGFYSRRYGWQ"
     misc_feature    535739..538444
                     /locus_tag="KPHS_05010"
                     /note="magnesium-transporting ATPase MgtA; Provisional;
                     Region: PRK10517"
                     /db_xref="CDD:236705"
     gene            complement(538520..538906)
                     /locus_tag="KPHS_05020"
                     /db_xref="GeneID:11845489"
     CDS             complement(538520..538906)
                     /locus_tag="KPHS_05020"
                     /codon_start=1
                     /transl_table=11
                     /product="2-iminobutanoate/2-iminopropanoate deaminase"
                     /protein_id="YP_005224802.1"
                     /db_xref="GeneID:11845489"
                     /translation="MSKTIATENAPAAIGPYVQGVDLGSMIITSGQIPVDPKTGSVPE
                     DVSAQARQSLNNVKAIVEAAGLTVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNATF
                     PARSCVEVARLPKDVKIEIEAIAVRR"
     misc_feature    complement(538526..538906)
                     /locus_tag="KPHS_05020"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cl10015"
                     /db_xref="CDD:299145"
     misc_feature    complement(order(538535..538537,538541..538543,
                     538547..538549,538577..538600,538634..538636,
                     538643..538645,538676..538678,538682..538684,
                     538688..538693,538697..538699,538814..538819,
                     538823..538825,538829..538831,538838..538840,
                     538844..538846,538853..538858))
                     /locus_tag="KPHS_05020"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(538547..538549,538592..538594,
                     538643..538645,538655..538657,538856..538858))
                     /locus_tag="KPHS_05020"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            complement(539059..539520)
                     /locus_tag="KPHS_05030"
                     /db_xref="GeneID:11845490"
     CDS             complement(539059..539520)
                     /locus_tag="KPHS_05030"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory
                     subunit"
                     /protein_id="YP_005224803.1"
                     /db_xref="GeneID:11845490"
                     /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTETDQRITI
                     GLNLPSGEMGRKDLIKIENTFLTDEQVNQLSLYAPQATVNRIDDYEVVGKSRPSLPDR
                     IDSVLVCPNSNCISHAEPVSSSFAVKKRADDIALKCKYCEKEFSHYVVLAN"
     misc_feature    complement(539062..539517)
                     /locus_tag="KPHS_05030"
                     /note="aspartate carbamoyltransferase regulatory subunit;
                     Reviewed; Region: PRK00893"
                     /db_xref="CDD:234859"
     gene            complement(539534..540469)
                     /locus_tag="KPHS_05040"
                     /db_xref="GeneID:11845491"
     CDS             complement(539534..540469)
                     /locus_tag="KPHS_05040"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase catalytic
                     subunit"
                     /protein_id="YP_005224804.1"
                     /db_xref="GeneID:11845491"
                     /translation="MANPLYQKHIISINDLSREDLELVLATAAKLKANPQPELLKHKV
                     IASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDA
                     IVMRHPQEGAARLATEFSGGVPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNVAM
                     VGDLKYGRTVHSLTQALAKFNGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSAIDD
                     VMAEVDILYMTRVQKERLDPSEYANVKAQFVLRAADLEGARANMKVLHPLPRIDEITT
                     DVDKTPHAWYFQQAGNGIFARQALLALVLNSELAL"
     misc_feature    complement(539552..540448)
                     /locus_tag="KPHS_05040"
                     /note="aspartate carbamoyltransferase; Region:
                     asp_carb_tr; TIGR00670"
                     /db_xref="CDD:273209"
     gene            540805..541257
                     /locus_tag="KPHS_05050"
                     /db_xref="GeneID:11845492"
     CDS             540805..541257
                     /locus_tag="KPHS_05050"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="YP_005224805.1"
                     /db_xref="GeneID:11845492"
                     /translation="MIIGNIHHLQPWLPAALREAIEHVIAQVSEATPLGKHAIDGDNL
                     FYLISEDTTEPQAARRAEYHARYLDIQIVLRGSEGMTFSTLPPGEPQTDWLAEKDIAF
                     LAEGQQEKTVILNEGDFVVFYPGEVHKPLCAVGAPAKVRKAVVKMLMV"
     misc_feature    540805..541251
                     /locus_tag="KPHS_05050"
                     /note="Beta-galactosidase, beta subunit [Carbohydrate
                     transport and metabolism]; Region: EbgC; COG2731"
                     /db_xref="CDD:225345"
     gene            541315..541446
                     /locus_tag="KPHS_05060"
                     /db_xref="GeneID:11845493"
     CDS             541315..541446
                     /locus_tag="KPHS_05060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224806.1"
                     /db_xref="GeneID:11845493"
                     /translation="MFFLAIPAFLLLIPSHLLLQPNAHTERIVQILMAISLIRYITY"
     gene            541500..542474
                     /locus_tag="KPHS_05070"
                     /db_xref="GeneID:11845494"
     CDS             541500..542474
                     /locus_tag="KPHS_05070"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar isomerase (SIS)"
                     /protein_id="YP_005224807.1"
                     /db_xref="GeneID:11845494"
                     /translation="MNTKEIINAVAKEIEDKGGIRQVFLVACGGSLVDMYPAKYFLDS
                     EATKLHVGMYTANEFVYATPKTLGENSLVIVCSHGGNTPESVAAAKLAQQHQAHTITL
                     THNAQAQLIEYASHNILYAWGNDTNVVDNPMAIILNLCVDTLQQVEGFNNYADFQQGM
                     TQINGVIAHGRQQVADRCQRFAQKYQDEKLFYILSSGASYGHAYGFAICSLMEMQWLH
                     AAPIHSGEYFHGPFEVTNKETPFILLMNEGRTRAMDERALAFLTKYAEKVEVVDAKEL
                     GIGVLPPSVVEFFNPVLFYSIMCEYRSALADIRQHPLDTRRYMGLVEY"
     misc_feature    541512..542471
                     /locus_tag="KPHS_05070"
                     /note="Fructoselysine-6-P-deglycase FrlB and related
                     proteins with duplicated sugar isomerase (SIS) domain
                     [Cell wall/membrane/envelope biogenesis]; Region: AgaS;
                     COG2222"
                     /db_xref="CDD:225132"
     gene            542486..543316
                     /locus_tag="KPHS_05080"
                     /db_xref="GeneID:11845495"
     CDS             542486..543316
                     /locus_tag="KPHS_05080"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase-like domain-containing protein"
                     /protein_id="YP_005224808.1"
                     /db_xref="GeneID:11845495"
                     /translation="MNVIGIGDNVVDKYVHTQTMYPGGNALNFAAYAAMLGHNAAYLG
                     IFGNDAAAEHVMQVLDKVGVKWPHCLQVAGENGCAQLKIEEGERIFLGSNAGGIRKTT
                     SMDFIFQHEQYLREFDLIHSGCYSYMETHLPQLRELNIPVSFDFSDDFVLEQALPLCR
                     YVDFAFFSCADYSLAQTREIVQQAQASGSRIVCATRGDEGAILFDGQDWYQQAPDYVT
                     PVDTMGAGDAFITAFICHFLAQPTGNKREAITNSLQKAAAFSAQICLKEGAFGYGTHY
                     "
     misc_feature    542492..543295
                     /locus_tag="KPHS_05080"
                     /note="ribokinase/pfkB superfamily: Kinases that accept a
                     wide variety of substrates, including carbohydrates and
                     aromatic small molecules, all are phosphorylated at a
                     hydroxyl group. The superfamily includes ribokinase,
                     fructokinase, ketohexokinase; Region:
                     ribokinase_pfkB_like; cl00192"
                     /db_xref="CDD:350937"
     misc_feature    order(542567..542569,543155..543157,543164..543166)
                     /locus_tag="KPHS_05080"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238177"
     misc_feature    order(542987..542989,543068..543070,543149..543151,
                     543158..543163,543170..543172)
                     /locus_tag="KPHS_05080"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238177"
     gene            543411..544976
                     /locus_tag="KPHS_05090"
                     /db_xref="GeneID:11845496"
     CDS             543411..544976
                     /locus_tag="KPHS_05090"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase family protein"
                     /protein_id="YP_005224809.1"
                     /db_xref="GeneID:11845496"
                     /translation="MHSDAADLILRSDAIFTAARNELFSGYVVIKNGAIAAMIANGED
                     IQTWRGERTRFIELGDRLICPGFCDNHTFFTGYMSMQRGVDLHAARDSNHALELLQDA
                     EKLLPEEKSLYGWGWSAARWGAVPDARLLDDAFPQRPVVAINDDKSYCWMNRAAVELY
                     GFTAEECSAEARIALLDEMLSDTAQLKKEMRAFMARLAGQGITAIKDVCFNDAPQLMN
                     AWDELEKEDALLLRVSIVSQPVSAPVDLAFGEQARRRFHSPWLRFHGFKFMVDGVIAD
                     HTGDMIYPYADRPGTNNERPVDYNALRQQVLLADARGFNCCMNAEGDAAIRRCIDIFA
                     ECRKRHPQSVVRHSLSDLECPHPNDIPRMAELGLFAEVYAQILLLNPCEAGAYMRERY
                     GEEREAQFYDYAALFGAGVTVTIGTDLPLFIPSVPDSMYAACSRQFPDGSPVNGWYRE
                     RGMTRQQLLTAWTLNSARHHGMEEMTGSLEPGKRADIAVFDRNLLSCPNDELRTSTVV
                     LTLVDGRITHDLL"
     misc_feature    543492..544877
                     /locus_tag="KPHS_05090"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:351001"
     misc_feature    order(543621..543623,543627..543629,544365..544367,
                     544461..544463,544662..544664)
                     /locus_tag="KPHS_05090"
                     /note="active site"
                     /db_xref="CDD:238617"
     misc_feature    <544797..544967
                     /locus_tag="KPHS_05090"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:351001"
     gene            545033..546451
                     /locus_tag="KPHS_05100"
                     /db_xref="GeneID:11845497"
     CDS             545033..546451
                     /locus_tag="KPHS_05100"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate anaerobic carrier"
                     /protein_id="YP_005224810.1"
                     /db_xref="GeneID:11845497"
                     /translation="MRIAKIKWAMPHCYALIFFIIILVALLTWCIPSGSFDYHSVTLP
                     GGETKTLVIPGSYHLLDKVSSEGDLRQGIAAVLAAPMEGIIKAADVVAFVLIVGGAFG
                     IILRTGAIERGLVALAERLAGKGILVIPIAMTLFSLGGATFGMSEEVIPLYAIFISLM
                     FALGYDSMTAILILFLGTQIGYVGAMTNPFSVLIAQGVAGIQGNPQLWLRAIAWLVFT
                     LLAIAYTMWYAHRVKRTPQKSPVYENDCRNREQFLSIQDTSVHFSIADRVIIIAFVLA
                     LAVISWGLITRGWYMVEIGSVFLALGLFSGIVGRMGISGMADSFVEGCKEFVYAAVVI
                     GLARGILVVAENGRIIDTLLFGLSEMLEGLPQYAFTTLMLLGHNVITFFVPSSSGEAA
                     LTMPVLAPLGDLVGINKEAMVMAYQFGNGLTNLVSPTGGVLLAGLSIARIGFGQWLKA
                     IAPLFPVLWIVSAAFAAISAWV"
     misc_feature    545042..546427
                     /locus_tag="KPHS_05100"
                     /note="Uncharacterized membrane protein YfcC, ion
                     transporter superfamily [General function prediction
                     only]; Region: YfcC; COG1288"
                     /db_xref="CDD:224207"
     gene            546536..547261
                     /locus_tag="KPHS_05110"
                     /db_xref="GeneID:11845498"
     CDS             546536..547261
                     /locus_tag="KPHS_05110"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005224811.1"
                     /db_xref="GeneID:11845498"
                     /translation="MSNFGLQQNTSVPLYRQLKDKILSDISSGKLAEGEKIPTEIELS
                     ELYNISRITVRNAVKELVAEGYLVKKQGKGTFVCLPKIERKVVHLLSFTAACDANHLP
                     THSVVTRREILRDYRNARQLLELESDDSVLYIQRLRIAGDAPLMLENNYYSLKRLGFL
                     QQEDLSGSLYQLLREKYAIVPTYAGETTVEMVRADSDSAPLLKQPPGEPLFLMKTLIL
                     DSQHQPIHYGEQYIVAERYTFSF"
     misc_feature    546569..547252
                     /locus_tag="KPHS_05110"
                     /note="DNA-binding transcriptional regulator, GntR family
                     [Transcription]; Region: MngR; COG2188"
                     /db_xref="CDD:225099"
     gene            complement(547264..548268)
                     /locus_tag="KPHS_05120"
                     /db_xref="GeneID:11845499"
     CDS             complement(547264..548268)
                     /locus_tag="KPHS_05120"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="YP_005224812.1"
                     /db_xref="GeneID:11845499"
                     /translation="MSAFYQKHFLKLLDFTPAEITALLELAAKLKADKKNGIEVQKLA
                     GKNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYD
                     GIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMKEHLPGKAFNQMTLV
                     YAGDARNNMGNSMLEAAALTGLDLRLVAPSACWPEAALVETCTALAKQQGGNITLTED
                     IAAGVKGADFIYTDVWVSMGEAKEKWAERIALLRDYQVNSAMLALTGNPQVKFLHCLP
                     AFHDDQTTLGKQMAADYGLHGGMEVTDEVFESAASVVFDQAENRMHTIKAVMVATLSR
                     "
     misc_feature    complement(547267..548268)
                     /locus_tag="KPHS_05120"
                     /note="ornithine carbamoyltransferase subunit I;
                     Provisional; Region: PRK03515"
                     /db_xref="CDD:179587"
     gene            548432..548854
                     /locus_tag="KPHS_05130"
                     /db_xref="GeneID:11845500"
     CDS             548432..548854
                     /locus_tag="KPHS_05130"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E inhibitor RraB"
                     /protein_id="YP_005224813.1"
                     /db_xref="GeneID:11845500"
                     /translation="MANPEHLEEQREETRLIIEELLEDGSDPDALYTIEHHLSADDFE
                     TLEKVAVEAFKLGYEVTEPEELEVEEGDMVICCDILSECALNADLIDAQVEQLMTLAE
                     KYDVEYDGWGTYYEDPNGEDGDDDDEEYVDEDDDGVRH"
     misc_feature    548432..548788
                     /locus_tag="KPHS_05130"
                     /note="RNase E inhibitor protein; Provisional; Region:
                     PRK11191"
                     /db_xref="CDD:236876"
     gene            548913..549677
                     /locus_tag="KPHS_05140"
                     /db_xref="GeneID:11845501"
     CDS             548913..549677
                     /locus_tag="KPHS_05140"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxylase for synthesis of
                     2-methylthio-cis-ribozeatin in tRNA"
                     /protein_id="YP_005224814.1"
                     /db_xref="GeneID:11845501"
                     /translation="MDYPQILSPIISFLHCPTPQAWIDEARKPENLPLLLTDHMVCEL
                     KAAQNAMLLVRRYVADKADADELLACLKPYEDFTYRRGPEPDFVTLHKRINKSAMPQT
                     DDPWGRQLLDSMILLIKEELHHFWQVREMMLARDIPYVKITASNYARGLRREVRSHEP
                     VMLIDKLICGAYIEARSCERFAALAPWLDDDLQKFYLSLLRSEARHYQDYLDLAQKIA
                     GEDISERVRQLGEAEAALILRPEAEFRFHSGVPVAA"
     misc_feature    548925..549656
                     /locus_tag="KPHS_05140"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cl00264"
                     /db_xref="CDD:350992"
     misc_feature    order(549039..549041,549273..549275,549282..549284,
                     549432..549434,549519..549521,549528..549530)
                     /locus_tag="KPHS_05140"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153097"
     gene            complement(549939..550442)
                     /locus_tag="KPHS_05150"
                     /db_xref="GeneID:11845502"
     CDS             complement(549939..550442)
                     /locus_tag="KPHS_05150"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_005224815.1"
                     /db_xref="GeneID:11845502"
                     /translation="MNTSVPAATLLRRITAADNAAIARVIRQVSAEYGLTADKGYTVA
                     DPNLDELYELYSQPGSAYWVVEQEGEVVGGGGVAPLACSEPDICELQKMYFMTSARGQ
                     GLAKKLALLALDYAREQGFKRCYLETTAFLTEAIGLYEHLGFEHIDGPLGCTGHVDCE
                     VRMLKTL"
     misc_feature    complement(550011..>550193)
                     /locus_tag="KPHS_05150"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:334159"
     gene            complement(550563..553418)
                     /locus_tag="KPHS_05160"
                     /db_xref="GeneID:11845503"
     CDS             complement(550563..553418)
                     /locus_tag="KPHS_05160"
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="YP_005224816.1"
                     /db_xref="GeneID:11845503"
                     /translation="MEKTYNPQDIEQPLYEHWEKQGYFKPNGDESQESFCIMIPPPNV
                     TGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTR
                     HDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRL
                     YKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLV
                     VATTRPETLLGDTGVAVNPEDPRYKDLIGKFVVLPLVNRRIPIVGDEHADMEKGTGCV
                     KITPAHDFNDYEVGRRHQLPMINILTFDGDIRESAEVYDTKGNESDVYSSEIPAEFQK
                     LERFAARKAVVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKP
                     AVEAVENGDIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGNVYVGRS
                     EDEVRQENNLSADVALRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSG
                     FDIIFFWIARMIMMTMHFIKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPL
                     DMVDGITLPELLEKRTGNMMQPQLADKIRKRTEKQFPNGIEPHGTDALRFTLAALAST
                     GRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEDQDCGFNGGEMVLSLADRWIIAEFN
                     HTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMNGGNEAELRGTRHTLV
                     TVLEGLLRLAHPIIPFITETIWQRVKAICGITADTIMLQPFPQYDASQVDDAALADTE
                     WLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSKDAERRVNDNRSFLLNLARLESITVL
                     PADDKGPVSVTKIVDGAELLIPMAGLINKEDELARLAKEVAKIEGEIGRIESKLANEG
                     FVARAPEAVIAKEREKLEGYAEAKAKLIEQQAVIAAL"
     misc_feature    complement(550569..553418)
                     /locus_tag="KPHS_05160"
                     /note="valyl-tRNA synthetase; Reviewed; Region: valS;
                     PRK05729"
                     /db_xref="CDD:235582"
     gene            complement(553418..553861)
                     /locus_tag="KPHS_05170"
                     /db_xref="GeneID:11845504"
     CDS             complement(553418..553861)
                     /locus_tag="KPHS_05170"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="YP_005224817.1"
                     /db_xref="GeneID:11845504"
                     /translation="MKNATFYLLDNDATVDGLSAVEQLVCDIAAERWRNGKRVLIACE
                     DEQQAIRLDEALWSRPPESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRLN
                     FADFATAFTEVIDFVPYEDNLKQLARERYKAYRMAGFNLNTATWK"
     misc_feature    complement(553421..553861)
                     /locus_tag="KPHS_05170"
                     /note="DNA polymerase III subunit chi; Validated; Region:
                     PRK05728"
                     /db_xref="CDD:235581"
     gene            complement(553981..555492)
                     /locus_tag="KPHS_05180"
                     /db_xref="GeneID:11845505"
     CDS             complement(553981..555492)
                     /locus_tag="KPHS_05180"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="YP_005224818.1"
                     /db_xref="GeneID:11845505"
                     /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYIS
                     ALLRRGELEGKPGQTLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINTLND
                     TGSMEAVCFLTELHVKGRNNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFN
                     VPTRRELTSGERAIQHGLAIAAGIKAAKDLGNMPPNICNAAYLASQARQLADTYSKNV
                     ITRVIGEQQMRELGMNAYLAVGNGSQNESLMSVIEYKGNPAEDARPIVLVGKGLTFDS
                     GGISIKPAEGMDEMKYDMCGAAAVYGVMRMVAELQLPLNVIGVLAGCENMPGGRAYRP
                     GDVLTTMSGQTVEVLNTDAEGRLVLCDVLTYVERFEPEAVIDVATLTGACVIALGHHI
                     TGLMSNHNPLAHELIGASELAGDRAWRLPLADEFQDQLESNFADMANIGGRPGGAITA
                     GCFLSRFTRKYNWAHLDIAGTAWRSGKAKGATGRPVALLSQFLLNRAGFNGEE"
     misc_feature    complement(554008..555492)
                     /locus_tag="KPHS_05180"
                     /note="multifunctional aminopeptidase A; Provisional;
                     Region: PRK00913"
                     /db_xref="CDD:234863"
     gene            555882..556979
                     /locus_tag="KPHS_05190"
                     /db_xref="GeneID:11845506"
     CDS             555882..556979
                     /locus_tag="KPHS_05190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein, transport"
                     /protein_id="YP_005224819.1"
                     /db_xref="GeneID:11845506"
                     /translation="MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIP
                     TNLVLSLLGLGIPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLIKAA
                     MILALFTGAVAAVNVMWAGPWSSRHQDEVLAEAKANPGMAALAQGQFQQASDGNAVMF
                     IESVNGNRFHDVFLAQLRPKGNARPSVVVADSGELSQQKDGSQVVTLNKGTRFEGTAM
                     LRDFRITDFNNYQAIIGHQAVSADPDDTEQMDMRTLWKTHTDRARAELHWRFTLVATV
                     FIMALMVVPLSVVNPRQGRVLSMLPAMLLYLVFFLLQTSIKSNGGKGKMDPAIWMWAI
                     NLLYFALAVLLNLWDTVPMRRFRARFNKGAA"
     misc_feature    555882..556976
                     /locus_tag="KPHS_05190"
                     /note="lipopolysaccharide ABC transporter permease LptF;
                     Provisional; Region: PRK15120"
                     /db_xref="CDD:185075"
     gene            556979..558061
                     /locus_tag="KPHS_05200"
                     /db_xref="GeneID:11845507"
     CDS             556979..558061
                     /locus_tag="KPHS_05200"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein, transport"
                     /protein_id="YP_005224820.1"
                     /db_xref="GeneID:11845507"
                     /translation="MQAFGVLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLKKSGQ
                     GSYDALGAGLYTILSVPKDIQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRLQV
                     ALAVMKTAIPLVLLTMAIGEWVAPQGEQMARNYRAQQMYGGSLLSTQQGLWAKDGHNF
                     VYIERVKGNDELGGVSIYAFNPERRLQSVRYAASAKFDSENKVWRLSQVDESDLTDPK
                     QVTGSQMVSGTWKTNLTPDKLGVVALDPDALSISGLHNYVKYLKSSGQDPGRYQLNMW
                     SKIFQPLSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFIFYVLDQIFGPLTLVYG
                     IPPIIGALLPSASFFLISLWLMMRKA"
     misc_feature    556988..558055
                     /locus_tag="KPHS_05200"
                     /note="lipopolysaccharide ABC transporter permease;
                     Provisional; Region: PRK15071"
                     /db_xref="CDD:237900"
     gene            complement(558110..559612)
                     /locus_tag="KPHS_05210"
                     /db_xref="GeneID:11845508"
     CDS             complement(558110..559612)
                     /locus_tag="KPHS_05210"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_005224821.1"
                     /db_xref="GeneID:11845508"
                     /translation="MSSPLLIARTLDNALYLLPAMANRHGLITGATGTGKTVTLQKLA
                     ESFSEIGVPVFMADVKGDLTGIAAAGQSSEKLQARLEKIGVSDWEPHANPVVLWDIFG
                     EKGHPVRATVSDLGPLLLARLLNLNEVQSGVLNIIFRIADDRGLLLLDFKDLRAITQF
                     IGDNAKSFQNQYGNINSASIGAIQRGLLTLEQQGAEHFFGEPMLDIADWMRVDASGKG
                     VINILSAEKLYQMPKLYAASLLWMLSELYERLPEAGDLDKPKLVFFFDEAHLLFNDAP
                     QVLLDKIEQVIRLIRSKGVGVYFVSQNPADIPDAVLGQLGNRVQHALRAFTPKDQKAV
                     KTAAQTMRANPAFSTEQAIQELGTGEALISFLDEKGSPSVVERAMVIAPCSRMGPVSD
                     DERNGLLNHSPLYGKYEEEVDRESAFEMLQQGVQVATGQQSAPPAKGQQNGDDDGLLG
                     GLKDILFGSTGPRGGKRDGIVQTAAKSAVRQVTNQIVRGMLGSLLGGRKR"
     misc_feature    complement(558113..559603)
                     /locus_tag="KPHS_05210"
                     /note="Bacterial protein of unknown function (DUF853);
                     Region: DUF853; pfam05872"
                     /db_xref="CDD:283518"
     gene            complement(559711..560532)
                     /locus_tag="KPHS_05220"
                     /db_xref="GeneID:11845509"
     CDS             complement(559711..560532)
                     /locus_tag="KPHS_05220"
                     /codon_start=1
                     /transl_table=11
                     /product="TIM barrel protein"
                     /protein_id="YP_005224822.1"
                     /db_xref="GeneID:11845509"
                     /translation="MAIAMQRFCINRKIAPALSIEAFFRLVNRLGLNKVELRNDLPSG
                     KVTDDLSHQQVRELAARYHIEILTINAVYPFNRRSEEVRQLTESLLKEAQAIGAKSLV
                     LCPLNDGSEVPASETLGALRDLAPLFAFYGIHGLVEPLGFPQSSLRSAHQAQTLIHDA
                     RVPFKLLLDTFHHHLYPQAADEFSQVEVADIGLVHLSGVDDSRPREQLTDAERIMLTP
                     KDRLGTCEQVKALEARGYQGVYAFEPFAPELAQWSEADIEREIEQSIALIQRHCA"
     misc_feature    complement(559723..560526)
                     /locus_tag="KPHS_05220"
                     /note="AP endonuclease family 2; These endonucleases play
                     a role in DNA repair. Cleave phosphodiester bonds at
                     apurinic or apyrimidinic sites; the alignment also
                     contains hexulose-6-phosphate isomerases, enzymes that
                     catalyze the epimerization of...; Region: AP2Ec; cl23721"
                     /db_xref="CDD:355019"
     gene            560883..562388
                     /locus_tag="KPHS_05230"
                     /db_xref="GeneID:11845510"
     CDS             560883..562388
                     /locus_tag="KPHS_05230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="YP_005224823.1"
                     /db_xref="GeneID:11845510"
                     /translation="MTITGNFIGGKTVISSSNETMPVYDPATGKAVREVTVSTAQEVS
                     EAIQVARDAFDSWSRTTPLRRARVLFNFKMLLEQHVEELAGIIVSEHGKVWSDALGEL
                     TRGMEVVEFACGIPHLIKGEYSSDVGTGVDSYSLMQPLGVVAGITPFNFPAMVPMWMF
                     PLALACGNSFVLKPPALAPTAAVRLAELLKEAGLPDGVFNVVHCSNEDAEQLYTDPRI
                     AAVSFVGSSGVAEYIYKTASAHGKRVQAFGAAKNHAIVMPDADLDATVNAIMGGAFGS
                     AGERCMALPVVVAVGDETADKLIARLKPLVEALKVGPGCMRGQEENEMGPVVSDTHQK
                     KVLGYIDKGESEGAKLVVDGRKLRVPGYDAGYYVGGTLFDHVTPEMTIWREEIFGPVL
                     GIVRAADYDSALELVNSHEFGNGSAVFTSNGHTAREFVHDVQAGMVGVNVPVPVPMAF
                     HSFGGWKRSVFGALNVHGPDGVRFYTRMKTATVRWPAGQQTVSEFSMPTLG"
     misc_feature    560892..562337
                     /locus_tag="KPHS_05230"
                     /note="Methylmalonate semialdehyde dehydrogenase and ALDH
                     family members 6A1 and 6B2; Region: ALDH_F6_MMSDH;
                     cd07085"
                     /db_xref="CDD:143404"
     misc_feature    order(561063..561065,561069..561071,561081..561083,
                     561090..561092,561102..561104,561201..561203,
                     561210..561215,561240..561263,561276..561278,
                     561285..561287,561294..561296,561573..561575,
                     561585..561587,561594..561596,561603..561605,
                     561609..561611,562143..562145,562149..562154,
                     562158..562163,562170..562172,562179..562184,
                     562188..562190,562194..562205,562230..562232,
                     562242..562244,562248..562250,562290..562292,
                     562311..562328,562332..562337)
                     /locus_tag="KPHS_05230"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143404"
     misc_feature    order(561321..561332,561354..561356,561399..561401,
                     561408..561410,561498..561500,561549..561560,
                     561567..561569,561621..561629,561723..561725,
                     562038..562040,562044..562046,562122..562124)
                     /locus_tag="KPHS_05230"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143404"
     misc_feature    order(561330..561332,561621..561623,561714..561716,
                     561723..561725)
                     /locus_tag="KPHS_05230"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143404"
     gene            562407..563216
                     /locus_tag="KPHS_05240"
                     /db_xref="GeneID:11845511"
     CDS             562407..563216
                     /locus_tag="KPHS_05240"
                     /codon_start=1
                     /transl_table=11
                     /product="5-deoxy-glucuronate isomerase"
                     /protein_id="YP_005224824.1"
                     /db_xref="GeneID:11845511"
                     /translation="MSLLAKSRKEGQIQHITPQSAGWRYIGFDVWMLKKGQTVTLESG
                     DRELCLVLVAGLASVKTQHADFPNLGKRMSPFERTPPWSVYIPPQDKVEVTADSDLEL
                     AVCSAPGKGSFPARLIRPEDVGVEHRGKGRNQRRVHNILPDSAEADCLLVVEVYTDEG
                     ATSSWPSHKHDTAQPGKETQLEETYYHRFDPPQGFAFQRVYTDDRSLDACMAPYNHDV
                     VMVPRGYHPVAAIAGYDSYYLNVMAGPDRKWLFTWEDDHAWINTPEYPRHD"
     misc_feature    562437..563204
                     /locus_tag="KPHS_05240"
                     /note="5-deoxy-D-glucuronate isomerase [Carbohydrate
                     transport and metabolism]; Region: IolB; COG3718"
                     /db_xref="CDD:226241"
     gene            complement(564320..565177)
                     /locus_tag="KPHS_05250"
                     /db_xref="GeneID:11845512"
     CDS             complement(564320..565177)
                     /locus_tag="KPHS_05250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative helix-turn-helix protein"
                     /protein_id="YP_005224825.1"
                     /db_xref="GeneID:11845512"
                     /translation="MANNPTQLTILQDEIRRRYDTLSKRLKQVARYILDNSNSVAFDT
                     VASIAQQADVPPSTLIRFANAFGFSGFNEMKQMFKQHLMEETANYTERARLFRQTTSD
                     ESSPPETPTEILNMFTMVNNQALQQLAMQTSSDDLERAVALLGEAENIYVIGLRRSFS
                     VASYLTYALRHLDRKAFLIDGLGGMFTEQLSLVGPKDVVVAVSFSPYAREVVELVELG
                     AQRKARQIAITDSQVSPLAAFSDVCFVVREAQVDGFRSQVASLCLAQTLAVSLALNSS
                     QESEAKQKA"
     misc_feature    complement(564326..565147)
                     /locus_tag="KPHS_05250"
                     /note="DNA-binding transcriptional regulator, MurR/RpiR
                     family, contains HTH and SIS domains [Transcription];
                     Region: RpiR; COG1737"
                     /db_xref="CDD:224651"
     gene            complement(565329..567242)
                     /locus_tag="KPHS_05260"
                     /db_xref="GeneID:11845513"
     CDS             complement(565329..567242)
                     /locus_tag="KPHS_05260"
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-2-deoxygluconokinase"
                     /protein_id="YP_005224826.1"
                     /db_xref="GeneID:11845513"
                     /translation="MNAAVKRLDVICIGRVAVDLYAQQIGSRLEDVASFAKYLGGSSG
                     NVAFGTAIQGLKSAMLARVGDEHNGRFLRETLNRAGVDTEYLITDKSRLTALVMLGIK
                     DQETFPLIFYRDNCADMALTPDDISEEYIASSRALAVTGTHLSHANTRAAVLKALEYA
                     RRHGLRTALDIDYRPVLWGLTSLGDGETRFIESGPVTSQLQEVLHLFDLVVGTEEEFH
                     IAGGSTDTLTALKNVRNATKATLVCKRGPMGCVVLEGDIPDSWDQVPLQQGVRVEVLN
                     VLGAGDAFMSGLLRGWLNDEGWEQACRYANACGALVVSRHGCAPAMPTKVELDDYLQR
                     AESVPRPDVDERLNHLHRVTSRRQQWPELCIFAFDHRKQLADLARETGRDEACIPQLK
                     LLLLAAAEAAAQEAGLDQRSGILADGTYGQRALNAITGKGWWIGRPIELPSSRPLRLE
                     HGNIGSQLIDWPLEHVVKCLVFYHPDDPAALRAEQDALLLEVWQACNKSGHELLLEVI
                     LPENGPDKDERHYHTMLEHFYQLGIKPDWWKLPPLSSASWQQITALIEREDPWSRGIL
                     ILGLDAPSDKLRAGFAEAAAHPMIKGFAVGRTIFGQPSRRWMQGELSDEALIEEVKRN
                     YLTLIGYWREARR"
     misc_feature    complement(566247..567224)
                     /locus_tag="KPHS_05260"
                     /note="5-dehydro-2-deoxygluconokinase; Region:
                     myo_inos_iolC_N; TIGR04382"
                     /db_xref="CDD:275175"
     misc_feature    complement(order(566289..566291,566397..566399,
                     566406..566408,566721..566723,566817..566819,
                     566904..566906,566910..566912,566952..566954,
                     567108..567110,567117..567122))
                     /locus_tag="KPHS_05260"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(566313..566315,566325..566327,
                     566391..566393,566400..566408,566433..566435,
                     566496..566498,566511..566513))
                     /locus_tag="KPHS_05260"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     misc_feature    complement(565335..566264)
                     /locus_tag="KPHS_05260"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2090); Region: DUF2090; pfam09863"
                     /db_xref="CDD:313145"
     gene            complement(567502..567663)
                     /locus_tag="KPHS_05270"
                     /db_xref="GeneID:11845514"
     CDS             complement(567502..567663)
                     /locus_tag="KPHS_05270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224827.1"
                     /db_xref="GeneID:11845514"
                     /translation="MDYRQTFFSLNTNTEEIFHFARRIKLSTHFIRFTYIPDTFSGPF
                     LPHQTAISP"
     gene            567748..569688
                     /locus_tag="KPHS_05280"
                     /db_xref="GeneID:11845515"
     CDS             567748..569688
                     /locus_tag="KPHS_05280"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetolactate synthase large subunit"
                     /protein_id="YP_005224828.1"
                     /db_xref="GeneID:11845515"
                     /translation="MGKLRLTTAQALVKFLDNQYLEVDGVELKFVKGIFAIFGHGNVL
                     GLGQALEQDSGDMRVYQGRNEQGMAHAATGFARQALRRQIIACTSSIGPGAANMITAA
                     GTASANRIPLLLLPGDVFATRQPDPVLQQIEQSYDLSISTNDAFRAVSKYWDRITRPE
                     QLMSACINAMRVLTDPAETGAVTLCLPQDVQGEAWDYPESFFARRVHRLDRRPASAAQ
                     LADAVAAIKASRKPLIVCGGGVKYSGAGEALSRFAERYGVPFAETQAGKGTVVSSHPL
                     NVGGVGETGCLAANLLAKEADLVIGVGTRFSDFTTASKWIFQHPEVRFLNINVSNFDA
                     WKLDGIAMLADAREAMTALDAALADSGWQAGWGAQIESVQSRQLKETQRVYQAVWQEK
                     SFVPEIDDHLDRESVYREFRQITDSTLTQSSVLGVLNETLPAEAVIVAAAGSLPGDLQ
                     RVWRNRAENTYHVEYGYSCMGYEVNAALGVKLAQPQSEVYSLVGDGSFMMLHSELVTS
                     LQERAKINVVLFDNMANGCINNLQMEHGMDSFGTEFRYRQPETGQLQGGLVPVDFATI
                     AAGYGCKTWRVTTLDELRHALDAARRETVSTLIDIKVLPKTMVHKYGSWWNVGVAQTA
                     LSERIRKVAQMINEKRAQARDY"
     misc_feature    567760..569679
                     /locus_tag="KPHS_05280"
                     /note="3,5/4-trihydroxycyclohexa-1,2-dione hydrolase;
                     Region: myo_inos_iolD; TIGR04377"
                     /db_xref="CDD:275170"
     gene            569735..570748
                     /locus_tag="KPHS_05290"
                     /db_xref="GeneID:11845516"
     CDS             569735..570748
                     /locus_tag="KPHS_05290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADH-dependent dehydrogenase"
                     /protein_id="YP_005224829.1"
                     /db_xref="GeneID:11845516"
                     /translation="MSLKLGVIGAGAIGKEHIRRCTQVLQGATVVAVSDINADNARAA
                     VALPGVQAEVYADGHDVINASDVDAILVTSWDPTHEEYTLAAIAAGKPVFCEKPLAMS
                     AEGCRRIVDAEMKAGRRLVQVGFMRPYDEGYLALKKVIDDGDIGAPLMLRCAHRNQSV
                     GENYTTDMAITNTLIHELDVLRWLLNDDYRSVQVRFPRSTSHTHARLKDPQIVSFETK
                     KGTLIDVEVFVNCQYGYDIQCEVVGETGIARLPEPSAVQMRKSASLSTAILTDWKDRF
                     IKAYDVELQAFINDVKAGQLHGPSAWDGYAASVAADACIKAQGTSEPVEVTLPECPAF
                     YKR"
     misc_feature    569735..570712
                     /locus_tag="KPHS_05290"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            570790..571674
                     /locus_tag="KPHS_05300"
                     /db_xref="GeneID:11845517"
     CDS             570790..571674
                     /locus_tag="KPHS_05300"
                     /codon_start=1
                     /transl_table=11
                     /product="protein IolH"
                     /protein_id="YP_005224830.1"
                     /db_xref="GeneID:11845517"
                     /translation="MKIAFDVDVIKDLGITRMVHQVAEWGYKYIEQSPHPQINPFYKH
                     PRASREIMAEYKQALRDTGLELSSFICVYRWSGPDELRRQAAVKNWKRLVEIAVEMGV
                     QVINTEFSGDPNQPEICDEMFYRSMEELLPIFEREGIRVEIQAHPWDFCEENNETVDI
                     VKSFRSDNVKYVYSVPHTFFYDKGVGDVASMLRYAGSDLSHVLIADTRNHTKHCRYIV
                     NPPGVDAVVHQHVGVGEGDVDFDALFRTLREMKFAEQTFKVGGEPIVATSLFGYPEKM
                     KYQAVETRELIERELLRR"
     misc_feature    570790..571545
                     /locus_tag="KPHS_05300"
                     /note="Sugar phosphate isomerase/epimerase [Carbohydrate
                     transport and metabolism]; Region: YcjR; COG1082"
                     /db_xref="CDD:224007"
     gene            571698..572597
                     /locus_tag="KPHS_05310"
                     /db_xref="GeneID:11845518"
     CDS             571698..572597
                     /locus_tag="KPHS_05310"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar phosphate isomerase/epimerase"
                     /protein_id="YP_005224831.1"
                     /db_xref="GeneID:11845518"
                     /translation="MNKDNVKLAIAPIGWTNDDMPELGSENTFQQIVSEMALAGFTGS
                     EVGSKYPRDPAVLKPMLDIRGIQICNAWFSTFFANGQREKTIDEFVNHMNFLHAMGAK
                     VIGCSEQSGSIQGLDKPILGDAKPCFSDEEWQRVAEGYNTLGRLAAEKGMQVCLHHHM
                     GTGIQTTAEIDKFMSLVDERVFLLFDTGHAWYSEGGEAPMLAILKKYLPRINHVHLKD
                     VRPPVIDQVRRDGLSFLDGVKKGTFTVPGDGVIDFRPVFKLLDDFGYKGWMVVEAEQD
                     PALANPFEYAVKARKYIRETAGI"
     misc_feature    571710..572588
                     /locus_tag="KPHS_05310"
                     /note="myo-inosose-2 dehydratase; Region: myo_inos_iolE;
                     TIGR04379"
                     /db_xref="CDD:275172"
     gene            complement(572741..574051)
                     /locus_tag="KPHS_05320"
                     /db_xref="GeneID:11845519"
     CDS             complement(572741..574051)
                     /locus_tag="KPHS_05320"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_005224832.1"
                     /db_xref="GeneID:11845519"
                     /translation="MFKPFTLVAVGLSLALSGAALAKEKIDFMFPAPVDGKLTMEMTR
                     VIKQFNDSQQDVEVRGIFTGNYDTTKIKAESAQKAGQPPALVIMSANFTTDLALKDEI
                     LPMDELFKYGDQKAGDFLQKEFWPAMHKNAQVMGTTYAIPFHNSTPILYYNKTMFDQA
                     GIKQPPQTWAELLADAKKLTDESKGQWGIMLPSTNDDYGGWIFSALVRANGGKYFNED
                     YPGEVYYNSPTAIGALRFWQDLIYKDKVMPSGVLNSKQISAAFFSGKLGMAMLSTGAL
                     GFMRENSKDFELGVAMLPAKEQRAVPIGGASLVSFKGINEAQKKAAYQFLTYLVSPEV
                     NGAWSRFTGYFSPRKASYDTPEMKAYLQQDPRAAIALEQLKYAHPWYSTWETVAVRKA
                     MENQLAAVVNDAKVTPEAAVQAAQKEADALMKPYVDKTALEEVK"
     misc_feature    complement(572795..573979)
                     /locus_tag="KPHS_05320"
                     /note="The periplasmic-binding component of ABC transport
                     system specific for sn-glycerol-3-phosphate; possesses
                     type 2 periplasmic binding fold; Region: PBP2_UgpB;
                     cd14748"
                     /db_xref="CDD:270451"
     misc_feature    complement(order(572882..572884,573020..573022,
                     573137..573142,573236..573238,573614..573616,
                     573620..573622,573782..573787,573854..573856))
                     /locus_tag="KPHS_05320"
                     /note="chemical substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:270451"
     gene            complement(574044..575117)
                     /locus_tag="KPHS_05330"
                     /db_xref="GeneID:11845520"
     CDS             complement(574044..575117)
                     /locus_tag="KPHS_05330"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter"
                     /protein_id="YP_005224833.1"
                     /db_xref="GeneID:11845520"
                     /translation="MLSLQNISKRFDGKPALSALSLDIHEGEFVVLVGPSGCGKSTLL
                     RLLAGLEPVSEGQIWLHDENITATTPRERNFAMIFQNYALFPHLSVRDNITFGMKVRK
                     EEKSSWQPRVDKVAQMLQLEALLDRKPAKLSGGQRQRVAMARAIVRNPRLFLMDEPLS
                     NLDARLRSEVRDSIMALHQQLKTSTIYVTHDQTEAMSMADRIVVMNGGHVQQVGRPEY
                     LYANPANLFVAGFIGSPAMNLLSLPCVDGNVQLGEQRHPLPPRHRDQTRVWLGVRPEH
                     ITDRVEEGHLRLPATVLQRELMGADYLLHVSTPIGTLRFSRRHRGTVPEKGESLQIGF
                     SPADVHLFHAETQHNLLMECNHV"
     misc_feature    complement(574083..575117)
                     /locus_tag="KPHS_05330"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     gene            complement(575123..575947)
                     /locus_tag="KPHS_05340"
                     /db_xref="GeneID:11845521"
     CDS             complement(575123..575947)
                     /locus_tag="KPHS_05340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphohydrolase"
                     /protein_id="YP_005224834.1"
                     /db_xref="GeneID:11845521"
                     /translation="MLLAHISDTHFRSRGEKLYGFIDVNAANADVVSQLNALRERPDA
                     VVVSGDIVNCGRPEEYQVARQILGSLNYPLYLIPGNHDDKAHFLEHLHPLCPQLGNDP
                     QNMRYAVDDFATRLLFIDSSHAGTSKGWLTDETISWLEAQLFEGGDKPATIFMHHPPL
                     PLGNAQMDPIACENGHRLLALVERFPSLTRIFCGHNHSLTMTQYRQALISTIPGTVHQ
                     VPYCHEDTRPYYDLSPASCLMHRQVGEQWVSYQHSLAHYAGPWLYDENISCPTEER"
     misc_feature    complement(575216..575941)
                     /locus_tag="KPHS_05340"
                     /note="Enterobacter aerogenes GpdQ and related proteins,
                     metallophosphatase domain; Region: MPP_GpdQ; cd07402"
                     /db_xref="CDD:277347"
     misc_feature    complement(order(575297..575299,575357..575359,
                     575363..575365,575480..575482,575705..575710,
                     575789..575791,575798..575800,575918..575920,
                     575924..575926))
                     /locus_tag="KPHS_05340"
                     /note="active site"
                     /db_xref="CDD:277347"
     misc_feature    complement(order(575357..575359,575363..575365,
                     575480..575482,575708..575710,575798..575800,
                     575918..575920,575924..575926))
                     /locus_tag="KPHS_05340"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:277347"
     misc_feature    complement(order(575219..575221,575225..575227,
                     575234..575236,575318..575320,575324..575332,
                     575339..575353,575372..575374,575378..575380,
                     575459..575464,575468..575470,575753..575755,
                     575780..575782,575789..575791,575846..575851,
                     575858..575863,575870..575872,575879..575881))
                     /locus_tag="KPHS_05340"
                     /note="homohexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277347"
     gene            complement(575958..576845)
                     /locus_tag="KPHS_05350"
                     /db_xref="GeneID:11845522"
     CDS             complement(575958..576845)
                     /locus_tag="KPHS_05350"
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol 3-phosphate transport system
                     permease"
                     /protein_id="YP_005224835.1"
                     /db_xref="GeneID:11845522"
                     /translation="MSAEISPLLVRTPAAARPLWLRLRRSSPFTLTVLMCCLALLWVS
                     PFIWMLATSFSATTFGDDMASLLPRLPLTLDNFRDAWNSADWLSLYANTLIFTFGTFF
                     VQLLTITTAGYVFACHEFRGKQTLFLLFLVQLMIMPVVMMVPNMLTLKTFGLLNTLTG
                     VMMPYFTSAFGVFLMRQAFLAIPKELEEAALMEGCRWWQVLFRVLLPMSWPSVLAFAT
                     VSITYHWNEYLWPLMMLNDPDKQVLTVGLVSFAMGAESGGQWGTIGAGTLMVCLPLML
                     AFILFQKQFLRSFGFSGIK"
     misc_feature    complement(575961..576755)
                     /locus_tag="KPHS_05350"
                     /note="ABC-type glycerol-3-phosphate transport system,
                     permease component [Carbohydrate transport and
                     metabolism]; Region: UgpE; COG0395"
                     /db_xref="CDD:223472"
     gene            complement(576835..577719)
                     /locus_tag="KPHS_05360"
                     /db_xref="GeneID:11845523"
     CDS             complement(576835..577719)
                     /locus_tag="KPHS_05360"
                     /codon_start=1
                     /transl_table=11
                     /product="putative SN-glycerol-3-phosphate transport
                     system permease"
                     /protein_id="YP_005224836.1"
                     /db_xref="GeneID:11845523"
                     /translation="MRVTMRKTWLPWLILSPSLLFLLLFTWFPLGRSVYDSLFDTRMA
                     SDGAQYVGLDNFSRLFADGVFWQSLVNNLLYILLTVVPGVTLALLLAVALSENHRVNR
                     WLRTAFFFPMIIPMVSAAALWLFIFMPGLGLLDHYLAKLFGPMNNNWLGRSNSALLAL
                     ALIGVWKFAGYYMLFFLAGLQSIPASTREAALMEGATRTQVFFKVTLPLLRPTLSFVI
                     TTALIYSITQIDHVAVMTRGGPDNATTVLLYYIQNLAWDTHDLGKASAATFLTLAGLF
                     AFSLINLKLLEKGAHYER"
     misc_feature    complement(576838..577719)
                     /locus_tag="KPHS_05360"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpA;
                     COG1175"
                     /db_xref="CDD:224096"
     misc_feature    complement(order(577024..577041,577348..577392))
                     /locus_tag="KPHS_05360"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(576976..576978,576985..576987,
                     577021..577023,577240..577242,577348..577350))
                     /locus_tag="KPHS_05360"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(577093..577095,577105..577110,
                     577126..577164))
                     /locus_tag="KPHS_05360"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(577850..578869)
                     /locus_tag="KPHS_05370"
                     /db_xref="GeneID:11845524"
     CDS             complement(577850..578869)
                     /locus_tag="KPHS_05370"
                     /codon_start=1
                     /transl_table=11
                     /product="putative alcohol dehydrogenase"
                     /protein_id="YP_005224837.1"
                     /db_xref="GeneID:11845524"
                     /translation="MTIIKSYAAKEAGADLSLWEYDAGELQPEDVEVEVEYCGICHSD
                     LSMIDNEWGMSSYPLVAGHEVIGRVAALGSAAQDKGLKIGQKVGIGWTARSCGHCDAC
                     ISGNQINCLEGSVPTILNRGGFANKLRADWQWVIPLPESIDLASAGPMLCGGITVFKP
                     LLTHHVTATSRVGVIGIGGLGHIAIKLLRAMGAEVTAFSSNPAKEQEVLAMGADRVVN
                     SRDPEALKALAGQFDLIINTVAVDLDWQPYFEALAYGGNFHTVGAVMKPFPVPAFTLI
                     GGDRSISGSATGNPSELRTLMKFAGRSKVAPTTELFPMSQINEALKHVREGKARYRAV
                     LKADF"
     misc_feature    complement(577862..578857)
                     /locus_tag="KPHS_05370"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD1; cd05283"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(578009..578017,578084..578089,
                     578147..578149,578153..578158,578213..578215,
                     578258..578260,578270..578275,578327..578344,
                     578402..578404,578414..578416,578732..578734,
                     578741..578749))
                     /locus_tag="KPHS_05370"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(578009..578011,578414..578416,
                     578597..578599,578681..578683,578741..578743,
                     578747..578749))
                     /locus_tag="KPHS_05370"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(578414..578416,578681..578683,
                     578747..578749))
                     /locus_tag="KPHS_05370"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(578540..578542,578564..578566,
                     578573..578575,578582..578584))
                     /locus_tag="KPHS_05370"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    complement(order(578012..578035,578042..578047,
                     578051..578053,578078..578080,578084..578092,
                     578105..578107,578381..578383,578393..578395,
                     578543..578545))
                     /locus_tag="KPHS_05370"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176186"
     gene            complement(578981..580450)
                     /locus_tag="KPHS_05380"
                     /db_xref="GeneID:11845525"
     CDS             complement(578981..580450)
                     /locus_tag="KPHS_05380"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfate transporter"
                     /protein_id="YP_005224838.1"
                     /db_xref="GeneID:11845525"
                     /translation="MNTLRQDSLAGIVVFLVALPLCLGIAQASGLPPFVGLLTGIIGG
                     LVVTALSPSRFAVSGPAAGLVTIVVAAIESLGSFSLFLMALALAGVLQLLFGILRAGR
                     FISLVPASVIKGMLAAIGILLIIQQIPVALGSAEETGLVDIVKGNATFSLSAIAVAAG
                     GLLVLWLWGSPLIRRVKSLRWIPGPLIAVLLGCVTTLLLTHFAPQQLAALPRITLPAF
                     GSLGDLLGELESPAWSAWRNPSVWVVAVTLALVASLETLLSQEALKKLRPQNPPPSPN
                     REMVAQGVGNLLSGVLGAMPITAVIVRSSVNVSNGAQSKLSIFIHGVLLLICGLWFSG
                     LLTLIPLASLAAVLLYTGYKLATPRLFIEQFRQGAAQYVPFLATIGGIIACGMLAGIG
                     IGLATQMAFSLWRSHRHSLQLARYDDHYVLRIQQNLTFMHNPHLLALLAKIPEKSVVI
                     VEHDSVGYLDPDVRAVLDDFAENAPQRGIRLNQWPLASR"
     misc_feature    complement(579005..580447)
                     /locus_tag="KPHS_05380"
                     /note="Sulfate permease or related transporter, MFS
                     superfamily [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     gene            complement(580447..581127)
                     /locus_tag="KPHS_05390"
                     /db_xref="GeneID:11845526"
     CDS             complement(580447..581127)
                     /locus_tag="KPHS_05390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative carbonic anhdrase"
                     /protein_id="YP_005224839.1"
                     /db_xref="GeneID:11845526"
                     /translation="MTTLKPLLARNRSWALQKCQHDPDYFEKWVDGQRPHSLWIGCSD
                     SRVPAEVLTGSQPGELFVHRNIANMLDPADDNVMSVLQYALDYLEVERVVLCGHYGCG
                     GVQAALSLPTLPLAQESSALARRIGQLRHTLHHEIAQIADDCCVAASPGASTSASANA
                     ERSRHALDALVEANVRAQFAPLLESEPVQTVLASGRPLSLHGCVYDLASGHLTTLVEH
                     LSPQEHAP"
     misc_feature    complement(580483..581097)
                     /locus_tag="KPHS_05390"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeA; cd00883"
                     /db_xref="CDD:238448"
     misc_feature    complement(order(580513..580515,580825..580827,
                     580834..580836,580864..580866,580879..580881,
                     580945..580947,580954..580956,580990..580998,
                     581002..581004,581023..581025,581029..581031))
                     /locus_tag="KPHS_05390"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238448"
     misc_feature    complement(order(580825..580827,580834..580836,
                     580996..580998,581002..581004))
                     /locus_tag="KPHS_05390"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238448"
     misc_feature    complement(order(580492..580494,580498..580500,
                     580504..580509,580513..580515,580762..580764,
                     580879..580884,580891..580896,580936..580938,
                     580942..580944,580948..580956,580969..580971,
                     580975..580980,580984..580986,580990..581001))
                     /locus_tag="KPHS_05390"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238448"
     gene            581952..583214
                     /locus_tag="KPHS_05400"
                     /db_xref="GeneID:11845527"
     CDS             581952..583214
                     /locus_tag="KPHS_05400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative P4-type integrase"
                     /protein_id="YP_005224840.1"
                     /db_xref="GeneID:11845527"
                     /translation="MKLNARQVETAKPKDKTYKMADGGGLYLEVSAKGSKYWRMKYRR
                     PSDKKEDRLAFGVWPTVTLAQARTKRDEAKKLLVQGIDPKAEQKEAQAENSGAYTFET
                     IAREWHASNKRWSEDHRSRVLRYLELYIFPHIGSSDIRQLKTSHLLAPIKKVDASGKH
                     DVAQRLQQRVTAIMRYAVQNDYIDSNPASDMAGALSTTKARHYPALPSSRFPEFLARL
                     AAYRGRVMTRIAVELSLLTFVRSSELRFARWDEFDFAKSLWRIPAKREEIKGVRYSYR
                     GMKMKEEHIVPLSRQAIVLLEQLKQISGDKELLFPGDHDATKVMSENTVNGALRAMGY
                     DTKTEVCGHGFRTMARGALGESGLWSDDAIERQLSHSERNNVRAAYIHTSEHLDERRL
                     MVQWWADYLKSNEGKIVTPYEFAKIRKS"
     misc_feature    581958..583181
                     /locus_tag="KPHS_05400"
                     /note="integrase; Provisional; Region: PRK09692"
                     /db_xref="CDD:170049"
     gene            complement(583272..584282)
                     /locus_tag="KPHS_05410"
                     /db_xref="GeneID:11845528"
     CDS             complement(583272..584282)
                     /locus_tag="KPHS_05410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224841.1"
                     /db_xref="GeneID:11845528"
                     /translation="MIYITSVSKETSMTKYEVKMKKNIRVIPKNIHSKLRRLGNTVVA
                     GTSIAFTENQLKNGMLEHLGIYFDNDVIKYEASIIPDPLQGKYSFKNVFGEEVIRKDL
                     PKETHYTEIESPNWGDSSNGTHTVRLPHDKYPRDIIPPKLIAIEINHKKSSDSYFIFN
                     FRATRILEKNSNKFDDELLFDLNLLQENLGKCGVENADKPISTYADTLIVSWDIFPPG
                     SKEEILARIFKGKNITDDKKAVAENRYEFFMSLEPKKIVTGNSTFSNYIGAMLEDDLV
                     VFENIEYGNAIYILYDDWDEISKLSRIDLLSGRAGSNFDRIIHSGNWKEEVRKKVATG
                     RL"
     gene            584693..584806
                     /locus_tag="KPHS_05420"
                     /db_xref="GeneID:11845529"
     CDS             584693..584806
                     /locus_tag="KPHS_05420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224842.1"
                     /db_xref="GeneID:11845529"
                     /translation="MIISDIQNIAKYIHVYLKMPTIAFNIQSSPDALFILD"
     gene            complement(584770..585849)
                     /locus_tag="KPHS_05430"
                     /db_xref="GeneID:11845530"
     CDS             complement(584770..585849)
                     /locus_tag="KPHS_05430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224843.1"
                     /db_xref="GeneID:11845530"
                     /translation="MNIGHLNFFKVNKCGLYKVNDNNTYGLELSETFDLIQDWVGTKS
                     LALTIPWDPKEKPNRSKCYCKDIYKDENTGDFLIMLWKSDTDSTGSLLGASEDGEIGS
                     SSVVKYTNSYRGKKVIWGRPCFYWVIPELETIVSIKFDHSICDSELFQDYVHSSITNR
                     VKHSKRVKNKTEKGYIRLSNTDDDDLYKYMYRFDMKLRSLETTHTELGKLIPKITHIV
                     RRETIIINPNDARADWLKTFSTLVPFVSGKKNTRTRQIEIKAEAKPSLNEVKEIIEKY
                     SSEDREKRLWDNVGFATDKGITWVDKYRMRDILNVPSEDYSTYSAAYIYEQISHKRKE
                     FISPILKESKALQSQSRINKASGED"
     gene            586054..587022
                     /locus_tag="KPHS_05440"
                     /db_xref="GeneID:11845531"
     CDS             586054..587022
                     /locus_tag="KPHS_05440"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase InsC for insertion sequence IS903"
                     /protein_id="YP_005224844.1"
                     /db_xref="GeneID:11845531"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNISFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGMPESVRIA"
     misc_feature    586153..586488
                     /locus_tag="KPHS_05440"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:290455"
     misc_feature    586447..586977
                     /locus_tag="KPHS_05440"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:334608"
     gene            complement(587435..587584)
                     /locus_tag="KPHS_05450"
                     /db_xref="GeneID:11845532"
     CDS             complement(587435..587584)
                     /locus_tag="KPHS_05450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224845.1"
                     /db_xref="GeneID:11845532"
                     /translation="MHAFPRLVIPVRPLSRRGLSPPMYLHENRPTKRAGEAGKALRAS
                     GKVFI"
     gene            complement(587656..588222)
                     /locus_tag="KPHS_05460"
                     /db_xref="GeneID:11845533"
     CDS             complement(587656..588222)
                     /locus_tag="KPHS_05460"
                     /codon_start=1
                     /transl_table=11
                     /product="phage polarity suppression protein"
                     /protein_id="YP_005224846.1"
                     /db_xref="GeneID:11845533"
                     /translation="MTTLTLQQAFEACQKNETAWLNRKAELAAAEQEYQEQVLAGDDR
                     IPAIMQELRDIIDVKKWEINQAAGRYIRSHEAVQRISIRNRLNDFMQAHGTELAATLA
                     PELMGLSQQPALLTGHALDRSAHYLREALSVWLSTGEEINYAAEDSDILTAIGFRPDA
                     ASRVDNQEKYTPAQSLIYARRRTELASK"
     misc_feature    complement(587662..588207)
                     /locus_tag="KPHS_05460"
                     /note="Phage polarity suppression protein (Psu); Region:
                     Psu; pfam07455"
                     /db_xref="CDD:311413"
     gene            complement(588240..588485)
                     /locus_tag="KPHS_05470"
                     /db_xref="GeneID:11845534"
     CDS             complement(588240..588485)
                     /locus_tag="KPHS_05470"
                     /codon_start=1
                     /transl_table=11
                     /product="phage transcriptional activator, Ogr/delta"
                     /protein_id="YP_005224847.1"
                     /db_xref="GeneID:11845534"
                     /translation="MMHCPFCKKSAHARTSRYLSENVKQRYHQCTNIECSATFRTTEA
                     IDEVIRPPAEKAPPVAEPVTPPAPRNVQGCYSSPYRH"
     misc_feature    complement(588297..588485)
                     /locus_tag="KPHS_05470"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; cl19592"
                     /db_xref="CDD:327595"
     gene            complement(588482..589219)
                     /locus_tag="KPHS_05480"
                     /db_xref="GeneID:11845535"
     CDS             complement(588482..589219)
                     /locus_tag="KPHS_05480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224848.1"
                     /db_xref="GeneID:11845535"
                     /translation="MTDTTFIPDYLKPALERLAEARAAHLEQARLMEDTLTAITRAEE
                     QKAELEQDNGSDTRTWRAAFRAGGAMLTDELKSGHIERVARRELAQECHNLTEVLAFE
                     RDQLKATCNSTARAFRQAHHAVLSKYAEEELNRALNDTLGPLVRAMVLKAEVMANPLA
                     NTTGHQGYTEPEKEVMHQVVTFLTGKVSAFSVTPADEPVLSLTGFPAVALAHMDHDAA
                     STPGERKVWQEKIRQREADLKARGLLP"
     gene            589780..590046
                     /locus_tag="KPHS_05490"
                     /db_xref="GeneID:11845536"
     CDS             589780..590046
                     /locus_tag="KPHS_05490"
                     /codon_start=1
                     /transl_table=11
                     /product="phage DNA binding protein"
                     /protein_id="YP_005224849.1"
                     /db_xref="GeneID:11845536"
                     /translation="MHTAFSSPSSAPAAPLMPVSDTVQERFIRLPEVMHLCGLSRSTI
                     YDLISREAFPKQISLGGKNVAWAQSEITGWMADRIAERNRGYDA"
     misc_feature    589849..590031
                     /locus_tag="KPHS_05490"
                     /note="Predicted DNA-binding transcriptional regulator
                     AlpA [Transcription, Mobilome: prophages, transposons];
                     Region: AlpA; COG3311"
                     /db_xref="CDD:225848"
     gene            590397..590591
                     /locus_tag="KPHS_05500"
                     /db_xref="GeneID:11845537"
     CDS             590397..590591
                     /locus_tag="KPHS_05500"
                     /codon_start=1
                     /transl_table=11
                     /product="phage immunity repressor protein"
                     /protein_id="YP_005224850.1"
                     /db_xref="GeneID:11845537"
                     /translation="MATTLTPSHPQFVFVFAAVRRADRQPRICMLRAVAGDEHAARLS
                     LVRDYVLSFAGRLPVAEVRA"
     gene            590588..590815
                     /locus_tag="KPHS_05510"
                     /db_xref="GeneID:11845538"
     CDS             590588..590815
                     /locus_tag="KPHS_05510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224851.1"
                     /db_xref="GeneID:11845538"
                     /translation="MKQPAITVKDLECLEHLRNVGHFVSAMMQEQDCTTIRRDPAQQS
                     QLTSVIYLMTAQLDGVVERCNHRWFTGEGNV"
     gene            590812..591132
                     /locus_tag="KPHS_05520"
                     /db_xref="GeneID:11845539"
     CDS             590812..591132
                     /locus_tag="KPHS_05520"
                     /codon_start=1
                     /transl_table=11
                     /product="P4 phage protein"
                     /protein_id="YP_005224852.1"
                     /db_xref="GeneID:11845539"
                     /translation="MKTPLPPVLRAALYRRAVACAWLTLCERQHRYPHLTLDALESAI
                     ATELEGFYLRQHGEEKGRLIACALLEDLMQAGPLKAAPSLSFLGLAVMDELCARHITS
                     PVLH"
     misc_feature    590812..591129
                     /locus_tag="KPHS_05520"
                     /note="Family of unknown function (DUF5375); Region:
                     DUF5375; pfam17345"
                     /db_xref="CDD:340061"
     gene            591147..593480
                     /locus_tag="KPHS_05530"
                     /db_xref="GeneID:11845540"
     CDS             591147..593480
                     /locus_tag="KPHS_05530"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphatase, D5 family"
                     /protein_id="YP_005224853.1"
                     /db_xref="GeneID:11845540"
                     /translation="MKMNVTDTVKQACGHWPRILPALGMKVIKNRHQACPVCGGADRF
                     RFDDQEGRGTWFCNQCGAGDGLKLVEKVFGISASEAAGKVNAVTGNLPPVAPEVTAAA
                     EAGTEADRKAAAALAVRLLEKTRPATGNAYLTRKGFAGRECLTLTASHKTGGVAYRAG
                     DVVVPLYDGTGALVNLQLINAEGLKRTLKGGQVKGACHLIDGQKQAGKRLWIAEGYAT
                     ALTVHHLTGETVMVALSSVNLLSLASLARHKHPACQIILAADRDLNGTGQTKAAAAAE
                     ACEGIVALPPVFGDWNDAAMLKGEDATRKAIYAAIRPAAQSPFDTMSEAEFTAMSASD
                     KAWRVHEHYGEALAVDANGQLLSRYEAGIWKVIQPSNFERDVAGLFQRLRAPFSSGRI
                     ASVVETLKLIIPQQAAPARRLIGFRNGVLDTQSGLFSPHSKSHWLRTLCDVDFTPPVE
                     GETLETHAPNFWRWLDRAASGNPTKRDVILAALFMVLANRYDWQLFLEVTGPGGSGKS
                     ILAEIATMLAGEDNATSANIDTLEDPRKRASLIGFSLIRLPDQEKWSGDGAGLKAITG
                     GDAVSVDPKYQNPYSTHIPAVILAVNNNPMRFTDRSGGVSRRRVIIHFPEQIAPEERD
                     PQLRDKIARELAVIVRQLMQQFSDPMSARSLLQSQQNSDEALSIKRDADPTFDFCGYL
                     EMLPQTNGMFMGNASIIPRNYRKYLYHAYLAYMEANGYRNVLSLKMFGLGLPMMLKEY
                     GMNYEKRHTKQGIQTNLSLKEESYGDWLPKCDEPTAT"
     misc_feature    591147..592250
                     /locus_tag="KPHS_05530"
                     /note="Uncharacterized domain associated with
                     phage/plasmid primase [Mobilome: prophages, transposons];
                     Region: COG4643"
                     /db_xref="CDD:226990"
     misc_feature    <592332..593468
                     /locus_tag="KPHS_05530"
                     /note="Phage- or plasmid-associated DNA primase [Mobilome:
                     prophages, transposons]; Region: COG3378"
                     /db_xref="CDD:225913"
     gene            594225..594491
                     /locus_tag="KPHS_05540"
                     /db_xref="GeneID:11845541"
     CDS             594225..594491
                     /locus_tag="KPHS_05540"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family element, transposase orfA"
                     /protein_id="YP_005224854.1"
                     /db_xref="GeneID:11845541"
                     /translation="MRKIRFTEHQIIAVLKSVEAERTVKDVCREAAISEASYYNWKAK
                     HGGMEAVDIKKIKDLEDENRRLKQMFADLSLECRALKDVIEKKL"
     misc_feature    594228..594437
                     /locus_tag="KPHS_05540"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:307599"
     gene            complement(594569..594724)
                     /locus_tag="KPHS_05550"
                     /db_xref="GeneID:11845542"
     CDS             complement(594569..594724)
                     /locus_tag="KPHS_05550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224855.1"
                     /db_xref="GeneID:11845542"
                     /translation="MVPGIALPAQQLEQLLKTVARIAFCQFSQRVDLGFITPGIGLIK
                     IHRPAQR"
     gene            594857..595336
                     /locus_tag="KPHS_05560"
                     /db_xref="GeneID:11845543"
     CDS             594857..595336
                     /locus_tag="KPHS_05560"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family element, transposase orfB"
                     /protein_id="YP_005224856.1"
                     /db_xref="GeneID:11845543"
                     /translation="MYDALVCGRRFRTFNVVDDFNREALAIEINRNIPAQRIIRVLDR
                     IVANRGYPLKMRMDNGPELVSRALAQWAEEHGVQLEFIKPGKPTQNAFIERFNRTYRT
                     EILDFYLFRTLNEAREITERWLIEYNNERPHESLNNLTPEEYRLMAEKPELSKSAWN"
     misc_feature    594875..595168
                     /locus_tag="KPHS_05560"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:334200"
     misc_feature    595079..595279
                     /locus_tag="KPHS_05560"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:338895"
     gene            595451..595678
                     /locus_tag="KPHS_05570"
                     /db_xref="GeneID:11845544"
     CDS             595451..595678
                     /locus_tag="KPHS_05570"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase D"
                     /protein_id="YP_005224857.1"
                     /db_xref="GeneID:11845544"
                     /translation="MEKLNALGIVTMLVNRVHSKIVIGDEGLLCIGSFNWFSATRDEK
                     YKRYDTSMVYRGESLQAEIKTIYSSLEQRKL"
     misc_feature    <595454..595669
                     /locus_tag="KPHS_05570"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:326546"
     misc_feature    order(595502..595504,595508..595510,595547..595549,
                     595553..595555,595595..595597)
                     /locus_tag="KPHS_05570"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     misc_feature    595502..595504
                     /locus_tag="KPHS_05570"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197200"
     gene            complement(595870..596085)
                     /locus_tag="KPHS_05580"
                     /db_xref="GeneID:11845545"
     CDS             complement(595870..596085)
                     /locus_tag="KPHS_05580"
                     /codon_start=1
                     /transl_table=11
                     /product="Hcp1 family type VI secretion system effector"
                     /protein_id="YP_005224858.1"
                     /db_xref="GeneID:11845545"
                     /translation="MYQILDAGVESEYFNITLENVKVTGITPNLFPDSGTGTHSETIQ
                     LRYEAITWKHCDGNIIYKDSWNHRATA"
     misc_feature    complement(595873..>596085)
                     /locus_tag="KPHS_05580"
                     /note="Type VI secretion system effector, Hcp; Region:
                     T6SS_HCP; cl01226"
                     /db_xref="CDD:321401"
     gene            complement(596352..596699)
                     /locus_tag="KPHS_05590"
                     /db_xref="GeneID:11845546"
     CDS             complement(596352..596699)
                     /locus_tag="KPHS_05590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224859.1"
                     /db_xref="GeneID:11845546"
                     /translation="MKKIITPLVDIVLCTYIITTCFICLTEFNNWQNKIIAVTIIIGS
                     AYIIAIALNRLLGTKIGVLSGIFNLLSGPLLIIGAIVCIALLDPWPVKVIGLFLWVII
                     MFCLPSFINRDKE"
     gene            complement(596701..597375)
                     /locus_tag="KPHS_05600"
                     /db_xref="GeneID:11845547"
     CDS             complement(596701..597375)
                     /locus_tag="KPHS_05600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224860.1"
                     /db_xref="GeneID:11845547"
                     /translation="MADIEGIARKLYNIIISPDTVTGLINGGLSVPLDYGYLIYGIFD
                     TDTRYERETERIRMMTAIRHDILNYENIVNAVKLIFQLFNKYLSESEQDRIYRSVVTS
                     IVGRISTNIIASNIAKAVIEKTSFTYVVFKGKGNPIAFLSTILLFGGMAERSIRTSDK
                     LRNEEPEVYSLLRPRDYDLLYFLFADAVQPFVDAIHAGYTEGNPVFDKIMKRVEDHLN
                     TNAKAG"
     gene            complement(597730..597912)
                     /locus_tag="KPHS_05610"
                     /db_xref="GeneID:11845548"
     CDS             complement(597730..597912)
                     /locus_tag="KPHS_05610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224861.1"
                     /db_xref="GeneID:11845548"
                     /translation="MKRLVLALLLFIFKESAVAPALTPEADITLVNPSMFAREGYRRH
                     NMMLSMCSHKPPVHES"
     misc_feature    complement(<597790..>597843)
                     /locus_tag="KPHS_05610"
                     /note="conjugative transfer ATPase, PFL_4706 family;
                     Region: traC_PFL_4706; TIGR03744"
                     /db_xref="CDD:274761"
     gene            complement(598562..599431)
                     /locus_tag="KPHS_05620"
                     /db_xref="GeneID:11845549"
     CDS             complement(598562..599431)
                     /locus_tag="KPHS_05620"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="YP_005224862.1"
                     /db_xref="GeneID:11845549"
                     /translation="MPSSTTLQHAIENITIWRKGEQRAPHKPLLLLYVLSQYQRGHAR
                     MFDYASEIRDELHSLLERFGPQRRQYRPDMPFWRLKGDGFWELHNSEQCSIQGSRKPP
                     GKELELCHVAGGFDEPHFALLNRNKRLINTLAHQILEAHFPESIQEELAEEMGFDLLQ
                     IRKERDPHFRQQVLRAYNYECAICGFNMRHDNTSVALEAAHIKWKQHGGPCEIPNGLA
                     LCAIHHKAFDKGSIGLDEDMRIQVSPAVNGGGIVGRLFWDFDGKPITLPQGKECYPQE
                     GFVAWHRREVFRG"
     misc_feature    complement(598568..599431)
                     /locus_tag="KPHS_05620"
                     /note="Predicted restriction endonuclease [Defense
                     mechanisms]; Region: COG3440"
                     /db_xref="CDD:225973"
     gene            599611..600249
                     /locus_tag="KPHS_05630"
                     /db_xref="GeneID:11845550"
     CDS             599611..600249
                     /locus_tag="KPHS_05630"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="YP_005224863.1"
                     /db_xref="GeneID:11845550"
                     /translation="MKKLPDHLSRECIIAAIRAYDAGVAHQFKSARLYEIEFEGRRYP
                     SKAIVGLAATLATGTEFTPADFSGGIKSKCVRLLLDQGFTIASQGAGDDEVALFPDEG
                     QTTMEFVEGAAMQVVVNRYERDRQARQAALRLHGCRCQVCGLDMASRYGEIGQGFIHI
                     HHLIPLAGIKQDYRLNPETDLIPVCPNCHAMLHRRDPPFTPEELKARLRPAD"
     misc_feature    <599929..600237
                     /locus_tag="KPHS_05630"
                     /note="Predicted restriction endonuclease, HNH family
                     [Defense mechanisms]; Region: COG3183"
                     /db_xref="CDD:225724"
     gene            complement(600332..602011)
                     /locus_tag="KPHS_05640"
                     /db_xref="GeneID:11845551"
     CDS             complement(600332..602011)
                     /locus_tag="KPHS_05640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative beta-1,4-xylosidase, XynB"
                     /protein_id="YP_005224864.1"
                     /db_xref="GeneID:11845551"
                     /translation="MSLIQNPILRGFNADPSIIRVEDTYYIANSTFEWFPGVRLHESK
                     DLKNWNLLPSPLSTTTLLDMKGNPSSGGIWAPALSWADGQFWLVYTDVKVTEGAFKDM
                     TNYLTTAKDIRGPWSDPIKLNGVGFDASLFHDDDGRKYIVQQTWDHREYHHPFDGITL
                     TELDTKTLKLMPETARTIYRGTAVALVEGPHLYKLNGYYYLFAAQGGTVFTHQEVVAR
                     SKTLEADSFETEPGDVFLTNVDTPDSYIQKQGHGALVSTPEGEWYYASLCARPWNRPG
                     ESIYDPRGWSTLGRETAIQKVYWDDEGWPRIEGGHGGKTFVEGPKDAIFTESASDNSQ
                     QDDFTSPALDPNWNTLRVPFTAKMGTTGDGKLTLIGQGSLANTHDLSLIARRWQAFYF
                     DAAVKVKFEPFSYQQMAGLTNYYNDRHWSFVFLTWNEINGKVIEVGENNRGKYTSYLK
                     DNAIKVPDGVEYVWFRTKVRKQTYSYEYSFDGVTFTEIPVQLDAAVLSDDYVLQSYGG
                     FFTGAFVGLAAVDYAGYGTQAEFYQFEYQELGDRLAADGSYSWEAGETRDK"
     misc_feature    complement(600395..602011)
                     /locus_tag="KPHS_05640"
                     /note="Beta-xylosidase [Carbohydrate transport and
                     metabolism]; Region: XynB2; COG3507"
                     /db_xref="CDD:226038"
     gene            complement(602070..603509)
                     /locus_tag="KPHS_05650"
                     /db_xref="GeneID:11845552"
     CDS             complement(602070..603509)
                     /locus_tag="KPHS_05650"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="YP_005224865.1"
                     /db_xref="GeneID:11845552"
                     /translation="MHSRHDEYHKLTRGERIGYGMGDFAQNLVFGTIGGFLALHMLTV
                     NTISTATAGFIFLFVRIINVFWDPMVGTYVDKRTSKAGKYRPWLLRAGVPLVILSALL
                     FAPIPGVKGSVAFAFIIYLALDLVYSLVNIPYGSLNASLTRDPESIDKLTSTRMMLAN
                     SANLLVYTLFPMFVQMAAPKDRSLKDTGFFGLELNLGNYTDPSANYAWFGVYAIYMII
                     GAVALFICYKCTKERVVATAEQTANVKTTDLFHELRHNRPLVILGMFFMLAFTFMFFM
                     NTVNGFFNQFVVGHSEWMGAVGLVASIPGIAFPVFWPKLKKIFGKKGFFHLFLAMFIV
                     GELLTYVWSREGMHDALWLAYIATFIKQWGLTSATGFMWALVPEVIAYGELKSGKRNA
                     AIINAIMGLFFKIGFTIGGAIPLWLLAVYGFNESGAVQSASAIDGIIMTAVWIPIALA
                     AISMVIMQVYPISDKHVTDINRQLDEIRV"
     misc_feature    complement(602076..603497)
                     /locus_tag="KPHS_05650"
                     /note="Na+/melibiose symporter or related transporter
                     [Carbohydrate transport and metabolism]; Region: MelB;
                     COG2211"
                     /db_xref="CDD:225121"
     gene            603936..605255
                     /locus_tag="KPHS_05660"
                     /db_xref="GeneID:11845553"
     CDS             603936..605255
                     /locus_tag="KPHS_05660"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="YP_005224866.1"
                     /db_xref="GeneID:11845553"
                     /translation="MQTYFDQLERVRFAGPKTDNPLAFRHYNPDEIVLGKRMADHLRF
                     AACYWHNFCWNGADMFGAGSFERPWQAAGDALEMAKRKADVAFEFFYKLNVPYYCFHD
                     VDVSPEGASLKEYLHNFAIMTEVLAEKQQQTGVKLLWGTANCFTHPRYGAGAATNPDP
                     EVFAWAATQVVTAMNATHQLGGENYVLWGGREGYESLLNTDLRQEREQIGRFLQMVVE
                     HKHKIGFGGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAG
                     HSFHHEIASAIALGIFGSVDANRGDAQLGWDTDQFPNSVEENTLVMYEILKAGGFTTG
                     GLNFDAKVRRQSTDKYDMFYGHIGAMDVMALSLKLAARMIEDGKLDQGLAKRYAGWQG
                     ELGQKIMSGQMSLDNIARYAEQHNLNPQPQSGRQELLENLVNTYIFG"
     misc_feature    603942..605252
                     /locus_tag="KPHS_05660"
                     /note="xylose isomerase; Provisional; Region: PRK05474"
                     /db_xref="CDD:235487"
     gene            605283..605396
                     /locus_tag="KPHS_05670"
                     /db_xref="GeneID:11845554"
     CDS             605283..605396
                     /locus_tag="KPHS_05670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224867.1"
                     /db_xref="GeneID:11845554"
                     /translation="MYSAVYPLPGNSVYWFVLCFFCQWRKTTCLISAKEEG"
     gene            605527..606909
                     /locus_tag="KPHS_05680"
                     /db_xref="GeneID:11845555"
     CDS             605527..606909
                     /locus_tag="KPHS_05680"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate porin"
                     /protein_id="YP_005224868.1"
                     /db_xref="GeneID:11845555"
                     /translation="MTMIKKLPLTMAVIAAFFPLTSVMAQEFTQEQIDAIVAKAVDKA
                     LADRQAKIDAAANKKVDVITNPETTAASPDMAIPFGLKFSGYARYGAHFQTGDQKYVG
                     VDGSYNGASAIGRLGNESNGGEFQISKAFKSAQGAIWDLNVMFDHWSDEVNLKKAYVG
                     VTNVLESNPNAYIWAGRDFHQRPQQGINDYFWMNHDGQGAGVKNFDIGGVQFDVAAVS
                     QVKSCSPEVMADETNPSRITCTGSSDTGDNGHYALTTKTHNIKAGPIDVEVYANYGFD
                     SKAVDSDARLEAWQGGLVLSHTNDSGVNKVILRYSDNSDNSVYNKTDDLTTVYASFEG
                     SHKFTQQAQVEYLLAFHDYDNGRDNTDNRKNYGAIVRPMYFWNDVYSTWLEAGYQRVD
                     YDQGGDNHGWKLTLSQNIAIGMGPEFRPMLRFYVTGGQVDNEHTAKVNGTQDQQLDSL
                     NVGGMFEAWF"
     misc_feature    605773..606906
                     /locus_tag="KPHS_05680"
                     /note="LamB porin; Region: LamB; pfam02264"
                     /db_xref="CDD:334868"
     gene            complement(607204..608085)
                     /locus_tag="KPHS_05690"
                     /db_xref="GeneID:11845556"
     CDS             complement(607204..608085)
                     /locus_tag="KPHS_05690"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF523 and DUF1722 domain-containing protein"
                     /protein_id="YP_005224869.1"
                     /db_xref="GeneID:11845556"
                     /translation="MGFVMDELAQWVAFKPVCPEMAIGLPVPRPALRLVQTPVGEIRM
                     RFSHAPHEDVTEKMADFASAHLATLGELSGFIVCAKSPSCGMERVRLYDEKGNRGRKE
                     GVGLFTGALMARYPWLPVEEDGRLHDPLLRENFVERVFALHELNALRARGLTRHSLLA
                     FHSRYKLQLLAHHQAGYREIGPFVASLHEWEDLEAFFEVYREKLMAILKQPASRKNHT
                     NVLMHIQGYFRDQLNSRQRGELREVILNYRAGLLPILAPLTLLKHYLAEYPDRYLQAQ
                     NYFDPYPQDLALRLTVN"
     misc_feature    complement(607696..608085)
                     /locus_tag="KPHS_05690"
                     /note="Uncharacterized conserved protein YbbK, DUF523
                     family [Function unknown]; Region: YbbK; COG1683"
                     /db_xref="CDD:224597"
     misc_feature    complement(607216..607695)
                     /locus_tag="KPHS_05690"
                     /note="Uncharacterized conserved protein YbgA, DUF1722
                     family [Function unknown]; Region: YbgA; COG3272"
                     /db_xref="CDD:225811"
     gene            complement(608160..608711)
                     /locus_tag="KPHS_05700"
                     /db_xref="GeneID:11845557"
     CDS             complement(608160..608711)
                     /locus_tag="KPHS_05700"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_005224870.1"
                     /db_xref="GeneID:11845557"
                     /translation="MKRILTLGLALLMLILAGCSTEVTEYRQQQPALDIFHYFQGRTE
                     AWGMVQDRSGKQLRRFHVAIDGDVVGDTLTLHERFVYDDGEKQQRVWRIRRTGDNRYQ
                     GTAGDIEGVASGQAAGNAFHWRYSMNVEASGSRWLLHFDDWMFLQDGSHLFNKTEMKK
                     FGITVATVTLFFTRTTAEERTAP"
     misc_feature    complement(608190..608654)
                     /locus_tag="KPHS_05700"
                     /note="Protein of unknown function (DUF3833); Region:
                     DUF3833; pfam12915"
                     /db_xref="CDD:338548"
     gene            complement(608708..609232)
                     /locus_tag="KPHS_05720"
                     /db_xref="GeneID:11845558"
     CDS             complement(608708..609232)
                     /locus_tag="KPHS_05720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224871.1"
                     /db_xref="GeneID:11845558"
                     /translation="MRFALLLLWLTTLAPAAHAADWLTWRRVGEATLTWGPFTVYHSQ
                     LRTPNGRYDGPQQDRALIITYQRDIDREALVEATRDQWQAQGILQQEPRSEAWLRMLQ
                     GIWPDVAPGSQLAFVDSGSEGQFWYRASAAQTAFTPLGPRQSAAFSTRFLAIWLDPRT
                     TYPELRQQLIGGTP"
     gene            complement(609229..609714)
                     /locus_tag="KPHS_05710"
                     /db_xref="GeneID:11845559"
     CDS             complement(609229..609714)
                     /locus_tag="KPHS_05710"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2878 domain-containing protein"
                     /protein_id="YP_005224872.1"
                     /db_xref="GeneID:11845559"
                     /translation="MTRPAQYLLMALAFDVYWTLVVMLRERGLLIWLTLALFAWLRLP
                     AASRPPALLLAAAGCGLDACWALAGLIDFRGDSLLPLWMVALWLMFAVVWTRLTRTTT
                     LPGWVLAAAATVGGPVAYLLGARLGAMTLLVPMALAVAAMACGWLVLMLLFHLGMGRR
                     K"
     misc_feature    complement(609259..609696)
                     /locus_tag="KPHS_05710"
                     /note="Protein of unknown function (DUF2878); Region:
                     DUF2878; pfam11086"
                     /db_xref="CDD:337909"
     gene            complement(609711..610931)
                     /locus_tag="KPHS_05730"
                     /db_xref="GeneID:11845560"
     CDS             complement(609711..610931)
                     /locus_tag="KPHS_05730"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclopropane-fatty-acyl-phospholipid synthase
                     family protein"
                     /protein_id="YP_005224873.1"
                     /db_xref="GeneID:11845560"
                     /translation="MTDPVFALEPDVPRNVRLARWLLFRLLSGLREGSLTVREGAQTF
                     HFGDPAAALRAEARVCTPEVYWRLLTGGSLAAAEAWMDGDWESHQLTALLQILARNGK
                     VLGRLERGFRLLGKPVARLRHWTRRNTRAQARENIAAHYDLGNEFYAHFLDEDLLYSS
                     ALFTDDQQDLTQAQRAKMARLCDQLALNPGDHLLEIGTGWGALAEYAARHYGCRVTTT
                     TLSREQHRWATERMARAGLQDRVEVLLCDYRDLRGEYDKLVSVEMIEAVGQRYLPAFF
                     RTCQARLRPGGRMALQAITIQDQRYRDYSKSVDFIQRYIFPGGFLPSITAMSELMTRH
                     TDFVVRNLFDMGPDYARTLAHWRQRFTHAWQDIEKLGFDERFRRMWLYYFGYCEAGFN
                     ARTISVVQLTAERV"
     misc_feature    complement(609717..610577)
                     /locus_tag="KPHS_05730"
                     /note="Cyclopropane fatty-acyl-phospholipid synthase and
                     related methyltransferases [Lipid transport and
                     metabolism]; Region: Cfa; COG2230"
                     /db_xref="CDD:225139"
     gene            complement(610928..611650)
                     /locus_tag="KPHS_05740"
                     /db_xref="GeneID:11845561"
     CDS             complement(610928..611650)
                     /locus_tag="KPHS_05740"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition ParA protein"
                     /protein_id="YP_005224874.1"
                     /db_xref="GeneID:11845561"
                     /translation="MNSCLYQGVLRHRRLQPKAHHFVYRLFMTWLDLDELDRLPEAGI
                     RRNRLAAAAWYDADYPLGAPLKAQVLNRLESLTGCRPAGRVMLLTQLRYFGFHFNPVN
                     FYYCYDEADTLRWVLAEVRNTPWNERHYYAVDGQQARPLEKAFHVSPFNPMDMVYHWR
                     FNAPGKTLHMHIENHQASKVFDATLALSRVPLTRANLRGLLLRLPLMTLKTVLAIYWQ
                     ALRLWLKRVPLYNHPVSRSERS"
     misc_feature    complement(610952..611620)
                     /locus_tag="KPHS_05740"
                     /note="Protein of unknown function (DUF1365); Region:
                     DUF1365; pfam07103"
                     /db_xref="CDD:336609"
     gene            complement(611652..612911)
                     /locus_tag="KPHS_05750"
                     /db_xref="GeneID:11845562"
     CDS             complement(611652..612911)
                     /locus_tag="KPHS_05750"
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate oxidase"
                     /protein_id="YP_005224875.1"
                     /db_xref="GeneID:11845562"
                     /translation="MNIAIIGSGIAGLTCAWRLAGHHQVTLFEAGATPGGHTATVDVA
                     TPQGTWAIDTGFIVYNDRTYPRFMGLLSELGIGGQKTQMSFSVHNPTSGLEYNGHSLT
                     SLFAQRRNLLKPAFWGLLSEIVRFNRLAKLALTEALDPGATLESFLTRHRFSPFFARH
                     YILPMGAAIWSSSLQEMRRFPLPLFLRFFENHGLLDIRDRPQWYVVPGGSREYVRALL
                     ARLGDRLDLRLNAPVQQVERHPAGVILRLASGEAHFDQVIFACHSAQALAMLAAPTDA
                     EREVLGDIGWQRNEVVLHSDPRWLPERQRAWASWNYRLSDGDLARACVTYNMNILQGL
                     PAGAPLFCVTLNPDAPVDDRYVWQRFVYEHPLFNPQSWSAQLRREEINGQQRSWYCGA
                     YWYNGFHEDGVRSALDVVQGIAAAEGK"
     misc_feature    complement(611664..612911)
                     /locus_tag="KPHS_05750"
                     /note="Predicted NAD/FAD-binding protein [General function
                     prediction only]; Region: COG2907"
                     /db_xref="CDD:225459"
     gene            complement(612908..613627)
                     /locus_tag="KPHS_05760"
                     /db_xref="GeneID:11845563"
     CDS             complement(612908..613627)
                     /locus_tag="KPHS_05760"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_005224876.1"
                     /db_xref="GeneID:11845563"
                     /translation="MMTVLITGASSGIGAGLAKSFAADGHLVIACGRDASRLAALQQL
                     SPNISVRLFDMTDRDACRQALTGCFADLIILCAGTCEYLDHGQVDAALVERVMATNFL
                     GPVNCLAALQTQLEAGDRVVLVSSMAHWLPFPRAEAYGASKAALTWFANSLRLDWEPK
                     GVAVTVVSPGFVDTPLTRKNDFAMPGRVSVDRAVAAIRHGLAKGKNHIAFPTGFSLAL
                     RLLASLPSGIQRLLLRRMVRS"
     misc_feature    complement(612917..613627)
                     /locus_tag="KPHS_05760"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl21454"
                     /db_xref="CDD:354811"
     gene            complement(613624..614058)
                     /locus_tag="KPHS_05770"
                     /db_xref="GeneID:11845564"
     CDS             complement(613624..614058)
                     /locus_tag="KPHS_05770"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="YP_005224877.1"
                     /db_xref="GeneID:11845564"
                     /translation="MSTSPSVIRRFVEYYAGLDAQPPAALATLYHPDATLSDPFGQHQ
                     GLFAIQRYFTHLLANVEQCRFTIDTPLCDGQRFAVTWTMHWSHPRIAGGETLALPGCS
                     VVDIAGEQVLHQRDYYDAGEMIYEHLPLLGWAVRGVKRRVRS"
     misc_feature    complement(613726..614022)
                     /locus_tag="KPHS_05770"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:338445"
     gene            complement(614290..615018)
                     /locus_tag="KPHS_05780"
                     /db_xref="GeneID:11845565"
     CDS             complement(614290..615018)
                     /locus_tag="KPHS_05780"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_005224878.1"
                     /db_xref="GeneID:11845565"
                     /translation="MPYSIGEFARLCGINATTLRAWQRRYGLLKPLRTDGGHRLYSDD
                     DVQQALKILDWVKKGVPVSQVKPLLSRPGARRTNNWLTLQETMLQRLKEGKIESLRQL
                     IYDAGREYPRQELVTEVLRPLRSQVSANVPAIMTLREILDGIIIAYTSFCLEGDKKAP
                     GDNFLITGWHLTDACEIWLEALKRTGQGHRIDVLPVPPAALAPEIFPQRNWLLVTSGK
                     LSAARQRQVELWQQQVVSLEVIPL"
     misc_feature    complement(614293..615012)
                     /locus_tag="KPHS_05780"
                     /note="transcriptional regulator MirA; Provisional;
                     Region: PRK15043"
                     /db_xref="CDD:185003"
     gene            615135..615668
                     /locus_tag="KPHS_05790"
                     /db_xref="GeneID:11845566"
     CDS             615135..615668
                     /locus_tag="KPHS_05790"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein Blc"
                     /protein_id="YP_005224879.1"
                     /db_xref="GeneID:11845566"
                     /translation="MKLWPVVTGVAIALTLVACKSPTPPKGVQPISGFDASRYLGKWY
                     EVARLENRFERGLEQVTATYGARSDGGISVVNRGYDPVKKRWNESDGKAYFTGAPTTA
                     ALKVSFFGPFYGGYNVIRLDDDYQYALVSGPNRDYLWILSRTPTIPAAVKQDYLNTAR
                     ELGFDVDRLVWIRQTPR"
     misc_feature    615135..615665
                     /locus_tag="KPHS_05790"
                     /note="outer membrane lipoprotein Blc; Provisional;
                     Region: PRK10477"
                     /db_xref="CDD:182489"
     gene            complement(615678..616025)
                     /locus_tag="KPHS_05800"
                     /db_xref="GeneID:11845567"
     CDS             complement(615678..616025)
                     /locus_tag="KPHS_05800"
                     /codon_start=1
                     /transl_table=11
                     /product="cyanate transport"
                     /protein_id="YP_005224880.1"
                     /db_xref="GeneID:11845567"
                     /translation="MNLNLVCYSLLLLTAVGSALLPYPLAMWFLLSSLLTWLIYGADK
                     LAARKAWRRVPETTLLVLGLAGGWPGAILGQQCFRHKTQKQPFRTRFFISVALNVAAL
                     AGLYVVYTYLLSR"
     misc_feature    complement(615777..615929)
                     /locus_tag="KPHS_05800"
                     /note="Protein of unknown function (DUF1294); Region:
                     DUF1294; pfam06961"
                     /db_xref="CDD:336557"
     gene            complement(616098..619247)
                     /locus_tag="KPHS_05810"
                     /db_xref="GeneID:11845568"
     CDS             complement(616098..619247)
                     /locus_tag="KPHS_05810"
                     /codon_start=1
                     /transl_table=11
                     /product="CusA/CzcA family heavy metal efflux RND
                     transporter"
                     /protein_id="YP_005224881.1"
                     /db_xref="GeneID:11845568"
                     /translation="MIEWIIRRSVANRFLVMMAALFLSIWGTWTIIHTPVDALPDLSD
                     VQVIVKTRYPGQAPQIVENQVTWPLTTTMLSVPGARTVRGFSQFGDSYVYVIFEDGTD
                     PYWARSRVLEYLNQVQGKLPAGVSAEMGPDATGVGWVFEYALVDRSGKHDLAELRSLQ
                     DWFLKYELKTIPNVSEVASVGGVVKEYQIVVDPMKLTQYGISLGEVKSALDASNQEAG
                     GSSVELAEAEYMVRASGYLQTLDDFKNIVLKTGDNGVPVYLGDVARVQIGPEMRRGIA
                     ELNGEGEVAGGVVILRSGKNAREVISAVKEKLASLQSSLPEGVEVVTTYDRSQLIDRA
                     IDNLSYKLLEEFIVVALVCALFLWHVRSALVAIISLPLGLCFAFIMMHFQGLNANIMS
                     LGGIAIAVGAMVDAAIVMIENAHKRLEEWEHQHPGEKLSNDTRWKIITEASVEVGPAL
                     FISLLIITLSFIPIFTLEGQEGKLFGPLAFTKTWSMAGAALLAIVAIPILMGFWIRGR
                     IPAENSNPLNRFLIRIYHPLLLKVLHWPKTTLLIALLSILTVVWPLNRVGGEFLPQIN
                     EGDLLYMPSTLPGISAAQAADMLQKTDKLIMAVPEVARVFGKTGKAETATDSAPLEMV
                     ETTIQLKPQDQWRPGMTMEKIVDELDKTVRLPGLANLWVPPIRNRIDMLSTGIKSPIG
                     IKVSGTNLADIDAIAGQIEGVARSVPGVTSALAERLVGGRYLDIDIQREKAARYGMTV
                     GDVQLFVSSAIGGAMVGETVEGVERYPINIRYPQSYRDSPETLRQLPILTPLKQQIVL
                     GDVAEVKVVTGPSMLKTENARPTSWIYIDARDRDMVSVVHDLQQAIGKEVKLKPGISV
                     SYSGQFELLERANQKLKLMVPMTLMIIFVLLYLAFRRVGEALLIITSVPFALVGGIWF
                     LYWMGFHLSVATGTGFIALAGVAAEFGVVMLMYLRHAIEAEPSLENPQTFSVDKLDEA
                     LYQGAVLRVRPKAMTVAVIIAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFI
                     IPAAYKLMWLYRHRGKRSQ"
     misc_feature    complement(616101..619247)
                     /locus_tag="KPHS_05810"
                     /note="heavy metal efflux pump, CzcA family; Region:
                     2A0601; TIGR00914"
                     /db_xref="CDD:129992"
     gene            complement(619259..620521)
                     /locus_tag="KPHS_05820"
                     /db_xref="GeneID:11845569"
     CDS             complement(619259..620521)
                     /locus_tag="KPHS_05820"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_005224882.1"
                     /db_xref="GeneID:11845569"
                     /translation="MASLTLKNTALILGSMLIGGALTAALYARLTPVDAAAPAAEQQR
                     KVLFWYDPMYPNTRFDKPGKSPFMDMDLVPKYADEESAAAGAPGVRIDPTQTQNLGVK
                     TAAVTRGPLRYAQTFPANISYNEYQYVIMQARAAGFINKVYPLTVGDKVKQGTPLLEL
                     TIPDWVEAQSEYLLLQETGGTATQVEGILERLRLAGMPDDDIRRLKATRKIQTRFTLK
                     APIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVSVAVPESIAWLIKDASQFSIQVP
                     AWPGKTFRISKWTLLPSVDSATRTLQLRLQVNNPDEALKPGMNAYLQLTSESAPMLLI
                     PSKALIDSGSEQRVITVDNEGRFVPKIVQVFHESNGVTAIRSGLQEGEKVVASGLFLI
                     DSEANIAGALERMRAQAPDAAASAAHAH"
     misc_feature    complement(619304..620506)
                     /locus_tag="KPHS_05820"
                     /note="copper/silver efflux system membrane fusion protein
                     CusB; Provisional; Region: PRK09783"
                     /db_xref="CDD:236625"
     gene            complement(620567..620911)
                     /locus_tag="KPHS_05830"
                     /db_xref="GeneID:11845570"
     CDS             complement(620567..620911)
                     /locus_tag="KPHS_05830"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding protein"
                     /protein_id="YP_005224883.1"
                     /db_xref="GeneID:11845570"
                     /translation="MNSLSKIALFTLLSGAVFAAQAAAPHAGMVMHEQPAAAQAQSIR
                     GKGVIKAIDMDNKKITIAHEAIPAVNWPPMTMRFTITPQTQLNNVKDGDSVDFTFVQQ
                     GNLSLLQDIRAQ"
     misc_feature    complement(620570..620911)
                     /locus_tag="KPHS_05830"
                     /note="periplasmic copper-binding protein; Provisional;
                     Region: PRK09838"
                     /db_xref="CDD:182104"
     gene            complement(620929..622314)
                     /locus_tag="KPHS_05840"
                     /db_xref="GeneID:11845571"
     CDS             complement(620929..622314)
                     /locus_tag="KPHS_05840"
                     /codon_start=1
                     /transl_table=11
                     /product="copper/silver efflux system outer membrane
                     protein CusC"
                     /protein_id="YP_005224884.1"
                     /db_xref="GeneID:11845571"
                     /translation="MRSIQLLTLSVIFTLTGCLSLAPDYQRPAAPVPQQFSLSQNKLV
                     TATAGYQETGWRTFFVDPQVKSLISTALTNNRDLRMATLKVQEARAQYRVTDADRYPQ
                     LNGDGSTTYGGKLKGDTTTSSDYAAGLNLSYDLDFFGRLKNLSEADRQNFFASEEARR
                     AVHILLIANVSQSYFNQRLAAAQLQVANDTLQNYQQSYAFVEKQLLTGSTTVLALEQA
                     RSMIESTRADIAKRQGQLAQANNALQLLLGSYQHLPDDSASSAVDLQGVTLPPSLSSA
                     ILLQRPDILEAEHSLQAANANIGAARAAFFPSITLTSSLSGSSSELSSLFNAGGAMWN
                     FIPKIELPIFNAGRNQASLDLAEIRQQQQVVNYEQKIQSAFKEVADALALRQSLADQI
                     AAQERYLASLNITLQRATALYRHGAVSYIEVLSAQRDIFTTRQTLLELNYSRQANEIT
                     LFTALGGGWME"
     misc_feature    complement(620932..622314)
                     /locus_tag="KPHS_05840"
                     /note="copper/silver efflux system outer membrane protein
                     CusC; Provisional; Region: PRK09837"
                     /db_xref="CDD:182103"
     gene            complement(622281..622421)
                     /locus_tag="KPHS_05850"
                     /db_xref="GeneID:11845572"
     CDS             complement(622281..622421)
                     /locus_tag="KPHS_05850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224885.1"
                     /db_xref="GeneID:11845572"
                     /translation="MKYQENDSFVIFPSRPEQSPLRKVAAMDKSSKLLPPCAQYSYLP
                     SA"
     gene            622486..623169
                     /locus_tag="KPHS_05860"
                     /db_xref="GeneID:11845573"
     CDS             622486..623169
                     /locus_tag="KPHS_05860"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator protein Irlr"
                     /protein_id="YP_005224886.1"
                     /db_xref="GeneID:11845573"
                     /translation="MKILIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTSD
                     YDLLILDIMLPDVNGWDIVRMLRAAGKGMPILLLTALGTIEHRVKGLELGADDYLVKP
                     FAFAELLARVRTLLRRGAAVIVESQFQAADLSVDLVSRKVTRGATRITLTSKEFTLLE
                     FFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDFEPKLIQTVRGVG
                     YMLEVPDGR"
     misc_feature    622486..623163
                     /locus_tag="KPHS_05860"
                     /note="DNA-binding transcriptional activator CusR;
                     Provisional; Region: PRK09836"
                     /db_xref="CDD:182102"
     gene            623159..624592
                     /locus_tag="KPHS_05870"
                     /db_xref="GeneID:11845574"
     CDS             623159..624592
                     /locus_tag="KPHS_05870"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor kinase CusS"
                     /protein_id="YP_005224887.1"
                     /db_xref="GeneID:11845574"
                     /translation="MAAKRPFSLATRLTFFISLATIIAFFAFTWIMIHSVKAHFEERD
                     VHDLRQLSTTLETVLDHADYPQARRLEIVKNIIAGYANVFICLDDGQGNILFQSPNGP
                     DLSHMLSTPGLAMQLRDGNVISWTDPQPRAMAHDNHPLETRAWRLIMLPLGKQADGKP
                     AYHLLMALSIDFHLHYINELKAKLISAASIISLLIIAIVLFVVYQGHKPIRQISRQIQ
                     NITSRDLDVRLDPQAVPVELERLALSFNHMLERIEDVFTRQSNFSADIAHEIRTPITN
                     LVTQTEIALSQSRSPQELEEVLYSNLEEFSRMSRMVSDMLFLAQADNNQLIPEQQALD
                     LADEVHKVFEFFEAWAEEKAVALRFVGSHCRVIGDPLMLRRAISNLLSNAIRYTPAGQ
                     AVTIQLSESAETVRLVVENPGTPIAAEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVK
                     SIVGAHHGSVAAQSDLRSTRFIVVLPK"
     misc_feature    623159..624589
                     /locus_tag="KPHS_05870"
                     /note="sensor kinase CusS; Provisional; Region: PRK09835"
                     /db_xref="CDD:182101"
     gene            624695..624961
                     /locus_tag="KPHS_05880"
                     /db_xref="GeneID:11845575"
     CDS             624695..624961
                     /locus_tag="KPHS_05880"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1778 domain-containing protein"
                     /protein_id="YP_005224888.1"
                     /db_xref="GeneID:11845575"
                     /translation="MPALKKQRIDLRLTDDDKSIIEEAAAISNQTITQFVVASASERA
                     AEVIEQHRRMVLNEQSWSLVMEAITQPPAPNDRLKRAAKRLQTR"
     misc_feature    624695..624952
                     /locus_tag="KPHS_05880"
                     /note="Uncharacterized conserved protein, DUF1778 family
                     [Function unknown]; Region: COG4453"
                     /db_xref="CDD:226860"
     gene            624972..625505
                     /locus_tag="KPHS_05890"
                     /db_xref="GeneID:11845576"
     CDS             624972..625505
                     /locus_tag="KPHS_05890"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GCN5-related N-acetyltransferase"
                     /protein_id="YP_005224889.1"
                     /db_xref="GeneID:11845576"
                     /translation="MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQI
                     LRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQQKKIPYQNAPSVTLGRLAIDKS
                     VQGQGWGEMLVAHVMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
                     LFYPTKSIEQLFTDDES"
     misc_feature    625035..625463
                     /locus_tag="KPHS_05890"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:338889"
     misc_feature    <625248..625427
                     /locus_tag="KPHS_05890"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_7; pfam13508"
                     /db_xref="CDD:338785"
     gene            complement(625553..626674)
                     /locus_tag="KPHS_05900"
                     /db_xref="GeneID:11845577"
     CDS             complement(625553..626674)
                     /locus_tag="KPHS_05900"
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="YP_005224890.1"
                     /db_xref="GeneID:11845577"
                     /translation="MAYQLNINWPEFLEKYWQKQPVVLKNAFPDFVDPITPDELAGLA
                     MEPEVDSRLVSLKNGKWQASNGPFEHFDGLGETGWSLLAQAVNHWHMPAAELVRPFRV
                     LPDWRLDDLMISFSVPGGGVGPHIDQYDVFIIQGMGSRRWRVGDKLPMRQFCPHPALL
                     HVDPFPPIIDEDLQPGDILYIPPGFPHDGITHETALNYSVGFRGPNGRDLISSFADYV
                     LENDLGGEHYSDPDLTCREHPGRVEEYELERLRTMMIDMIRQPEDFKQWFGSFVTTPR
                     HELDIAPAEPPYEEEEVVDALLGGEKLSRLSGLRVLHIGDSFFVHSEQLDTTDAEALD
                     ALCRYTSLGQEELGSGLQNPAFVSELTRLINQGYWYFEE"
     misc_feature    complement(625556..626674)
                     /locus_tag="KPHS_05900"
                     /note="Ribosomal protein L16 Arg81 hydroxylase, contains
                     JmjC domain [Translation, ribosomal structure and
                     biogenesis]; Region: RoxA; COG2850"
                     /db_xref="CDD:225406"
     gene            627272..628798
                     /locus_tag="KPHS_r00190"
                     /db_xref="GeneID:11845578"
     rRNA            627272..628798
                     /locus_tag="KPHS_r00190"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:11845578"
     gene            629149..632047
                     /locus_tag="KPHS_r00110"
                     /db_xref="GeneID:11845579"
     rRNA            629149..632047
                     /locus_tag="KPHS_r00110"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:11845579"
     gene            632147..632261
                     /locus_tag="KPHS_r00020"
                     /db_xref="GeneID:11845580"
     rRNA            632147..632261
                     /locus_tag="KPHS_r00020"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:11845580"
     gene            632375..632542
                     /locus_tag="KPHS_05910"
                     /db_xref="GeneID:11845581"
     CDS             632375..632542
                     /locus_tag="KPHS_05910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224891.1"
                     /db_xref="GeneID:11845581"
                     /translation="MALRLPGLQKRSPDKVRSTAFIASQNSVTNACGMVNRIVNLPDD
                     TSRKIIISSYD"
     gene            632865..633182
                     /locus_tag="KPHS_05920"
                     /db_xref="GeneID:11845582"
     CDS             632865..633182
                     /locus_tag="KPHS_05920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224892.1"
                     /db_xref="GeneID:11845582"
                     /translation="MKILLNWSPLRQLFTYIQERFTFLVLLCWPAIIWLFCRVGVWLT
                     DNVYELLGKSPAQSFTVYLQPFMTPGTLLRISISWVVLLFILFSMAMAFTWGLRRFMN
                     RHK"
     gene            complement(633223..634347)
                     /locus_tag="KPHS_05930"
                     /db_xref="GeneID:11845583"
     CDS             complement(633223..634347)
                     /locus_tag="KPHS_05930"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic transport system permease component"
                     /protein_id="YP_005224893.1"
                     /db_xref="GeneID:11845583"
                     /translation="MRGLRNIYNLGVKELRSLLGDKAMLALIVFAFTVSVYSSATVMP
                     GSLHLAPIAVADMDKSQLSSRIINAFYRPWFLEPELITADEMDAGLDAGRYTFAINIP
                     PNFQRDVLADRQPEIQVNVDATRMSQAFTGNGYIQNIITGEVNSFIARYRDNSVLPVE
                     LAVRMRFNPNLEQERFGAVMAIINNITMLAIVLTGSALIREREHGTIEHLLVMPITPF
                     EIMLAKIWSMGLVVLVVSGLSLILMVQGILQVPIEGSIPLFMLGVALSLFATTSIGIF
                     MGTLARSMPQLGLLMILVLLPLQMLSGGSTPRESMPQLVQDIMLTMPTTHFVSLAQAI
                     LYRGASFAIVWPQFLTLLAIGGVFFTIALLRFRKTIGEMA"
     misc_feature    complement(633916..634311)
                     /locus_tag="KPHS_05930"
                     /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
                     cl19580"
                     /db_xref="CDD:354443"
     misc_feature    complement(633244..634098)
                     /locus_tag="KPHS_05930"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: YadH; COG0842"
                     /db_xref="CDD:223912"
     gene            complement(634347..637091)
                     /locus_tag="KPHS_05940"
                     /db_xref="GeneID:11845584"
     CDS             complement(634347..637091)
                     /locus_tag="KPHS_05940"
                     /codon_start=1
                     /transl_table=11
                     /product="putative multidrug ABC transporter ATPase and
                     permease"
                     /protein_id="YP_005224894.1"
                     /db_xref="GeneID:11845584"
                     /translation="MKLTPQDTSPPVALLEHVGQQFGATIALRDISLAIPARRMVGLI
                     GPDGVGKSSLLSLIAGARTIEQGNVMVLGGDMRDVHHRREVCPKIAWMPQGLGKNLYH
                     TLSVYENVDFFARLFGHDKAERELRINELLQSTGLAPFRDRPAGKLSGGMKQKLGLCC
                     ALIHDPQLLILDEPTTGVDPLSRAQFWELIDSIRQRQPAMSVLVATAYMEEAERFDWL
                     VAMNAGEVLATGSAAELKAQTGSQTLEQAFIALLPEAQRQAHRAVVIPPRDSREEEIA
                     IEARGLTMRFGNFVAVDHVNFRIARGEIFGFLGSNGCGKSTTMKMLTGLLPASEGEAW
                     LFGQPVDPKDIATRQRVGYMSQAFSLYSELTVRQNLELHARLFHIPDGEIPGRVAEMC
                     ERFMLTEVEDALPADLPLGIRQRLSLAVAVIHRPEMLILDEPTSGVDPVARDMFWQLM
                     VDLARQDQVTIFISTHFMNEAERCDRISLMHAGKVLASDTPQALVEQRGSNSLEEAFI
                     AWLKEAQPSSPVPEEPTSAVASYSRHTTPRQAFSLRRLFSYSRREALELRRDPVRSTL
                     ALLGTVILMFIMGYGISMDVEDLRFAVLDRDQTLSSQGWSQNLAGSRYFIEQAPLHSY
                     DELDRRMRDGELAVAIEIPPNFGRDIARGTPVQIGVWVDGAMPNRAETVRGYVQAMHL
                     AWLQEMAGRQSSPRRDTSLISIETRYRYNPDVKSLPAIVPAVIPLLLMMIPAMLSALS
                     VVREKELGSIINLYVTPTTRSEFLLGKQLPYIVLGMFNFFLLCALSVFVFGVAHKGSF
                     LTLTLAALLYVTIATGLGLLISTFMKSQIAAIFGTAIITLIPATQFSGMIDPVASLEG
                     PGRWIGQIYPTSHFLTIARGTFSKALNISDLWGSFIPLLIAVPLVLGLSVLLLKKQEG
                     "
     misc_feature    complement(636255..637025)
                     /locus_tag="KPHS_05940"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(<635589..636266)
                     /locus_tag="KPHS_05940"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(634401..635258)
                     /locus_tag="KPHS_05940"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: YadH; COG0842"
                     /db_xref="CDD:223912"
     gene            complement(637088..638155)
                     /locus_tag="KPHS_05950"
                     /db_xref="GeneID:11845585"
     CDS             complement(637088..638155)
                     /locus_tag="KPHS_05950"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane fusion protein family auxiliary
                     transport protein"
                     /protein_id="YP_005224895.1"
                     /db_xref="GeneID:11845585"
                     /translation="MDKIKKRWAGYFVGLLVVLAAAAWWLLRPPGLPAGFASSNGRIE
                     ATEVDIASKIAGRIDTILVKEGQFVHQGEVLARMDTRVLNEQRLEAAAQIKEAESAVL
                     AARALLDQRQSEMRASEAVVKQRQAELDSTAKRHVRSNTLSQRGAVSAQQLDDDRAAA
                     ESARAALESAKAQVSAARAAIEAARTSIIQAQTRVEAAQATERRILADIDDSELKAPR
                     DGRIQYRVAEPGEVLAAGGRVLNMVDLADVYMTFFLPTEQAGLLALGSEARLVLDAAP
                     DLVIPANISFVASVAQFTPKTVETSDERLKLMFRVKARIPPELLAQHLEYVKTGLPGM
                     AYVRLDKQQPWPEALAVRLPQ"
     misc_feature    complement(637226..638143)
                     /locus_tag="KPHS_05950"
                     /note="putative efflux pump membrane fusion protein;
                     Provisional; Region: PRK03598"
                     /db_xref="CDD:235136"
     gene            complement(638462..639469)
                     /locus_tag="KPHS_05960"
                     /db_xref="GeneID:11845586"
     CDS             complement(638462..639469)
                     /locus_tag="KPHS_05960"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tryptophanyl-tRNA synthetase"
                     /protein_id="YP_005224896.1"
                     /db_xref="GeneID:11845586"
                     /translation="MNHPQTILTGDRPTGQLHLGHYVGSLRQRVALQHNHQQFILIAD
                     LQGLTDNGSNPQKISHHILEVMADYLAVGIDPRLTTICLQSALPALAELSALYMNIVT
                     VARVERNPTVKNEIAQKGFARSLPVGFLAYPISQAADITAFKAELVPVGDDQLPMIEQ
                     TNEIVHKMNSLTGEPVLRHCKALLSEVSRLPGVDGNAKMSKSLGNTLTLSATEEEIHH
                     AVSAMYTDPTHLRVSDPGHVEGNVVFTYLDAFHSDKVRVAEMKAHYQRGGLGDRQCKN
                     ELETCLQTLLAPIRERRATFIQDKGMLLELLRQGSERAHHLTQQTLHEVKRGLGLPVL
                     F"
     misc_feature    complement(638465..639463)
                     /locus_tag="KPHS_05960"
                     /note="tryptophanyl-tRNA synthetase II; Reviewed; Region:
                     PRK12282"
                     /db_xref="CDD:183400"
     gene            639974..640957
                     /locus_tag="KPHS_05970"
                     /db_xref="GeneID:11845587"
     CDS             639974..640957
                     /locus_tag="KPHS_05970"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LACI-type transcriptional regulator"
                     /protein_id="YP_005224897.1"
                     /db_xref="GeneID:11845587"
                     /translation="MHKRLVVNIFSSLLLGAALISAPVYAAEKTVVNISKVDGMPWFN
                     RMGEGVVQAGKEFNLNASQVGPSSTDAPQQVKIIEDLIARKVDAITIVPNDANVLEPV
                     FKKARDAGIVVLTNESPGQPSANWDVEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGS
                     LTVPQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDDSRRTTLDLMKTYPDLKAVV
                     SFGSNGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDPATAGYAL
                     AAVASTLLNGKTIEPGFELKELGKAEVDSDKHIIRFHKVLLVNKDNIDSLY"
     misc_feature    640061..640945
                     /locus_tag="KPHS_05970"
                     /note="Periplasmic binding domain of autoinducer-2 (AI-2)
                     receptor LsrB from Salmonella typhimurium and its close
                     homologs; Region: PBP1_LsrB_Quorum_Sensing; cd06302"
                     /db_xref="CDD:107297"
     misc_feature    order(640079..640081,640322..640324,640361..640363,
                     640466..640471,640478..640480,640631..640639,
                     640772..640774)
                     /locus_tag="KPHS_05970"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107297"
     gene            641008..642492
                     /locus_tag="KPHS_05980"
                     /db_xref="GeneID:11845588"
     CDS             641008..642492
                     /locus_tag="KPHS_05980"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner-membrane translocator"
                     /protein_id="YP_005224898.1"
                     /db_xref="GeneID:11845588"
                     /translation="MEPFLSLRHVSKTFHANRALNDISIDFMPGEVHCLAGQNGCGKS
                     TLIKIISGVYRPDVGAAMTLGGKTWPKLTPAASVAHGIQVIYQDLSLFPNLSVWENIA
                     INHYHRGVLVRRSELRRSAEQAMRSINVSLPLDAAVESLSIARCQLVAICRALAQDAR
                     LIIMDEPTASLTHQEVEGLLHVVRQLRERGICIVFVSHRLEEVMAVSDRISVLKDGNL
                     VGTLPAAEVTTRRLGFLMTGQEFDYQVRDLWQGQGSTPVLEVRNLSRKGEYHNVSLKV
                     EAGEVVSIVGLLGAGRTELCLSLFGMTRPDSGEILINGQPVRLRSNQDAIRHGIGYVS
                     EDRMSRGLVMSQSIENNIISTVFHKVKGACGLLSDSKAQQLVARMVNALTIKAPDTHL
                     PVNTLSGGNAQRVSIAKWLAISPKLLILDSPTVGVDIANKAGIYHIISDLAAHGIAVL
                     MICDEIEEAWYQSHRILVMKQGELTHSFLPDSSTQQQIAEVVNG"
     misc_feature    641008..642489
                     /locus_tag="KPHS_05980"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     gene            642485..643456
                     /locus_tag="KPHS_05990"
                     /db_xref="GeneID:11845589"
     CDS             642485..643456
                     /locus_tag="KPHS_05990"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose high-affinity ABC transporter permease
                     component"
                     /protein_id="YP_005224899.1"
                     /db_xref="GeneID:11845589"
                     /translation="MANLLKRHEFWLGMFIIALCLLLGWRSEEFFTFGNLYDLANNYA
                     MLTILACGLFVVLIAGGIDISFPAMTIIAQYGMVVMLQKVGGNFAVAFVLAGGIGVLL
                     GLVNALLVNRLRVPSIIITISTLNIFYGLLLWLSKGVWLYDFPPWFEKGVMLFKYTDA
                     DGYDYGLGLPLLTMIVVVLLTAFIMNFTTVGRKIYAMGGNRESASRVGFSVLRLQLFV
                     YGYMGLMSGAAGVVQAWTVMTVAPDSLLGYELTVLAAVVLGGTSLIGGRGTLTGTLLG
                     VILLAVMQNGLNLLGVSSYWQTLITGAIIVVSISVTAWSQHQNRSLL"
     misc_feature    642614..643420
                     /locus_tag="KPHS_05990"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    643088..643144
                     /locus_tag="KPHS_05990"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            643453..644409
                     /locus_tag="KPHS_06000"
                     /db_xref="GeneID:11845590"
     CDS             643453..644409
                     /locus_tag="KPHS_06000"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose high-affinity ABC transporter permease
                     component"
                     /protein_id="YP_005224900.1"
                     /db_xref="GeneID:11845590"
                     /translation="MKKSWRNNVEFYLIGLLLLMVIAFSIAMPNIFWSVSNFQSIASQ
                     MPVLGILALAMAMTMLCGGINLSIIATANACSLVMAWVATSYPPGGATALATLLAGGG
                     AAMIIGLCNGILIAGIRVSPILATLGMMTLLKGINILITGGSAIANYPQWVLWLNHAQ
                     WFGIPLPMWLFAVVAAGLWVLLEKSPLGRAIMLIGSNERATHYSGINTRRVLMWVYVI
                     SALLCAVAAFLMMSKLNSAKASYGESYLLVSILAAVLGGVNPDGGSGRIVGMVLALFL
                     LQIIESGFNILGISPYLTMALWGVLLLCFIQARGMLGLERAG"
     misc_feature    643453..644391
                     /locus_tag="KPHS_06000"
                     /note="Ribose/xylose/arabinose/galactoside ABC-type
                     transport system, permease component [Carbohydrate
                     transport and metabolism]; Region: AraH; COG1172"
                     /db_xref="CDD:224093"
     misc_feature    644047..644103
                     /locus_tag="KPHS_06000"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(644446..645228)
                     /locus_tag="KPHS_06010"
                     /db_xref="GeneID:11845591"
     CDS             complement(644446..645228)
                     /locus_tag="KPHS_06010"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H dehydrogenase (quinone)"
                     /protein_id="YP_005224901.1"
                     /db_xref="GeneID:11845591"
                     /translation="MKVLLIYAHPEPRSLNGALKNFAVRHLQQAGHEVQVSDLYAMRW
                     KAGYDADDSGAPPVGEFWRPTLDSKQAFAQGTQSADIAAEQEKLLWADTVIFQFPLWW
                     FSMPAIMKGWIDRVYAWGFAYGVGEHSDRHWGDRYGEGTFVGKRAMLIVTAGGWAEHY
                     SPRGINGPIDDILFPIQHGMLFYPGFEVLPPLVFYRTDKTDAGQFADQCAALAERLDT
                     LWQTEPIPFRRQNHGDYLIPSLTLRPELAPGQSGLAVHLRSE"
     misc_feature    complement(644572..645228)
                     /locus_tag="KPHS_06010"
                     /note="Putative NADPH-quinone reductase (modulator of drug
                     activity B) [General function prediction only]; Region:
                     MdaB; COG2249"
                     /db_xref="CDD:225158"
     gene            645315..646223
                     /locus_tag="KPHS_06020"
                     /db_xref="GeneID:11845592"
     CDS             645315..646223
                     /locus_tag="KPHS_06020"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LysR"
                     /protein_id="YP_005224902.1"
                     /db_xref="GeneID:11845592"
                     /translation="MINLQRLDLNLLRTLDVLLSENNVTRAAQRLNLSQPSVSIQLAR
                     LREIFADPLLMPGPRGMQPTARADELRQPLRAALAALEQAVAPVSPFDPATAAETWRV
                     AATDYMASAILLPMLAGLRQASPGSRLAVFELQPARLEQQAASDTVDLFFHTREGAPP
                     GLHQRLLFRERYVLAGRAEHSALRPGLSLETFCQLEHVIVSPDGGGFSAATDIALANL
                     GLMRRVVLSVPHFLFMLETLRNSDLVAVLPERLVRGQSGLVVVEPPLAVAGFEMLMLW
                     HERWHRDPAHQWLRQFIVNSLEEQTC"
     misc_feature    645339..645515
                     /locus_tag="KPHS_06020"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:333860"
     misc_feature    645609..646202
                     /locus_tag="KPHS_06020"
                     /note="Type 2 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_2; cl21456"
                     /db_xref="CDD:354813"
     misc_feature    order(645654..645659,645663..645668,645675..645677,
                     645687..645689,645693..645713,645987..646004,
                     646020..646025,646029..646034)
                     /locus_tag="KPHS_06020"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            646217..646636
                     /locus_tag="KPHS_06030"
                     /db_xref="GeneID:11845593"
     CDS             646217..646636
                     /locus_tag="KPHS_06030"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_005224903.1"
                     /db_xref="GeneID:11845593"
                     /translation="MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGD
                     LWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASH
                     YFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQ"
     misc_feature    646226..646600
                     /locus_tag="KPHS_06030"
                     /note="fosfomycin resistant protein subfamily FosA;
                     Region: FosA; cd07244"
                     /db_xref="CDD:319908"
     misc_feature    order(646226..646249,646292..646294,646301..646318,
                     646331..646333,646337..646345,646352..646354,
                     646364..646366,646409..646432,646442..646444,
                     646454..646456,646544..646546,646553..646561,
                     646565..646573,646580..646585)
                     /locus_tag="KPHS_06030"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:319908"
     misc_feature    order(646235..646237,646415..646417,646553..646555)
                     /locus_tag="KPHS_06030"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:319908"
     misc_feature    order(646499..646501,646505..646507,646517..646519,
                     646523..646525,646580..646582)
                     /locus_tag="KPHS_06030"
                     /note="K binding site [ion binding]; other site"
                     /db_xref="CDD:319908"
     gene            complement(646708..648120)
                     /locus_tag="KPHS_06040"
                     /db_xref="GeneID:11845594"
     CDS             complement(646708..648120)
                     /locus_tag="KPHS_06040"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminotransferase, class I and II"
                     /protein_id="YP_005224904.1"
                     /db_xref="GeneID:11845594"
                     /translation="MTRYQHLATLLAERIEQGLYRHGEKLPSVRSLSQEHGVSISTVQ
                     QAYQLLEQQQMIVPQPRSGYFVAPRKAQPPVPPMSRPVQRPVEITQWDQVLTMLDARY
                     DKSIIPFGGGSPDVTQPSLKPIWRELSRAIQHNLTEVLNYDELAGRRELREQIARLML
                     DGGSVVTADDLVLTSGCHSALSLALLSVCQPGDIIAVESPCYYGTMQMLRGLGLKTIE
                     IPTDPETGISIEALELALDQWPIKGVILVPNCNNPLGFIMPDARKRAVLNLAQRYDIV
                     IFEDDIYGELATEYPRPRTIHSWDIDGRVMLCSSFTKTIAPGLRIGWIAPGRYYDKLL
                     QMKYAASGTNVPSTQLAACNFIREGHYHRHVRRMRQIYQRNIEIYTCWLREFFPCGIC
                     VTRPKGGFMLWVELPEQVDMVCVAKQLCRLKIQVAPGSLFSAAGKYRNCVRINCALPP
                     TEKHKAVMVKLGEAVKVAME"
     misc_feature    complement(646711..648120)
                     /locus_tag="KPHS_06040"
                     /note="DNA-binding transcriptional regulator, MocR family,
                     contains an aminotransferase domain [Transcription, Amino
                     acid transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     gene            648298..648462
                     /locus_tag="KPHS_06050"
                     /db_xref="GeneID:11845595"
     CDS             648298..648462
                     /locus_tag="KPHS_06050"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1127 domain-containing protein"
                     /protein_id="YP_005224905.1"
                     /db_xref="GeneID:11845595"
                     /translation="MEFHENRARQPFIGFVLLVRFIKKWWLQEQTRRVLQQMSDEQLK
                     DIGLRRDQIN"
     misc_feature    648298..648456
                     /locus_tag="KPHS_06050"
                     /note="Uncharacterized conserved protein YjiS, DUF1127
                     family [Function unknown]; Region: YjiS; COG5457"
                     /db_xref="CDD:227744"
     gene            648627..649091
                     /locus_tag="KPHS_06060"
                     /db_xref="GeneID:11845596"
     CDS             648627..649091
                     /locus_tag="KPHS_06060"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_005224906.1"
                     /db_xref="GeneID:11845596"
                     /translation="MTEDELFARRPLGMRMAMVVRQWRAIIDSAITDTGLTQSSWTVL
                     MQLHQLGDNVSVSELAEVQGIELPPLMRTLSLLEKQGYLVRSTSPYDKRIRLLTLTAE
                     GRAILEKLSCVIETYQERVTQTIPEADLATFSATLNQIACRLRNIREEDNKI"
     misc_feature    648657..649085
                     /locus_tag="KPHS_06060"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:354815"
     gene            649098..650165
                     /locus_tag="KPHS_06070"
                     /db_xref="GeneID:11845597"
     CDS             649098..650165
                     /locus_tag="KPHS_06070"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="YP_005224907.1"
                     /db_xref="GeneID:11845597"
                     /translation="MMTPEQKFARWVRVSIAAFLGIFAWFIVADIWIPLTPDSTVMRV
                     VTPVSSRVSGYVSHVYVHNNSQVKKGDLLYELDPTPFINKVEAAQIALEQAKLSNQQL
                     DAQIAAARANLRTAQYTARNDKVTLDRYQRLSTMQNVSQSDLDKVRTTWQTSEQSVSA
                     LNAQIQNLLIQRGERDDKRNVTLQKYRNALEEAQLNLAWTKVRAETDGMVSNLQLNPG
                     IYATAATAVLALVNNNTDIVADFREKSLRHTAVNTDAAVVFDALPGQVFPAHVTSSDA
                     GILAGQEAVNGQLSQPEQSTRWVRDAQRMRIHVALDQPLDKPLPTGARATVQLYNSEG
                     PFARTFAGLQIHLVSWLHYVY"
     misc_feature    649101..650078
                     /locus_tag="KPHS_06070"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     gene            650155..651219
                     /locus_tag="KPHS_06080"
                     /db_xref="GeneID:11845598"
     CDS             650155..651219
                     /locus_tag="KPHS_06080"
                     /codon_start=1
                     /transl_table=11
                     /product="putative (R)-hydroxyglutaryl-CoA dehydratase
                     activator (putative oxidoreductase)"
                     /protein_id="YP_005224908.1"
                     /db_xref="GeneID:11845598"
                     /translation="MSINTLAHVFTPHGNIVYTANDFRQTVRIAVAGTIALSISTFYD
                     VQYGVFFVVYPLMLMSLVPMFNLHVARQFIFSAAVNCVEMVLIVGYLSQWPVIMTLVV
                     FALYVMRFRFMSQGPLFLLGSMGVVCQSTMLNFMSYPTSNWHTLMFSNMEACVMAVAL
                     SALLHYLIPDVEPRKPPPRIEKDAARIRHESLLSGTVATIIFVVFQICDLSDSLSALM
                     AGILILFPMHYRGAVISSIWRVVGVVLACLYILVVQLIIYDFSNHMILMMPLIGLGLA
                     FSARLHVMEKVGAGVGFASITTIGIMFGQNLHPYQDLVFSDLYRITSVTVSLVVTLTL
                     VFLMHRLLNCFAATRFVVSD"
     misc_feature    650227..650643
                     /locus_tag="KPHS_06080"
                     /note="Protein of unknown function (DUF2955); Region:
                     DUF2955; pfam11168"
                     /db_xref="CDD:337932"
     gene            complement(651216..651470)
                     /locus_tag="KPHS_06090"
                     /db_xref="GeneID:11845599"
     CDS             complement(651216..651470)
                     /locus_tag="KPHS_06090"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3343 domain-containing protein"
                     /protein_id="YP_005224909.1"
                     /db_xref="GeneID:11845599"
                     /translation="MTTFLFLFHSTVGVVRMRKAMQAAGVAFEVKDIPRQLRSGCGLC
                     ILLEGTEADARGWIVPEQTAALYQQNGEAWRCLATFPPAG"
     misc_feature    complement(651309..651458)
                     /locus_tag="KPHS_06090"
                     /note="Protein of unknown function (DUF3343); Region:
                     DUF3343; pfam11823"
                     /db_xref="CDD:314656"
     gene            complement(651467..652234)
                     /locus_tag="KPHS_06100"
                     /db_xref="GeneID:11845600"
     CDS             complement(651467..652234)
                     /locus_tag="KPHS_06100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224910.1"
                     /db_xref="GeneID:11845600"
                     /translation="MNYTVGIDSGSTATKGILLADGVIVRRFLCPTPFRPADAIHEAW
                     ETLRAGLTETPFLTLTGYGRQLVDFADKQVTEISCHGLGARLLAPDTRTVIDIGGQDS
                     KVIQLDAGGNLSDFLMNDKCAAGTGRFLEVISRTLGASVEQLDAITDGVEPHAITSMC
                     TVFAESEVISLRSAGVAPEAILAGVINAMARRSANFIGRLSAQGPLLFTGGVSHCAAF
                     ARMLESHVGMAVTTHPDAQFAGAIGAALIGQRQRRRG"
     misc_feature    complement(651494..652228)
                     /locus_tag="KPHS_06100"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:354300"
     gene            complement(652244..653395)
                     /locus_tag="KPHS_06110"
                     /db_xref="GeneID:11845601"
     CDS             complement(652244..653395)
                     /locus_tag="KPHS_06110"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 2-hydroxyglutaryl-CoA dehydratase"
                     /protein_id="YP_005224911.1"
                     /db_xref="GeneID:11845601"
                     /translation="MSLITDLPAIFDQFSEARQKGFLTVMDLKEQNVPLVGTYCTFMP
                     QEIAMAAGAVVVSLCSTSDETIEEAEKDLPRNLCPLIKSSYGFGKTDKCPYFYFSDLV
                     VGETTCDGKKKMYEYMAEFKAVHVMQLPNSASDAASRALWKTEILRLQQVIEARFGTP
                     ISEAALREAIVLKNRERRALAHFYRLGQLNPPALSGGDILKVVYGATFRFDKTALIDE
                     LHAMAERIHQEWQQGKRLEPRPRILITGCPIGGAAEKVVRAIEENGGWVVGYENCTGA
                     KATERCVAEEGDVYDALTDKYLAIGCSCISPNDQRLQLLSQMVEEYQADGVIDVILQA
                     CHTYAVESLAIKRHLRQQHDLPYMAIETDYSTADLGQLSTRVAAFIEML"
     misc_feature    complement(652247..653395)
                     /locus_tag="KPHS_06110"
                     /note="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
                     dehydratase subunit, BcrC/BadD/HgdB [Secondary metabolites
                     biosynthesis, transport and catabolism]; Region: HgdB;
                     COG1775"
                     /db_xref="CDD:224689"
     gene            complement(653493..653732)
                     /locus_tag="KPHS_06120"
                     /db_xref="GeneID:11845602"
     CDS             complement(653493..653732)
                     /locus_tag="KPHS_06120"
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2164 domain-containing protein"
                     /protein_id="YP_005224912.1"
                     /db_xref="GeneID:11845602"
                     /translation="MNDIELSQAQRDLLRDRLSKYCAETFDLELEQFDAEFFVDFIAK
                     ELGPLFYNAGIEEAIRTHQAWSERIQEEMDLKKVY"
     misc_feature    complement(653514..653717)
                     /locus_tag="KPHS_06120"
                     /note="Uncharacterized conserved protein (DUF2164);
                     Region: DUF2164; pfam09932"
                     /db_xref="CDD:337562"
     gene            complement(653758..654999)
                     /locus_tag="KPHS_06130"
                     /db_xref="GeneID:11845603"
     CDS             complement(653758..654999)
                     /locus_tag="KPHS_06130"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein MdtM"
                     /protein_id="YP_005224913.1"
                     /db_xref="GeneID:11845603"
                     /translation="MMHRISHWLSRHAAALFFPAALILYDFSAYLTTDLIQPGILHVV
                     RDFNADVALAPASVSLYMAGGMALQWLLGPLSDRIGRRPVLLTGALIFTLACLATLFT
                     TSMTQFLIARFVQGTSICFIATVGYVTVQEAFEEKRSIRLMAVITSVVLVAPIVGPLS
                     GAALMHFIHWKALFGIIAAMGLVAWLGLLLTMPETVRRGDVPFSPVGVLRDFRNVFRN
                     RIFLLGAATLSLSYIPLMNWVAVSPVILMDAGGLTTSEFAWSQVPVFSAVIIANLSVA
                     RWVKDPTRPRFVLSAVPVQMLGLAILIVGNLVWPHVWLWSVLGTCFYAFGIGLIFPTL
                     FRFTLFSNDLPKGTVSASLNIVILSVSALSIEGARWLWFHGGRLPFHLLAVAAGIVAA
                     CCLAGLLRHQRGQAVIEARQS"
     misc_feature    complement(653764..654996)
                     /locus_tag="KPHS_06130"
                     /note="multidrug efflux system protein MdtM; Provisional;
                     Region: PRK15403"
                     /db_xref="CDD:237958"
     gene            complement(655053..656345)
                     /locus_tag="KPHS_06140"
                     /db_xref="GeneID:11845604"
     CDS             complement(655053..656345)
                     /locus_tag="KPHS_06140"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="YP_005224914.1"
                     /db_xref="GeneID:11845604"
                     /translation="MLKHMEKLAELKRAKLLALSLLLIAAAIFITTLALPPSPWVGAL
                     KAISEAAMVGALADWFAVVALFRRIPLPFVARHTAIIPRNKDRIADNLGRFVEEKFLD
                     TPSLVALIRRYQPALMLGNWFSQPENARRVGQHLLQVMSGFLELTDDARIQRLLRRAV
                     HKAIDKVDLTQTSAMMLEGLTRDNRHQKLLDSLINQLIALLQRDSSRAFIARGIVHWL
                     ETEHPLKAKLLPTEWLGEHSAEMVTDAVNTLLDEVTHDRTHQIRQTFDRAVQKLIDNL
                     KSDPDMAQKADNIKAWLKNDETFNHYLGEVWGDLRGWVKNDISSDDSRIKQRIAEAGQ
                     WFGETLLRDDALRESLNEHLEQAAHRVAPEFAAFLTRHISDTVKSWDARDMSRQIELN
                     IGKDLQFIRINGTLVGGTIGLLLWLLSQIPSLLHLHIG"
     misc_feature    complement(655080..656333)
                     /locus_tag="KPHS_06140"
                     /note="Uncharacterized membrane-anchored protein YjiN,
                     DUF445 family [Function unknown]; Region: YjiN; COG2733"
                     /db_xref="CDD:225347"
     gene            complement(656338..657000)
                     /locus_tag="KPHS_06150"
                     /db_xref="GeneID:11845605"
     CDS             complement(656338..657000)
                     /locus_tag="KPHS_06150"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid exporter"
                     /protein_id="YP_005224915.1"
                     /db_xref="GeneID:11845605"
                     /translation="MHTLSTLFPAVFPALALSHFVALLSPGPDFFLLVGYAVRYRIRG
                     SIGLCLGIAAGNALYIVLAIVGWGLLRQAPLLFLLIELLGAGYLLWIGSLLIRSRPAT
                     LAMESVRAARPGFGRQLLLGLGSSLLNPKNALFYLALMTSLLGAAVTLLQQTVSGLWM
                     VSVVFFWDLLLVSAIALPQIQRRLGAIVWRVERAAGAILMLFGLGIIWRFLHDLAVRL
                     YA"
     misc_feature    complement(656374..656976)
                     /locus_tag="KPHS_06150"
                     /note="Threonine/homoserine/homoserine lactone efflux
                     protein [Amino acid transport and metabolism]; Region:
                     RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(657048..657863)
                     /locus_tag="KPHS_06160"
                     /db_xref="GeneID:11845606"
     CDS             complement(657048..657863)
                     /locus_tag="KPHS_06160"
                     /codon_start=1
                     /transl_table=11
                     /product="negative transcriptional regulator of cel
                     operon"
                     /protein_id="YP_005224916.1"
                     /db_xref="GeneID:11845606"
                     /translation="MNHTRDIPQTFWRDDRLPWLELRSTWRSRQAYKHHSHPQLSVGA
                     IIEGETRCLCAGQEYLLQPGDLIVIPPHAPHSCNPLHGRPRSYHMLYLDATWCHAQRP
                     DIPPGASITSPQPLLRDSPLFASFQQVVALMSRGSLEQLPARLAQLLHALPLCAAAPQ
                     APHHASALLFQRLAMDLPASPSLDKLAHDSALRKETVIRAVKQDTGLTPASLINMARI
                     EYAKTRLRAGDPIADVGYQAGFADQSHFHKTFVSYTAATPRQYAQSRSISDNK"
     misc_feature    complement(657408..657779)
                     /locus_tag="KPHS_06160"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:334888"
     misc_feature    complement(657081..657323)
                     /locus_tag="KPHS_06160"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            658080..659006
                     /locus_tag="KPHS_06170"
                     /db_xref="GeneID:11845607"
     CDS             658080..659006
                     /locus_tag="KPHS_06170"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005224917.1"
                     /db_xref="GeneID:11845607"
                     /translation="MAKGTTSTPHDAVFKQFLTQADTARDFLAIHLPPALRQRCDLDT
                     LQLESASFIEESLRAWYSDVLWSLKTASGEGYIYVVIEHQSSPDAQMAFRLMRYAIAA
                     MQRHLDGGHTKLPLVVPMLFYHGATTPYPWSLNWLDCFADPQLASELYISPFPLVDVT
                     VIPDDEIVRHRRVALLELIQKHIRQRDLMGIVEQLTTILLSGDANDRQLKTLFNYLLQ
                     TGNARRFGRFIHEVAQRVPQHRERLMTIAERLQEVGRRKGKREGRLEGRQEGQHAEAL
                     RIAQRMLADGIARETVVKITGLTADEIAALAH"
     misc_feature    658080..659003
                     /locus_tag="KPHS_06170"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09956"
                     /db_xref="CDD:182167"
     gene            659165..660535
                     /locus_tag="KPHS_06180"
                     /db_xref="GeneID:11845608"
     CDS             659165..660535
                     /locus_tag="KPHS_06180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="YP_005224918.1"
                     /db_xref="GeneID:11845608"
                     /translation="MAYQTVNPANNQLIKTYPAHSDADVEAALQQADALYHSAWAKGD
                     IEPRLAVLHKLADLIDSRAEELAKIASQEMGKLIKQSRGEVKLCAQIARYYADNAKSF
                     LAPVKYPSELGEAWVEHHPIGVLLAVEPWNFPYYQLIRVLAPNLAAGNPVIAKHASIV
                     PHCAETFAHLVREAGAPEGAWTNLFISQDQVAKIIADDRVQGAALTGSEKAGSVVAAQ
                     AAKHIKKSTLELGGNDVFVVLDDADLERAVKIGVQARLNNAGQVCTAAKRFILHENIA
                     DAFLTKFSEAFRQVKIGDPLDESTTLGPLSSKDALDTLSKQVDEAVKNGAKLHLGGKA
                     VAREGNFFEPTILTGITRDNPAYFEEFFGPVAQIYVVKNDEEAIQLANDSHYGLGGAV
                     FSQDIERAKRMASAIETGMVYINWLTDTAPELPFGGVKRSGYGRELSDLGIKEFVNQK
                     LVVVRR"
     misc_feature    659237..660526
                     /locus_tag="KPHS_06180"
                     /note="Mycobacterium tuberculosis succinate-semialdehyde
                     dehydrogenase 1-like; Region: ALDH_SSADH1_GabD1; cd07100"
                     /db_xref="CDD:143418"
     misc_feature    order(659546..659560,659582..659584,659627..659629,
                     659633..659638,659777..659788,659795..659797,
                     659804..659809,659849..659857,659951..659953,
                     660242..660244,660248..660250,660326..660328,
                     660440..660442)
                     /locus_tag="KPHS_06180"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143418"
     misc_feature    order(659558..659560,659849..659851,659942..659944,
                     659951..659953)
                     /locus_tag="KPHS_06180"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143418"
     gene            complement(660633..661178)
                     /locus_tag="KPHS_06190"
                     /db_xref="GeneID:11845609"
     CDS             complement(660633..661178)
                     /locus_tag="KPHS_06190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative porin"
                     /protein_id="YP_005224919.1"
                     /db_xref="GeneID:11845609"
                     /translation="MRKLNILILAALTAVSGSAMAVGFTVEQGKNFTNLNMEMGKSSS
                     GLYAESHWLKNTDDGSQTGGVGAGYNLEVGPVMLNAGAKAIYLGPKKGDNGVAFPVGG
                     GVNVTLTDSIHVFGEGYVAPDGLNNSVKNYVEANGGVSWSPIGPVTLKVGYRHVSVDG
                     KEGRPNHTLIDGAYVGGGVTF"
     misc_feature    complement(660636..661178)
                     /locus_tag="KPHS_06190"
                     /note="YfaZ precursor; Region: YfaZ; pfam07437"
                     /db_xref="CDD:284781"
     gene            complement(661570..662526)
                     /locus_tag="KPHS_06200"
                     /db_xref="GeneID:11845610"
     CDS             complement(661570..662526)
                     /locus_tag="KPHS_06200"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GTP-binding protein YjiA"
                     /protein_id="YP_005224920.1"
                     /db_xref="GeneID:11845610"
                     /translation="MAPIAVTLLTGFLGAGKTTLLRHILNEQHGFKIAVIENEFGEVS
                     VDDQLIGDRATQIKTLTNGCICCTRSNELEDALLDLLDSRDRGEIEFDRLVIECTGMA
                     DPGPIIQTFFSHQVLCERYLLDGVIALVDAVHADQQMDQFTIAQSQVGYADRILLTKT
                     DVAGDTEKLRERLARINARAPIYTVIHGDIDLSQLFNTSGFMLEEKVVSATPRFHFVA
                     EKQNDVSSIVVELDYPVDISEVSRVMENLLLSFAEQLMRYKGMLWIDGEPNRLLFQGV
                     QRLYSADWDRPWGDETPHSTLVFIGIQLPEEEIRAAFAGLRR"
     misc_feature    complement(661573..662526)
                     /locus_tag="KPHS_06200"
                     /note="putative GTP-binding protein YjiA; Provisional;
                     Region: PRK11537"
                     /db_xref="CDD:183183"
     gene            complement(662538..662741)
                     /locus_tag="KPHS_06210"
                     /db_xref="GeneID:11845611"
     CDS             complement(662538..662741)
                     /locus_tag="KPHS_06210"
                     /codon_start=1
                     /transl_table=11
                     /product="YbdD/YjiX family protein"
                     /protein_id="YP_005224921.1"
                     /db_xref="GeneID:11845611"
                     /translation="MFGNLGQAKKYLGQAAKMLIGIPDYDNYVTHMQTNHPDQPYMTY
                     EEFFRERQQARYGGDGKGGVRCC"
     misc_feature    complement(662541..662741)
                     /locus_tag="KPHS_06210"
                     /note="Uncharacterized short protein YbdD, DUF466 family
                     [Function unknown]; Region: YbdD; COG2879"
                     /db_xref="CDD:225434"
     gene            complement(662851..665001)
                     /locus_tag="KPHS_06220"
                     /db_xref="GeneID:11845612"
     CDS             complement(662851..665001)
                     /locus_tag="KPHS_06220"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon starvation protein"
                     /protein_id="YP_005224922.1"
                     /db_xref="GeneID:11845612"
                     /translation="MDTKKLFKHIPWVILGIIGAFCLSVVALRRGEHVSALWIVVASV
                     SVYLVAYRYYSLYIAQKVMKLDPTRSTPAVINNDGLNYVPTNRYVLFGHHFAAIAGAG
                     PLVGPVLAAQMGYLPGTLWLLAGVVLAGAVQDFMVLFISSRRNGASLGEMIKQEMGPV
                     PGSIALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFMGIYMRFLRPG
                     RVGEVSVIGIVLLVASIWFGGVIAHDPYWGPALTFKDTTITFTLIGYAFISALLPVWL
                     ILAPRDYLATFLKIGVIVGLALGIVILNPDLKMPAVTQYIDGTGPLWKGALFPFLFIT
                     IACGAVSGFHALIASGTTPKLLANETDARFIGYGAMLMESFVAVMALVAASIIEPGLY
                     FAMNTPPAGLGIVMPNLHEMGGENAAMIAAQLKEVTVHAAATVSSWGFVISPEQILQT
                     AKDIGEPSVLNRAGGAPTLAVGIAHVFHKIIPMADMGFWYHFGILFEALFILTALDAG
                     TRAGRFMLQDLLGNFVPFLKKTDSLVAGIIGTAGCVGLWGYLLYQGVVDPLGGVKSLW
                     PLFGISNQMLAAVALVLGTVVLVKMQRTKYIWVTVIPAAWLLLCTTWALGLKLFSSNP
                     QMEGFFFMAQQYKEKIAAGGELTAQQIANMNHIVVNNYTNAGLSILFLVVVYSIIFYG
                     IKTWLNVRNNKVRTDKETPYVPVPEGGVKTSSHH"
     misc_feature    complement(662875..664980)
                     /locus_tag="KPHS_06220"
                     /note="Carbon starvation protein CstA; Region: CstA;
                     cl27408"
                     /db_xref="CDD:355647"
     gene            665386..666009
                     /locus_tag="KPHS_06230"
                     /db_xref="GeneID:11845613"
     CDS             665386..666009
                     /locus_tag="KPHS_06230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224923.1"
                     /db_xref="GeneID:11845613"
                     /translation="MKFVKIMIIASAFYLTYAHAREIHQAVDEPAAPYNLRWGMSYDE
                     ARNTPLYSLEVSDINYAGKDPDLIISTLTPQEVGALKYQEMKLYFDKNKGLKSVFVSA
                     DVDSSQQAYKVDDGREALALYNEEVKVLDREYGPATIKEEFIAEKGKFYQSLSACIAK
                     QQEWYNKRLDLNKIKKCSTWQRTYKKGRVTVLLYIEPRQVSKHYIYK"
     gene            666137..666847
                     /locus_tag="KPHS_06240"
                     /db_xref="GeneID:11845614"
     CDS             666137..666847
                     /locus_tag="KPHS_06240"
                     /codon_start=1
                     /transl_table=11
                     /product="ascBF operon repressor"
                     /protein_id="YP_005224924.1"
                     /db_xref="GeneID:11845614"
                     /translation="MTLSDHQRAKSALNANDLNAAQGYLTGEKYNNRYRPVSGEESWG
                     SLQYRAAKIVANAAANGQKVRDDALYLAYISLFEAEEGVPEHPDIMLGYMHKAMALLL
                     ANPQLLDKIDSKNVSTLPSQFTLERYAVWQYLYDGGEIDWTKKAPEGEGYTIAGESYQ
                     TWNIKLKKAIWNRGDAFLTNIGKQQFIHDAIDYSQFPVIACTARRKGWHLTLPADYRE
                     QNFRGGGRFDWASCRAVE"
     gene            complement(666922..667434)
                     /locus_tag="KPHS_06250"
                     /db_xref="GeneID:11845615"
     CDS             complement(666922..667434)
                     /locus_tag="KPHS_06250"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224925.1"
                     /db_xref="GeneID:11845615"
                     /translation="MQLDEQRLRFRDAMASLSAAVNVVTTAGEAGRCGITATAVCSVT
                     DTPPSVMVCINANSAMNPVFQGNGKLCINVLNHEQEIMARHFAGMTGVTMEERFALSG
                     WQQGALGQPVLKGSLASLEGEISQVQTIGTHLVYLVEIRNITLSPQGHGLIYFKRRFH
                     PVMMEMEVAV"
     misc_feature    complement(666925..667434)
                     /locus_tag="KPHS_06250"
                     /note="4-hydroxyphenylacetate 3-monooxygenase reductase
                     subunit; Provisional; Region: hpaC; PRK15486"
                     /db_xref="CDD:185383"
     gene            complement(667454..669016)
                     /locus_tag="KPHS_06260"
                     /db_xref="GeneID:11845616"
     CDS             complement(667454..669016)
                     /locus_tag="KPHS_06260"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224926.1"
                     /db_xref="GeneID:11845616"
                     /translation="MKPEDFRADAKRPLTGEEYLKSLQDGREIYIYGERVKDVTTHPA
                     FRNAAASVAQLYDALHKPEMQDSLCWGTDTGSGGYTHKFFRVAKSADDLRQQRDAIAE
                     WSRLSYGWMGRTPDYKAAFGCALGANPAFYGQFEQNARNWYTRIQETGLYFNHAIVNP
                     PIDRHKPADEVKDVYIKLEKETDAGIIVSGAKVVATNSALTHYNMIGFGSAQVMGENP
                     DFALMFVAPMDAEGVKLISRASYEMVAGATGSPYDYPLSSRFDENDAILVMDKVLIPW
                     ENVLIYRDFDRCRRWTMEGGFARMYPLQACVRLAVKLDFITALLKRSLECTGTLEFRG
                     VQADLGEVVAWRNMFWALSDSMCSEATPWVNGAWLPDHAALQTYRVMAPMAYAKIKNI
                     IERNVTSGLIYLPSSARDLNNPQIDQYLAKYVRGSNGMDHVERIKILKLMWDAIGSEF
                     GGRHELYEINYSGSQDEIRLQCLRQAQSSGNMDKMMAMVDRCLSEYDQNGWTVPHLHN
                     NADINMLDKLLK"
     misc_feature    complement(667457..669013)
                     /locus_tag="KPHS_06260"
                     /note="4-hydroxyphenylacetate 3-hydroxylase C terminal;
                     Region: HpaB; cl29812"
                     /db_xref="CDD:356688"
     gene            complement(669242..670132)
                     /locus_tag="KPHS_06270"
                     /db_xref="GeneID:11845617"
     CDS             complement(669242..670132)
                     /locus_tag="KPHS_06270"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism regulatory
                     protein HpaA"
                     /protein_id="YP_005224927.1"
                     /db_xref="GeneID:11845617"
                     /translation="MCQHSIANIDINKDYDESLGTEEVHYQSFSRMAAFFGRDMQAHR
                     HDRYFQMHYLDTGQIELQLDDHRYSVQAPLFVITPPSVPHAFITESDSDGHVLTVHEE
                     LIWPLLEVLYPGTRETFGLPGICLSLADKPDELAALAHYWQLIRRESTAQLPGREHTL
                     ALLAQAVFTLLLRNARLDDHAASGMRGELKLFQRFNQMIDSHYHQHWTVPDYARELHL
                     TESRLTDICRRFANRSPKRLIFDRQLREAKRLLLFSDSAVNEIAWQLGFKDPAYFARF
                     FSRQVGCSPSSYRAQKVPVS"
     misc_feature    complement(669260..670117)
                     /locus_tag="KPHS_06270"
                     /note="4-hydroxyphenylacetate catabolism regulatory
                     protein HpaA; Region: HpaA; TIGR02297"
                     /db_xref="CDD:131350"
     gene            complement(670142..671500)
                     /locus_tag="KPHS_06280"
                     /db_xref="GeneID:11845618"
     CDS             complement(670142..671500)
                     /locus_tag="KPHS_06280"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate permease"
                     /protein_id="YP_005224928.1"
                     /db_xref="GeneID:11845618"
                     /translation="MTTSTLQHNDNKAVEVENRVIKKLFRRLITFLFVLFVFSFLDRI
                     NIGFAGLTMGKDLGLTSTMFGLAATLFYVTYVLCGIPSNIMLAKVGARRWIAGIMVVW
                     GIASTCTMFATSPHTLYILRMLVGIAEAGFLPGILVYLTWWFPAYHRARANALFMIAM
                     PVTMMLGSILSGYILALDGLWNLKGWQWLFLLEGLPSVVLGVVTWFFLNDTPDKANWL
                     DNEEKQALKAMIDREREHAAIVPASPRSTLREVLTPAVLMYTLAYFCLTNTLSAINIW
                     TPQILQSFNTGSSNIMIGLLAAIPQFCTIFGMIWWSRRSDRRKERKMHTILPYLFAAA
                     GWLLASATHHSLIQLIGIIMASVGSFTAMAIFWTTPDRVISLQSRAVALAVINAIGNV
                     GSAVSPLLIGILRDTTGSFSSGLWFVAGLLIVGALVLTRIPMSQREDAAAAPGLAAQK
                     GH"
     misc_feature    complement(670229..671443)
                     /locus_tag="KPHS_06280"
                     /note="4-hydroxyphenylacetate permease; Region: HpaX;
                     TIGR02332"
                     /db_xref="CDD:131385"
     gene            complement(671522..672319)
                     /locus_tag="KPHS_06290"
                     /db_xref="GeneID:11845619"
     CDS             complement(671522..672319)
                     /locus_tag="KPHS_06290"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224929.1"
                     /db_xref="GeneID:11845619"
                     /translation="MNNAFKDALKAGRPQIGLWLGLCSSYSAELLAGAGFDWLLIDGE
                     HAPNNVPTVLTQLQAIAPYPSQPVVRPSWNDPVQIKQLLDVGAQTLLVPMVQNAEEAR
                     LAVRATRYPPAGIRGVGSALARASRWNRVPDYIHRANDAMCVLVQIETREALKNLPQI
                     LDVDGVDGVFIGPADLSADMGHGGNPQHPEVQAAIEDAIQQIRQAGKAPGILMANEQL
                     AKRYLELGALFVAVGVDTTLLARGAEALAARFTHNATTTTDNNKSVY"
     misc_feature    complement(671570..672313)
                     /locus_tag="KPHS_06290"
                     /note="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase;
                     Region: HpaI; TIGR02311"
                     /db_xref="CDD:131364"
     gene            complement(672330..673133)
                     /locus_tag="KPHS_06300"
                     /db_xref="GeneID:11845620"
     CDS             complement(672330..673133)
                     /locus_tag="KPHS_06300"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
                     /protein_id="YP_005224930.1"
                     /db_xref="GeneID:11845620"
                     /translation="MLDKQTRTLIAQRLNQAEKQREQIRAISLDYPSITIEDAYAVQR
                     EWVEMKIAEGRVLKGHKIGLTSKAMQASSQISEPDYGALLDDMFFHDGSDIPTDRFIV
                     PRIEVELAFVLAKPLRGPNCTLFDVYNATDYVIPALELIDARCHNIDPETQRPRKVFD
                     TISDNAANAGVILGGRPIKPDELDLRWISALLYRNGVIEETGVAAGVLNHPANGVAWL
                     ANKLAPYDVQLEAGQIILGGSFTRPVPARKGDTFHVDYGNMGAISCRFV"
     misc_feature    complement(672333..673133)
                     /locus_tag="KPHS_06300"
                     /note="2-oxo-hepta-3-ene-1,7-dioic acid hydratase; Region:
                     HpaH; TIGR02312"
                     /db_xref="CDD:131365"
     gene            complement(673242..673622)
                     /locus_tag="KPHS_06310"
                     /db_xref="GeneID:11845621"
     CDS             complement(673242..673622)
                     /locus_tag="KPHS_06310"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224931.1"
                     /db_xref="GeneID:11845621"
                     /translation="MPHFIAECTDNIREQADLPGLFAKVNEALAATGIFPIGGIRSRA
                     HWLDTWQMADGRQDYAFVHMTLKIGAGRSLESRQDVGDMLFALIKSHFATLMESRYLA
                     LSFAMEELDPTLNYKQNNVHALFK"
     misc_feature    complement(673245..673622)
                     /locus_tag="KPHS_06310"
                     /note="5-carboxymethyl-2-hydroxymuconate delta-isomerase;
                     Provisional; Region: PRK15031"
                     /db_xref="CDD:184991"
     misc_feature    complement(order(673407..673409,673416..673418,
                     673500..673502,673506..673508,673617..673619))
                     /locus_tag="KPHS_06310"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238324"
     misc_feature    complement(order(673281..673283,673299..673322,
                     673356..673358,673368..673370,673389..673394,
                     673422..673424,673434..673436,673446..673448,
                     673464..673505,673509..673514,673545..673547,
                     673554..673556,673602..673604,673614..673616))
                     /locus_tag="KPHS_06310"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238324"
     gene            complement(673632..674489)
                     /locus_tag="KPHS_06320"
                     /db_xref="GeneID:11845622"
     CDS             complement(673632..674489)
                     /locus_tag="KPHS_06320"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224932.1"
                     /db_xref="GeneID:11845622"
                     /translation="MGKLALAAKITHVPSMYLSELPGKNHGCRQGAIDGHKEIGKRCR
                     EMGVDTIIVFDTHWLVNSAYHINCADHFQGVYTSNELPHFIRDMTYDYDGNPELGQLI
                     ADEAVKLGVRAKAHNIPSLKLEYGTLVPMRYMNSDKHFKVVSISAFCTVHDFADSRRL
                     GEAILKAIEKYDGTVAVLASGSLSHRFIDDQRAEEGMNSYTREFDHQMDERVVKLWRE
                     GKFKEFCTMLPEYADYCYGEGNMHDTVMLLGLLGWDKYDGKVEFITELFASSGTGQVN
                     AVFPLPAQA"
     misc_feature    complement(673647..674489)
                     /locus_tag="KPHS_06320"
                     /note="3,4-dihydroxyphenylacetate 2,3-dioxygenase; Region:
                     HpaD_Fe; TIGR02298"
                     /db_xref="CDD:131351"
     misc_feature    complement(order(673674..673679,673770..673772,
                     673935..673937,674115..674117,674319..674321,
                     674448..674456))
                     /locus_tag="KPHS_06320"
                     /note="putative active site [active]"
                     /db_xref="CDD:153382"
     misc_feature    complement(order(674319..674321,674454..674456))
                     /locus_tag="KPHS_06320"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:153382"
     gene            complement(674491..675957)
                     /locus_tag="KPHS_06330"
                     /db_xref="GeneID:11845623"
     CDS             complement(674491..675957)
                     /locus_tag="KPHS_06330"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224933.1"
                     /db_xref="GeneID:11845623"
                     /translation="MKKINHWINGKNVAGADYFHTTNPATGEVLAEVASGGEAEINQA
                     VAAAKEAFPKWANLPMKERARLMRRLGDLIDQNVPEIAAMETADTGLPIHQTKNVLIP
                     RASHNFEFFAEVCQQMNGKTYPVDDKMLNYTLVQPVGVCALVSPWNVPFMTATWKVAP
                     CLALGNTAVLKMSELSPLTADRLGELALEAGIPAGVLNVVQGYGATAGDALVRHHDVR
                     AVSFTGGTATGRNIMKNAGLKKYSMELGGKSPVLIFEDADIERALDAALFTIFSINGE
                     RCTAGSRIFIQQSIYPEFVKRFAERANRLRVGDPTDPNTQVGALITQQHWEKVSGYIR
                     LGIEEGATLLAGGADKPSDLPAHLKAGNFLRPTVLADVDNRMRVAQEEIFGPVACLLP
                     FKDEAEGLRLANDVEYGLASYIWTQDVSKVLRLARGIEAGMVFVNTQNVRDLRQPFGG
                     VKASGTGREGGEYSFEVFAEMKNVCISMGDHPIPKWGV"
     misc_feature    complement(674530..675897)
                     /locus_tag="KPHS_06330"
                     /note="Human aldehyde dehydrogenase family 8 member
                     A1-like; Region: ALDH_F8_HMSADH; cd07093"
                     /db_xref="CDD:143412"
     misc_feature    complement(order(674614..674616,674806..674808,
                     674812..674814,675124..675126,675223..675228,
                     675265..675267,675274..675276,675283..675291,
                     675331..675336,675346..675348,675436..675441,
                     675445..675447,675499..675501,675517..675525))
                     /locus_tag="KPHS_06330"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143412"
     misc_feature    complement(order(675124..675126,675133..675135,
                     675226..675228,675514..675516))
                     /locus_tag="KPHS_06330"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143412"
     gene            complement(675954..676718)
                     /locus_tag="KPHS_06340"
                     /db_xref="GeneID:11845624"
     CDS             complement(675954..676718)
                     /locus_tag="KPHS_06340"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate degradation bifunctional
                     isomerase/decarboxylase C-terminal subunit"
                     /protein_id="YP_005224934.1"
                     /db_xref="GeneID:11845624"
                     /translation="MKQARIEWQGQVRDVLVNERDQVRLDDGTVLKEGEFRWLPPANG
                     TLFALGLNYADHASELEFKPPTEPLVFIKAPNTFTGHQQQSVRPDNVEYMHYEAELVV
                     VIGKTARRVSEAEAMDYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDTLTPIGPWIVS
                     KEAIPDPHNLALRTWVNGELRQQGTTADLIFSIPFLIAYLSEFMTLQPGDMIATGTPK
                     GLSDVVPGDEVIVEVEGVGRLVNHIISQQAYEETLS"
     misc_feature    complement(675975..>676646)
                     /locus_tag="KPHS_06340"
                     /note="4-hydroxyphenylacetate degradation bifunctional
                     isomerase/decarboxylase; Provisional; Region: PRK15203"
                     /db_xref="CDD:185125"
     gene            complement(676715..677347)
                     /locus_tag="KPHS_06350"
                     /db_xref="GeneID:11845625"
     CDS             complement(676715..677347)
                     /locus_tag="KPHS_06350"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224935.1"
                     /db_xref="GeneID:11845625"
                     /translation="MKGTIFAVALNHRSQLDAWREAFQQAPYKTPPKTAVWFIKPRNT
                     VIGDGEAIPHPQGETVQSGATVALIVGKTARKVAAEEAANYIAGYALANDVSLPEESF
                     YRPAIKAKCRDGFCPIGTLSAVRNVDDLTIITEINGREADSWHTGDLQRSAAQLLSAL
                     SEFATLNPGDAILIGTPHSRVTLRPGDRVRILADGFPALENPVVAEGELA"
     misc_feature    complement(<676718..677347)
                     /locus_tag="KPHS_06350"
                     /note="4-hydroxyphenylacetate degradation bifunctional
                     isomerase/decarboxylase; Provisional; Region: PRK15203"
                     /db_xref="CDD:185125"
     gene            complement(677405..677569)
                     /locus_tag="KPHS_06360"
                     /db_xref="GeneID:11845626"
     CDS             complement(677405..677569)
                     /locus_tag="KPHS_06360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224936.1"
                     /db_xref="GeneID:11845626"
                     /translation="MYNRFLHLKSTSLFLKNIQVIDFQQISNCYVNIVLIRSQNIHFQ
                     LLNLSAKHKR"
     gene            677634..678074
                     /locus_tag="KPHS_06370"
                     /db_xref="GeneID:11845627"
     CDS             677634..678074
                     /locus_tag="KPHS_06370"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylacetate catabolism"
                     /protein_id="YP_005224937.1"
                     /db_xref="GeneID:11845627"
                     /translation="MHDSLTIALLQAREAAMAYFRPIVKRHNLTEQQWRIVRILAERP
                     SMDFHDLAFRACILRPSLTGILTRMERDGLVLRLKPVNDQRKLYVSLTPAGTALYESA
                     QAEVEETYRLLEAQFTTEKLQQLTSLLEEFIALGVPAGRGDEEE"
     misc_feature    677643..677996
                     /locus_tag="KPHS_06370"
                     /note="homoprotocatechuate degradation operon regulator,
                     HpaR; Region: HpaR; TIGR02337"
                     /db_xref="CDD:188209"
     gene            678037..678366
                     /locus_tag="KPHS_06380"
                     /db_xref="GeneID:11845628"
     CDS             678037..678366
                     /locus_tag="KPHS_06380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224938.1"
                     /db_xref="GeneID:11845628"
                     /translation="MASLPGAAMKKSSGYGSALSLARAISVSARAGDSGSLGCGSGQP
                     YSQRALGQFGLQPVVGGSHVAAAHIFATAQQALRRRRVFQRFRQPEGAVYGVGEALPA
                     PGAALAQ"
     gene            678356..678604
                     /locus_tag="KPHS_06390"
                     /db_xref="GeneID:11845629"
     CDS             678356..678604
                     /locus_tag="KPHS_06390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224939.1"
                     /db_xref="GeneID:11845629"
                     /translation="MLNDIRHVASGLVHRIRHRLQAARAAAEDQFLPVNHAAAVGGFK
                     QHAVRGGAGNQPRAVHLPDGGDVVGDLLLGRAQLPAAG"
     gene            678641..679657
                     /locus_tag="KPHS_06400"
                     /db_xref="GeneID:11845630"
     CDS             678641..679657
                     /locus_tag="KPHS_06400"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dehydrogenase"
                     /protein_id="YP_005224940.1"
                     /db_xref="GeneID:11845630"
                     /translation="MESVTLSLPEAYDLALEVLSANGFSADHAAAIARNVTAGERDGC
                     ASHGLWRLLGIVDTLRKGKVSPDAEPQIHDQAPGIARADAGGAFSLLAYERALPLLLE
                     KARHNGIAALAINRCVHFSALFADIEPLTEAGLVGLACTPSHAWVAPAGGTRPLFGTN
                     PIAFGWPRRDKPPFIVDMATSAAARGEIQLHQRAGKALPEGWGIDSQGQPTTDAAEVL
                     NGAMLTFGGHKGSALAAMVELLAGPLIGDMTSAESLAWDNGAGGLPYGGELILALDPQ
                     RFLGAQAPEQLARAETLFMGMQEQGARLPGERRFACRQQSERQGVIISRSLHDEICAL
                     RRGG"
     misc_feature    678659..679627
                     /locus_tag="KPHS_06400"
                     /note="Malate/L-lactate dehydrogenase; Region: Ldh_2;
                     pfam02615"
                     /db_xref="CDD:335007"
     gene            complement(679776..680996)
                     /locus_tag="KPHS_06410"
                     /db_xref="GeneID:11845631"
     CDS             complement(679776..680996)
                     /locus_tag="KPHS_06410"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid deaminase"
                     /protein_id="YP_005224941.1"
                     /db_xref="GeneID:11845631"
                     /translation="MKYHSAPLIPHKSALMSAPANLLAEEVCLPAALLKKSALENNIS
                     WMQRYADARGVSLAPHGKTTMTPWIFQAQQRAGAWGIGVGSAWQASAAMASGIQRVLM
                     VNQLVGKANMQVVAQLKAHYRAVDFICCVDSEVNVRALSTFFADQGQTLDVLIELGVP
                     GGRCGCRSVNDALALAQRVSDLPGLRLRGLELYEGVLHGDDPQPQVEALLQQAAALAC
                     RMEPLVDGEFILTGAGTVWYDVVCNIWLAAAKPRRCRIVIRPGCYITHDRGIYDLAQQ
                     ELIARDPIACDLAGDLTSALELMAMVQSVPEADRAVVNFGKRDCAFDAGLPQPIAHYR
                     NGQELALRAESIVSTGIMDQHCMLRLAPGSDVQVGDILLFGTSHPCLTFDKWKTLLLV
                     DDDYNVLDELDTLF"
     misc_feature    complement(679785..680918)
                     /locus_tag="KPHS_06410"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Bacterial Cryptic D-Serine Dehydratase; Region:
                     PLPDE_III_cryptic_DSD; cd06818"
                     /db_xref="CDD:143492"
     misc_feature    complement(order(679806..679808,680043..680048,
                     680055..680057,680061..680063,680067..680069,
                     680079..680090,680502..680513,680580..680582,
                     680592..680594,680601..680603,680664..680666,
                     680715..680717,680733..680738,680742..680747,
                     680805..680807,680811..680813,680910..680912))
                     /locus_tag="KPHS_06410"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143492"
     misc_feature    complement(order(680046..680048,680211..680222,
                     680292..680297,680418..680420,680508..680510,
                     680529..680531,680688..680690,680751..680753,
                     680811..680813,680817..680819))
                     /locus_tag="KPHS_06410"
                     /note="active site"
                     /db_xref="CDD:143492"
     misc_feature    complement(order(680211..680222,680292..680297,
                     680418..680420,680529..680531,680688..680690,
                     680751..680753,680811..680813,680817..680819))
                     /locus_tag="KPHS_06410"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143492"
     misc_feature    complement(order(680211..680213,680418..680420,
                     680508..680510,680811..680813))
                     /locus_tag="KPHS_06410"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143492"
     misc_feature    complement(680811..680813)
                     /locus_tag="KPHS_06410"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:143492"
     gene            complement(681040..681219)
                     /locus_tag="KPHS_06420"
                     /db_xref="GeneID:11845632"
     CDS             complement(681040..681219)
                     /locus_tag="KPHS_06420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224942.1"
                     /db_xref="GeneID:11845632"
                     /translation="MKSQSTFIAITPFRHADKLTIYKRKKQWKTTQKSDRFVILLFKT
                     NNIFILKIYLSNSYK"
     gene            681197..682636
                     /locus_tag="KPHS_06430"
                     /db_xref="GeneID:11845633"
     CDS             681197..682636
                     /locus_tag="KPHS_06430"
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminoacylase"
                     /protein_id="YP_005224943.1"
                     /db_xref="GeneID:11845633"
                     /translation="MKVDWLFKNVTVIDGSGGPQYRADVAVKGDRIMAIAPALDVAAE
                     QVIDGQGRVLAPGFIDVHTHDDINVIRMPEYLPKLSQGVTTVIVGNCGISAATATMRG
                     EVPDPMNLLGEQQHFIYPTVEAYAHAVEAARPSLNVGTLIGHTALRNNHMDDLFRPAN
                     ETEIAGMRVQLRDALRQGALGLSTGLAYASAFQSTTEEVMALAEELAAGKGVYTTHLR
                     SEFEPILEALDEAFRIGRHGNVPVVVSHHKCAGAKNWGRTKETLAFFDEMRQQQDIAC
                     DCYPYSASSSTLDMKQVTDEFDIVITWSEAQPEQAGKTLQQIADEWQVSLHDAAARLM
                     PAGAIYHNMDEQDVRRVMRYPVTMIGSDGLPNDPMPHPRLWGAFPRVLGHYSRDEQLF
                     PLTTAVHKMTGLSAARFQLADRGLVKIGYFADLVLFDPQTVRDVASFSDPKRPADGIE
                     AVMVNGVMSYGSDKKITGRAGRFLRRRMD"
     misc_feature    681206..682612
                     /locus_tag="KPHS_06430"
                     /note="D-aminoacylases (N-acyl-D-Amino acid
                     amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino
                     acids to produce the corresponding D-amino acids, which
                     are used as intermediates in the synthesis of pesticides,
                     bioactive peptides, and antibiotics; Region:
                     D-aminoacylase; cd01297"
                     /db_xref="CDD:238622"
     misc_feature    order(681380..681382,681386..681388,681467..681469,
                     681842..681844,681932..681934,682280..682282)
                     /locus_tag="KPHS_06430"
                     /note="active site"
                     /db_xref="CDD:238622"
     misc_feature    order(681938..681940,682031..682033,682049..682051,
                     682280..682282)
                     /locus_tag="KPHS_06430"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238622"
     gene            682647..683039
                     /locus_tag="KPHS_06440"
                     /db_xref="GeneID:11845634"
     CDS             682647..683039
                     /locus_tag="KPHS_06440"
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="YP_005224944.1"
                     /db_xref="GeneID:11845634"
                     /translation="MSIKRYGVEGGTGTGGQHLPFARAVEAGGWLYVSGQTPMKNGEV
                     VEGGIVDQSRLAIQNCVDIMTEAGYTLADVVHVKVILTDARYFQSFNKVFREFFGDNP
                     PARICCVADLVVDCKVEVDVTCFNAARQ"
     misc_feature    682707..683015
                     /locus_tag="KPHS_06440"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    order(682707..682712,682719..682721,682725..682727,
                     682734..682736,682740..682742,682746..682751,
                     682863..682865,682869..682874,682878..682880,
                     682884..682886,682917..682919,682926..682928,
                     682953..682967,682968..682973,683001..683003,
                     683007..683009,683013..683015)
                     /locus_tag="KPHS_06440"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    order(682707..682709,682905..682907,682917..682919,
                     682959..682961,683001..683003)
                     /locus_tag="KPHS_06440"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            683225..684712
                     /locus_tag="KPHS_06450"
                     /db_xref="GeneID:11845635"
     CDS             683225..684712
                     /locus_tag="KPHS_06450"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/panthothenate symporter"
                     /protein_id="YP_005224945.1"
                     /db_xref="GeneID:11845635"
                     /translation="MNNMSFMIWFSVYACAMITLGWYVSRKQKTGEDFLLGGRSLPMI
                     LTLGSTVGTMVGTGSSVGAVGFGYSNGWAGMLYGLGGAVGILLVAWLFAPVRKLRFMT
                     MSEEMSYYTGGSKIIKNLVAILIFIASIGWLGAHILGGGLYLAWASGIDINVAKIIIA
                     LAFVVYVGIGGYSAVVWIDTIQSIVLFVGFILMAILAVHHVGGWNHIQQAVDPAAQSL
                     FAVDKLGVLPALSLAMVIGVGVLATPSYRQRIYSAKTVSSVRQSFTITGLLYLGFSFL
                     PAIIGMAVWTMNPQLENSGFAFLFATQVLPPVLAMAILIAGMSANMSSGSSDAIAAVS
                     IMLRDLYTLVTGHMPAPEKAIRLSRIFLVLVIALALLFALTSNDIISYITKMISMIMS
                     GMFICTMLGRFWTRFNWQGAVAALAGGAGASVAVLVDSDWLAFWGNPCIPAVLTSLVA
                     SVVVTLLTPASSMSREQALEMITRERESRPTPPPLPIGKRHTSRG"
     misc_feature    683240..684589
                     /locus_tag="KPHS_06450"
                     /note="Solute carrier 5 family, sodium/glucose
                     transporters and related proteins; solute-binding domain;
                     Region: SLC5sbd; cd10322"
                     /db_xref="CDD:271357"
     misc_feature    order(683378..683380,683387..683389,684182..684184,
                     684191..684196)
                     /locus_tag="KPHS_06450"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:271357"
     gene            684722..685594
                     /locus_tag="KPHS_06460"
                     /db_xref="GeneID:11845636"
     CDS             684722..685594
                     /locus_tag="KPHS_06460"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo-3-deoxygalactonate kinase"
                     /protein_id="YP_005224946.1"
                     /db_xref="GeneID:11845636"
                     /translation="MNEYIAVDWGSTQLRAWRMRDGECIDKLKLPCGVTRLNGQRAEA
                     VFQQQLAPWRGDPALPVVMAGMIGSDAGWQPVPYLACPLALEALNGQLYEVAEKVWIV
                     PGLKVAQAADYDVMRGEETQLLGAWQLMPAECYVMPGTHCKWVQVQNGVVRQFATAMT
                     GELHHLLLNHSLLGQQLPAQFPDEASFALGIEKGLNQPALLSGLFSARAARVLGSLAA
                     TSVSDYLSGLLIGAEVATFSERYRASRVVLVGEHSLNARYQQAMAARGLAVSCCSGEA
                     AFLSGIARMIDGQD"
     misc_feature    684743..685576
                     /locus_tag="KPHS_06460"
                     /note="2-keto-3-deoxy-galactonokinase; Region: DGOK;
                     pfam05035"
                     /db_xref="CDD:335992"
     gene            685581..686180
                     /locus_tag="KPHS_06470"
                     /db_xref="GeneID:11845637"
     CDS             685581..686180
                     /locus_tag="KPHS_06470"
                     /codon_start=1
                     /transl_table=11
                     /product="keto-hydroxyglutarate-aldolase/keto-deoxy-
                     phosphogluconate aldolase"
                     /protein_id="YP_005224947.1"
                     /db_xref="GeneID:11845637"
                     /translation="MDKIKLVAILRGIQPAEAADHIETLINADFRYIEIPLNSPDWQQ
                     SIPAMVRQFGERAMIGAGTVLKVEQVDFLAEAGAKLIVTPNTAPAVIRRAVDKGMLVC
                     AGCATASEAFSALDAGAQWLKIFPSSAFGADYIRALKAVLPPEVPVLAVGGVTPESLA
                     TWIQAGCAGAGLGSDLYRAGQAVERTREQAERFISASKS"
     misc_feature    685581..686168
                     /locus_tag="KPHS_06470"
                     /note="2-dehydro-3-deoxy-6-phosphogalactonate aldolase;
                     Reviewed; Region: PRK09140"
                     /db_xref="CDD:181670"
     gene            complement(686177..687040)
                     /locus_tag="KPHS_06480"
                     /db_xref="GeneID:11845638"
     CDS             complement(686177..687040)
                     /locus_tag="KPHS_06480"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005224948.1"
                     /db_xref="GeneID:11845638"
                     /translation="MSWSIDIISCITDRFVELTATEKRIAQFILDDVAAAAELPIAEI
                     ARLTQTSQASVTRFARALGCKDVRELKMKLAQSLAVGQRFILDVPDLEGVQGIYESII
                     SVLETNRRALDIEALKRAVSWLSDARQILALGMGGGSTICAQEIQYRLFRLGLPVVSQ
                     SDGLLVRMMSSAVTPQDVVIVLSLGGYTREIIESAAIASQYGAKVIAITPAGTPLAEQ
                     ADLVLPLLVRENDYIFKPSTSRYAMLAMVDVLATELAMANKPQAKGKLRRIKLALDSH
                     RGGVDRQPLGD"
     misc_feature    complement(686207..687025)
                     /locus_tag="KPHS_06480"
                     /note="DNA-binding transcriptional regulator, MurR/RpiR
                     family, contains HTH and SIS domains [Transcription];
                     Region: RpiR; COG1737"
                     /db_xref="CDD:224651"
     gene            complement(687110..687646)
                     /locus_tag="KPHS_06490"
                     /db_xref="GeneID:11845639"
     CDS             complement(687110..687646)
                     /locus_tag="KPHS_06490"
                     /codon_start=1
                     /transl_table=11
                     /product="putative N-acetyltransferase"
                     /protein_id="YP_005224949.1"
                     /db_xref="GeneID:11845639"
                     /translation="MMKTNTITAGAVLRLTQESDIALLPAIERSAAQAFRQIPSLAWL
                     ADSEVISVARHHDYLETEHSLLAVAAGQPVGFILTEPLDDALFIVEVAVHQAWQQQGI
                     GRMLLERVIESARQMGYPAVTLTTFREVPWNAPFYTRLGFAMLDELTLPAGLAAKREQ
                     ETRHGLPPESRCAMRLAL"
     misc_feature    complement(687221..687469)
                     /locus_tag="KPHS_06490"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_7; pfam13508"
                     /db_xref="CDD:338785"
     misc_feature    complement(order(687335..687340,687368..687376))
                     /locus_tag="KPHS_06490"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            687676..688512
                     /locus_tag="KPHS_06500"
                     /db_xref="GeneID:11845640"
     CDS             687676..688512
                     /locus_tag="KPHS_06500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative N-acetyltransferase"
                     /protein_id="YP_005224950.1"
                     /db_xref="GeneID:11845640"
                     /translation="MELTAVPATQFSSVQLTDILNACFEAYLVPVTQSVEGFVQRFSA
                     EGMSLVDSRVWLAGDEPAAIAIVARRGSAARLAAFALRPAWRGKGLGRKLMQELLMLL
                     QQQGIETVFLEVIRDNHAAVALYQSLGFTRRYGLCGYLSTELLPPVPGVLQLYPTLSL
                     LRRAIEESNSQLPWLLDPLTFATLPCQVVTLEQRAFAVLTTAGSRPVLSFLWVEPAAR
                     RQGLARELLKALAQQFPGIGTSVTVPETFTPLFAAAGYAALTLQQYEMSATMNALRSA
                     GR"
     misc_feature    687730..688074
                     /locus_tag="KPHS_06500"
                     /note="ribosomal-protein-alanine acetyltransferase;
                     Region: rimI; TIGR01575"
                     /db_xref="CDD:273701"
     misc_feature    <687922..688065
                     /locus_tag="KPHS_06500"
                     /note="N-Acyltransferase superfamily: Various enyzmes that
                     characteristicly catalyze the transfer of an acyl group to
                     a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:354318"
     misc_feature    <688306..688437
                     /locus_tag="KPHS_06500"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_7; pfam13508"
                     /db_xref="CDD:338785"
     misc_feature    order(688306..688314,688342..688347)
                     /locus_tag="KPHS_06500"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(688516..689877)
                     /locus_tag="KPHS_06510"
                     /db_xref="GeneID:11845641"
     CDS             complement(688516..689877)
                     /locus_tag="KPHS_06510"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_005224951.1"
                     /db_xref="GeneID:11845641"
                     /translation="MESQNITIDPQTDFKEGKAEPLSVPLENTLQRSSRIKKIQTTAM
                     ILLFLAAVINYLDRSSLSVANLTIRQELGLNATEIGALLSVFSLAYGIAQLPCGPLLD
                     RKGPRIMLGLGMFFWSLFQALSGMVHSFTQFVLVRIGMGIGEAPMNPCGVKVINDWFN
                     IKERGRPMGFFNAASTIGVAVSPPILAAMMLMMGWRWMFITIGILGIFIAIGWYMLYR
                     NREDLPLTADEQAYLNAGSVNVRRDPLSFAEWRSLFKNKTMWGMMLGFSGINYTAWLY
                     LAWLPGYLQTAYNLDLKSTGFMAAIPFLFGAAGMLINGYVTDWLVKGGMAPIKSRKIC
                     IIAGMFCSAAFTLIVPHATTSFAAVLLIGMALFCIHFAGTSCWGLIHVAVASRMTASV
                     GSIQNFASFICASFAPVVTGFIVDTTHSFQLALVICGCVTALGALAYIFLVRQPISDP
                     RND"
     misc_feature    complement(688552..689748)
                     /locus_tag="KPHS_06510"
                     /note="Hexuronate transporter, Glucarate transporter, and
                     similar transporters of the Major Facilitator Superfamily;
                     Region: MFS_ExuT_GudP_like; cd17319"
                     /db_xref="CDD:340877"
     misc_feature    complement(order(688666..688668,688675..688680,
                     688687..688692,688699..688701,688747..688749,
                     688759..688761,688771..688776,688948..688950,
                     688960..688962,689044..689046,689053..689061,
                     689068..689073,689080..689082,689341..689343,
                     689350..689355,689362..689364,689422..689424,
                     689431..689439,689443..689448,689596..689598,
                     689692..689694,689701..689706,689713..689718))
                     /locus_tag="KPHS_06510"
                     /note="putative chemical substrate binding pocket
                     [chemical binding]; other site"
                     /db_xref="CDD:340877"
     gene            complement(690057..690971)
                     /locus_tag="KPHS_06520"
                     /db_xref="GeneID:11845642"
     CDS             complement(690057..690971)
                     /locus_tag="KPHS_06520"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005224952.1"
                     /db_xref="GeneID:11845642"
                     /translation="MSRSQNLRHNVINQVINDMARGFIPSPLPSQSALAEMYNISRTT
                     VRHILCHLCERGVLSQVNHDYQILRQPEVQDGFDSSSASLAEQNRLFEQAFFTMINQR
                     QLRAGERFSELQLARAAGVSPVVVREFLLKFSRYNLIESEKRGQWNMKKFEQSWAEQL
                     FELREMLETHALQHFLNLPDSDARWLQAKTLLERHRTLRDSIGDSFSMFSQLDRDFHS
                     LLLSAADNIFFNQSLEIISVIFHFHYQWDESDLKQRNIIAIDEHMTILSALICRSDLD
                     ANLALRNHLNTAKQSMINSIKQSESLAH"
     misc_feature    complement(690795..690953)
                     /locus_tag="KPHS_06520"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:354815"
     misc_feature    complement(690060..690734)
                     /locus_tag="KPHS_06520"
                     /note="DNA-binding transcriptional regulator, GntR family
                     [Transcription]; Region: GntR; COG1802"
                     /db_xref="CDD:224715"
     gene            691108..692130
                     /locus_tag="KPHS_06530"
                     /db_xref="GeneID:11845643"
     CDS             691108..692130
                     /locus_tag="KPHS_06530"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase GroES domain-containing
                     protein"
                     /protein_id="YP_005224953.1"
                     /db_xref="GeneID:11845643"
                     /translation="MTSMNTLVCQEPKKLHWEKRQIPIPGDDEVLIKIKAVGICGTDI
                     HAWGGNQPFFSYPRVLGHEICGEIIGLGKNILNLKSGQQVAVIPYVACRHCPACLSGR
                     TNCCENISVIGVHRDGGFSEYLCVPVNNLLVVDDVDPEAVALIEPFAISAHAVRRAAI
                     QPGDQVLVVGAGPIGLGAAAIAKADGAQVVVADTSPARRDHVAQHLGLTTLDPSDPLF
                     TEQLSATFDGSLAQKVIDATGNQQAMNNTVNLIRHGGSIIFVGLFKGELQFSDPEFHK
                     KETTMMGSRNATEEDFAKVGRLMTEGKVTARMMLTHRYDFKSLAEIYESDVINNRQLI
                     KGVIHF"
     misc_feature    691117..692127
                     /locus_tag="KPHS_06530"
                     /note="Alcohol dehydrogenases of the MDR family; Region:
                     Zn_ADH7; cd08261"
                     /db_xref="CDD:176222"
     misc_feature    order(691225..691233,691240..691242,691543..691545,
                     691555..691557,691615..691632,691684..691689,
                     691699..691701,691744..691746,691816..691821,
                     691825..691827,691885..691890,691957..691965)
                     /locus_tag="KPHS_06530"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176222"
     misc_feature    order(691225..691227,691291..691296,691543..691545)
                     /locus_tag="KPHS_06530"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176222"
     misc_feature    order(691381..691383,691390..691392,691399..691401,
                     691423..691425)
                     /locus_tag="KPHS_06530"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176222"
     gene            692142..693587
                     /locus_tag="KPHS_06540"
                     /db_xref="GeneID:11845644"
     CDS             692142..693587
                     /locus_tag="KPHS_06540"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_005224954.1"
                     /db_xref="GeneID:11845644"
                     /translation="MKTLNRQNFPGPQYPTRAIQFGEGNFLRAFIDWQLDLLNEKTDL
                     ATGVTIVRPINTVFPPSLNTQDGLYTTVIRGLNERGEAVSEARIIRSVNNEINPWQDF
                     AGYLALARDPEITFVFSNTTEAGISYHAGDRPDDMPPVSFPAKLTQLLLERFRHFNGA
                     ADKGWTIIPCELIDYNGEALKALVLRYAKEWQLPTAFSDWVETANTFCSTLVDRIVTG
                     YPREEAEKLEAELGYHDAFLDTAEYFWLFVIQGPQGLAEMLRLDRCPLNIRIVEDIRP
                     YKARKVAILNGAHTALVPVAWLCGVDTVGEAMRDKAVRHYVQQTIDEEIIPALDLPAE
                     ELRQFADAVTGRFLNPYIRHQLLAIALNGMTKFRTRILPQLLTTIRQHGAIPPRLTFA
                     LAALIAFYRGQRDGQTYPLQDDEVWLTRFAEGWAQVANGSPLHELVTEVLQDAAHWGE
                     DLTAIPCLADQVTRYLEMILRAGMREALSRL"
     misc_feature    692142..693554
                     /locus_tag="KPHS_06540"
                     /note="altronate oxidoreductase; Provisional; Region:
                     PRK03643"
                     /db_xref="CDD:235147"
     gene            693724..696489
                     /locus_tag="KPHS_06550"
                     /db_xref="GeneID:11845645"
     CDS             693724..696489
                     /locus_tag="KPHS_06550"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54 dependent transcriptional regulator"
                     /protein_id="YP_005224955.1"
                     /db_xref="GeneID:11845645"
                     /translation="MRKTELLAFLQNQTDFFDPDNLSEVFTASWLARCFAMQRNTASH
                     YLNQLVAQDVLVKINTRPVYFLHKKAFCQQFYPLSRSEYASMAELLAESDRQPEQADH
                     FSLLTGHDGSLRKPIEQMKTALFYPNGGLPLLITGDSGTGKSYMAELMHEFAIAQGLL
                     APDAPFVSFNCAQYASNPELLAANLFGYVKGAFTGAQSDKAGAFEAANGGMLFLDEVH
                     RLDAQGQEKLFTWLDRKEIYRVGETAQGLPISLRLVFATTEDIHSTFLTTFLRRIPIL
                     VSLPDLQHRSREEKEALTLQFFWQEARTLAARLQLTPRLLQVLTQYVYRGNVGELKNV
                     VKYAVASAWARSPGREMLTVTLHDLPENVMAATPALSEAMGQQEPLLIEPQTSLVWLL
                     RARDPVQGLIYDVQCRVLAQYEAVLNKKTVWEEAQRSMGEEIETLFDRLIFDNHDSSS
                     SQMLLLIAHQVREEYYRLEKRFNIQFNGNCLYALSHYLIHRSRQPQSTINNEKARQLE
                     DFLVQKFPLLYRFCEAILGALTLKLDIEPQRIDLLLLVLWFHKNGAISQQQVTRAIIL
                     AHGYATASSIANVANRLLKSQLFESFDMPLDVTPEAIANQVMAYIESHALASGLIILV
                     DMGSLNAIHRHFNRRLSTPMAIINNVSTGMAMYVGERILQGVMLEDIVREIGDDLAVE
                     HQLYYPQTDKPRAILTTCATGLGAAANLSALLKASIPEALGIDIVACDVETLADPARR
                     EPMLSRYEVLAIVGTLDPHLADLPWISLDSLISGEGSRPLMRIFGELATAEQVSEINN
                     LILKNFSLRRVIESVTILDTAKVINQVEQFLLRYEHLAGRDVPNDRKVALYVHISCLI
                     ERLIRHASPAQYTGGQCPDRELATLREAFSVIESGYSVKIPVVELCYIHDILTRETEF
                     IQEDQDF"
     misc_feature    693793..695076
                     /locus_tag="KPHS_06550"
                     /note="Transcriptional regulators containing an AAA-type
                     ATPase domain and a DNA-binding domain [Transcription,
                     Signal transduction mechanisms]; Region: PspF; COG1221"
                     /db_xref="CDD:224142"
     misc_feature    695104..696462
                     /locus_tag="KPHS_06550"
                     /note="Transcriptional regulatory protein LevR, contains
                     PRD, AAA+ and EIIA domains [Transcription]; Region: LevR;
                     COG3933"
                     /db_xref="CDD:226443"
     gene            696590..697012
                     /locus_tag="KPHS_06560"
                     /db_xref="GeneID:11845646"
     CDS             696590..697012
                     /locus_tag="KPHS_06560"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PTS permease"
                     /protein_id="YP_005224956.1"
                     /db_xref="GeneID:11845646"
                     /translation="MKRHYIFASHGSFANGLLNSVELILGKQPDIHTLCAYVEEEVDL
                     TQQVEALVARFPAQDELIVITDIFAGSVNNEFVRFLSRPHFHLLSGLNLPLIIDLLIS
                     AAEDNTEKLITEALTNAKESIQYCNQTIASAMTMDKDF"
     misc_feature    696593..697009
                     /locus_tag="KPHS_06560"
                     /note="Phosphotransferase system,
                     mannose/fructose-specific component IIA [Carbohydrate
                     transport and metabolism]; Region: ManX; COG2893"
                     /db_xref="CDD:225446"
     misc_feature    order(696617..696619,696659..696664,696695..696697,
                     696800..696802,696890..696892)
                     /locus_tag="KPHS_06560"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(696617..696619,696785..696787,696800..696802)
                     /locus_tag="KPHS_06560"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    696617..696619
                     /locus_tag="KPHS_06560"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            697027..697497
                     /locus_tag="KPHS_06570"
                     /db_xref="GeneID:11845647"
     CDS             697027..697497
                     /locus_tag="KPHS_06570"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PTS permease"
                     /protein_id="YP_005224957.1"
                     /db_xref="GeneID:11845647"
                     /translation="MITLLRVDHRLLHGQVAFSWTQYVGADCILIANDSVPGDELRKT
                     TIKLAKPPSVKLVIKNINDSIEAIKSGVTDKYNLFIVVESVNDAWRIASAIDEIKSIN
                     LGGIKAKEGSKNISKAINLLPTEIEQLQQLVGKGVEVEIRQVPNDRKQLFAECV"
     misc_feature    697030..697473
                     /locus_tag="KPHS_06570"
                     /note="PTS system sorbose subfamily IIB component; Region:
                     PTSIIB_sorb; pfam03830"
                     /db_xref="CDD:335494"
     misc_feature    order(697042..697044,697054..697056,697063..697065)
                     /locus_tag="KPHS_06570"
                     /note="active site"
                     /db_xref="CDD:237975"
     misc_feature    697063..697065
                     /locus_tag="KPHS_06570"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237975"
     gene            697514..698293
                     /locus_tag="KPHS_06580"
                     /db_xref="GeneID:11845648"
     CDS             697514..698293
                     /locus_tag="KPHS_06580"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PTS permease"
                     /protein_id="YP_005224958.1"
                     /db_xref="GeneID:11845648"
                     /translation="MVEALLLGLVAFIAQSEYALGTSLISRPIVTGLLTGLVLGDVQT
                     GVIMGATLELAFIGSFSVGASIPPDVVTGGILGVAFAITSGAGTETALLLGLPIATLT
                     LILKNIYLGMFIPMLSQKADGYAERADLRGIERMHLIAGFGLSLMLAAVVTVSFLVGS
                     NAVKSLLDTIPEFIKHGLSVATGIIPALGFAMLARLLINKKVAPYFFLGFVLMAYLKI
                     PVTGIAILGAIVAVVMVNVTALNSPRITTEQGVSDDDEDDF"
     misc_feature    697514..698212
                     /locus_tag="KPHS_06580"
                     /note="PTS system sorbose-specific iic component; Region:
                     EII-Sor; pfam03609"
                     /db_xref="CDD:335397"
     gene            698271..699122
                     /locus_tag="KPHS_06590"
                     /db_xref="GeneID:11845649"
     CDS             698271..699122
                     /locus_tag="KPHS_06590"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannose/fructose/sorbose transporter
                     subunit IID"
                     /protein_id="YP_005224959.1"
                     /db_xref="GeneID:11845649"
                     /translation="MTTKMISEETLQPQAQEETRITPRDLRRVFWRSFQMEFSWNYER
                     QMNLAFVYALIPVLKKLYPRREELAAALKRHLVFFNTTPHIVTLLLGITTAMEEKNSQ
                     QKNMDATAIDNVKASLMGPLAGLGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLV
                     FNVPHILVRWCFTRWGYVLGTGVLQRIQKSGMMASLTYGASIIGLMVVGAMTASMIDI
                     TIPLSFGAGEAKTQVQDIINDILPCMLPLVSFGIVYWLLGRKVKPLSIIGGMALVGIL
                     GSWIGLF"
     misc_feature    698313..699119
                     /locus_tag="KPHS_06590"
                     /note="Phosphotransferase system,
                     mannose/fructose/N-acetylgalactosamine-specific component
                     IID [Carbohydrate transport and metabolism]; Region: ManZ;
                     COG3716"
                     /db_xref="CDD:226239"
     gene            699135..700196
                     /locus_tag="KPHS_06600"
                     /db_xref="GeneID:11845650"
     CDS             699135..700196
                     /locus_tag="KPHS_06600"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glucosamine-fructose-6-phosphate
                     aminotransferase"
                     /protein_id="YP_005224960.1"
                     /db_xref="GeneID:11845650"
                     /translation="MRPTMMTYISEEPACLAQILRDYRQKLAPIETFARQHPVRRILL
                     LATGSSLNAALCARYFFEQRFGVLLDIKEPYNFTHYDAIDPHADLVVAISQSGKSAST
                     LEAMRKVQASGKSVFAMTSDPQSPIGGASDGVLDINTGIESVGFVTRGFSATVLNLLL
                     IALIIARKQEKASEVEEQHYLAELQRLVAAIPEVIVRTSRFIDRHSETLRSGERFVAT
                     GYGALVGVAKEFETKFTETVRVPSSGFELEAYMHGPYLEANARHVMLFIEDTPDARTR
                     ALRDYLAPSIGRAFTLTLGDEEDAQTLALNCPCEHHLAPLLLIVPVQMLAWHTAGLKG
                     IDLAKRIFDDFDRVLKSKI"
     misc_feature    <699135..700184
                     /locus_tag="KPHS_06600"
                     /note="Glucosamine 6-phosphate synthetase, contains
                     amidotransferase and phosphosugar isomerase domains [Cell
                     wall/membrane/envelope biogenesis]; Region: GlmS; COG0449"
                     /db_xref="CDD:223526"
     gene            700214..701224
                     /locus_tag="KPHS_06610"
                     /db_xref="GeneID:11845651"
     CDS             700214..701224
                     /locus_tag="KPHS_06610"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glucosamine-fructose-6-phosphate
                     aminotransferase"
                     /protein_id="YP_005224961.1"
                     /db_xref="GeneID:11845651"
                     /translation="MLGFNQDEYLTSAREIIAARKQAETVADDIYDSGCSALFFASVG
                     GSLAPMMAINEFAKELTSVPVYLEQAAELIHRGHKKLNKDAVVVTLSKSGDTKESVAI
                     AEWCKAQGIRVVAITRHADSPLAAAASWHIPMCHKNGVEYEYMLLYWLFFRVIFRHGE
                     FADYARFASQLELLPENLLQAKRQFDPRADSIAAQYHDCDYMMWIGGAEMWGEVYLFS
                     MCILEEMQWKRTKSVSSAEFFHGTLELLEKEVPLFLVKGEGRCRALDERVERFAEKIT
                     EHLVVIDPRDYPLNGIDDAFRWIMAPCVVSTLLVDRLAAHFEHHTGHDLNIRRYYRQF
                     DY"
     misc_feature    700214..701221
                     /locus_tag="KPHS_06610"
                     /note="Fructoselysine-6-P-deglycase FrlB and related
                     proteins with duplicated sugar isomerase (SIS) domain
                     [Cell wall/membrane/envelope biogenesis]; Region: AgaS;
                     COG2222"
                     /db_xref="CDD:225132"
     gene            701358..702302
                     /locus_tag="KPHS_06620"
                     /db_xref="GeneID:11845652"
     CDS             701358..702302
                     /locus_tag="KPHS_06620"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="YP_005224962.1"
                     /db_xref="GeneID:11845652"
                     /translation="MAMKKRMTSTPHDAVFKRFLRHPETATDFLTLYLPEAILQRCDF
                     STLRLQSASFIDEDLRAWYSDVLWSVQTTCGTGYVYVVIEHQSSPDSHMAFRLMRYAI
                     AAMQRHLDAGHKTLPLVVPMLFYHGATSPYPFSLNWLDEFADPQLAKTLYGCPFPLID
                     VTVMPDDDIVQHRRVALLELMQKHIRQRDLSGITESLAAVVMLGYTNRRQLRMLFHYM
                     LQYGNTAEPGVFLRRLARRLPQYEETLMSIAQKLKQEGRQQGRLEGREEGHLEGLQEG
                     SRREALRIAGSMLQNGLDKEMVQKITGLSADELQPLCG"
     misc_feature    701364..702296
                     /locus_tag="KPHS_06620"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09956"
                     /db_xref="CDD:182167"
     gene            complement(702357..704648)
                     /locus_tag="KPHS_06630"
                     /db_xref="GeneID:11845653"
     CDS             complement(702357..704648)
                     /locus_tag="KPHS_06630"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerol transferase I"
                     /protein_id="YP_005224963.1"
                     /db_xref="GeneID:11845653"
                     /translation="MSELLSIALFLASVVLYAWKAGRNTWWFAATLTVLGLFVVLNIT
                     LYASDYFTGDGINDAVLYTLTNSLTGAGIGKYILPGVGVAVALVAVFGALGWVLRRRR
                     HHPHHVGYSLAALLLALASVDASPAFHQISELVKSQSREGDPDFAAYYKEPSKQIDNP
                     QLNLVYIYGESLERTYFDNDAFPNLTPELGRIKDEAIDFSNTMQLPGTDYTIAGMVAS
                     QCGIPLFAPFEGNASASVSSFFPQNICLGDILKNSGYENYFVQGANLRFAGKDVFLKS
                     HGFDHLYGAEELKTTVADPTYRNDWGFYDDTVLDETWKKFEELSQSGKRFSLFALTVD
                     THHPDGFISRTCERKRYDVDGKKNLSFSAVSCSQEHIAALIEKIKASPYFKNTVIVVS
                     SDHLAMKNSAWDYLNKHDRSNLFFVLRGDKPQQETLAVKRNTMDNGATVLDILGGDNY
                     IGLGRSSLSGQSLSGIFMNMKEKVLAWKPDVIRLWNFPKEMKNFTIDSQKNMIAFSGS
                     HFRLPLLLRVSDQRVEPLPESEYSAPLRFQLADFAPRDNFVWVDRCYKMGQLWSPELA
                     LSTDWCVSQGQLGGEQKVQHVDKPQWHGKTAFRDTLIDMERYKGNVDTLKIVDNDIRY
                     KADSFVFNVAGAPEEVKQFSGISRPESWGRWSNAQLGSDVKIEYKEPLPEKFDLVITA
                     KAYGPNANKPIPVRVGESEQVLTLDNDVTTTTLHFDNPTRSNTLIITPPDPQTTNEGN
                     ILGHSPRQLGIGMVEIKVVKSEG"
     misc_feature    complement(702363..704648)
                     /locus_tag="KPHS_06630"
                     /note="phosphoglycerol transferase I; Provisional; Region:
                     PRK03776"
                     /db_xref="CDD:179648"
     misc_feature    complement(order(703464..703469,703641..703643,
                     704016..704018,704139..704141))
                     /locus_tag="KPHS_06630"
                     /note="putative active site [active]"
                     /db_xref="CDD:293739"
     misc_feature    complement(order(703464..703466,703641..703643,
                     704016..704018,704139..704141))
                     /locus_tag="KPHS_06630"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:293739"
     misc_feature    complement(order(703464..703469,704016..704018,
                     704139..704141))
                     /locus_tag="KPHS_06630"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:293739"
     misc_feature    complement(order(703833..703835,703842..703853,
                     703857..703859))
                     /locus_tag="KPHS_06630"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293739"
     gene            complement(704906..705397)
                     /locus_tag="KPHS_06640"
                     /db_xref="GeneID:11845654"
     CDS             complement(704906..705397)
                     /locus_tag="KPHS_06640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="YP_005224964.1"
                     /db_xref="GeneID:11845654"
                     /translation="MKSFKNSVIAALAVSAFTLSGAHAASWQDSLNSAASQLSGSNAQ
                     ASGGMSVSSLTSLLNGSSQSLTASSMNNAAGILSYCAKQKLASVTSADNVKNQVLDKL
                     GLSTPEKQKQDTSYLDGLQGLLNSKNGQQLDLNTLGNSSLAKQVKTKACDLVLKQGVN
                     FLS"
     misc_feature    complement(704912..705397)
                     /locus_tag="KPHS_06640"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11667"
                     /db_xref="CDD:236951"
     gene            complement(705463..706200)
                     /locus_tag="KPHS_06650"
                     /db_xref="GeneID:11845655"
     CDS             complement(705463..706200)
                     /locus_tag="KPHS_06650"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication protein DnaC"
                     /protein_id="YP_005224965.1"
                     /db_xref="GeneID:11845655"
                     /translation="MKNVGDLMKRLQKMMPAHIEPAFKTGEELLAWQKEQGRLRSEAL
                     ERENRAMKMQRTFNRSGIRPLHQNCSFDNYRVECEGQMNALARARQYVEEFDGNIASF
                     IFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFGNRETSEEQLLNDL
                     SMVDLLVIDEIGMQTESRYEKVIINQIVDRRSSSKRPTGMLTNSNMEEMNKLLGERVM
                     DRMRLGNSLWVIFNWESYRHRVTGKEY"
     misc_feature    complement(705469..706200)
                     /locus_tag="KPHS_06650"
                     /note="DNA replication protein DnaC; Validated; Region:
                     PRK07952"
                     /db_xref="CDD:181180"
     gene            complement(706203..706742)
                     /locus_tag="KPHS_06660"
                     /db_xref="GeneID:11845656"
     CDS             complement(706203..706742)
                     /locus_tag="KPHS_06660"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein I"
                     /protein_id="YP_005224966.1"
                     /db_xref="GeneID:11845656"
                     /translation="MSSRILTSHFSGLEEFLQQHAALLAKSTDGTVAVFANNAPAFYA
                     LTPARLAQLLELEARLARPGSDIALDPQFFEEPAAAPVAVPMGKFAMYAGWQPDADFQ
                     RLAALWGIALSQPVTPEELAAFVAYWQAEGKVFHHVQWQQKLARSVQISRASNGGQPK
                     RDVNSVSEPDSHIPRGFRG"
     misc_feature    complement(706206..706742)
                     /locus_tag="KPHS_06660"
                     /note="primosomal protein DnaI; Provisional; Region:
                     PRK02854"
                     /db_xref="CDD:179484"
     gene            complement(706845..707318)
                     /locus_tag="KPHS_06670"
                     /db_xref="GeneID:11845657"
     CDS             complement(706845..707318)
                     /locus_tag="KPHS_06670"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine/serine exporter"
                     /protein_id="YP_005224967.1"
                     /db_xref="GeneID:11845657"
                     /translation="MGIISFIFALAEDMLLAAIPAVGFAMVFNVPQRALRWCALLGAI
                     GHGSRMIMMSAGFNIEWATFLAALLVGSIGIQWSRWYLAHPKIFTVAAVIPMFPGISA
                     YTAMISAVKISHFGYSEEMMILLLSNFLKASSIVGALSIGLSIPGLWLYRKRPRV"
     misc_feature    complement(706848..707318)
                     /locus_tag="KPHS_06670"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09917"
                     /db_xref="CDD:182143"
     gene            complement(707309..708085)
                     /locus_tag="KPHS_06680"
                     /db_xref="GeneID:11845658"
     CDS             complement(707309..708085)
                     /locus_tag="KPHS_06680"
                     /codon_start=1
                     /transl_table=11
                     /product="paral putative membrane protein"
                     /protein_id="YP_005224968.1"
                     /db_xref="GeneID:11845658"
                     /translation="MQVDRTQQRAITRLCIQCGLFLLQHGAESALVEELSTRLGLALG
                     MDSVESAISSNAIVLTTIKNGECLTSTRKNVDRGINMHVVTEVQHIVILAEHKLLDYR
                     DVEKRFAQIVPLRYPRWLLVLMVGLSCACFCKLNNGGWDGALVSFCASTVAMYIRQML
                     THRSMHPQINFCITAFVATTISGLLLRLPAFASTPTIAMAASVLLLVPGFPLINAVAD
                     MFKGHINTGLARWAIASLLTLATCIGVVMAMTVWGLRGWA"
     misc_feature    complement(707354..708067)
                     /locus_tag="KPHS_06680"
                     /note="Uncharacterized membrane protein YjjP, DUF1212
                     family [Function unknown]; Region: YjjP; COG2966"
                     /db_xref="CDD:225514"
     gene            708158..708337
                     /locus_tag="KPHS_06690"
                     /db_xref="GeneID:11845659"
     CDS             708158..708337
                     /locus_tag="KPHS_06690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005224969.1"
                     /db_xref="GeneID:11845659"
                     /translation="MGSNNVQKFPVCGAAEFEASHTFASLVKSAIFVAIHPFFFPTDL
                     SKMQKSTFIKQKLYK"
     gene            708365..709549
                     /locus_tag="KPHS_06700"
                     /db_xref="GeneID:11845660"
     CDS             708365..709549
                     /locus_tag="KPHS_06700"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate 3-monooxygenase"
                     /protein_id="YP_005224970.1"
                     /db_xref="GeneID:11845660"
                     /translation="MKTQVAIIGAGPSGLLLGQLLHNAGIHTVILERQTPQYVLGRIR
                     AGILESGTVDLLREAGVAQRMDAEGLVHHGVEFLFDGQRVPVALSELTDGKSVMVYGQ
                     TEVTRDLMAARAASGAPIVYGVSEVAIHDAKSDRPTITYLSEGETCRLECDFIAGCDG
                     FHGVSRQSIPAGILQTYESVWPFGWLGLLADTPPVNPELIYAHHQRGFVLCSQRSLTR
                     SRYYLQVPLSDKVEAWSDERFWQELKSRLPEELASRLVTGHALEKSIAPLRSFVVEPM
                     QYGRLFLVGDAAHIVPPTGAKGLNLAASDVNYLWRILREYYHRGRSDLLAAYSQLALD
                     RVWKGERFSWFMTRLLHDFPDQNAFDAKMQAADRRYYLGSRAGLTTIAENYVGLPMER
                     VA"
     misc_feature    708365..709540
                     /locus_tag="KPHS_06700"
                     /note="4-hydroxybenzoate 3-monooxygenase; Validated;
                     Region: PRK08243"
                     /db_xref="CDD:236198"
     gene            709566..710447
                     /locus_tag="KPHS_06710"
                     /db_xref="GeneID:11845661"
     CDS             709566..710447
                     /locus_tag="KPHS_06710"
                     /codon_start=1
                     /transl_table=11
                     /product="putative AraC-type regulatory protein"
                     /protein_id="YP_005224971.1"
                     /db_xref="GeneID:11845661"
                     /translation="MPFVQTVPVFKLYGEECGWPTPDLLHCESILQRSSLYQWHIRVH
                     QHAEMVQLLYLHQGRAEIEIEGATAVMTESCIQVVPALCIHGFNFSPGTQGFVLSLAL
                     PLLSRFENQFGRPLDVLSVPQCVPVGRSRGRMHTLFSALREEYCEEHDAREMMLYSLL
                     GTLLVWLNRQCHPASPAEDKAERKRSMMRHFARLIESHYRQHLPLAEYAKLIGLSVTH
                     LNYLCREFYGCSALGVLHQRLMLEARRNLQYTRMTITQLSDYLGFSDAAYFSRFFRRY
                     SGMSPKAFRETIKDNAS"
     misc_feature    709638..710420
                     /locus_tag="KPHS_06710"
                     /note="4-hydroxyphenylacetate catabolism regulatory
                     protein HpaA; Region: HpaA; TIGR02297"
                     /db_xref="CDD:131350"
     gene            710713..711435
                     /locus_tag="KPHS_06720"
                     /db_xref="GeneID:11845662"
     CDS             710713..711435
                     /locus_tag="KPHS_06720"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="YP_005224972.1"
                     /db_xref="GeneID:11845662"
                     /translation="MLPGQGKFGVVISKIPVMQSGLKVIFNENLPDYELSFCRSHDEL
                     TLLQLRRAVLVVADISGEIAHPRAVCERYYSLMTQYRDIHWVFMVSDSLYPLAVELLI
                     RPESSLISESEPVNRLIEVICAGSRAAEQISRTLFAGDEDSDFASYHSAAMLTLSERK
                     VLRLLAKGWGINQIAALLKKSNKTISAQKNSAMRRLSLRSNAEMYAWINSAQGMQELN
                     INSAYGEQMEWKKIVQPAMSPS"
     misc_feature    710740..711321
                     /locus_tag="KPHS_06720"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            711396..712070
                     /locus_tag="KPHS_06730"
                     /db_xref="GeneID:11845663"
     CDS             711396..712070
                     /locus_tag="KPHS_06730"
                     /codon_start=1
                     /transl_table=11
                     /product="2-component transcriptional regulator"
                     /protein_id="YP_005224973.1"
                     /db_xref="GeneID:11845663"
                     /translation="MEKNSTTRHVAIVEKCVMTEMAWRYIFSREDNRRYHIHLFKNVS
                     MLRAAEIPFPWSTIIFSLSGSRSSRAESLLFVHEMARCRPEVQTIILANNESEMHLIG
                     HLMPACLHGILNKSAPRRGLQERLLQLLDNHHLSGSEQFCDREACNDPLSPTEHAILR
                     YMSWGYSLSDIAIQLNRNIKTIRAHKFNAMTKLGVRSDIGLLNAADILLHLPLNSTTS
                     AVKQVA"
     misc_feature    711447..712064
                     /locus_tag="KPHS_06730"
                     /note="DNA-binding transcriptional activator BglJ;
                     Provisional; Region: PRK11475"
                     /db_xref="CDD:236915"
     gene            complement(712076..712534)
                     /locus_tag="KPHS_06740"
                     /db_xref="GeneID:11845664"
     CDS             complement(712076..712534)
                     /locus_tag="KPHS_06740"
                     /codon_start=1
                     /transl_table=11
                     /product="YbaK/EbsC family protein"
                     /protein_id="YP_005224974.1"
                     /db_xref="GeneID:11845