GenomeNet

Database: RefSeq
Entry: NC_017825
LinkDB: NC_017825
Original site: NC_017825 
LOCUS       NC_017825              36711 bp    DNA     linear   VRL 21-DEC-2020
DEFINITION  Chimpanzee adenovirus Y25, complete genome.
ACCESSION   NC_017825
VERSION     NC_017825.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Chimpanzee adenovirus Y25
  ORGANISM  Chimpanzee adenovirus Y25
            Viruses; Varidnaviria; Bamfordvirae; Preplasmiviricota;
            Tectiliviricetes; Rowavirales; Adenoviridae; Mastadenovirus; Human
            mastadenovirus E.
REFERENCE   1  (bases 1 to 36711)
  AUTHORS   Dicks,M.D., Spencer,A.J., Edwards,N.J., Wadell,G., Bojang,K.,
            Gilbert,S.C., Hill,A.V. and Cottingham,M.G.
  TITLE     A novel chimpanzee adenovirus vector with low human seroprevalence:
            improved systems for vector derivation and comparative
            immunogenicity
  JOURNAL   PLoS ONE 7 (7), E40385 (2012)
   PUBMED   22808149
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 36711)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 36711)
  AUTHORS   Dicks,M.D.J., Cottingham,M.G. and Gilbert,S.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JUL-2011) Jenner Institute, Nuffield Department of
            Medicine, Oxford University, Roosevelt Drive, Oxford OX3 7DQ, UK
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JN254802.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..36711
                     /organism="Chimpanzee adenovirus Y25"
                     /mol_type="genomic DNA"
                     /host="Pan troglodytes"
                     /db_xref="taxon:1123958"
                     /collection_date="1969"
                     /collected_by="William D. Hillis"
     gene            577..1443
                     /locus_tag="YOE_gp01"
                     /db_xref="GeneID:12657135"
     CDS             join(577..1141,1235..1443)
                     /locus_tag="YOE_gp01"
                     /codon_start=1
                     /product="E1A"
                     /protein_id="YP_006272949.1"
                     /db_xref="GeneID:12657135"
                     /translation="MRHLRDLPDEKIIIASGNEILELVVNAMMGDDPPEPPTPFEAPS
                     LHDLYDLEVDVPEDDPNEEAVNDLFSDAALLAAEEASSPSSDSDSSLHTPRPGRGEKK
                     IPELKGEEMDLRCYEECLPPSDDEDEQAIQNAASQGMQAASESFALDCPPLPGHGCKS
                     CEFHRLNTGDKAVLCALCYMRAYNHCVYSPVSDADDETPTTESTSSPPEIGTSPPENI
                     VRPVPVRATGRRAAVECLDDLLQAGDEPLDLCTRKRPRH"
     misc_feature    join(634..1141,1235..1434)
                     /locus_tag="YOE_gp01"
                     /note="Early E1A protein; Region: Adeno_E1A; pfam02703"
                     /db_xref="CDD:280806"
     gene            1602..2165
                     /locus_tag="YOE_gp02"
                     /db_xref="GeneID:12657136"
     CDS             1602..2165
                     /locus_tag="YOE_gp02"
                     /codon_start=1
                     /product="E1B 19K"
                     /protein_id="YP_006272950.1"
                     /db_xref="GeneID:12657136"
                     /translation="MEIWTILEDLHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAK
                     QDYSEQFEVILRECPGLFDALNLGHQTHFNQRIVRALDFTTPGRSTAAVAFFAFLLDK
                     WSQETHFSRDYQLDFLAVALWRTWKSQRLNAISGYLPVQPLDTLKILNLQESPRARQR
                     RRQQQRQQEEDQEENPRAGLDPPAEEE"
     misc_feature    1602..2012
                     /locus_tag="YOE_gp02"
                     /note="Adenovirus E1B 19K protein / small t-antigen;
                     Region: Adeno_E1B_19K; pfam01691"
                     /db_xref="CDD:279955"
     gene            1907..3406
                     /locus_tag="YOE_gp03"
                     /db_xref="GeneID:12657137"
     CDS             1907..3406
                     /locus_tag="YOE_gp03"
                     /codon_start=1
                     /product="E1B 55K"
                     /protein_id="YP_006272951.1"
                     /db_xref="GeneID:12657137"
                     /translation="MESRNPFQQGLPAGFLSSSFVENMEIPAPECNLRLLAGTATRHS
                     EDPESPGESQGTPTSPAAAAAAGGGSRREPESRPGPSGGGGVADLFPELRRVLTRSSS
                     GRERGIKRERHDETNHRTELTVGLMSRKRPETVWWHEVQSTGTDEVSVMHERFSLEQV
                     KTCWLEPEDDWEVAIRNYAKLALRPDKKYKITKLINIRNACYISGNGAEVEICLQERV
                     AFRCCMMNMYPGVVGMDGVTFMNMRFRGDGYNGTVFMANTKLTVHGCSFFGFNNTCIE
                     AWGQVGVRGCSFSANWMGVVGRTKSMLSVKKCLFERCHLGVMSEGEARIRHCASTETG
                     CFVLCKGNAKIKHNMICGASDERGYQMLTCAGGNSHMLATVHVASHARKPWPEFEHNV
                     MTRCNMHLGSRRGMFMPYQCNLNYVKVLLEPDAMSRVSLTGVFDMNVEVWKILRYDES
                     KTRCRACECGGKHARFQPVCVEVTEDLRPDHLVLSCTGTEFGSSGEESD"
     misc_feature    1907..>2056
                     /locus_tag="YOE_gp03"
                     /note="Adenovirus E1B protein N-terminus; Region:
                     Adeno_E1B_55K_N; pfam04623"
                     /db_xref="CDD:113396"
     misc_feature    2246..3394
                     /locus_tag="YOE_gp03"
                     /note="Adenovirus EB1 55K protein / large t-antigen;
                     Region: Adeno_E1B_55K; pfam01696"
                     /db_xref="CDD:279960"
     gene            3491..3919
                     /locus_tag="YOE_gp04"
                     /db_xref="GeneID:12657138"
     CDS             3491..3919
                     /locus_tag="YOE_gp04"
                     /codon_start=1
                     /product="pIX"
                     /protein_id="YP_006272952.1"
                     /db_xref="GeneID:12657138"
                     /translation="MSGSGSFEGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPAN
                     SSTLTYATLSSSSVDAAAAAAAASAASAVRGMAMGAGYYGTLVANSSSTNNPASLNEE
                     KLLLLMAQLEALTQRLGELTQQVAQLQEQTRAAVATVKSK"
     misc_feature    3491..3901
                     /locus_tag="YOE_gp04"
                     /note="capsid protein IX,hexon associated protein IX;
                     Provisional; Region: IX; PHA03385"
                     /db_xref="CDD:177621"
     gene            complement(3978..5602)
                     /locus_tag="YOE_gp05"
                     /db_xref="GeneID:12657139"
     CDS             complement(join(3978..5311,5590..5602))
                     /locus_tag="YOE_gp05"
                     /codon_start=1
                     /product="IVa2"
                     /protein_id="YP_006272953.1"
                     /db_xref="GeneID:12657139"
                     /translation="METKGRRSGAVFDQPDEPEAHPRKRPARRAPLHRDGDHPDADAA
                     ALEGPDPGCAGRPSSGALLPQSSQPAKRGGLLDRDAVEHITELWDRLELLQQTLSKMP
                     MADGLKPLKNFASLQELLSLGGERLLAELVRENMHVREMMNEVAPLLREDGSCLSLNY
                     HLQPVIGVIYGPTGCGKSQLLRNLLSAQLISPAPETVFFIAPQVDMIPPSELKAWEMQ
                     ICEGNYAPGIEGTFVPQSGTLRPKFIKMAYDDLTQDHNYDVSDPRNVFAQAAAHGPIA
                     IIMDECMENLGGHKGVAKFFHAFPSKLHDKFPKCTGYTVLVVLHNMNPRRDLGGNIAN
                     LKIQAKMHLISPRMHPSQLNRFVNTYTKGLPVAISLLLKDIVQHHALRPCYDWVIYNT
                     TPEHEALQWSYLHPRDGLMPMYLNIQAHLYRVLEKIHRVLNDRDRWSRAYRARKIK"
     misc_feature    complement(3987..5099)
                     /locus_tag="YOE_gp05"
                     /note="Adenovirus IVa2 protein; Region: Adeno_IVa2;
                     pfam02456"
                     /db_xref="CDD:280594"
     misc_feature    complement(4296..4820)
                     /locus_tag="YOE_gp05"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     gene            complement(5081..13846)
                     /locus_tag="YOE_gp06"
                     /db_xref="GeneID:12657140"
     CDS             complement(join(5081..8662,13838..13846))
                     /locus_tag="YOE_gp06"
                     /codon_start=1
                     /product="polymerase"
                     /protein_id="YP_006272954.1"
                     /db_xref="GeneID:12657140"
                     /translation="MALVQTHGSRGLHPEASDPGRQPSRRRSRQSSPGAVPEPTRARR
                     RRAPAAPASGPRAASAARRASSPPLLTMEEAPPPSPQPPKKKRGTVVTPQGHGTLQAI
                     DVATNGAVEIKYHLDLPRALEKLLQVNRAPPLPTDLTPQRLRTLDSSGLRALVLALRP
                     ARAEVWTCLPRGLVSMTTIEAEEGQADHHDVVQHEMQAPRLHFPLKFLVKGTQVQLVQ
                     HVHPVQRCEHCGRLYKHKHECSARRRHFYFHHINSHSSNWWQEIQFFPIGSHPRTERL
                     FLTYDVETYTWMGSFGKQLVPFMLVMKLSGDDRLVELALDLALQLKWDRWHGDPRTFY
                     CVTPEKMAVGQQFRQYRDRLQTALAVDLWTSFLRANPHLADWALEQHGLSDPDELTYE
                     ELKKLPHVKGRPRFVELYIVGHNINGFDEIVLAAQVINNRAEVPQPFRITRNFMPRAG
                     KILFNDVTFALPNPAYKKRTDFQLWEQGGCDDIDFKHQFLKVMVRDTFALTHTSLRKA
                     AQAYALPVEKGCCAYKAVNQFYMLGSYRADQDGFPLEEYWKDREEFLLNRELWKQKGQ
                     LKYDIIQETLDYCALDVLVTAELVAKLQDSYAHFIRDSVGLPHAHFNIFQRPTISSNS
                     HAIFRQIVYRAEKPSRTNLGPGLLAPSHELYDYVRASIRGGRCYPTYIGILEEPLYVY
                     DICGMYASALTHPMPWGTPLSPYERALAVREWQASLDDLATSISYFDPDLLPGIFTID
                     ADPPDEVMLDPLPPFCSRKGGRLCWTNEPLRGEVATSVDLITLHNRGWQVRIVPDEMT
                     TVFPEWKCVAREYVQLNIAAKERADKEKNQTMRSIAKLLSNALYGSFATKLDNKKIVF
                     SDQMDEGLLKGISAGTVNIKSSSFLETDNLSAEVMPAFEREYLPQQLALLDSDPEDSE
                     DEQGPAPFYTPPAGTPGHVAYTYKPITFLDVDEGDMCLHTLEKVDPLVDNDRYPSHVA
                     SFVLAWTRAFVSEWAGFLYEEDRGTPLEDRPIKSVYGDTDSLFVTQRGHELMETKGKK
                     RIKKNGGKLVFDPDQPDLTWLVECETVCAHCGADAYAPDSVFLAPKLYALKSLLCPAC
                     GQTSKGKLRAKGHAAEALNYELMVNCYLADAQGADRERFSTSRMSLKRTLASAQPGAH
                     PFTVTETTLTRTLRPWKDRTLAALDAHRLVPYSRSRPNPRNEEVCWIEMP"
     misc_feature    complement(5906..7333)
                     /locus_tag="YOE_gp06"
                     /note="DNA polymerase type B, organellar and viral;
                     Region: DNA_pol_B_2; pfam03175"
                     /db_xref="CDD:281206"
     misc_feature    complement(<6059..>7009)
                     /locus_tag="YOE_gp06"
                     /note="DNA polymerase; Provisional; Region: PHA02563"
                     /db_xref="CDD:222879"
     misc_feature    complement(<5546..>5773)
                     /locus_tag="YOE_gp06"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both synthetic...; Region: POLBc;
                     cl10023"
                     /db_xref="CDD:271693"
     misc_feature    complement(order(5633..5638,5642..5644))
                     /locus_tag="YOE_gp06"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            complement(8461..13846)
                     /locus_tag="YOE_gp07"
                     /db_xref="GeneID:12657141"
     CDS             complement(join(8461..10392,13838..13846))
                     /locus_tag="YOE_gp07"
                     /codon_start=1
                     /product="pTP"
                     /protein_id="YP_006272955.1"
                     /db_xref="GeneID:12657141"
                     /translation="MALSIHDCARLTGQTVPTMNYFLPLRNIWNRVREFPRASTTAAG
                     ITWMSRYIYGYHRTMLEDLAPGAPATERWPLYRQPPPHFLIGYQYLVRTCNDYIFDTR
                     AYSRLKYHELVRPGHQTVNWSVMANCSYTINTGAYHRFVDFDDFQTTLTQIQQAILAE
                     RVVADLALVQPQRGFGLTRMHGRAGEEEVPVERLMQDYYKDLARCQDHAWGMADRLRI
                     QQAGPKDLVLLATIRRLRTAYFNFITSSIARPAPQHDPAEETVLSLPCDCDWLEAFVQ
                     RFSDPVDLETLRSLRGVPTGQLIRCIVSALSLPNGDPPGHLEMRGGVFTLRPREDGRA
                     VTETMRRRRGETIERFIDRLPVRRRRRRPPPPPPPPPEEEVEEMLVEEEEEEEVEELP
                     GAFEREVRATIAELIRLLEEELTVSARNSQFFNFAVDFYEAMERLEALGDVSEMPLRR
                     WIMYFFVTEHIATTLNYLYQRLCNYAVFTRHVELNLAQVVMRARDPEGVVVYSRVWNE
                     AGMNAFSQLMGRISNDLAATVERAGRGDLQEEEIEQFMTEIAYQDNSGDVQEILRQAA
                     VNDTEIDSVELSFRFKLTGPVAFTQRRQIQDVNRRVVAHASLLRAQYQNLPARGADVP
                     LPPLPPGPEPPLPPGARPRRRF"
     misc_feature    complement(8593..10227)
                     /locus_tag="YOE_gp07"
                     /note="Adenoviral DNA terminal protein; Region:
                     Adeno_terminal; pfam02459"
                     /db_xref="CDD:280597"
     gene            10827..12017
                     /locus_tag="YOE_gp08"
                     /db_xref="GeneID:12657142"
     CDS             10827..12017
                     /locus_tag="YOE_gp08"
                     /codon_start=1
                     /product="52/55kDa"
                     /protein_id="YP_006272956.1"
                     /db_xref="GeneID:12657142"
                     /translation="MHPVLRQMRPHHPPPQQQPPPPQPALLPPPQQQQQLPATTAAAA
                     VSGAGQTSQYDHLALEEGEGLARLGASSPERHPRVQMKRDAREAYVPKQNLFRDRSGE
                     EPEEMRAARFHAGRELRRGLDRKRVLRDEDFEADELTGISPARAHVAAANLVTAYEQT
                     VKEESNFQKSFNNHVRTLIAREEVTLGLMHLWDLLEAIVQNPTSKPLTAQLFLVVQHS
                     RDNEAFREALLNITEPEGRWLLDLVNILQSIVVQERGLPLSEKLAAINFSVLSLGKYY
                     ARKIYKTPYVPIDKEVKIDGFYMRMTLKVLTLSDDLGVYRNDRMHRAVSASRRRELSD
                     QELMHSLQRALTGAGTEGESYFDMGADLHWQPSRRALEAAGGPPYIEEVDDEVDEEGE
                     YLED"
     misc_feature    11019..11624
                     /locus_tag="YOE_gp08"
                     /note="Adenoviral protein L1 52/55-kDa; Region: Adeno_52K;
                     pfam03052"
                     /db_xref="CDD:145936"
     gene            12041..13810
                     /locus_tag="YOE_gp09"
                     /db_xref="GeneID:12657143"
     CDS             12041..13810
                     /locus_tag="YOE_gp09"
                     /codon_start=1
                     /product="pIIIa"
                     /protein_id="YP_006272957.1"
                     /db_xref="GeneID:12657143"
                     /translation="MQQQPPPDPAMRAALQSQPSGINSSDDWTQAMQRIMALTTRNPE
                     AFRQQPQANRLSAILEAVVPSRSNPTHEKVLAIVNALVENKAIRGDEAGLVYNALLER
                     VARYNSTNVQTNLDRMVTDVREAVAQRERFHRESNLGSMVALNAFLSTQPANVPRGQE
                     DYTNFISALRLMVTEVPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLQGLWGVQAP
                     VGDRATVSSLLTPNSRLLLLLVAPFTDSGSINRNSYLGYLINLYREAIGQAHVDEQTY
                     QEITHVSRALGQDDPGNLEATLNFLLTNRSQKIPPQYTLSAEEERILRYVQQSVGLFL
                     MQEGATPSAALDMTARNMEPSMYASNRPFINKLMDYLHRAAAMNSDYFTNAILNPHWL
                     PPPGFYTGEYDMPDPNDGFLWDDVDSSVFSPRPGANERPLWKKEGSDRRPSSALSGRE
                     GAAAAVPEAASPFPSLPFSLNSIRSSELGRITRPRLLGEEEYLNDSLLRPEREKNFPN
                     NGIESLVDKMSRWKTYAQEHRDDPSQGATSRGSAARKRRWHDRQRGLMWDDEDSADDS
                     SVLDLGGSGNPFAHLRPRIGRMM"
     misc_feature    12257..13798
                     /locus_tag="YOE_gp09"
                     /note="Hexon-associated protein (IIIa); Region: Hex_IIIa;
                     pfam02455"
                     /db_xref="CDD:280593"
     gene            13891..15489
                     /locus_tag="YOE_gp10"
                     /db_xref="GeneID:12657144"
     CDS             13891..15489
                     /locus_tag="YOE_gp10"
                     /codon_start=1
                     /product="penton"
                     /protein_id="YP_006272958.1"
                     /db_xref="GeneID:12657144"
                     /translation="MMRRAYPEGPPPSYESVMQQAMAAAAAMQPPLEAPYVPPRYLAP
                     TEGRNSIRYSELAPLYDTTRLYLVDNKSADIASLNYQNDHSNFLTTVVQNNDFTPTEA
                     STQTINFDERSRWGGQLKTIMHTNMPNVNEFMYSNKFKARVMVSRKTPNGVTVTDGSQ
                     DILEYEWVEFELPEGNFSVTMTIDLMNNAIIDNYLAVGRQNGVLESDIGVKFDTRNFR
                     LGWDPVTELVMPGVYTNEAFHPDIVLLPGCGVDFTESRLSNLLGIRKRQPFQEGFQIM
                     YEDLEGGNIPALLDVDAYEKSKEESAAAATAAVATASTEVRGDNFASPAAVAAAEAAE
                     TESKIVIQPVEKDSKDRSYNVLPDKINTAYRSWYLAYNYGDPEKGVRSWTLLTTSDVT
                     CGVEQVYWSLPDMMQDPVTFRSTRQVSNYPVVGAELLPVYSKSFFNEQAVYSQQLRAF
                     TSLTHVFNRFPENQILVRPPAPTITTVSENVPALTDHGTLPLRSSIRGVQRVTVTDAR
                     RRTCPYVYKALGIVAPRVLSSRTF"
     misc_feature    14023..15486
                     /locus_tag="YOE_gp10"
                     /note="Adenovirus penton base protein; Region:
                     Adeno_Penton_B; pfam01686"
                     /db_xref="CDD:279951"
     gene            15493..16074
                     /locus_tag="YOE_gp11"
                     /db_xref="GeneID:12657145"
     CDS             15493..16074
                     /locus_tag="YOE_gp11"
                     /codon_start=1
                     /product="pVII"
                     /protein_id="YP_006272959.1"
                     /db_xref="GeneID:12657145"
                     /translation="MSILISPSNNTGWGLRAPSKMYGGARQRSTQHPVRVRGHFRAPW
                     GALKGRVRSRTTVDDVIDQVVADARNYTPAAAPVSTVDAVIDSVVADARRYARAKSRR
                     RRIARRHRSTPAMRAARALLRRARRTGRRAMLRAARRAASGASAGRTRRRAATAAAAA
                     IASMSRPRRGNVYWVRDAATGVRVPVRTRPPRT"
     misc_feature    15493..>15759
                     /locus_tag="YOE_gp11"
                     /note="Adenoviral core protein VII; Region: Adeno_VII;
                     pfam03228"
                     /db_xref="CDD:281252"
     gene            16119..17141
                     /locus_tag="YOE_gp12"
                     /db_xref="GeneID:12657115"
     CDS             16119..17141
                     /locus_tag="YOE_gp12"
                     /codon_start=1
                     /product="pV"
                     /protein_id="YP_006272960.1"
                     /db_xref="GeneID:12657115"
                     /translation="MSKRKFKEEMLQVIAPEIYGPAVVKEERKPRKIKRVKKDKKEED
                     DDLVEFVREFAPRRRVQWRGRKVHPVLRPGTTVVFTPGERSGSASKRSYDEVYGDEDI
                     LEQAAERLGEFAYGKRSRPALKEEAVSIPLDHGNPTPSLKPVTLQQVLPSAAPRRGFK
                     REGEDLYPTMQLMVPKRQKLEDVLETMKVDPDVQPEVKVRPIKQVAPGLGVQTVDIKI
                     PTEPMETQTEPMIKPSTSTMEVQTDPWMPSAPSRRPRRKYGAASLLMPNYALHPSIIP
                     TPGYRGTRFYRGHTTSRRRKTTTRRRRRRTAAASTPAALVRRVYRRGRAPLTLPRARY
                     HPSIAI"
     misc_feature    16119..16973
                     /locus_tag="YOE_gp12"
                     /note="Adenovirus minor core protein PV; Region: Adeno_PV;
                     pfam03910"
                     /db_xref="CDD:281848"
     gene            17161..17394
                     /locus_tag="YOE_gp13"
                     /db_xref="GeneID:12657116"
     CDS             17161..17394
                     /locus_tag="YOE_gp13"
                     /codon_start=1
                     /product="Mu"
                     /protein_id="YP_006272961.1"
                     /db_xref="GeneID:12657116"
                     /translation="MALTCRLRVPITGYRGRKPRRRRLAGNGMRRHHHRRRRAISKRL
                     GGGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
     gene            17470..18201
                     /locus_tag="YOE_gp14"
                     /db_xref="GeneID:12657117"
     CDS             17470..18201
                     /locus_tag="YOE_gp14"
                     /codon_start=1
                     /product="pVI"
                     /protein_id="YP_006272962.1"
                     /db_xref="GeneID:12657117"
                     /translation="MEDINFSSLAPRHGTRPFMGTWSDIGTSQLNGGAFNWSSLWSGL
                     KNFGSTLKTYGSKAWNSTTGQALRDKLKEQNFQQKVVDGLASGINGVVDLANQAVQRQ
                     INSRLDPVPPAGSVEMPQVEEELPPLDKRGEKRPRPDAEETLLTHTDEPPPYEEAVKL
                     GLPTTRPIAPLATGVLKPESNKPATLDLPPPASRPSTVAKPLPPVAVARARPGGSARP
                     HANWQSTLNSIVGLGVQSVKRRRCY"
     misc_feature    17485..18198
                     /locus_tag="YOE_gp14"
                     /note="Minor capsid protein VI; Region: MCPVI; pfam02993"
                     /db_xref="CDD:281051"
     gene            18302..21130
                     /locus_tag="YOE_gp15"
                     /db_xref="GeneID:12657118"
     CDS             18302..21130
                     /locus_tag="YOE_gp15"
                     /codon_start=1
                     /product="hexon"
                     /protein_id="YP_006272963.1"
                     /db_xref="GeneID:12657118"
                     /translation="MATPSMLPQWAYMHIAGQDASEYLSPGLVQFARATDTYFSLGNK
                     FRNPTVAPTHDVTTDRSQRLTLRFVPVDREDNTYSYKVRYTLAVGDNRVLDMASTYFD
                     IRGVLDRGPSFKPYSGTAYNSLAPKGAPNSSQWEQKKAGNGDTMETHTFGVAPMGGEN
                     ITIDGLQIGTDATADQDKPIYADKTFQPEPQVGEENWQETESFYGGRALKKDTSMKPC
                     YGSYARPTNVKGGQAKLKVGADGVPTKEFDIDLAFFDTPGGTVNGQDEYKADIVMYTE
                     NTYLETPDTHVVYKPGKDDASSEINLVQQSMPNRPNYIGFRDNFIGLMYYNSTGNMGV
                     LAGQASQLNAVVDLQDRNTELSYQLLLDSLGDRTRYFSMWNQAVDSYDPDVRIIENHG
                     VEDELPNYCFPLDGSGTNAAYQGVKVKNGNDGDVESEWENDDTVAARNQLCKGNIFAM
                     EINLQANLWRSFLYSNVALYLPDSYKYTPANITLPTNTNTYDYMNGRVVPPSLVDAYI
                     NIGARWSLDPMDNVNPFNHHRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKSLLLLP
                     GSYTYEWNFRKDVNMILQSSLGNDLRTDGASISFTSINLYATFFPMAHNTASTLEAML
                     RNDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNWAAFRGWSFTRLKTKETPSLG
                     SGFDPYFVYSGSIPYLDGTFYLNHTFKKVSITFDSSVSWPGNDRLLTPNEFEIKRTVD
                     GEGYNVAQCNMTKDWFLVQMLAHYNIGYQGFYVPEGYKDRMYSFFRNFQPMSRQVVDE
                     VNYKDYQAVTLAYQHNNSGFVGYLAPTMRQGQPYPANYPYPLIGKSAVTSVTQKKFLC
                     DRVMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMNFEVDPMDESTLLYVVFEVFD
                     VVRVHQPHRGVIEAVYLRTPFSAGNATT"
     misc_feature    18434..20002
                     /locus_tag="YOE_gp15"
                     /note="Hexon, adenovirus major coat protein, N-terminal
                     domain; Region: Adeno_hexon; pfam01065"
                     /db_xref="CDD:279414"
     misc_feature    20177..20845
                     /locus_tag="YOE_gp15"
                     /note="Hexon, adenovirus major coat protein, C-terminal
                     domain; Region: Adeno_hexon_C; pfam03678"
                     /db_xref="CDD:281648"
     gene            21146..21775
                     /locus_tag="YOE_gp16"
                     /db_xref="GeneID:12657119"
     CDS             21146..21775
                     /locus_tag="YOE_gp16"
                     /codon_start=1
                     /product="endoprotease"
                     /protein_id="YP_006272964.1"
                     /db_xref="GeneID:12657119"
                     /translation="MAEPTGSGEQELRAIIRDLGCGPYFLGTFDKRFPGFMAPHKLAC
                     AIVNTAGRETGGEHWLAFAWNPRSNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSALA
                     TEDRCVTLEKSTQTVQGPRSAACGLFCCMFLHAFVHWPDRPMDKNPTMNLLTGVPNGM
                     LQSPQVEPTLRRNQEALYRFLNSHSAYFRSHRARIEKATAFDRMNNQDM"
     misc_feature    21218..21748
                     /locus_tag="YOE_gp16"
                     /note="Adenovirus endoprotease; Region: Peptidase_C5;
                     pfam00770"
                     /db_xref="CDD:279154"
     gene            complement(21852..23390)
                     /locus_tag="YOE_gp17"
                     /db_xref="GeneID:12657120"
     CDS             complement(21852..23390)
                     /locus_tag="YOE_gp17"
                     /note="DBP"
                     /codon_start=1
                     /product="DNA binding protein"
                     /protein_id="YP_006272965.1"
                     /db_xref="GeneID:12657120"
                     /translation="MAGRGGSQSERRRERTPERGRGSASHPPSRGGESPSPPPLPPKR
                     HTYRRVASDQEEEEIVVVSENSRSPSPQASPPPLPPKKKPRKTKHVVMQDVSQDSEDE
                     RQAEEELAAVGFSYPPVRITEKDGKRSFETLDESDPLAAAASAKMMVKNPMSLPIVSA
                     WEKGMEIMTMLMDRYRVETDLKANFQLMPEQGEVYRRICHLYINEEHRGIPLTFTSNK
                     TLTTMMGRFLQGFVHAHSQIAHKNWECTGCALWLHGCTEAEGKLRCLHGTTMIQKEHM
                     IEMDVASENGQRALKENPDRAKITQNRWGRSVVQLANNDARCCVHDAGCATNQFSSKS
                     CGVFFTEGAKAQQAFRQLEAFMKAMYPGMNADQAQMMLIPLHCDCNHKPGCVPTMGRQ
                     TCKMTPFGMANAEDLDVESITDAAVLASVKHPALMVFQCCNPVYRNSRAQNAGPNCDF
                     KISAPDLLGALQLTRKLWTDSFPDTPLPKLLIPEFKWLAKYQFRNVSLPAGHAETRQN
                     PFDF"
     misc_feature    complement(21855..23114)
                     /locus_tag="YOE_gp17"
                     /note="early DNA-binding protein E2A; Provisional; Region:
                     PHA03384"
                     /db_xref="CDD:223068"
     misc_feature    complement(22668..22901)
                     /locus_tag="YOE_gp17"
                     /note="Viral DNA-binding protein, all alpha domain;
                     Region: Viral_DNA_bi; pfam02236"
                     /db_xref="CDD:280410"
     misc_feature    complement(22308..22607)
                     /locus_tag="YOE_gp17"
                     /note="Viral DNA-binding protein, zinc binding domain;
                     Region: Viral_DNA_Zn_bi; pfam03728"
                     /db_xref="CDD:281690"
     misc_feature    complement(21984..22256)
                     /locus_tag="YOE_gp17"
                     /note="Viral DNA-binding protein, zinc binding domain;
                     Region: Viral_DNA_Zn_bi; pfam03728"
                     /db_xref="CDD:281690"
     gene            23419..25827
                     /locus_tag="YOE_gp18"
                     /db_xref="GeneID:12657121"
     CDS             23419..25827
                     /locus_tag="YOE_gp18"
                     /codon_start=1
                     /product="100kDa"
                     /protein_id="YP_006272966.1"
                     /db_xref="GeneID:12657121"
                     /translation="METQPSPTSPSAPTAGDEKQQQQNESLTAPPPSPASDAAAVPDM
                     QEMEESIEIDLGYVTPAEHEEELAVRFQSSSQEDKEQPEQEAENEQSQAGLEHGDYLH
                     LSGEEDALIKHLARQATIVKDALLDRTEVPLSVEELSRAYELNLFSPRVPPKRQPNGT
                     CEPNPRLNFYPVFAVPEALATYHIFFKNQKIPVSCRANRTRADALFNLGPGARLPDIA
                     SLEEVPKIFEGLGSDETRAANALQGEGGGEHEHHSALVELEGDNARLAVLKRTVELTH
                     FAYPALNLPPKVMSAVMDQVLIKRASPISEDEGMQDSEEGKPVVSDEQLARWLGPNAT
                     PQSLEERRKLMMAVVLVTVELECLRRFFADAETLRKVEENLHYLFRHGFVRQACKISN
                     VELTNLVSYMGILHENRLGQNVLHTTLRGEARRDYIRDCVYLYLCHTWQTGMGVWQQC
                     LEEQNLKELCKLLQKNLKGLWTGFDERTTASDLADLIFPERLRLTLRNGLPDFMSQSM
                     LQNFRSFILERSGILPATCSALPSDFVPLTFRECPPPLWSHCYLLRLANYLAYHSDVI
                     EDVSGEGLLECHCRCNLCTPHRSLACNPQLLSETQIIGTFELQGPSEGEGAKGGLKLT
                     PGLWTSAYLRKFVPEDYHPFEIRFYEDQSQPPKAELSACVITQGAILAQLQAIQKSRQ
                     EFLLKKGRGVYLDPQTGEELNPGFPQDAPRKQEAESGAAARGGFGGRLGEQQSGRGDG
                     GRLGQHSGRGGQPARQSGGRRGGGRGGGGRSSRRQTVVLGGGESKQHGYHLRSGSGSR
                     SAPQ"
     misc_feature    <23419..23892
                     /locus_tag="YOE_gp18"
                     /note="Vesicle coat trafficking protein Sec16 N-terminus;
                     Region: Sec16_N; pfam12935"
                     /db_xref="CDD:289687"
     misc_feature    23746..25524
                     /locus_tag="YOE_gp18"
                     /note="Late 100kD protein; Region: Adeno_100; pfam02438"
                     /db_xref="CDD:280578"
     gene            25544..26372
                     /locus_tag="YOE_gp19"
                     /db_xref="GeneID:12657122"
     CDS             join(25544..25871,26041..26372)
                     /locus_tag="YOE_gp19"
                     /codon_start=1
                     /product="33K"
                     /protein_id="YP_006272967.1"
                     /db_xref="GeneID:12657122"
                     /translation="MPRGNKKLKVELPPVEDLEEDWENSSQAEEMEEDWDSTQAEEDS
                     LQDSLEEDEEEAEEEVEEAAAARPSSSAGEKASSTDTISAPGRGPARPHSRWDETGRF
                     PNPTTQTAPTTSKKRQQQQKKTRKPARKSTAAAAAGGLRIAANEPAQTRELRNRIFPT
                     LYAIFQQSRGQEQELKVKNRSLRSLTRSCLYHKSEDQLQRTLEDAEALFNKYCALTLK
                     E"
     misc_feature    join(25550..25871,26041..26360)
                     /locus_tag="YOE_gp19"
                     /note="Protein of unknown function (DUF2890); Region:
                     DUF2890; pfam11081"
                     /db_xref="CDD:287991"
     gene            25544..26098
                     /locus_tag="YOE_gp20"
                     /db_xref="GeneID:12657123"
     CDS             25544..26098
                     /locus_tag="YOE_gp20"
                     /codon_start=1
                     /product="22K"
                     /protein_id="YP_006272968.1"
                     /db_xref="GeneID:12657123"
                     /translation="MPRGNKKLKVELPPVEDLEEDWENSSQAEEMEEDWDSTQAEEDS
                     LQDSLEEDEEEAEEEVEEAAAARPSSSAGEKASSTDTISAPGRGPARPHSRWDETGRF
                     PNPTTQTGKKERQGYKSWRGHKNAIVSCLQACGGNISFTRRYLLFHRGVNFPRNILHY
                     YRHLHSPYYFQEEAAAAEKDQKTS"
     misc_feature    25547..26059
                     /locus_tag="YOE_gp20"
                     /note="Protein of unknown function (DUF2890); Region:
                     DUF2890; pfam11081"
                     /db_xref="CDD:287991"
     gene            26455..27138
                     /locus_tag="YOE_gp21"
                     /db_xref="GeneID:12657124"
     CDS             26455..27138
                     /locus_tag="YOE_gp21"
                     /codon_start=1
                     /product="pVIII"
                     /protein_id="YP_006272969.1"
                     /db_xref="GeneID:12657124"
                     /translation="MSKEIPTPYMWSYQPQMGLAAGAAQDYSTRMNWLSAGPAMISRV
                     NDIRAHRNQILLEQSALTATPRNHLNPRNWPAALVYQEIPQPTTVLLPRDAQAEVQLT
                     NSGVQLAGGATLCRHRPAQGIKRLVIRGRGTQLNDEVVSSSLGLRPDGVFQLAGSGRS
                     SFTPRQAVLTLESSSSQPRSGGIGTLQFVEEFTPSVYFNPFSGSPGHYPDEFIPNFDA
                     ISESVDGYD"
     misc_feature    26461..27102
                     /locus_tag="YOE_gp21"
                     /note="Adenovirus hexon associated protein, protein VIII;
                     Region: Adeno_PVIII; pfam01310"
                     /db_xref="CDD:279630"
     gene            27139..27459
                     /locus_tag="YOE_gp22"
                     /db_xref="GeneID:12657125"
     CDS             27139..27459
                     /locus_tag="YOE_gp22"
                     /codon_start=1
                     /product="E3 12.5K"
                     /protein_id="YP_006272970.1"
                     /db_xref="GeneID:12657125"
                     /translation="MSHGGAADLARLRHLDHCRRFRCFARDLAEFTYFELPEEHPQGP
                     AHGVRIVVEGGLDSHLLRIFSQRPILVERQQGNTLLTLYCICDHPGLHESLCCLLCTE
                     YNKS"
     misc_feature    27151..27453
                     /locus_tag="YOE_gp22"
                     /note="Adenovirus E3A; Region: Adeno_E3A; pfam05248"
                     /db_xref="CDD:283025"
     gene            28033..28563
                     /locus_tag="YOE_gp23"
                     /db_xref="GeneID:12657126"
     CDS             28033..28563
                     /locus_tag="YOE_gp23"
                     /codon_start=1
                     /product="E3 gp19K"
                     /protein_id="YP_006272971.1"
                     /db_xref="GeneID:12657126"
                     /translation="MGKITLVCGVLVTVVLSILGGGSAAVVTEKKADPCLTFNPDKCR
                     LSFQPDGNRCAVLIKCGWECESVLVQYKNKTWNNTLASTWQPGDPEWYTVSVPGADGS
                     LRTVNNTFIFEHMCETAMFMSKQYGMWPPRKENIVVFSIAYSACTVLITAIVCLSIHM
                     LIAIRPRNNAEKEKQP"
     misc_feature    28159..28560
                     /locus_tag="YOE_gp23"
                     /note="Adenovirus GP19K; Region: Adeno_GP19K; pfam04881"
                     /db_xref="CDD:282705"
     gene            31636..32040
                     /locus_tag="YOE_gp24"
                     /db_xref="GeneID:12657127"
     CDS             31636..32040
                     /locus_tag="YOE_gp24"
                     /codon_start=1
                     /product="E3 14.7kDa"
                     /protein_id="YP_006272972.1"
                     /db_xref="GeneID:12657127"
                     /translation="MTDPMANNTVNDLLDMDGRASEQRLAQLRIRQQQERAVKELQDA
                     VAIHQCKRGIFCLVKQAKISFEVTSTDHRLSYELLQQRQKFTCLVGVNPIVITQQSGD
                     TKGCIHCSCDSPECVHTLIKTLCGLRDLLPMN"
     misc_feature    31684..32031
                     /locus_tag="YOE_gp24"
                     /note="Adenovirus 15.3kD protein in E3 region; Region:
                     Adeno_E3_15_3; pfam03307"
                     /db_xref="CDD:281322"
     gene            32290..33621
                     /locus_tag="YOE_gp25"
                     /db_xref="GeneID:12657128"
     CDS             32290..33621
                     /locus_tag="YOE_gp25"
                     /codon_start=1
                     /product="fiber"
                     /protein_id="YP_006272973.1"
                     /db_xref="GeneID:12657128"
                     /translation="MSKKRARVDDGFDPVYPYDADNAPTVPFINPPFVSSDGFQEKPL
                     GVLSLRLADPVTTKNGAVTLKLGEGVDLDDSGKLISKNATKATAPLSISNGTISLNMA
                     APFYNNNGTLSLNVSTPLAVFPTFNTLGISLGNGLQTSNKLLTVQLTHPLTFSSNSIT
                     VKTDKGLYINSSGNRGLEANISLKRGLIFDGNAIATYLGSGLDYGSYDSDGKTRPIIT
                     KIGAGLNFDANNAMAVKLGTGLSFDSAGALTAGNKEDDKLTLWTTPDPSPNCQLLSDR
                     DAKFTLCLTKCGSQILGTVAVAAVTVGSALNPINDTVKSAIVFLRFDSDGVLMSNSSM
                     VGDYWNFREGQTTQSVAYTNAVGFMPNLGAYPKTQSKTPKNSIVSQVYLNGETTMPMT
                     LTITFNGTDEKDTTPVSTYSMTFTWQWTGDYKDKNITFATNSFTFSYMAQE"
     misc_feature    32422..32508
                     /locus_tag="YOE_gp25"
                     /note="Adenoviral fibre protein (repeat/shaft region);
                     Region: Adeno_shaft; pfam00608"
                     /db_xref="CDD:109656"
     misc_feature    33067..33606
                     /locus_tag="YOE_gp25"
                     /note="Adenoviral fibre protein (knob domain); Region:
                     Adeno_knob; pfam00541"
                     /db_xref="CDD:278941"
     gene            complement(33714..34861)
                     /locus_tag="YOE_gp26"
                     /db_xref="GeneID:12657129"
     CDS             complement(join(33714..33965,34688..34861))
                     /locus_tag="YOE_gp26"
                     /codon_start=1
                     /product="E4Orf6/7"
                     /protein_id="YP_006272974.1"
                     /db_xref="GeneID:12657129"
                     /translation="MSGNSSIMTRSRTRLASSRHHPYQPPAPLPRCEETETRASLVED
                     HPVLPDCDTLSMHNITVIPTTEDSPQLLNFEVQMQECPEGFISLTDPRLARSETVWNV
                     ETKTMSITNGIQMFKAVRGERVVYSMSWEGGGKITTRIL"
     gene            complement(33962..34861)
                     /locus_tag="YOE_gp27"
                     /db_xref="GeneID:12657130"
     CDS             complement(33962..34861)
                     /locus_tag="YOE_gp27"
                     /codon_start=1
                     /product="E4Orf6"
                     /protein_id="YP_006272975.1"
                     /db_xref="GeneID:12657130"
                     /translation="MSGNSSIMTRSRTRLASSRHHPYQPPAPLPRCEETETRASLVED
                     HPVLPDCDTLSMHNVSCVRGLPCSAGFTVLQEFPVPWDMVLTPEELRVLKTCMSVCLC
                     CANIDLFSSQLIHGRERWVLHCHCQDPGSLRCMAGGAVLAIWFRRIIQGCMFNQRVMW
                     YREVVNLHMPKEIMYMGSVFWRGRHLIYIRIWYDGHVGSIVPQMSFGWSTLNYGLLNN
                     LVVLCCTYCSDLSEIRIRCCARRTRRLMLRAIGIMRRESLDPDPLSSSLTERRRQRLL
                     RGLMRHNRPIPFADYDSHRSSSR"
     misc_feature    complement(34091..34441)
                     /locus_tag="YOE_gp27"
                     /note="Adenovirus early E4 34 kDa protein conserved
                     region; Region: Adeno_E4_34; pfam04528"
                     /db_xref="CDD:282396"
     gene            complement(34764..35132)
                     /locus_tag="YOE_gp28"
                     /db_xref="GeneID:12657131"
     CDS             complement(34764..35132)
                     /locus_tag="YOE_gp28"
                     /codon_start=1
                     /product="E4Orf4"
                     /protein_id="YP_006272976.1"
                     /db_xref="GeneID:12657131"
                     /translation="MVLPVLPSPSVTETQQNCIIWLGLAHSTVADVIRAIRADGIFIT
                     QEAQEILHALREWLFYNFNTERSKRRDRRRRAVCSARTRFCFVKYENVRKQLHHDTIQ
                     NTISVIPPSSVPTAGPLTSL"
     misc_feature    complement(34809..35132)
                     /locus_tag="YOE_gp28"
                     /note="Mastadenovirus early E4 13 kDa protein; Region:
                     Adeno_E4; pfam05385"
                     /db_xref="CDD:283128"
     gene            complement(35141..35494)
                     /locus_tag="YOE_gp29"
                     /db_xref="GeneID:12657132"
     CDS             complement(35141..35494)
                     /locus_tag="YOE_gp29"
                     /codon_start=1
                     /product="E4Orf3"
                     /protein_id="YP_006272977.1"
                     /db_xref="GeneID:12657132"
                     /translation="MRVCLRMPVEGALRELFIMAGLDLPQELIRIIQGWKNENYLGMV
                     QECNMMIEELENAPAFAVLLFLDVRVEALLEATVEHLENRVTFDLAVIFHQHSGGERC
                     HLRDLHFEVLRDRLE"
     misc_feature    complement(35144..35485)
                     /locus_tag="YOE_gp29"
                     /note="Mastadenovirus E4 ORF3 protein; Region:
                     Adeno_E4_ORF3; pfam06931"
                     /db_xref="CDD:284372"
     gene            complement(35491..35880)
                     /locus_tag="YOE_gp30"
                     /db_xref="GeneID:12657134"
     CDS             complement(35491..35880)
                     /locus_tag="YOE_gp30"
                     /codon_start=1
                     /product="E4Orf2"
                     /protein_id="YP_006272978.1"
                     /db_xref="GeneID:12657134"
                     /translation="MLERTPCTYSIVVPEALNLHLDDFSFVDFLKNCLPDFLSSYLED
                     ITGSSQHAYFNLTFGNAHWGGLRFICNVACPALIPGGPMAKNFGDDMKDYIQLLLREE
                     LRDRGRDFDIPIVNLLQVNQEQNLLEL"
     gene            complement(35930..36304)
                     /locus_tag="YOE_gp31"
                     /db_xref="GeneID:12657133"
     CDS             complement(35930..36304)
                     /locus_tag="YOE_gp31"
                     /codon_start=1
                     /product="E4Orf1"
                     /protein_id="YP_006272979.1"
                     /db_xref="GeneID:12657133"
                     /translation="MDAEALYVFLEGAGALLPVQEGSNYIFYAPANFVLHPHGVALLE
                     LRLSIVVPRGFIGRFFSLTDANVPGVYASSRIIHAGHREGLSVMLFNHGDSFYEGRAG
                     DPVACLVLERVIYPPVRQASMV"
     misc_feature    complement(35951..36262)
                     /locus_tag="YOE_gp31"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cl00493"
                     /db_xref="CDD:294336"
ORIGIN      
        1 ccatcatcaa taatatacct caaacttttt gtgcgcgtta atatgcaaat gaggcgtttg
       61 aatttgggaa gggaggaagg tgattggccg agagaagggc gaccgttagg ggcggggcga
      121 gtgacgtttt gatgacgtga ccgcgaggag gagccagttt gcaagttctc gtgggaaaag
      181 tgacgtcaaa cgaggtgtgg tttgaacacg gaaatactca attttcccgc gctctctgac
      241 aggaaatgag gtgtttctag gcggatgcaa gtgaaaacgg gccattttcg cgcgaaaact
      301 gaatgaggaa gtgaaaatct gagtaatttc gcgtttatga cagggaggag tatttgccga
      361 gggccgagta gactttgacc gattacgtgg gggtttcgat taccgtgttt ttcacctaaa
      421 tttccgcgta cggtgtcaaa gtccggtgtt tttacgtagg tgtcagctga tcgccagggt
      481 atttaaacct gcgctctcca gtcaagaggc cactcttgag tgccagcgag aagagttttc
      541 tcctccgcgc cgcgagtcag atctacactt tgaaagatga ggcacctgag agacctgccc
      601 gatgagaaaa tcatcatcgc ttccgggaac gagattctgg aactggtggt aaatgccatg
      661 atgggcgacg accctccgga gccccccacc ccatttgagg caccttcgct acacgatttg
      721 tatgatctgg aggtggatgt gcccgaggac gaccccaacg aggaggcggt aaatgattta
      781 tttagcgatg ccgcgctgct agctgccgag gaggcttcga gccctagctc agacagcgac
      841 tcttcactgc atacccctag acccggcaga ggtgagaaaa agatccccga gcttaaaggg
      901 gaagagatgg acttgcgctg ctatgaggaa tgcttgcccc cgagcgatga tgaggacgag
      961 caggcgatcc agaacgcagc gagccaggga atgcaagccg ccagcgagag ttttgcgctg
     1021 gactgcccgc ctctgcccgg acacggctgt aagtcttgtg aatttcatcg cttgaatact
     1081 ggagataaag ctgtgttatg tgcactttgc tatatgagag cttacaacca ttgtgtttac
     1141 agtaagtgtg attaagttga actttagagg gaggcagaga gcagggtgac tgggcgatga
     1201 ctggtttatt tatgtatata tgttctttat ataggtcccg tctctgacgc agatgatgag
     1261 acccccacta cagagtccac ttcgtcaccc ccagaaattg gcacatctcc acctgagaat
     1321 attgttagac cagttcctgt tagagccact gggaggagag cagctgtgga atgtttggat
     1381 gacttgctac aggctgggga tgaacctttg gacttgtgta cccggaaacg ccccaggcac
     1441 taagtgccac acatgtgtgt ttacttgagg tgatgtcagt atttataggg tgtggagtgc
     1501 aataaaaaat gtgttgactt taagtgcgtg gtttatgact caggggtggg gactgtgggt
     1561 atataagcag gtgcagacct gtgtggttag ctcagagcgg catggagatt tggacgatct
     1621 tggaagatct tcacaagact agacagctgc tagagaacgc ctcgaacgga gtctctcacc
     1681 tgtggagatt ctgcttcggt ggcgacctag ctaagctagt ctatagggcc aaacaggatt
     1741 atagcgaaca atttgaggtt attttgagag agtgtccggg tctttttgac gctcttaatt
     1801 tgggtcatca gactcacttt aaccagagga ttgtaagagc ccttgatttt actactcccg
     1861 gcagatccac tgcggcagta gccttttttg cttttcttct tgacaaatgg agtcaagaaa
     1921 cccatttcag cagggattac cagctggatt tcttagcagt agctttgtgg agaacatgga
     1981 aatcccagcg cctgaatgca atctcaggct acttgccggt acagccacta gacactctga
     2041 agatcctgaa tctccaggag agtcccaggg cacgccaacg tcgccggcag cagcagcggc
     2101 agcaggagga ggatcaagaa gagaacccga gagccggcct ggaccctccg gcggaggagg
     2161 agtagctgac ctgtttcctg aactgcgccg ggtgctgact aggtcttcga gtggtcggga
     2221 gagggggatt aagcgggaga ggcatgatga gactaatcac agaactgaac tgactgtggg
     2281 tctgatgagc cgcaagcgtc cagaaacagt gtggtggcat gaggtgcagt cgactggcac
     2341 agatgaggtg tcagtgatgc atgagaggtt ttccctagaa caagtcaaga cttgttggtt
     2401 agagcctgag gatgattggg aggtagccat caggaattat gccaagctgg ctctgaggcc
     2461 agacaagaag tacaagatta ctaagctgat aaatatcaga aatgcctgct acatctcagg
     2521 gaatggggct gaagtggaga tctgtcttca ggaaagggtg gctttcagat gctgcatgat
     2581 gaatatgtac ccgggagtgg tgggcatgga tggggtcacc tttatgaaca tgaggttcag
     2641 gggagatggg tataatggca cggtctttat ggccaatacc aagctgacag ttcatggctg
     2701 ctccttcttt gggtttaata acacctgcat tgaggcctgg ggtcaggttg gtgtgagggg
     2761 ctgtagtttt tcagccaact ggatgggggt cgtgggcagg accaagagta tgctgtccgt
     2821 gaagaaatgc ttgttcgaga ggtgccacct gggggtgatg agcgagggcg aagccagaat
     2881 ccgccactgc gcctctaccg agacgggctg ttttgtgctg tgcaagggca atgctaagat
     2941 caagcataat atgatctgtg gagcctcgga cgagcgcggc taccagatgc tgacctgcgc
     3001 cggtgggaac agccatatgc tggccaccgt gcatgtggcc tcccatgccc gcaagccctg
     3061 gcccgagttc gagcacaatg tcatgaccag gtgcaatatg catctggggt cccgccgagg
     3121 catgttcatg ccctatcagt gcaacctgaa ttatgtgaag gtgctgctgg agcccgatgc
     3181 catgtccaga gtgagcctga cgggggtgtt tgacatgaat gtggaggtgt ggaagattct
     3241 gagatatgat gaatccaaga ccaggtgccg agcctgcgag tgcggaggga agcatgccag
     3301 gttccagccc gtgtgtgtgg aggtgacgga ggacctgcga cccgatcatt tggtgttgtc
     3361 ctgcaccggg acggagttcg gttccagcgg ggaagaatct gactagagtg agtagtgttc
     3421 tggggcgggg gaggacctgc atgagggcca gaatgactga aatctgtgct tttctgtgtg
     3481 ttgcagcatc atgagcggaa gcggctcctt tgagggaggg gtattcagcc cttatctgac
     3541 ggggcgtctc ccctcctggg cgggagtgcg tcagaatgtg atgggatcca cggtggacgg
     3601 ccggcccgtg cagcccgcga actcttcaac cctgacctat gcaaccctga gctcttcgtc
     3661 ggtggacgca gctgccgccg cagctgctgc atccgccgcc agcgccgtgc gcggaatggc
     3721 catgggcgcc ggctactacg gcactctggt ggccaactcg agttccacca ataatcccgc
     3781 cagcctgaac gaggagaagc tgctgctgct gatggcccag cttgaggcct tgacccagcg
     3841 cctgggcgag ctgacccagc aggtggctca gctgcaggag cagacgcggg ccgcggttgc
     3901 cacggtgaaa tccaaataaa aaatgaatca ataaataaac ggagacggtt gttgatttta
     3961 acacagagtc tgaatcttta tttgattttt cgcgcgcggt aggccctgga ccaccggtct
     4021 cgatcattga gcacccggtg gatcttttcc aggacccggt agaggtgggc ttggatgttg
     4081 aggtacatgg gcatgagccc gtcccggggg tggaggtagc tccattgcag ggcctcgtgc
     4141 tcgggggtgg tgttgtaaat cacccagtca tagcaggggc gcagggcgtg gtgttgcaca
     4201 atatctttga ggaggagact gatggccacg ggcagccctt tggtgtaggt gtttacaaat
     4261 ctgttgagct gggagggatg catgcggggg gagatgaggt gcatcttggc ctggatcttg
     4321 agattggcga tgttaccgcc cagatcccgc ctggggttca tgttgtgcag gaccaccagc
     4381 acggtgtatc cggtgcactt ggggaattta tcatgcaact tggaagggaa ggcgtgaaag
     4441 aatttggcga cgcccttgtg tccgcccagg ttttccatgc actcatccat gatgatggca
     4501 atgggcccgt gggcggcggc ctgggcaaag acgtttcggg ggtcggacac atcatagttg
     4561 tggtcctggg tgaggtcatc ataggccatt ttaatgaatt tggggcggag ggtgccggac
     4621 tgggggacaa aggtaccctc gatcccgggg gcgtagttcc cctcacagat ctgcatctcc
     4681 caggctttga gctcagaggg ggggatcatg tccacctgcg gggcgataaa gaacacggtt
     4741 tccggggcgg gggagatgag ctgggccgaa agcaagttcc ggagcagctg ggacttgccg
     4801 cagccggtgg ggccgtaaat gaccccgatg accggctgca ggtggtagtt gagggagaga
     4861 cagctgccgt cctcccggag gaggggggcc acctcgttca tcatctcgcg cacgtgcatg
     4921 ttctcgcgca ccagttccgc caggaggcgc tctcccccca gagataggag ctcctggagc
     4981 gaggcgaagt ttttcagcgg cttgagtccg tcggccatgg gcattttgga gagggtctgt
     5041 tgcaagagtt ccaagcggtc ccagagctcg gtgatgtgct ctacggcatc tcgatccagc
     5101 agacctcctc gtttcgcggg ttgggacgac tgcgggagta gggcaccaga cgatgggcgt
     5161 ccagcgcagc cagggtccgg tccttccagg gccgcagcgt ccgcgtcagg gtggtctccg
     5221 tcacggtgaa ggggtgcgcg ccgggctggg cgcttgcgag ggtgcgcttc aggctcatcc
     5281 ggctggtcga aaaccgctcc cgatcggcgc cctgcgcgtc ggccaggtag caattgacca
     5341 tgagttcgta gttgagcgcc tcggccgcgt ggcctttggc gcggagctta cctttggaag
     5401 tctgcccgca ggcgggacag aggagggact tgagggcgta gagcttgggg gcgaggaaga
     5461 cggaatcggg ggcgtaggcg tccgcgccgc agtgggcgca gacggtctcg cactccacga
     5521 gccaggtgag gtcgggctgg tcggggtcaa aaaccagttt cccgccgttc tttttgatgc
     5581 gtttcttacc tttggtctcc atgagctcgt gtccccgctg ggtgacaaag aggctgtccg
     5641 tgtccccgta gaccgacttt atgggccggt cctcgagcgg tgtgccgcgg tcctcctcgt
     5701 agaggaaccc cgcccactcc gagacgaaag cccgggtcca ggccagcacg aaggaggcca
     5761 cgtgggacgg gtagcggtcg ttgtccacca gcgggtccac tttttccagg gtatgcaaac
     5821 acatgtcccc ctcgtccaca tccaggaagg tgattggctt gtaagtgtag gccacgtgac
     5881 cgggggtccc ggccgggggg gtataaaagg gggcgggccc ctgctcgtcc tcactgtctt
     5941 ccggatcgct gtccaggagc gccagctgtt ggggtaggta ttccctctcg aaggcgggca
     6001 tgacctcggc actcaggttg tcagtttcta gaaacgagga ggatttgata ttgacggtgc
     6061 cagcggagat gcctttcaag agcccctcgt ccatctggtc agaaaagacg atttttttgt
     6121 tgtcgagctt ggtggcgaag gagccgtaga gggcgttgga aaggagcttg gcgatggagc
     6181 gcatggtctg gtttttttcc ttgtcggcgc gctccttggc cgcgatgttg agctgcacgt
     6241 actcgcgcgc cacgcacttc cattcgggga agacggtggt catctcgtcg ggcacgattc
     6301 tgacctgcca acctcgatta tgcagggtga tgaggtccac actggtggcc acctcgccgc
     6361 gcaggggctc gttggtccag cagaggcggc cgcccttgcg cgagcagaag gggggcagag
     6421 ggtccagcat gacctcgtcg ggggggtcgg catcgatggt gaagatgccg ggcaggagat
     6481 cggggtcgaa gtagctgatg gaagtggcca gatcgtccag ggaagcttgc cattcgcgca
     6541 cggccagcgc gcgctcgtag ggactgaggg gcgtgcccca gggcatgggg tgggtgagcg
     6601 cggaggcgta catgccgcag atgtcgtaga cgtagagggg ctcctcgagg atgccgatgt
     6661 aggtggggta gcagcgcccc ccgcggatgc tggcgcgcac gtagtcatac agctcgtgcg
     6721 agggcgcgag gagccccggg cccaggttgg tgcgactggg cttttcggcg cggtagacga
     6781 tctggcgaaa gatggcatgc gagttggagg agatggtggg cctttggaag atgttgaagt
     6841 gggcgtgggg gaggccgacc gagtcgcgga tgaagtgggc gtaggagtct tgcagtttgg
     6901 cgacgagctc ggcggtgacg aggacgtcca gagcgcagta gtcgagggtc tcctggatga
     6961 tgtcatactt gagctggccc ttttgtttcc acagctcgcg gttgagaagg aactcttcgc
     7021 ggtccttcca gtactcttcg agggggaacc cgtcctgatc tgcacggtaa gagcctagca
     7081 tgtagaactg gttgacggcc ttgtaggcgc agcagccctt ctccacgggg agggcgtagg
     7141 cctgggcggc cttgcgcagg gaggtgtgcg tgagggcgaa ggtgtccctg accatgacct
     7201 tgaggaactg gtgcttgaaa tcgatatcgt cgcagccccc ctgctcccag agctggaagt
     7261 ccgtgcgctt cttgtaggcg gggttgggca aagcgaaagt aacatcgttg aaaaggatct
     7321 tgcccgcgcg gggcataaag ttgcgagtga tgcggaaagg ctggggcacc tcggcccggt
     7381 tgttgatgac ctgggcggcg agcacgatct cgtcgaaacc gttgatgttg tggcccacga
     7441 tgtagagttc cacgaatcgc gggcggccct tgacgtgggg cagcttcttg agctcctcgt
     7501 aggtgagctc gtcggggtcg ctgagaccgt gctgctcgag cgcccagtcg gcgagatggg
     7561 ggttggcgcg gaggaaggaa gtccagagat ccacggccag ggcggtttgc agacggtccc
     7621 ggtactgacg gaactgctgc ccgacggcca ttttttcggg ggtgacgcag tagaaggtgc
     7681 gggggtcccc gtgccagcgg tcccatttga gctggagggc gagatcgagg gcgagctcga
     7741 cgaggcggtc gtcccctgag agtttcatga ccagcatgaa ggggacgagc tgcttgccga
     7801 aggaccccat ccaggtgtag gtttccacat cgtaggtgag gaagagcctt tcggtgcgag
     7861 gatgcgagcc gatggggaag aactggatct cctgccacca attggaggaa tggctgttga
     7921 tgtgatggaa gtagaaatgc cgacggcgcg ccgaacactc gtgcttgtgt ttatacaagc
     7981 ggccacagtg ctcgcaacgc tgcacgggat gcacgtgctg cacgagctgt acctgagttc
     8041 ctttgacgag gaatttcagt gggaagtgga gtcgtggcgc ctgcatctcg tgctgtacta
     8101 cgtcgtggtg gtcggcctgg ccctcttctg cctcgatggt ggtcatgctg acgagcccgc
     8161 gcgggaggca ggtccagacc tcggcgcgag cgggtcggag agcgaggacg agggcgcgca
     8221 ggccggagct gtccagggtc ctgagacgct gcggagtcag gtcagtgggc agcggcggcg
     8281 cgcggttgac ttgcaggagt ttttccaggg cgcgcgggag gtccagatgg tacttgatct
     8341 ccaccgcgcc gttggtggcg acgtcgatgg cttgcagggt cccgtgcccc tggggtgtga
     8401 ccaccgtccc ccgtttcttc ttgggcggct ggggcgacgg gggcggtgcc tcttccatgg
     8461 ttagaagcgg cggcgaggac gcgcgccggg cggcagaggc ggctcggggc ccggaggcag
     8521 gggcggcagg ggcacgtcgg cgccgcgcgc gggtaggttc tggtactgcg cccggagaag
     8581 actggcgtga gcgacgacgc gacggttgac gtcctggatc tgacgcctct gggtgaaggc
     8641 cacgggaccc gtgagtttga acctgaaaga gagttcgaca gaatcaatct cggtatcgtt
     8701 gacggcggcc tgccgcagga tctcttgcac gtcgcccgag ttgtcctggt aggcgatctc
     8761 ggtcatgaac tgctcgatct cctcctcctg aaggtctccg cgaccggcgc gctccacggt
     8821 ggccgcgagg tcgttggaga tgcggcccat gagctgcgag aaggcgttca tgcccgcctc
     8881 gttccagacg cggctgtaga ccacgacgcc ctcgggatcg cgggcgcgca tgaccacctg
     8941 ggcgaggttg agctccacgt ggcgcgtgaa gaccgcgtag ttgcagaggc gctggtagag
     9001 gtagttgagc gtggtggcga tgtgctcggt gacgaagaaa tacatgatcc agcggcggag
     9061 cggcatctcg ctgacgtcgc ccagcgcctc caagcgttcc atggcctcgt aaaagtccac
     9121 ggcgaagttg aaaaactggg agttgcgcgc cgagacggtc aactcctcct ccagaagacg
     9181 gatgagctcg gcgatggtgg cgcgcacctc gcgctcgaag gcccccggga gttcctccac
     9241 ttcctcctct tcttcctcct ccactaacat ctcttctact tcctcctcag gcggtggtgg
     9301 tggcggggga gggggcctgc gtcgccggcg gcgcacgggc agacggtcga tgaagcgctc
     9361 gatggtctcg ccgcgccggc gtcgcatggt ctcggtgacg gcgcgcccgt cctcgcgggg
     9421 ccgcagcgtg aagacgccgc cgcgcatctc caggtggccg ggggggtccc cgttgggcag
     9481 ggagagggcg ctgacgatgc atcttatcaa ttgccccgta gggactccgc gcaaggacct
     9541 gagcgtctcg agatccacgg gatctgaaaa ccgttgaacg aaggcttcga gccagtcgca
     9601 gtcgcaaggt aggctgagca cggtttcttc tgccgggtca tgttggggag cggggcgggc
     9661 gatgctgctg gtgatgaagt tgaaataggc ggttctgaga cggcggatgg tggcgaggag
     9721 caccaggtct ttgggcccgg cttgctggat gcgcagacgg tcggccatgc cccaggcgtg
     9781 gtcctgacac ctggccaggt ccttgtagta gtcctgcatg agccgctcca cgggcacctc
     9841 ctcctcgccc gcgcggccgt gcatgcgcgt gagcccgaag ccgcgctggg gctggacgag
     9901 cgccaggtcg gcgacgacgc gctcggcgag gatggcctgc tggatctggg tgagggtggt
     9961 ctggaagtcg tcaaagtcga cgaagcggtg gtaggctccg gtgttgatgg tgtaggagca
    10021 gttggccatg acggaccagt tgacggtctg gtggcccgga cgcacgagct cgtggtactt
    10081 gaggcgcgag taggcgcgcg tgtcgaagat gtagtcgttg caggtgcgca ccaggtactg
    10141 gtagccgatg aggaagtgcg gcggcggctg gcggtagagc ggccatcgct cggtggcggg
    10201 ggcgccgggc gcgaggtcct cgagcatggt gcggtggtag ccgtagatgt acctggacat
    10261 ccaggtgatg ccggcggcgg tggtggaggc gcgcgggaac tcgcggacgc ggttccagat
    10321 gttgcgcagc ggcaggaagt agttcatggt gggcacggtc tggcccgtga ggcgcgcgca
    10381 gtcgtggatg ctctatacgg gcaaaaacga aagcggtcag cggctcgact ccgtggcctg
    10441 gaggctaagc gaacgggttg ggctgcgcgt gtaccccggt tcgaatctcg aatcaggctg
    10501 gagccgcagc taacgtggta ctggcactcc cgtctcgacc caagcctgca ccaaccctcc
    10561 aggatacgga ggcgggtcgt tttgcaactt tttttggagg ccggaaatga aactagtaag
    10621 cgcggaaagc ggccgaccgc gatggctcgc tgccgtagtc tggagaagaa tcgccagggt
    10681 tgcgttgcgg tgtgccccgg ttcgaggccg gccggattcc gcggctaacg agggcgtggc
    10741 tgccccgtcg tttccaagac cccatagcca gccgacttct ccagttacgg agcgagcccc
    10801 tcttttgttt tgtttgtttt tgccagatgc atcccgtact gcggcagatg cgcccccacc
    10861 accctccacc gcaacaacag ccccctcctc cacagccggc gcttctgccc ccgccccagc
    10921 agcagcagca acttccagcc acgaccgccg cggccgccgt gagcggggct ggacagactt
    10981 ctcagtatga tcacctggcc ttggaagagg gcgaggggct ggcgcgcctg ggggcgtcgt
    11041 cgccggagcg gcacccgcgc gtgcagatga aaagggacgc tcgcgaggcc tacgtgccca
    11101 agcagaacct gttcagagac aggagcggcg aggagcccga ggagatgcgc gcggcccggt
    11161 tccacgcggg gcgggagctg cggcgcggcc tggaccgaaa gagggtgctg agggacgagg
    11221 atttcgaggc ggacgagctg acggggatca gccccgcgcg cgcgcacgtg gccgcggcca
    11281 acctggtcac ggcgtacgag cagaccgtga aggaggagag caacttccaa aaatccttca
    11341 acaaccacgt gcgcaccctg atcgcgcgcg aggaggtgac cctgggcctg atgcacctgt
    11401 gggacctgct ggaggccatc gtgcagaacc ccaccagcaa gccgctgacg gcgcagctgt
    11461 tcctggtggt gcagcatagt cgggacaacg aggcgttcag ggaggcgctg ctgaatatca
    11521 ccgagcccga gggccgctgg ctcctggacc tggtgaacat tctgcagagc atcgtggtgc
    11581 aggagcgcgg gctgccgctg tccgagaagc tggcggccat caacttctcg gtgctgagtc
    11641 tgggcaagta ctacgctagg aagatctaca agaccccgta cgtgcccata gacaaggagg
    11701 tgaagatcga cgggttttac atgcgcatga ccctgaaagt gctgaccctg agcgacgatc
    11761 tgggggtgta ccgcaacgac aggatgcacc gcgcggtgag cgccagcagg cggcgcgagc
    11821 tgagcgacca ggagctgatg cacagcctgc agcgggccct gaccggggcc gggaccgagg
    11881 gggagagcta ctttgacatg ggcgcggacc tgcactggca gcccagccgc cgggccttgg
    11941 aggcggcagg cggtcccccc tacatagaag aggtggacga tgaggtggac gaggagggcg
    12001 agtacctgga agactgatgg cgcgaccgta tttttgctag atgcaacaac agccacctcc
    12061 tgatcccgcg atgcgggcgg cgctgcagag ccagccgtcc ggcattaact cctcggacga
    12121 ttggacccag gccatgcaac gcatcatggc gctgacgacc cgcaaccccg aagcctttag
    12181 acagcagccc caggccaacc ggctctcggc catcctggag gccgtggtgc cctcgcgctc
    12241 caaccccacg cacgagaagg tcctggccat cgtgaacgcg ctggtggaga acaaggccat
    12301 ccgcggcgac gaggccggcc tggtgtacaa cgcgctgctg gagcgcgtgg cccgctacaa
    12361 cagcaccaac gtgcagacca acctggaccg catggtgacc gacgtgcgcg aggccgtggc
    12421 ccagcgcgag cggttccacc gcgagtccaa cctgggatcc atggtggcgc tgaacgcctt
    12481 cctcagcacc cagcccgcca acgtgccccg gggccaggag gactacacca acttcatcag
    12541 cgccctgcgc ctgatggtga ccgaggtgcc ccagagcgag gtgtaccagt ccgggccgga
    12601 ctacttcttc cagaccagtc gccagggctt gcagaccgtg aacctgagcc aggcgttcaa
    12661 gaacttgcag ggcctgtggg gcgtgcaggc cccggtcggg gaccgcgcga cggtgtcgag
    12721 cctgctgacg ccgaactcgc gcctgctgct gctgctggtg gcccccttca cggacagcgg
    12781 cagcatcaac cgcaactcgt acctgggcta cctgattaac ctgtaccgcg aggccatcgg
    12841 ccaggcgcac gtggacgagc agacctacca ggagatcacc cacgtgagcc gcgccctggg
    12901 ccaggacgac ccgggcaatc tggaagccac cctgaacttt ttgctgacca accggtcgca
    12961 gaagatcccg ccccagtaca cgctcagcgc cgaggaggag cgcatcctgc gatacgtgca
    13021 gcagagcgtg ggcctgttcc tgatgcagga gggggccacc cccagcgccg cgctcgacat
    13081 gaccgcgcgc aacatggagc ccagcatgta cgccagcaac cgcccgttca tcaataaact
    13141 gatggactac ttgcatcggg cggccgccat gaactctgac tatttcacca acgccatcct
    13201 gaatccccac tggctcccgc cgccggggtt ctacacgggc gagtacgaca tgcccgaccc
    13261 caatgacggg ttcctgtggg acgatgtgga cagcagcgtg ttctcccccc gaccgggtgc
    13321 taacgagcgc cccttgtgga agaaggaagg cagcgaccga cgcccgtcct cggcgctgtc
    13381 cggccgcgag ggtgctgccg cggcggtgcc cgaggccgcc agtcctttcc cgagcttgcc
    13441 cttctcgctg aacagtattc gcagcagcga gctgggcagg atcacgcgcc cgcgcttgct
    13501 gggcgaggag gagtacttga atgactcgct gttgagaccc gagcgggaga agaacttccc
    13561 caataacggg atagagagcc tggtggacaa gatgagccgc tggaagacgt atgcgcagga
    13621 gcacagggac gatccgtcgc agggggccac gagccggggc agcgccgccc gtaaacgccg
    13681 gtggcacgac aggcagcggg gactgatgtg ggacgatgag gattccgccg acgacagcag
    13741 cgtgttggac ttgggtggga gtggtaaccc gttcgctcac ctgcgccccc gcatcgggcg
    13801 catgatgtaa gagaaaccga aaataaatga tactcaccaa ggccatggcg accagcgtgc
    13861 gttcgtttct tctctgttgt tgtatctagt atgatgaggc gtgcgtaccc ggagggtcct
    13921 cctccctcgt acgagagcgt gatgcagcag gcgatggcgg cggcggcggc gatgcagccc
    13981 ccgctggagg ctccttacgt gcccccgcgg tacctggcgc ctacggaggg gcggaacagc
    14041 attcgttact cggagctggc acccttgtac gataccaccc ggttgtacct ggtggacaac
    14101 aagtcggcgg acatcgcctc gctgaactac cagaacgacc acagcaactt cctgaccacc
    14161 gtggtgcaga acaatgactt cacccccacg gaggccagca cccagaccat caactttgac
    14221 gagcgctcgc ggtggggcgg tcagctgaaa accatcatgc acaccaacat gcccaacgtg
    14281 aacgagttca tgtacagcaa caagttcaag gcgcgggtga tggtctcccg caagaccccc
    14341 aacggggtga cagtgacaga tggtagtcag gatatcttgg agtatgaatg ggtggagttt
    14401 gagctgcccg aaggcaactt ctcggtgacc atgaccatcg acctgatgaa caacgccatc
    14461 atcgacaatt acttggcggt ggggcggcag aacggggtcc tggagagcga tatcggcgtg
    14521 aagttcgaca ctaggaactt caggctgggc tgggaccccg tgaccgagct ggtcatgccc
    14581 ggggtgtaca ccaacgaggc cttccacccc gatattgtct tgctgcccgg ctgcggggtg
    14641 gacttcaccg agagccgcct cagcaacctg ctgggcattc gcaagaggca gcccttccag
    14701 gagggcttcc agatcatgta cgaggatctg gaggggggca acatccccgc gctcctggat
    14761 gtcgacgcct atgagaaaag caaggaggag agcgccgccg cggcgactgc agctgtagcc
    14821 accgcctcta ccgaggtcag gggcgataat tttgccagcc ctgcagcagt ggcagcggcc
    14881 gaggcggctg aaaccgaaag taagatagtc attcagccgg tggagaagga tagcaaggac
    14941 aggagctaca acgtgctgcc ggacaagata aacaccgcct accgcagctg gtacctggcc
    15001 tacaactatg gcgaccccga gaagggcgtg cgctcctgga cgctgctcac cacctcggac
    15061 gtcacctgcg gcgtggagca agtctactgg tcgctgcccg acatgatgca agacccggtc
    15121 accttccgct ccacgcgtca agttagcaac tacccggtgg tgggcgccga gctcctgccc
    15181 gtctactcca agagcttctt caacgagcag gccgtctact cgcagcagct gcgcgccttc
    15241 acctcgctca cgcacgtctt caaccgcttc cccgagaacc agatcctcgt ccgcccgccc
    15301 gcgcccacca ttaccaccgt cagtgaaaac gttcctgctc tcacagatca cgggaccctg
    15361 ccgctgcgca gcagtatccg gggagtccag cgcgtgaccg ttactgacgc cagacgccgc
    15421 acctgcccct acgtctacaa ggccctgggc atagtcgcgc cgcgcgtcct ctcgagccgc
    15481 accttctaaa aaatgtccat tctcatctcg cccagtaata acaccggttg gggcctgcgc
    15541 gcgcccagca agatgtacgg aggcgctcgc caacgctcca cgcaacaccc cgtgcgcgtg
    15601 cgcgggcact tccgcgctcc ctggggcgcc ctcaagggcc gcgtgcggtc gcgcaccacc
    15661 gtcgacgacg tgatcgacca ggtggtggcc gacgcgcgca actacacccc cgccgccgcg
    15721 cccgtctcca ccgtggacgc cgtcatcgac agcgtggtgg ccgacgcgcg ccggtacgcc
    15781 cgcgccaaga gccggcggcg gcgcatcgcc cggcggcacc ggagcacccc cgccatgcgc
    15841 gcggcgcgag ccttgctgcg cagggccagg cgcacgggac gcagggccat gctcagggcg
    15901 gccagacgcg cggcttcagg cgccagcgcc ggcaggaccc ggagacgcgc ggccacggcg
    15961 gcggcagcgg ccatcgccag catgtcccgc ccgcggcgag ggaacgtgta ctgggtgcgc
    16021 gacgccgcca ccggtgtgcg cgtgcccgtg cgcacccgcc cccctcgcac ttgaagatgt
    16081 tcacttcgcg atgttgatgt gtcccagcgg cgaggaggat gtccaagcgc aaattcaagg
    16141 aagagatgct ccaggtcatc gcgcctgaga tctacggccc cgcggtggtg aaggaggaaa
    16201 gaaagccccg caaaatcaag cgggtcaaaa aggacaaaaa ggaagaagat gacgatctgg
    16261 tggagtttgt gcgcgagttc gccccccggc ggcgcgtgca gtggcgcggg cggaaagtgc
    16321 acccggtgct gagacccggc accaccgtgg tcttcacgcc cggcgagcgc tccggcagcg
    16381 cttccaagcg ctcctacgac gaggtgtacg gggacgagga catcctcgag caggcggccg
    16441 agcgcctggg cgagtttgct tacggcaagc gcagccgccc cgccctgaag gaagaggcgg
    16501 tgtccatccc gctggaccac ggcaacccca cgccgagcct caagcccgtg accctgcagc
    16561 aggtgctgcc gagcgcagcg ccgcgccggg ggttcaagcg cgagggcgag gatctgtacc
    16621 ccaccatgca gctgatggtg cccaagcgcc agaagctgga agacgtgctg gagaccatga
    16681 aggtggaccc ggacgtgcag cccgaggtca aggtgcggcc catcaagcag gtggccccgg
    16741 gcctgggcgt gcagaccgtg gacatcaaga tccccacgga gcccatggaa acgcagaccg
    16801 agcccatgat caagcccagc accagcacca tggaggtgca gacggatccc tggatgccat
    16861 cggctcctag ccgaagaccc cggcgcaagt acggcgcggc cagcctgctg atgcccaact
    16921 acgcgctgca tccttccatc atccccacgc cgggctaccg cggcacgcgc ttctaccgcg
    16981 gtcatacaac cagccgccgc cgcaagacca ccacccgccg ccgccgtcgc cgcacagccg
    17041 ctgcatctac ccctgccgcc ctggtgcgga gagtgtaccg ccgcggccgc gcgcctctga
    17101 ccctaccgcg cgcgcgctac cacccgagca tcgccattta aactttcgcc tgctttgcag
    17161 atggccctca catgccgcct ccgcgttccc attacgggct accgaggaag aaaaccgcgc
    17221 cgtagaaggc tggcggggaa cgggatgcgt cgccaccacc atcggcggcg gcgcgccatc
    17281 agcaagcggt tggggggagg cttcctgccc gcgctgatcc ccatcatcgc cgcggcgatc
    17341 ggggcgatcc ccggcattgc ttccgtggcg gtgcaggcct ctcagcgcca ctgagacact
    17401 tggaaaacat cttgtaataa accaatggac tctgacgctc ctggtcctgt gatgtgtttt
    17461 cgtagacaga tggaagacat caatttttcg tccctggctc cgcgacacgg cacgcggccg
    17521 ttcatgggca cctggagcga catcggcacc agccaactga acgggggcgc cttcaattgg
    17581 agcagtctct ggagcgggct taagaatttc gggtccacgc ttaaaaccta tggcagcaag
    17641 gcgtggaaca gcaccacagg gcaggcgctg agggataagc tgaaagagca gaacttccag
    17701 cagaaggtgg tcgatgggct cgcctcgggc atcaacgggg tggtggacct ggccaaccag
    17761 gccgtgcagc ggcagatcaa cagccgcctg gacccggtgc cgcccgccgg ctccgtggag
    17821 atgccgcagg tggaggagga gctgcctccc ctggacaagc ggggcgagaa gcgaccccgc
    17881 cccgacgcgg aggagacgct gctgacgcac acggacgagc cgcccccgta cgaggaggcg
    17941 gtgaaactgg gtctgcccac cacgcggccc atcgcgcccc tggccaccgg ggtgctgaaa
    18001 cccgaaagta ataagcccgc gaccctggac ttgcctcctc ccgcttcccg cccctctaca
    18061 gtggctaagc ccctgccgcc ggtggccgtg gcccgcgcgc gacccggggg ctccgcccgc
    18121 cctcatgcga actggcagag cactctgaac agcatcgtgg gtctgggagt gcagagtgtg
    18181 aagcgccgcc gctgctatta aacctaccgt agcgcttaac ttgcttgtct gtgtgtgtat
    18241 gtattatgtc gccgctgtcc gccagaagga ggagtgaaga ggcgcgtcgc cgagttgcaa
    18301 gatggccacc ccatcgatgc tgccccagtg ggcgtacatg cacatcgccg gacaggacgc
    18361 ttcggagtac ctgagtccgg gtctggtgca gttcgcccgc gccacagaca cctacttcag
    18421 tctggggaac aagtttagga accccacggt ggcgcccacg cacgatgtga ccaccgaccg
    18481 cagccagcgg ctgacgctgc gcttcgtgcc cgtggaccgc gaggacaaca cctactcgta
    18541 caaagtgcgc tacacgctgg ccgtgggcga caaccgcgtg ctggacatgg ccagcaccta
    18601 ctttgacatc cgcggcgtgc tggatcgggg ccctagcttc aaaccctact ccggcaccgc
    18661 ctacaacagc ctggctccca agggagcgcc caattccagc cagtgggagc aaaaaaaggc
    18721 aggcaatggt gacactatgg aaacacacac atttggtgtg gccccaatgg gcggtgagaa
    18781 tattacaatc gacggattac aaattggaac tgacgctaca gctgatcagg ataaaccaat
    18841 ttatgctgac aaaacattcc agcctgaacc tcaagtagga gaagaaaatt ggcaagaaac
    18901 tgaaagcttt tatggcggta gggctcttaa aaaagacaca agcatgaaac cttgctatgg
    18961 ctcctatgct agacccacca atgtaaaggg aggtcaagct aaacttaaag ttggagctga
    19021 tggagttcct accaaagaat ttgacataga cctggctttc tttgatactc ccggtggcac
    19081 agtgaatgga caagatgagt ataaagcaga cattgtcatg tataccgaaa acacgtatct
    19141 ggaaactcca gacacgcatg tggtatacaa accaggcaag gatgatgcaa gttctgaaat
    19201 taacctggtt cagcagtcca tgcccaatag acccaactat attgggttca gagacaactt
    19261 tattgggctc atgtattaca acagtactgg caatatgggg gtgctggctg gtcaggcctc
    19321 acagctgaat gctgtggtcg acttgcaaga cagaaacacc gagctgtcat accagctctt
    19381 gcttgactct ttgggtgaca gaacccggta tttcagtatg tggaatcagg cggtggacag
    19441 ttatgatcct gatgtgcgca ttattgaaaa ccatggtgtg gaagacgaac ttcccaacta
    19501 ttgcttcccc ctggatgggt ctggcactaa tgccgcttac caaggtgtga aagtaaaaaa
    19561 tggtaacgat ggtgatgttg agagcgaatg ggaaaatgat gatactgtcg cagctcgaaa
    19621 tcaattatgc aagggcaaca tttttgccat ggaaattaac ctccaagcca acctgtggag
    19681 aagtttcctc tactcgaacg tggccctgta cctgcccgac tcttacaagt acacgccagc
    19741 caacatcacc ctgcccacca acaccaacac ttatgattac atgaacggga gagtggtgcc
    19801 tccctcgctg gtggacgcct acatcaacat cggggcgcgc tggtcgctgg accccatgga
    19861 caacgtcaat cccttcaacc accaccgcaa cgcgggcctg cgctaccgct ccatgctcct
    19921 gggcaacggg cgctacgtgc ccttccacat ccaggtgccc cagaaatttt tcgccatcaa
    19981 gagcctcctg ctcctgcccg ggtcctacac ctacgagtgg aacttccgca aggacgtcaa
    20041 catgatcctg cagagctccc tcggcaacga cctgcgcacg gacggggcct ccatctcctt
    20101 caccagcatc aacctctacg ccaccttctt ccccatggcg cacaacacgg cctccacgct
    20161 cgaggccatg ctgcgcaacg acaccaacga ccagtccttc aacgactacc tctcggcggc
    20221 caacatgctc taccccatcc cggccaacgc caccaacgtg cccatctcca tcccctcgcg
    20281 caactgggcc gccttccgcg gctggtcctt cacgcgcctc aagaccaagg agacgccctc
    20341 gctgggctcc gggttcgacc cctacttcgt ctactcgggc tccatcccct acctcgacgg
    20401 caccttctac ctcaaccaca ccttcaagaa ggtctccatc accttcgact cctccgtcag
    20461 ctggcccggc aacgaccggc tcctgacgcc caacgagttc gaaatcaagc gcaccgtcga
    20521 cggcgaggga tacaacgtgg cccagtgcaa catgaccaag gactggttcc tggtccagat
    20581 gctggcccac tacaacatcg gctaccaggg cttctacgtg cccgagggct acaaggaccg
    20641 catgtactcc ttcttccgca acttccagcc catgagccgc caggtggtgg acgaggtcaa
    20701 ctacaaggac taccaggccg tcaccctggc ctaccagcac aacaactcgg gcttcgtcgg
    20761 ctacctcgcg cccaccatgc gccagggcca gccctacccc gccaactacc cgtacccgct
    20821 catcggcaag agcgccgtca ccagcgtcac ccagaaaaag ttcctctgcg acagggtcat
    20881 gtggcgcatc cccttctcca gcaacttcat gtccatgggc gcgctcaccg acctcggcca
    20941 gaacatgctc tatgccaact ccgcccacgc gctagacatg aatttcgaag tcgaccccat
    21001 ggatgagtcc acccttctct atgttgtctt cgaagtcttc gacgtcgtcc gagtgcacca
    21061 gccccaccgc ggcgtcatcg aggccgtcta cctgcgcacc cccttctcgg ccggtaacgc
    21121 caccacctaa attgctactt gcatgatggc tgagcccaca ggctccggcg agcaggagct
    21181 cagggccatc atccgcgacc tgggctgcgg gccctacttc ctgggcacct tcgataagcg
    21241 cttcccggga ttcatggccc cgcacaagct ggcctgcgcc atcgtcaaca cggccggccg
    21301 cgagaccggg ggcgagcact ggctggcctt cgcctggaac ccgcgctcga acacctgcta
    21361 cctcttcgac cccttcgggt tctcggacga gcgcctcaag cagatctacc agttcgagta
    21421 cgagggcctg ctgcgccgta gcgccctggc caccgaggac cgctgcgtca ccctggaaaa
    21481 gtccacccag accgtgcagg gtccgcgctc ggccgcctgc gggctcttct gctgcatgtt
    21541 cctgcacgcc ttcgtgcact ggcccgaccg ccccatggac aagaacccca ccatgaactt
    21601 gctgacgggg gtgcccaacg gcatgctcca gtcgccccag gtggaaccca ccctgcgccg
    21661 caaccaggag gcgctctacc gcttcctcaa ctcccactcc gcctactttc gctcccaccg
    21721 cgcgcgcatc gagaaggcca ccgccttcga ccgcatgaac aatcaagaca tgtaaaccgt
    21781 gtgtgtatgt ttaaaatatc ttttaataaa cagcacttta atgttacaca tgcatctgag
    21841 atgattttat tttagaaatc gaaagggttc tgccgggtct cggcatggcc cgcgggcagg
    21901 gacacgttgc ggaactggta cttggccagc cacttgaact cggggatcag cagtttgggc
    21961 agcggggtgt cggggaagga gtcggtccac agcttccgcg tcagctgcag ggcgcccagc
    22021 aggtcgggcg cggagatctt gaaatcgcag ttgggacccg cgttctgcgc gcgagagttg
    22081 cggtacacgg ggttgcagca ctggaacacc atcagggccg ggtgcttcac gctcgccagc
    22141 accgccgcgt cggtgatgct ctccacgtcg aggtcctcgg cgttggccat cccgaagggg
    22201 gtcatcttgc aggtctgcct tcccatggtg ggcacgcacc cgggcttgtg gttgcaatcg
    22261 cagtgcaggg ggatcagcat catctgggcc tggtcggcgt tcatccccgg gtacatggcc
    22321 ttcatgaaag cctccaattg cctgaacgcc tgctgggcct tggctccctc ggtgaagaag
    22381 accccgcagg acttgctaga gaactggttg gtggcacagc cggcatcgtg cacgcagcag
    22441 cgcgcgtcgt tgttggccag ctgcaccacg ctgcgccccc agcggttctg ggtgatcttg
    22501 gcccggtcgg ggttctcctt cagcgcgcgc tgcccgttct cgctcgccac atccatctcg
    22561 atcatgtgct ccttctggat catggtggtc ccgtgcaggc accgcagttt gccctcggcc
    22621 tcggtgcacc cgtgcagcca cagcgcgcac ccggtgcact cccagttctt gtgggcgatc
    22681 tgggaatgcg cgtgcacgaa cccttgcagg aagcggccca tcatggtcgt cagggtcttg
    22741 ttgctagtga aggtcaacgg gatgccgcgg tgctcctcgt tgatgtacag gtggcagatg
    22801 cggcggtaca cctcgccctg ctcgggcatc agttggaagt tggctttcag gtcggtctcc
    22861 acgcggtagc ggtccatcag catagtcatg atttccatgc ccttctccca ggccgagacg
    22921 atgggcaggc tcatagggtt cttcaccatc atcttagcac tagcagccgc ggccaggggg
    22981 tcgctctcat ccagggtctc aaagctccgc ttgccgtcct tctcggtgat ccgcaccggg
    23041 gggtagctga agcccacggc cgccagctcc tcctcggcct gtctttcgtc ctcgctgtcc
    23101 tggctgacgt cctgcatgac cacatgcttg gtcttgcggg gtttcttctt gggcggcagt
    23161 ggcggcggag atgcttgtgg cgagggggag cgcgagttct cgctcaccac tactatctct
    23221 tcctcttctt ggtccgaggc cacgcggcgg taggtatgtc tcttcggggg cagaggcgga
    23281 ggcgacgggc tctcgccgcc gcgacttggc ggatggctgg cagagcccct tccgcgttcg
    23341 ggggtgcgct cccggcggcg ctctgactga cttcctccgc ggccggccat tgtgttctcc
    23401 tagggaggaa caacaagcat ggagactcag ccatcgccaa cctcgccatc tgcccccacc
    23461 gccggcgacg agaagcagca gcagcagaat gaaagcttaa ccgccccgcc gcccagcccc
    23521 gcctccgacg cagccgcggt cccagacatg caagagatgg aggaatccat cgagattgac
    23581 ctgggctatg tgacgcccgc ggagcatgag gaggagctgg cagtgcgctt tcaatcgtca
    23641 agccaggaag ataaagaaca gccagagcag gaagcagaga acgagcagag tcaggctggg
    23701 ctcgagcatg gcgactacct ccacctgagc ggggaggagg acgcgctcat caagcatctg
    23761 gcccggcagg ccaccatcgt caaggacgcg ctgctcgacc gcaccgaggt gcccctcagc
    23821 gtggaggagc tcagccgcgc ctacgagctc aacctcttct cgccgcgcgt gccccccaag
    23881 cgccagccca acggcacctg cgagcccaac ccccgcctca acttctaccc ggtcttcgcg
    23941 gtgcccgagg ccctggccac ctaccacatc tttttcaaga accaaaagat ccccgtctcc
    24001 tgccgcgcca accgcacccg cgccgacgcc ctcttcaacc tgggtcccgg cgcccgccta
    24061 cctgatatcg cctccttgga agaggttccc aagatcttcg agggtctggg cagcgacgag
    24121 actcgggccg cgaacgctct gcaaggagaa ggaggaggag agcatgagca ccacagcgcc
    24181 ctggtcgagt tggaaggcga caacgcgcgg ctggcggtgc tcaaacgcac ggtcgagctg
    24241 acccatttcg cctacccggc tctgaacctg cccccgaaag tcatgagcgc ggtcatggac
    24301 caggtgctca tcaagcgcgc gtcgcccatc tccgaggacg agggcatgca agactccgag
    24361 gagggcaagc ccgtggtcag cgacgagcag ctggcccggt ggctgggtcc taatgctacc
    24421 cctcaaagtt tggaagagcg gcgcaagctc atgatggccg tggtcctggt gaccgtggag
    24481 ctggagtgcc tgcgccgctt cttcgccgac gcggagaccc tgcgcaaggt cgaggagaac
    24541 ctgcactacc tcttcaggca cgggttcgtg cgccaggcct gcaagatctc caacgtggag
    24601 ctgaccaacc tggtctccta catgggcatc ttgcacgaga accgcctggg gcagaacgtg
    24661 ctgcacacca ccctgcgcgg ggaggcccgc cgcgactaca tccgcgactg cgtctacctc
    24721 tacctctgcc acacctggca gacgggcatg ggcgtgtggc agcagtgtct ggaggagcag
    24781 aacctgaaag agctctgcaa gctcctgcaa aagaacctca agggtctgtg gaccgggttc
    24841 gacgagcgga ccaccgcctc ggacctggcc gacctcatct tccccgagcg cctcaggctg
    24901 acgctgcgca acggcctgcc cgactttatg agccaaagca tgttgcaaaa ctttcgctct
    24961 ttcatcctcg aacgctccgg aatcctgccc gccacctgct ccgcgctgcc ctcggacttc
    25021 gtgccgctga ccttccgcga gtgccccccg ccgctgtgga gccactgcta cctgctgcgc
    25081 ctggccaact acctggccta ccactcggac gtgatcgagg acgtcagcgg cgagggcctg
    25141 ctcgagtgcc actgccgctg caacctctgc acgccgcacc gctccctggc ctgcaacccc
    25201 cagctgctga gcgagaccca gatcatcggc accttcgagt tgcaagggcc cagcgagggc
    25261 gagggagcca aggggggtct gaaactcacc ccggggctgt ggacctcggc ctacttgcgc
    25321 aagttcgtgc ccgaggatta ccatcccttc gagatcaggt tctacgagga ccaatcccag
    25381 ccgcccaagg ccgagctgtc ggcctgcgtc atcacccagg gggcgatcct ggcccaattg
    25441 caagccatcc agaaatcccg ccaagaattc ttgctgaaaa agggccgcgg ggtctacctc
    25501 gacccccaga ccggtgagga gctcaacccc ggcttccccc aggatgcccc gaggaaacaa
    25561 gaagctgaaa gtggagctgc cgcccgtgga ggatttggag gaagactggg agaacagcag
    25621 tcaggcagag gagatggagg aagactggga cagcactcag gcagaggagg acagcctgca
    25681 agacagtctg gaggaagacg aggaggaggc agaggaggag gtggaagaag cagccgccgc
    25741 cagaccgtcg tcctcggcgg gggagaaagc aagcagcacg gataccatct ccgctccggg
    25801 tcggggtccc gctcggcccc acagtagatg ggacgagacc gggcgattcc cgaaccccac
    25861 cacccagacc ggtaagaagg agcggcaggg atacaagtcc tggcgggggc acaaaaacgc
    25921 catcgtctcc tgcttgcagg cctgcggggg caacatctcc ttcacccggc gctacctgct
    25981 cttccaccgc ggggtgaact tcccccgcaa catcttgcat tactaccgtc acctccacag
    26041 cccctactac ttccaagaag aggcagcagc agcagaaaaa gaccagaaaa ccagctagaa
    26101 aatccacagc ggcggcagcg gcaggtggac tgaggatcgc ggcgaacgag ccggcgcaga
    26161 cccgggagct gaggaaccgg atctttccca ccctctatgc catcttccag cagagtcggg
    26221 ggcaggagca ggaactgaaa gtcaagaacc gttctctgcg ctcgctcacc cgcagttgtc
    26281 tgtatcacaa gagcgaagac caacttcagc gcactctcga ggacgccgag gctctcttca
    26341 acaagtactg cgcgctcact cttaaagagt agcccgcgcc cgcccagtcg cagaaaaagg
    26401 cgggaattac gtcacctgtg cccttcgccc tagccgcctc cacccagcac cgccatgagc
    26461 aaagagattc ccacgcctta catgtggagc taccagcccc agatgggcct ggccgccggc
    26521 gccgcccagg actactccac ccgcatgaat tggctcagcg ccgggcccgc gatgatctca
    26581 cgggtgaatg acatccgcgc ccaccgaaac cagatactcc tagaacagtc agcgctcacc
    26641 gccacgcccc gcaatcacct caatccgcgt aattggcccg ccgccctggt gtaccaggaa
    26701 attccccagc ccacgaccgt actacttccg cgagacgccc aggccgaagt ccagctgact
    26761 aactcaggtg tccagctggc gggcggcgcc accctgtgtc gtcaccgccc cgctcagggt
    26821 ataaagcggc tggtgatccg gggcagaggc acacagctca acgacgaggt ggtgagctct
    26881 tcgctgggtc tgcgacctga cggagtcttc caactcgccg gatcggggag atcttccttc
    26941 acgcctcgtc aggcggtcct gactttggag agttcgtcct cgcagccccg ctcgggcggc
    27001 atcggcactc tccagttcgt ggaggagttc actccctcgg tctacttcaa ccccttctcc
    27061 ggctcccccg gccactaccc ggacgagttc atcccgaact ttgacgccat cagcgagtcg
    27121 gtggacggct acgattgaat gtcccatggt ggcgcggctg acctagctcg gcttcgacac
    27181 ctggaccact gccgccgctt tcgctgcttc gctcgggacc tcgccgagtt cacctacttt
    27241 gagctgcccg aggagcatcc tcagggcccg gcccacggag tgcggatcgt cgtcgaaggg
    27301 ggcctagact cccacctgct tcggatcttc agccagcgcc cgatcctggt cgagcgccaa
    27361 cagggcaaca ccctcctgac cctctactgc atctgcgacc accccggcct gcatgaaagt
    27421 ctttgttgtc tgctgtgtac tgagtataat aaaagctgag atcagcgact actccggact
    27481 caactgtggt gtttctgcat ccatcaatcg gtctctgacc ttcaccggga acgagaccga
    27541 gctccaggtc cagtgtaagc cccacaagaa gtacctcacc tggctgtacc agggctcccc
    27601 gatcgccgtt gttaaccact gcgacgacga cggagtcctg ctgaacggcc ccgccaacct
    27661 tactttttcc acccgcagaa gcaagctact gctcttccga cccttcctcc ccggcaccta
    27721 tcagtgcatc tcgggaccct gccatcacac cttccacctg atcccgaata ccacctcttc
    27781 cccagcaccg ctccccacta acaaccaaac taaccaccac caacgctacc gacgcgacct
    27841 cgtttctgaa tctaatacca cccacaccgg aggtgagctc cgaggtcgca aaccctctgg
    27901 gatttattac ggcccctggg aggtggtggg gttaatagct ttaggcttag tggcgggtgg
    27961 gcttttggct ctctgctacc tatacctccc ttgcttttcc tacttagtgg tgctttgttg
    28021 ctggtttaag aaatggggaa gatcacccta gtgtgcggtg tgctggtgac ggtggtgctt
    28081 tcgattctgg gagggggaag cgcggctgta gtgacggaga agaaggccga tccctgcttg
    28141 actttcaacc ccgataaatg ccggctgagt tttcagcccg atggcaatcg gtgcgcggtg
    28201 ttgatcaagt gcggatggga atgcgagagc gtgttggtcc agtataaaaa caagacctgg
    28261 aacaatactc tcgcgtccac atggcagccc ggggaccccg agtggtacac cgtctctgtc
    28321 cctggtgctg acggctccct ccgcacggtg aacaacactt tcatttttga gcacatgtgc
    28381 gagaccgcca tgttcatgag caagcagtac ggtatgtggc ccccacgtaa agagaatatc
    28441 gtggtcttct ccatcgctta cagcgcgtgc acggtgctaa tcaccgcgat cgtgtgcctg
    28501 agcattcaca tgctcatcgc tattcgcccc agaaataatg ccgagaaaga gaaacagcca
    28561 taacacactt ttcacatacc tttttcagac catggcctct gttacaatcc ttatttattt
    28621 tttgggactt gtgggcacta gcagcacttt tcagcatata aacaaaactg tttatgctgg
    28681 ttcaaattct gtgttagctg gacatcagtc ataccagaaa gtttcatggt actggtatga
    28741 taaaaatcaa acacccgtta cactctgcaa gggtccacaa cagcccgtaa accgtagtgg
    28801 gatttttttt agctgtaatc ataataatat cacactactt tcaattacaa agcactatgc
    28861 tggaacttac tatggaacca atttcaatat caaacatgac acttactata gtgtcagagt
    28921 attggatcca actaccccta gaacaactac aaagcccacc acaactaaga agcccactac
    28981 acctaagaag cctaccacgc ccaaaaccac taagacaact actaagacca ctaccacaga
    29041 gccaaccaca accagcaccc acacttgcta taactacaca cacacacaca cactgagctg
    29101 acctcacagg caactactga aaatggtttt gccctgttac aaaaggggga aaacagtagc
    29161 agcagtcctc tgcctaccac ccccagtgag gaaataccta aatccatggt tggcattatc
    29221 gctgctgtag tggtgtgtat gctgattatc atcttgtgca tgatgtacta tgcctgctac
    29281 tacagaaaac acaggctgaa caacaagctg gaccccctac tgaatgttga tttttaattt
    29341 tttagaacca tgaagatcct aagccttttt tgtttttcta taattattac ctctgctatt
    29401 tgtaactcag tggataagga cgttactgtc accactggct ctaattatac actgaaagga
    29461 cctccctcag gtatgctttc gtggtattgc tattttggaa ctgatgtttc acaaactgaa
    29521 ttgtgtaatt ttcaaaaagg caaaacccaa aatcctaaaa ttcataacta tcaatgcaat
    29581 ggtactgatt tagtactgtt caatatcacg aaaacatatg ctggaagtta ttactgcccg
    29641 ggagataatg ttgacaatat gattttttac gaattacaag tagttgatcc cactactcca
    29701 gcaccaccca ccacaactac caaggcacat agcacagaca cacaggaaac cactccagag
    29761 gcagaagtag cagagttagc aaagcagatt catgaagatt cctttgttgc caataccccc
    29821 acacaccccg gaccgcaatg tccagggcca ttagtcagcg gcattgtcgg tgtgctttgc
    29881 gggttagcag ttataatcat ctgcatgttc atttttgctt gctgctacag aaggcttcac
    29941 cgacaaaaat cagacccact gctgaacctc tatgtttaat ttttgatttt ccagagccat
    30001 gaaggcactt agcactttag tttttttgac cttgattggc attgttttta atagtaaaat
    30061 taccagggtt agctttctca aacatgttaa tgttactgaa ggaaataata tcacactagt
    30121 aggtgtagaa ggtgctcaaa acaccacctg gacaaaatac catctcgggt ggaaagatat
    30181 ttgcacctgg aatgtcactt atttttgcat aggagttaat cttaccattg ttaatgctaa
    30241 tcaatctcag aatggattaa ttaaagggca gagcgtgagt gttaccagtg atgggtacta
    30301 tacccagcat aatttcaact acaacattac tgttatacca ctgccaacac ctagcccacc
    30361 tagcactact cagaccacac aaacaactca cactacacag agctccacaa ctaccatgca
    30421 gaccactcag acaaccacat acactacttc ccctcagccc accaccacta cagcagaggc
    30481 gagtagctca cccaccatca aagtggcatt tttaatgctg gccccatcta gcagtcccac
    30541 tgctagtacc aatgagcaga ctactgaatt tttgtccact attcagagca gcaccacagc
    30601 tacctcgagt gccttctcta gcaccgccaa tctcacctcg ctttcctcta tgccaatcag
    30661 taatgctact acctcccccg ctcctcttcc cactcctctg aagcaatccg agtccagcac
    30721 gcagctgcag atcaccctgc tcattgtgat cggggtggtc atcctggcag tgctgctcta
    30781 ctttatcttc tgccgtcgca tccccaacgc aaagccggcc tacaagccca ttgttatcgg
    30841 gacgccggag ccgcttcagg tggagggagg tctaaggaat cttctcttct cttttacagt
    30901 atggtgattt gaactatgat tcctagacat ttcattatca cttctctaat ctgtgtgctc
    30961 caagtctgtg ccaccctcgc tctcgtggct aacgcgagtc cagactgcat tggagcgttc
    31021 gcctcctacg tgctctttgc cttcatcacc tgcatctgct gctgtagcat agtctgcctg
    31081 cttatcacct tcttccagtt cgttgactgg gtctttgtgc gcatcgccta cctgcgccac
    31141 cacccccagt accgcgacca gagagtggcg caactgttga gactcatctg atgataagca
    31201 tgcgggctct gctactactt ctcgcgcttc tgctagctcc cctcgccgcc cccctatccc
    31261 tcaaatcccc cacccagtcc cctgaagagg ttcgaaaatg taaattccaa gaaccctgga
    31321 aattcctttc atgctacaaa ctcaaatcag aaatgcaccc cagctggatc atgatcgttg
    31381 gaatcgtgaa catccttgcc tgtaccctct tctcctttgt gatttacccc cgctttgact
    31441 ttgggtggaa cgcacccgag gcgctctggc tcccgcctga tcccgacaca ccaccacagc
    31501 agcagcagca aaatcaggca caggcacacg caccaccaca gcctaggcca caatacatgc
    31561 ccatcttaaa ctatgaggcc gaggcacagc gagccatgct tcctgctatt agttacttca
    31621 atctaaccgg cggagatgac tgaccccatg gccaacaaca ccgtcaacga cctcctggac
    31681 atggacggcc gcgcctcgga gcagcgactc gcccaactcc gcatccgcca gcagcaggag
    31741 agagccgtca aggagctgca ggatgcggtg gccatccacc agtgcaagag aggcatcttc
    31801 tgcctggtga agcaggccaa gatctccttc gaggtcacgt ccaccgacca tcgcctctcc
    31861 tacgagctcc tgcagcagcg ccagaagttc acctgcctgg tcggagtcaa ccccatcgtc
    31921 atcacccagc agtctggcga taccaagggt tgcatccact gctcctgcga ctcccccgag
    31981 tgcgttcaca ccctgatcaa gaccctctgc ggcctccgcg acctcctccc catgaactaa
    32041 tcaactaacc ccctacccct ttaccctcca gtaaaaataa agattaaaaa tgattgaatt
    32101 gatcaataaa gaatcactta cttgaaatct gaaaccaggt ctctgtccat gttttctgtc
    32161 agcagcactt cactcccctc ttcccaactc tggtactgca ggccccggcg ggctgcaaac
    32221 ttcctccaca ctctgaaggg gatgtcaaat tcctcctgtc cctcaatctt catttttatc
    32281 ttctatcaga tgtccaaaaa gcgcgcgcgg gtggatgatg gcttcgaccc cgtgtacccc
    32341 tacgatgcag acaacgcacc gactgtgccc ttcatcaacc ctcccttcgt ctcttcagat
    32401 ggattccaag aaaagcccct gggggtgttg tccctgcgac tggccgaccc cgtcaccacc
    32461 aagaatgggg ctgtcaccct caagctgggg gagggggtgg acctcgacga ctcgggaaaa
    32521 ctcatctcca aaaatgccac caaggccact gcccctctca gtatttccaa cggcaccatt
    32581 tcccttaaca tggctgcccc tttttacaac aacaatggaa cgttaagtct caatgtttct
    32641 acaccattag cagtatttcc cacttttaac actttaggta tcagtcttgg aaacggtctt
    32701 caaacttcta ataagttgct gactgtacag ttaactcatc ctcttacatt cagctcaaat
    32761 agcatcacag taaaaacaga caaaggactc tatattaatt ctagtggaaa cagagggctt
    32821 gaggctaaca taagcctaaa aagaggactg atttttgatg gtaatgctat tgcaacatac
    32881 cttggaagtg gtttagacta tggatcctat gatagcgatg ggaaaacaag acccatcatc
    32941 accaaaattg gagcaggttt gaattttgat gctaataatg ccatggctgt gaagctaggc
    33001 acaggtttaa gttttgactc tgccggtgcc ttaacagctg gaaacaaaga ggatgacaag
    33061 ctaacacttt ggactacacc tgacccaagc cctaattgtc aattactttc agacagagat
    33121 gccaaattta ccctatgtct tacaaaatgc ggtagtcaaa tactaggcac tgttgcagta
    33181 gctgctgtta ctgtaggttc agcactaaat ccaattaatg acacagtaaa aagcgccata
    33241 gtattcctta gatttgactc tgacggtgtg ctcatgtcaa actcatcaat ggtaggtgat
    33301 tactggaact ttagggaagg acagaccacc caaagtgtgg cctatacaaa tgctgtggga
    33361 ttcatgccca atctaggtgc atatcctaaa acccaaagca aaacaccaaa aaatagtata
    33421 gtaagtcagg tatatttaaa tggagaaact actatgccaa tgacactgac aataactttc
    33481 aatggcactg atgaaaaaga cacaacacct gtgagcactt actccatgac ttttacatgg
    33541 cagtggactg gagactataa ggacaagaat attacctttg ctaccaactc ctttactttc
    33601 tcctacatgg cccaagaata aaccctgcat gccaacccca ttgttcccac cactatggaa
    33661 aactctgaag cagaaaaaaa taaagttcaa gtgttttatt gattcaacag ttttcacaga
    33721 attcgagtag ttattttccc tcctccctcc caactcatgg aatacaccac cctctcccca
    33781 cgcacagcct taaacatctg aatgccattg gtaatggaca tggttttggt ctccacattc
    33841 cacacagttt cagagcgagc cagtctcggg tcggtcaggg agatgaaacc ctccgggcac
    33901 tcctgcatct gcacctcaaa gttcagtagc tgagggctgt cctcggtggt cgggatcaca
    33961 gttatctgga agaagagcgg tgagagtcat aatccgcgaa cgggatcggg cggttgtggc
    34021 gcatcaggcc ccgcagcagt cgctgtctgc gccgctccgt caagctgctg ctcaaggggt
    34081 ctgggtccag ggactccctg cgcatgatgc cgatggccct gagcatcagt cgcctggtgc
    34141 ggcgggcgca gcagcggatg cggatctcac tcaggtcgga gcagtacgtg cagcacagca
    34201 ctaccaagtt gttcaacagt ccatagttca acgtgctcca gccaaaactc atctgtggaa
    34261 ctatgctgcc cacatgtcca tcgtaccaga tcctgatgta aatcaggtgg cgccccctcc
    34321 agaacacact gcccatgtac atgatctcct tgggcatgtg caggttcacc acctcccggt
    34381 accacatcac ccgctggttg aacatgcagc cctggataat cctgcggaac cagatggcca
    34441 gcaccgcccc gcccgccatg cagcgcaggg accccgggtc ctggcaatgg cagtggagca
    34501 cccaccgctc acggccgtgg attaactggg agctgaacaa gtctatgttg gcacagcaca
    34561 ggcacacgct catgcatgtc ttcagcactc tcagttcctc gggggtcagg accatgtccc
    34621 agggcacggg gaactcttgc aggacagtga acccggcaga acagggcagc cctcgcacac
    34681 aacttacatt gtgcatggac agggtatcgc aatcaggcag caccggatga tcctccacca
    34741 gagaagcgcg ggtctcggtc tcctcacagc gaggtaaggg ggccggcggt tggtacggat
    34801 gatggcggga tgacgctaat cgtgttctgg atcgtgtcat gatggagctg tttcctgaca
    34861 ttttcgtact tcacgaagca gaacctggta cgggcactgc acaccgctcg ccggcgacgg
    34921 tctcggcgct tcgagcgctc ggtgttgaag ttatagaaca gccactccct cagagcgtgc
    34981 agtatctcct gagcctcttg ggtgatgaaa atcccatccg ctctgatggc tctgatcaca
    35041 tcggccacgg tggaatgggc cagacccagc cagatgatgc aattttgttg ggtttcggtg
    35101 acggagggag agggaagaac aggaagaacc atgattaact ttattccaaa cggtctcgga
    35161 gcacttcaaa atgcaggtcc cggaggtggc acctctcgcc cccactgtgt tggtggaaaa
    35221 taacagccag gtcaaaggtg acacggttct cgagatgttc cacggtggct tccagcaaag
    35281 cctccacgcg cacatccaga aacaagagga cagcgaaagc gggagcgttt tctaattcct
    35341 caatcatcat attacactcc tgcaccatcc ccagataatt ttcatttttc cagccttgaa
    35401 tgattcgtat tagttcctga ggtaaatcca agccagccat gataaaaagc tcgcgcagag
    35461 cgccctccac cggcattctt aagcacaccc tcataattcc aagagattct gctcctggtt
    35521 cacctgcagc agattaacaa tgggaatatc aaaatctctg ccgcgatccc taagctcctc
    35581 cctcaacaat aactgtatgt aatctttcat atcatctccg aaatttttag ccatagggcc
    35641 gccaggaata agagcagggc aagccacatt acagataaag cgaagtcctc cccagtgagc
    35701 attgccaaat gtaagattga aataagcatg ctggctagac cctgtgatat cttccagata
    35761 actggacaga aaatcaggca agcaattttt aagaaaatca acaaaagaaa agtcgtccag
    35821 gtgcaggttt agagcctcag gaacaacgat ggaataagtg caaggagtgc gttccagcat
    35881 ggttagtgtt tttttggtga tctgtagaac aaaaaataaa catgcaatat taaaccatgc
    35941 tagcctggcg aacaggtggg taaatcactc tttccagcac caggcaggct acggggtctc
    36001 cggcgcgacc ctcgtagaag ctgtcgccat gattgaaaag catcaccgag agaccttccc
    36061 ggtggccggc atggatgatt cgagaagaag catacactcc gggaacattg gcatccgtga
    36121 gtgaaaaaaa gcgacctata aagcctcggg gcactacaat gctcaatctc aattccagca
    36181 aagccacccc atgcggatgg agcacaaaat tggcaggtgc gtaaaaaatg taattactcc
    36241 cctcctgcac aggcagcaaa gcccccgctc cctccagaaa cacatacaaa gcctcagcgt
    36301 ccatagctta ccgagcacgg caggcgcaag agtcagagaa aaggctgagc tctaacctga
    36361 ctgcccgctc ctgtgctcaa tatatagccc taacctacac tgacgtaaag gccaaagtct
    36421 aaaaataccc gccaaaatga cacacacgcc cagcacacgc ccagaaaccg gtgacacact
    36481 caaaaaaata cgtgcgcttc ctcaaacgcc caaaccggcg tcatttccgg gttcccacgc
    36541 tacgtcaccg ctcagcgact ttcaaattcc gtcgaccgtt aaaaacgtca ctcgccccgc
    36601 ccctaacggt cgcccttctc tcggccaatc accttcctcc cttcccaaat tcaaacgcct
    36661 catttgcata ttaacgcgca caaaaagttt gaggtatata tttgaatgat g
//
DBGET integrated database retrieval system