GenomeNet

Database: RefSeq
Entry: NC_018231
LinkDB: NC_018231
Original site: NC_018231 
LOCUS       NC_018231             479467 bp    DNA     linear   CON 30-MAR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 4.
ACCESSION   NC_018231
VERSION     NC_018231.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 479467)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 479467)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799591.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..479467
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="4"
     gap             1985..4029
                     /estimated_length=2045
     gene            <8198..>11269
                     /locus_tag="LDBPK_040010"
                     /db_xref="GeneID:13391037"
     mRNA            <8198..>11269
                     /locus_tag="LDBPK_040010"
                     /product="calcium-translocating P-type ATPase"
                     /transcript_id="XM_003858016.1"
                     /db_xref="GeneID:13391037"
     CDS             8198..11269
                     /locus_tag="LDBPK_040010"
                     /codon_start=1
                     /product="calcium-translocating P-type ATPase"
                     /protein_id="XP_003858064.1"
                     /db_xref="GeneID:13391037"
                     /db_xref="GOA:E9B7W7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005782"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9B7W7"
                     /translation="MAKLVLPDDPASMDGHLICTLLGVKEARGLPYDEVDKRLHEFGK
                     NGFPTMPSTPFWKLVVSQFEDTLVRILLLAAFVSFCLAVLESNVIDLVEPFIILLILT
                     LNAIVGVWQEDRAEKAIDALKDFVPETAVVVREGMTQKILAENLVPGDIVEVAVGDRV
                     AADVRLLTLESTTLRVDQSILNGESVEAMKQVESVRGKPERFPSSMVYRGTAVVYGKA
                     RGVVVRTGTSTEMGFIERDVREQEETKTPLQLKLDEFGVLLSTVIGYICLFVFVVNLL
                     HWFRTHTPATEESWFERYIQPTVHSLKVAVALAVAAIPEGLPAVVTTCLALGSRKMAR
                     HNALVRDLQSVETLGRCTVICSDKTGTLTTNMMSVSEVVTMEPSGKAHKYSIHDSRFN
                     IVAAAVSHNGTLAGDVLGNDAALDMVATIATLCSDASLIYGTRSVEVEKVGDATEAAL
                     LVMSEKLYHSAARNGVDGAHLPVDRCRSLKRQLWLKKATLEFTRSRKSMSVCCTSTAD
                     VRVHSLFVKGAPEEILKRCTRIMFKDGHISPLTPKMVNTVTANIDRMSGTEEALRCIA
                     FAFRPIPDPKQLNLSDPAKFEAIESDLTFVGVCGMLDPPRGEVADAIAKCRTAGIRVI
                     VITGDKKETAEAVCRRIGLMPYEPTKGLSFTGYELDQMTPAQRRAAVSSAVLFSRTDP
                     SHKMQLVNLLQEQRLICAMTGDGVNDSPALKKADIGIAMGSGTEVAKAASKMVLADDN
                     FATVVKAVHEGRTIFNNTKQFIRYLISSNIGEVACVLATGLFGLPEALSPIQLLWVNL
                     VTDGLPATALGFNAADPDIMEQAPRRGDEPIVDGWLFFRYMVVGVYVGLATVAGFVWW
                     FLTNGFTLSDLASFTTCTDMSNSRCAVLANPQTARAIALSILVVVEMLNALNALSENQ
                     SLVVIRPSTNKWLIAAICSSIALHLTIMYIPFFSRLFGVTPLGVDVDVVATASPWEVL
                     LPTDFTDWKMVLVLSIPVIFLDELLKLFSRCSNHHRESYSAEPVVGGLSGM"
     gene            <16286..>18460
                     /locus_tag="LDBPK_040030"
                     /db_xref="GeneID:13391036"
     mRNA            <16286..>18460
                     /locus_tag="LDBPK_040030"
                     /product="cAMP-specific phosphodiesterase, putative"
                     /transcript_id="XM_003858017.1"
                     /db_xref="GeneID:13391036"
     CDS             16286..18460
                     /locus_tag="LDBPK_040030"
                     /codon_start=1
                     /product="cAMP-specific phosphodiesterase, putative"
                     /protein_id="XP_003858065.1"
                     /db_xref="GeneID:13391036"
                     /db_xref="GOA:E9B7W8"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="UniProtKB/TrEMBL:E9B7W8"
                     /translation="MHPFDVLASVKDDPSLSPQLREKIGGALVRLREICKTADPPSVA
                     KAPPRSCAHSYFEEMISGHAPLRFSCHSSESTHTRAKHFDIASSRLPGPIVMSSSKTL
                     MQRTTPALQSPKEIFAELNAIAFQTLRYIDEVEQIEFDVTNVCEHDGSIMEDKERLFL
                     SVCCSVFANFSFFTSLRINAEKFLHFLRKLFTCYPLDNSYHNATHAADALQMMSLFFR
                     EPTVNFLFSDEEIAICFLAVLAVDVAHPGASDALLVALDHPLASVFGDVAIAEHASLL
                     VLTSVLVLEDNFFFSTPDEAVSVDSAHLVKEALYDVVLNAALRSRPSLMSALRDIETS
                     GRITDADAPKLMAALLVMACNSFAFRSQAQCCRMGAWFLSELHREECEMERHGIRVTL
                     PHVAGADCAAVLSDYINIVVKPVTAATLALVPTDLQDRLEWNADLVDAAASTGGRACK
                     VVVESSLAQWMTSSLSVMEILKKVATHASSVDRKASKCAILNASPSRSQGAAPGMMRA
                     DSLSSNSSTSGSMSAAKREATSNCPQLSFTSEPCSAAGSPTARPGRSEHYFSFLRLYD
                     KCERAGESAKDFVGQLIFLALQLDPRYIAAYARKEYGDDCCGAECAEMGLLISKMEEA
                     PSTAEVIASRPPGGSFSNRVADEIDHTDSFILFLMDMYCSREAALAEMESAVPVSDKA
                     KTPPPAEPAPPKAAPQCQQNSPIRMPVNTESKNTGPRLRLVP"
     gene            <19452..>19673
                     /locus_tag="LDBPK_040031"
                     /db_xref="GeneID:13390677"
     mRNA            <19452..>19673
                     /locus_tag="LDBPK_040031"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858018.1"
                     /db_xref="GeneID:13390677"
     CDS             19452..19673
                     /locus_tag="LDBPK_040031"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858066.1"
                     /db_xref="GeneID:13390677"
                     /db_xref="UniProtKB/TrEMBL:E9B7W9"
                     /translation="MSPRVAGFLIGGFVTAMASAILLQYDVLRKQELTTRKTEEVAVQ
                     ADMIVHRFHVVEAGLRTLSEGGEARPSTT"
     gene            <20177..>21496
                     /locus_tag="LDBPK_040040"
                     /db_xref="GeneID:13390678"
     mRNA            <20177..>21496
                     /locus_tag="LDBPK_040040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858019.1"
                     /db_xref="GeneID:13390678"
     CDS             20177..21496
                     /locus_tag="LDBPK_040040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858067.1"
                     /db_xref="GeneID:13390678"
                     /db_xref="UniProtKB/TrEMBL:E9B7X0"
                     /translation="MQQRMGAMPMTVLYPQSYLPHGAVPCPAPGYGSMFGGYGAAPVM
                     MMVAGNAPYPVNGNFSHSVTPMYFAMDPANSAAPMAVAADAASACATPKAKLAHSGSG
                     NSLSTQSCCSGGETPSLLSRSAASSTVKQRLPHDVSVWGFALVDQLHPSLQRIPVPLS
                     CLHEPTMGISLYDNDVMSSSTRPCKSSVCLLHAQGLGCAEGAGCRCFHVSNAYLMQCR
                     ATSESLCCALHNCYYSQEMLGANCAPHVSGRCYALSLDDASKFPQDGEKPYLIDLSLL
                     NLSLTVGLETLPCVNGVYVVSWKKHVCRLNMNGLCKWTKDCGHIHVCRQLAKFLQDAE
                     TLSIVKTLQERTTSKSSAELYRDIILSENTLRYVRSAAALSLVAALLEAGDVEALKAL
                     ARAKCALLPSQSAALQKLGIALSSNDSTRIITVSPKLLVLLTPKGIN"
     gene            <25529..>26032
                     /locus_tag="LDBPK_040050"
                     /db_xref="GeneID:13390679"
     mRNA            <25529..>26032
                     /locus_tag="LDBPK_040050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858020.1"
                     /db_xref="GeneID:13390679"
     CDS             25529..26032
                     /locus_tag="LDBPK_040050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858068.1"
                     /db_xref="GeneID:13390679"
                     /db_xref="UniProtKB/TrEMBL:E9B7X1"
                     /translation="MAQWIPKTAWKVSNLNKRYGAPYVAKGYASLDPRCSLDAYSSLQ
                     QTVTSADVKKALLSIDCTSSGALVIDVRSEPERRLRPLLSPAIVALHPHDILSGAACP
                     ILPSNKERAEMFVVASEAQRAVNTCTALRRWGFSRVAAVSVDAVSEAIAVVPKPADTA
                     TSSPTKS"
     gene            <27179..>28768
                     /locus_tag="LDBPK_040060"
                     /db_xref="GeneID:13390680"
     mRNA            <27179..>28768
                     /locus_tag="LDBPK_040060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858021.1"
                     /db_xref="GeneID:13390680"
     CDS             27179..28768
                     /locus_tag="LDBPK_040060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858069.1"
                     /db_xref="GeneID:13390680"
                     /db_xref="UniProtKB/TrEMBL:E9B7X2"
                     /translation="MRSTELIVERGPLHHEAHSMANESPLNQPQEQFSLEPKLEKVTA
                     PSCESSSDEAAYPKGNEEEERNETPRDPCKLTDVSTDHYAKDPDSEEEEAAAASLANK
                     EPEEDAQDEAGGDGSHVGAVPAEVAKTTRPHGLHKAKKKHSNHAKEAKAAETVEKSAA
                     PRKKKPMYKVNIDNVERHPPVPEGVNTPRSVALCKEHGVNPSELARYDRKHFKGAGVS
                     DEVAELRYQSYEKRRCARMAQLKPAYKESIKYDLEDAVSVSAAKNKAQAAEEALARPA
                     AAVQAAAPPPKLLDEEAEMQRQFEAQHQRLLEQERRKTVASGYNSDGRRRSPPRAGHF
                     YGASVRSVGSSKSPGRHSMNTSVGARPTVDQPYSAAKIYSASIVESRPLTQSEVIMID
                     EINEREAHRIDTQERAFVIQENKQLMHVERELIRERLACVRVQKNAEDREKMQQKMHK
                     RNEARQNVAAERRKKLEAERQARIQDSIAEKAVRCHATNPYASLMLRQMSGFSTRRTS
                     SSFPSQGADVSASQEQSSEAE"
     gene            <30880..>31668
                     /locus_tag="LDBPK_040070"
                     /db_xref="GeneID:13390681"
     mRNA            <30880..>31668
                     /locus_tag="LDBPK_040070"
                     /product="DNA topoisomerase type IB small subunit"
                     /transcript_id="XM_003858022.1"
                     /db_xref="GeneID:13390681"
     CDS             30880..31668
                     /locus_tag="LDBPK_040070"
                     /codon_start=1
                     /product="DNA topoisomerase type IB small subunit"
                     /protein_id="XP_003858070.1"
                     /db_xref="GeneID:13390681"
                     /db_xref="GOA:E9B7X3"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:E9B7X3"
                     /translation="MQPVQSPPVAPPSVPVAAPKKTPIDISALKLKMSPSVRATLAAA
                     GVLGQCPRPIEAADEDALLKLKPMKTMVPSVKKVVAPVATTAPPPKVRRVESSSSSSS
                     DSSSSSSDDDSSSDDSSGSDSSSYSSDDRSSSSAESVVSGEATLFHIAQSQGLVNKEV
                     LTQEEEEVPTLVPPRPPVVRSFPNDIGKALERYRERLNREESIIRIKDDNKAVSLGTS
                     KINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF"
     gene            <32615..>33352
                     /locus_tag="LDBPK_040080"
                     /db_xref="GeneID:13390682"
     mRNA            <32615..>33352
                     /locus_tag="LDBPK_040080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858023.1"
                     /db_xref="GeneID:13390682"
     CDS             32615..33352
                     /locus_tag="LDBPK_040080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858071.1"
                     /db_xref="GeneID:13390682"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B7X4"
                     /translation="MMEPTRNAEYSKQEYWDRRYTEEEHYDWFPSVYPMCVAAAFETV
                     EAVYRVQRSTGAFEGTLKVLHLGTGSSTLCADIRAAYEAKYPTEDSRPYRLVQVATDY
                     SAVVIEHMKTKYGPAHPLEDVHWVVADIRDLSRVREQFGPFFDVVLDKGTMDALQADK
                     ANQNMDDDIERMLCEVSRCVEGGVGTLVYRVFVQITWEIPYLRLHYTTKNATHTFAWG
                     TNVTYRFLGESDMYRMYTYEVSPPSSE"
     gene            <34038..>34514
                     /locus_tag="LDBPK_040090"
                     /db_xref="GeneID:13390683"
     mRNA            <34038..>34514
                     /locus_tag="LDBPK_040090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858024.1"
                     /db_xref="GeneID:13390683"
     CDS             34038..34514
                     /locus_tag="LDBPK_040090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858072.1"
                     /db_xref="GeneID:13390683"
                     /db_xref="UniProtKB/TrEMBL:E9B7X5"
                     /translation="MRRCLTPAGAWVSTWRRVTTVSRAVGYNRSHCPPLTETDASKTT
                     SAASTTAPAAPTSEDYRALLLDLLLYRRETLTPVVEALRLERDEVEKKMQQLDTHVRE
                     LSSIRDELRQLAEAVLDAERTRLHDFVMKPSNPPAAESTMAAQGAAESEEVEEIVL"
     gene            <35614..>41232
                     /locus_tag="LDBPK_040100"
                     /db_xref="GeneID:13390684"
     mRNA            <35614..>41232
                     /locus_tag="LDBPK_040100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858025.1"
                     /db_xref="GeneID:13390684"
     CDS             35614..41232
                     /locus_tag="LDBPK_040100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858073.1"
                     /db_xref="GeneID:13390684"
                     /db_xref="UniProtKB/TrEMBL:E9B7X6"
                     /translation="MPSPPHVIAYSMQRRVAPPYHSLRGRPIGAMVIDSFPVQLRMYV
                     ASSPLIASAGGWSSCFASARLFTDAAASLSPVVDVSSSAPPSPFEVHQVIARAAQRGE
                     WEHAIRLLVGSLHSHCVPLAETYQLILLAALRGGGWRASVQLTKQMATSTLSTAALYH
                     TAADLLLAKSTFNLETSSTSLDRVVLKELVPLMLADATQHVVWRPRHREAALRALGKA
                     EKHQKISALFRRWTAATALLGSVSRLRCSEEEATLFMAAFGVTGDWRSAETLRTSLSQ
                     ISAPLLVSYVRAFAVAVQHAETSSLAAPQELVPWEMALDTAAAGKQDAPLLEAVTELL
                     SAARHTAAPAGGARWWWAASTSTHAKLAELRRRAAISAREAAQLLVECHVTTAQVRSL
                     LDAVRVSGVLSSAAAEASPYYEGWVNVVLVLSQYCPQALVSVDGCADGLVQLLPHPHL
                     QIRRQRGGATPHTLALWRHVAQSAAGGDVAKPASVAWYVVYTSSALHYLRHAALQPAQ
                     LAKAEGTLSAALARQLRCPGHHPMHGALLTGFAGKPDALFILLRTVSAHISVPSAERC
                     VTLVMRDEAASIGEMVDELLLSFLEPLDALGTPEEMCEAVCAAGEAALLSSPLSYSST
                     QFVCLAVWYTCHQLRRGVSLSSLRPALRRTVSLVERLPGSAEALTLLSAQLQWCWGAS
                     LEALREQAVPILLRREEWDVLARLLERCPQPLSTQEQHILQRCKNGAKVTALQNLVTV
                     HRATAAWEYWQGELCGAAREAPLPTSLYDSLVSLLLAHGLVTEAHAVLDGSGASEVRV
                     PHTTWSHTGLRVYDYARRWRRREQGMQLAELWGAAALAEEEADRDGSEVRKREATVIL
                     ALYAGLALEHTHRAADASQVIAAAVDYVLRYDEAHHHRGTQPPLDFATLHRTDAQLAA
                     RLPDYVQCAAPRLICAALNCSGETSRKPATKAACSSVDSGAVSEVLRSVAYLLPLTST
                     SGAAVMAWSETVLRLYTVAGACAIDAMPAVAKLAQKLLYQAAEQKVAVAPSFLRLVLA
                     TGPLSTTLLAAVRQCLLLRPGNAPTGPYSTDVAATAVQVAVSLADSGNHSAALEWVEE
                     FELWQRGEAAGKEVTEPVPQTVVDMATQLSWLQAAQAAAQRRADQRAALCQHRRAAQA
                     GASRGSVAFELYSRDALDRLIDCDAWEEALDAFLHVLAAPIDVKSLFSEESMKLMELR
                     DAYLSADVLNSVMLCVARCAPWRTTVQAWMLLTSQAPLFPWNACAAALTPSIHELLSV
                     MARQCALPHEVGTVVAWMVAQLDLPRSATSALCSRFADCIDASSSTGAGHAWTAAEAQ
                     LCAEIVAQLRRLCGEKRVREAGHAIAEAQAALFPPSLHTPAPHSEEGTVPSATSWLPP
                     GRPPLSAEELDTLAVIAPLLLLASTPQLESLAQQHLGGTFKAHELKALLYLYREELLQ
                     RVATVREPDAALVQYLAQNATLRVLLSQCAEVRPAKHPTWRTRDKAAAEWMAQHIFDG
                     FLPLSTAEELWKACEEPAKKLAECRWSAVAEAELCGELLRRHGKPPEKLSTAPHLTRQ
                     AISHYWSCFHRVLLPEMHFGPLELCCLASYAPALAEARAACPDMTQPAYADAVAELAN
                     HAYKSHFCPSSVPVEDTLSYLRRPHCAAAIAAVMTSAFKKLKVLHAQLSDVRSAAARG
                     YRLPFSWNTVSAAAVQLPPELNRQCLADAARCIPHDAVPVTKVAPGHASHTCIASPLL
                     RRWTQWATGMACASSPKSLPQAGSLLLVEWTKEALQSACDLPHADQVRSAALTAAGGG
                     GNKVCALWQEVARAGKRELRQQRCRDLSAVWQLLAGAKVWRFMDPGHVMVLRRLVLPS
                     NSKVRALPSKRDAVMHHRKTSQRKEEKGCV"
     gap             41424..41522
                     /estimated_length=99
     gap             42240..42338
                     /estimated_length=99
     gene            <43256..>44989
                     /locus_tag="LDBPK_040110"
                     /db_xref="GeneID:13390685"
     mRNA            <43256..>44989
                     /locus_tag="LDBPK_040110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858026.1"
                     /db_xref="GeneID:13390685"
     CDS             43256..44989
                     /locus_tag="LDBPK_040110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858074.1"
                     /db_xref="GeneID:13390685"
                     /db_xref="UniProtKB/TrEMBL:E9B7X7"
                     /translation="MDRNCPSRTSRRCACAPWRRRVLLVCAWAVTAVLLSNCALAWPQ
                     FLYLRRREELPAAVQADADDARAHTPPRLFPGAMERGEQARMLWEEAEAKGRLSPCWK
                     RSLQLLHAKCAEVRNEDTMRSRLALFMATCDANSDGRAHPSFHCGSAATQPSELSAHA
                     VRQCVQGLSDSAYAAFLQYRLHADVLCAYLEEELYQQRTEAAVAAMHLQMQRSSHMLT
                     ALQHSGAEVVALMKDSQTLQQESREAASSLLHQLGLLHNGQAAALQSLQQAVSAILRT
                     SSHTDAALGELHTRVQGAAAEALASVQALSQETFKRFAEVEAQTRGVVRLMQQMDALH
                     QLLARQRLPRHRMAWVLGCLCGVLALTCLPQTAAARLPATLLTVVGCAGVPLLRWWTG
                     RARWLFLHETAWESLCLSLAVGLVGYCAHRHTPSDTCRRRRLAREEAIRLCGELQLQQ
                     QLGGAMLQPYAPQIPILGLQPHPCMVRSDAPEASLSVAHAWPPLSIVVSPRDDEVEAT
                     STTADGSHCTASNEGSLSLPDEVSSAASTPNRKRGRPFTAGDDAARHHATARTRRSTA
                     RSTCRTTRRKG"
     gene            <46093..>47136
                     /locus_tag="LDBPK_040120"
                     /db_xref="GeneID:13390686"
     mRNA            <46093..>47136
                     /locus_tag="LDBPK_040120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858027.1"
                     /db_xref="GeneID:13390686"
     CDS             46093..47136
                     /locus_tag="LDBPK_040120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858075.1"
                     /db_xref="GeneID:13390686"
                     /db_xref="UniProtKB/TrEMBL:E9B7X8"
                     /translation="MLTCSLKQADRTRSDASLVTVEELGGWASVAEALLGECACAALV
                     DVAEPSARARLVVEYADSLVALVRIHAADVAALQCRAATAEEKRSDALAHQLHAVVQE
                     CETMRSNLGSERTSRAALEEESRRLLNELLITQEERDALRAERTALWCAVREAQAVAG
                     VTCAAKATMEEHVRVLCEWVRSAQAELTSAAALMGATTPLPVAVAPYQPARLLYRRIL
                     PTTPMNPVTASLLRVKEQVQQMREPSVAELQLAVGMYRHRGDEAAAPLTPSPRTRAAT
                     VTAAVSTPAPLLVNRSLGRSRSCTPHRSTNGSATQREEDVVASPPWRTRMMKLQEELK
                     GLRRELGTAAAPP"
     gene            <47900..>48802
                     /locus_tag="LDBPK_040130"
                     /db_xref="GeneID:13390687"
     mRNA            <47900..>48802
                     /locus_tag="LDBPK_040130"
                     /product="exosome complex exonuclease RRP40, putative"
                     /transcript_id="XM_003858028.1"
                     /db_xref="GeneID:13390687"
     CDS             47900..48802
                     /locus_tag="LDBPK_040130"
                     /codon_start=1
                     /product="exosome complex exonuclease RRP40, putative"
                     /protein_id="XP_003858076.1"
                     /db_xref="GeneID:13390687"
                     /db_xref="GOA:E9B7X9"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:E9B7X9"
                     /translation="MTQPGAVVAIGGGLRLLAQPAPTPTADGASQALTDVFLSEYCAS
                     LQRSSHHLHTHVPRYTVPTPASRRYIPRAGDPVLAIIARKVSQHYYYCYIGGSALAYM
                     DALAFDGATKVSRPRLVEGDVVYCYVKPRAGSSYVGGVHRSVASEVFDTTGEVEVSCT
                     AAEVGLPPKDWTSGEAAFGPLQGGRVLHLPLAYVRRLITPVGSSPDKASAQQRKHGHT
                     EGEGGYGDEVPASYLLQLLGRRVPFEVAVGLNGLVWVRGLSSEADTTAAARRTVAVSS
                     CISEAQYDVTRAEMEARVEVYFPS"
     gene            <49768..>50244
                     /locus_tag="LDBPK_040140"
                     /db_xref="GeneID:13390688"
     mRNA            <49768..>50244
                     /locus_tag="LDBPK_040140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858029.1"
                     /db_xref="GeneID:13390688"
     CDS             49768..50244
                     /locus_tag="LDBPK_040140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858077.1"
                     /db_xref="GeneID:13390688"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y0"
                     /translation="MPDFSQFIKYLNANLHAPTGQYAAQGGVGGKGSGGASGATEAAS
                     PASHGDASAFTRSCDTTWRVLLPSDAAAKESGTRSSGPSAAAAAAHTSPSHPSVTIGR
                     MMVSTEDRWRIQAQMRREEARTGQARKEYNKKVTRAIKVTKGPSENAFPPGRGRPL"
     gene            <51206..>52510
                     /locus_tag="LDBPK_040150"
                     /db_xref="GeneID:13390689"
     mRNA            <51206..>52510
                     /locus_tag="LDBPK_040150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858030.1"
                     /db_xref="GeneID:13390689"
     CDS             51206..52510
                     /locus_tag="LDBPK_040150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858078.1"
                     /db_xref="GeneID:13390689"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y1"
                     /translation="MLENDNGARPLHDGTVLISPDASPNLTRRATNHHSAENTEAPPL
                     VDLLMSASKTIREERGRADSLEKENAKLQAQLDGVRLAYQLVATQRAQRNSQALGRVT
                     ALDKAGEDMLFAYVRDRLIGRDIHPSSEHEKCSCTRESSSRARLGQRQRRSNAAAPPV
                     ASAAARVPSRNFITAATRSCTKRGKAGITPPESVSSKTAEPHISVATEAREEHGYLPT
                     ALRNCDLKSAKDHLATSLTGGGSRKGEGNAEMVEGGSDTEESPTHWMARRLLRALAPR
                     PTDSVVGDIVHTMVTALQQDVQAELSRPSDGRHAAPNRMRGFALVRLKPCVYRLLVGP
                     PAEVKAMECAARSSNRSARQTAPRLPSAALHRDHFLLYSRNPETNTAARPCSSKITNT
                     VIHLTIDTGTLRVVRGGGHIDFIDYLERRLQVKLYTRRSRPA"
     gene            <53006..>54583
                     /locus_tag="LDBPK_040160"
                     /db_xref="GeneID:13390690"
     mRNA            <53006..>54583
                     /locus_tag="LDBPK_040160"
                     /product="hypothetical protein, conserved in leishmania"
                     /transcript_id="XM_003858031.1"
                     /db_xref="GeneID:13390690"
     CDS             53006..54583
                     /locus_tag="LDBPK_040160"
                     /codon_start=1
                     /product="hypothetical protein, conserved in leishmania"
                     /protein_id="XP_003858079.1"
                     /db_xref="GeneID:13390690"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y2"
                     /translation="MGPFAPRCCALALLCAVVVLAAVLVRAESLTVTRDVTMSDASFD
                     DYTMMLDLSSSSADVVTVQLINSQVSGSGLTVKNARGSSPSSARLSMNMAITTVAQSV
                     ITLSGVMPANSDIRIVATTGSLAPAQSLFDFSGLALDSNATVMVENTAVTWPKDSINT
                     GSIVLISAGSNAVGIKSTAALFVLNATAINGASVVSIDTQSSFPITKGAALTVDYGRC
                     ERCSSALVSINVPLVVDASSLFRVANCKVVGASNGLLTSAGSITVSDKSAYVIHDSAV
                     ESGALFSFPTGLEDASEVYPFAVSGGSTVSFLNLKGSSTGVAAGQSVPNALEQSNVIG
                     GGCVINDKELRVASEYRSHGLSVETVVDSQGASSGTCANAKCIPGNTKPGATVSGTEP
                     CTCQCSSTKHHPPFCTSVVDPMQNYDPNVWCAVPNCITCDRLDPSNRCTECDTGYSLT
                     NDYQCKATTTTTKAPTCTAPYCSVCAAGSGSVCSSCRPPYTLSNGVCVANTNVAAGAH
                     TAALAAAVCVVAAFYAL"
     gap             55558..55656
                     /estimated_length=99
     gap             56974..57072
                     /estimated_length=99
     gene            <57483..>58529
                     /locus_tag="LDBPK_040170"
                     /db_xref="GeneID:13390691"
     mRNA            <57483..>58529
                     /locus_tag="LDBPK_040170"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858032.1"
                     /db_xref="GeneID:13390691"
     CDS             57483..>58529
                     /locus_tag="LDBPK_040170"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858080.1"
                     /db_xref="GeneID:13390691"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR006212"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y3"
                     /translation="MRCREILIAVLAVTCVALSPAVAYTTSQCREVSRCDVDGTLVYA
                     FSGECVCCPEMPTGDILPVQCVPSTAHCPSVPSCRACDTTAGMCDACMTGYVLEPTNI
                     CNECLASMCDVCQSSSEGKRCKLCSVGYYWVSGGECHAVSNSQASESNMQCRVAFCST
                     CASPTASTCAKCNDGYATDSNGFCVSDCNVQQCDMCYTGNSADCQLCSAGNTWSATGC
                     SAGASGCRVGHCTTCVAGDNTNCATCESGYTLTAGYCLPQQLCADANCASCPSDAGTC
                     TQCANGYGLVDGACVRCQVPNCFSCDSDANKCTQCAPNYYLTPLLTCSPVACNIEHCM
                     QCDPQTPSRCQECVA"
     gap             58532..58630
                     /estimated_length=99
     gap             60309..60407
                     /estimated_length=99
     gene            <60774..>62483
                     /locus_tag="LDBPK_040180"
                     /db_xref="GeneID:13390692"
     mRNA            <60774..>62483
                     /locus_tag="LDBPK_040180"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858033.1"
                     /db_xref="GeneID:13390692"
     CDS             60774..>62483
                     /locus_tag="LDBPK_040180"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858081.1"
                     /db_xref="GeneID:13390692"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y4"
                     /translation="MHSARGGSLAVAAVAVCLAVLATVGTCVFDSQEIGGSSFTFAGW
                     SSASKEESYQSCTLTEKAFRIQGAASSLSDDATLPGGILRFSTLRVSNGYIVVEKYFP
                     RNTNITIKDASGTVAAGMPFIDANTAIFSDQLSIVVTDSTLSWAAARSGQSMVRAPFT
                     IQLSSSLFVLGSTVAQASSVVEVTGPSSISQKSALAVDYAKCTGCAQGLVYFTDFVRV
                     WDRSLLRVSHSSVKGAAGKPLIGIAQRAGASLAVENSLFVVENVSSPTSNLIDAPVSM
                     GTDAQITLRAVAVKSIGATMAGGVTAQLLTADDIAQQIPSVSVVPDTSCAAACVPTAT
                     VDSRCKCTCNADMPNMNFCTAMKDPYTNYAYLGCSVGCTTCFNETACLECRPSYEMLP
                     SMTCSLTGLQCTDPNCKTCTTYGQCTDCNDGYGLTSSSACVRCSVAGCKSCPIDANVC
                     EVCLGGSEPVNNMCPCTDANCASCPSDAGTCTQCANGYGLVDGACVRCQVPNCFSCDS
                     DANKCTQCAPNYYLTPLLTCSPVACNIEHCMQCDPQTPSRCQECVAPYVVDSYDGLCR
                     LSDA"
     gap             62485..63164
                     /estimated_length=680
     gene            <63975..>64523
                     /locus_tag="LDBPK_040190"
                     /db_xref="GeneID:13390693"
     mRNA            <63975..>64523
                     /locus_tag="LDBPK_040190"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858034.1"
                     /db_xref="GeneID:13390693"
     CDS             63975..64523
                     /locus_tag="LDBPK_040190"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858082.1"
                     /db_xref="GeneID:13390693"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y5"
                     /translation="MSVKHLLMAAVLAAVACSVVMASDASSLSSPSAPARGSISLATM
                     RTVPSSKSSSNSSSATGANETASTTFTTTNTVSTAASSCAVSNCAACSSTNPNVCTTC
                     SPGYAVDRLGQCMVVGSCNVAHCVTCHTNDNARCLSCASGYMPTASFKCVPEQSRNAA
                     FRTSSLVVSVGVALVGTALTMA"
     gene            <66572..>67429
                     /locus_tag="LDBPK_040200"
                     /db_xref="GeneID:13390694"
     mRNA            <66572..>67429
                     /locus_tag="LDBPK_040200"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858035.1"
                     /db_xref="GeneID:13390694"
     CDS             66572..67429
                     /locus_tag="LDBPK_040200"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858083.1"
                     /db_xref="GeneID:13390694"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y6"
                     /translation="MSAFDFRSSPHKRGAAAVLLLFAIAAVAPLTVSAQAIDDYPPVA
                     CDSTVPNCLECRKVGMLSLCSNCKEGYSTAVSPMTPTEFGKCKPYDPSTCRLDNCLRC
                     AADDNTKCVQCPVGYPNINTYLCDGTTAAPTTAAPTTSAPSTTTTASPTTAAPTTAAP
                     TTTTTTTTAVPTTAAPTTSAPSTDCQAPSCAICVPGNQYTCAVCESGMVLMASGQCMA
                     AGSCSMTNCAQCYPNDSNRCSSCEPGYALTVSYTCIPRKSGNSAAAPTPVLAALVIVA
                     VAATVAYVM"
     gene            <70452..>71516
                     /locus_tag="LDBPK_040210"
                     /db_xref="GeneID:13390695"
     mRNA            <70452..>71516
                     /locus_tag="LDBPK_040210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858036.1"
                     /db_xref="GeneID:13390695"
     CDS             70452..71516
                     /locus_tag="LDBPK_040210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858084.1"
                     /db_xref="GeneID:13390695"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y7"
                     /translation="MAPHAAVLAVATVVAVLLGYGTRGVCGYNFVTITSLFYVPGATG
                     TRSEDAGMCLERGGYLATEATAVLHEADVQALESEGFTTYYAFLGGGIVQPWHMESYE
                     MGFCPFSIKDPDIWWDTSFSQTNGDNNNCYWRWSVGRWIEMPSTSSLPYDEGKTGIIF
                     YRGQSTLGYDRQVNGFPLFFPFNPPMYHPNMQLGHHLVLYRGGLHPTEAVWGDTYARG
                     GFTYGDNFANNPQLVEATLKDWRLVCQAQGPLRLNYETASASSQLQGRWWAVFFSILF
                     VLCLITFLALVFCQEREDMDEPPEDAPEWAEKETAQRIVSRRYVSQRSFRGNESSSSR
                     NSLSDGSNSSKDEDGESVSR"
     gene            <73344..>74120
                     /locus_tag="LDBPK_040220"
                     /db_xref="GeneID:13390696"
     mRNA            <73344..>74120
                     /locus_tag="LDBPK_040220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858037.1"
                     /db_xref="GeneID:13390696"
     CDS             73344..74120
                     /locus_tag="LDBPK_040220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858085.1"
                     /db_xref="GeneID:13390696"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y8"
                     /translation="MATMENVAFAGYAYYSTGGEGFIYALSSKEDVESTGTPVIIVNA
                     TSKAVNFFPFLFLVVGGVLMVGLMASVMVTFCCRRKVAKLEKMYWELQYAFADVNNTL
                     VQEASRRTTSPASLKQKHTPQSTSCLVAGSQSPPQMMQRHGSIARVASMRPSQHIMEP
                     LPPAAPVFPAAPLPYGMNANPLYFQPVTTSAASPYTCSHGGKGAQVTVFAAQPPPIPS
                     SPQPQRQTRLSVGPAAPQSPCTTPEPPLRRRASKVSFIGA"
     gene            <75501..>76373
                     /locus_tag="LDBPK_040230"
                     /db_xref="GeneID:13390697"
     mRNA            <75501..>76373
                     /locus_tag="LDBPK_040230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858038.1"
                     /db_xref="GeneID:13390697"
     CDS             75501..76373
                     /locus_tag="LDBPK_040230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858086.1"
                     /db_xref="GeneID:13390697"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:E9B7Y9"
                     /translation="MQQQPRPVVAQYAYIELLPLIYTGPAPPPAPACMDPTPDEQYRR
                     GVAEKKEALKQKEARRQMSSSGSGMLASLKSAVSQAVMTVEKGAADVSTRTESQVRQL
                     EYQYDCDRFNLHFHELAESGEVLLADYRCSAMHGGLQVKGHIQITRHYLCFFAETSSS
                     IAKTTDAVMGVFAAARHPTNPNDEPRNRPVGVKQVIALASIVSIQPSVVLESIGGQAP
                     FFMLLPAPTVRPTALQLYTQDSKLYQFMNFESLISRASGALNDVVKGTALDQAYNYLD
                     HAWRDTVNLQSKDV"
     gene            <78379..>82785
                     /locus_tag="LDBPK_040240"
                     /db_xref="GeneID:13390698"
     mRNA            <78379..>82785
                     /locus_tag="LDBPK_040240"
                     /product="RNA pseudouridylate synthase-like protein"
                     /transcript_id="XM_003858039.1"
                     /db_xref="GeneID:13390698"
     CDS             78379..82785
                     /locus_tag="LDBPK_040240"
                     /codon_start=1
                     /product="RNA pseudouridylate synthase-like protein"
                     /protein_id="XP_003858087.1"
                     /db_xref="GeneID:13390698"
                     /db_xref="GOA:E9B7Z0"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z0"
                     /translation="MRAAWAATVSRRRSHIACGSSSSPLWALQPRRASSVHRGRVSQA
                     TSGASSNTSSSHASNRRGRRPKRGQPNARHIAPAAETRFSASSHRMGCGHIADRVKRR
                     RQLEDAIHAAQAFRSWCVMHAPCTQAAVGASVSATAALRPGELSPSHAPVLHRVGGSV
                     ATLADIGYEEGANSRTARHHLGFSPPTAPTTNPPLTAGGAVPLTERRMLEHYAVLLHN
                     VRAAATRVATSDYHRFYAAVVEELLAASKSGGGGGAFSVPRSVVWQDAAASTYHGESG
                     EDATAQAERRLAAWASYWYKDLKQWHSRHGTHTPGAGNAVDAQQMLLHGELWQDVLDG
                     GDGIIGTREEDKSMAVLLLQGQWRAAIDSLLEADATPPRSASAAAMEPNGSSTTASQR
                     PSVAELFSTASVRRRHRVPWRPSSHRGSANSSSSTLPPLPRRLALAPVTPAELRLLRH
                     PPSPGLRVLPHSIASKVQQAGCRERPAGEEVAAAPSLLLEAAAAAEVAGGRATGIPPM
                     CVVRLRRRLWVLQHLPRHLPASLVRFQEPRRPSLRAGGGSGREVRSGAIPHAHLLRSH
                     ALEKLPWYTLCVLGEVLEASGNGGSTVATVLRNARTHMCAALFLSVHADYAALHDYAH
                     TLFLTLGSSMVARAVVARQRQRGRSDGDAAVTVFESAFAQTAIALLQPPPPEAYAAAG
                     LSPRPASSSGNAADFLARSSSARTPSSSTDITDVHVVPPRVFRRLCAAVQDWRNYHLS
                     LYCETLSQIADSDGMALRELARVLAAQPHGEDALQEEVAVVLAPESAAAIVTALLLQL
                     LDQLSRPSASPSSTTARAPLSFLSNAPRTAGAHASAGCDPQGASPSLPPLPPVLCFSV
                     PHDKAHAVASYFKGIFHPSFFRRVVTAAPCTNGDECQLGDDGAAATSTITTTITTGAR
                     TADEENGKASALPSFVLPPAEWERNAAARLVGRTLRRLDRYPTRTTEAFFARYVRGDD
                     VHSKREVGEEGGSEAAAAQSSSTTVAPPLAMSLFVVNLQAAVDHWRERHRSPILGVPP
                     PASSHAQQQEQVSLPAQPSVSAARDGRTADTKSAATAAATPAGAEASLTETGKDGLPG
                     PIVLLASPRMLPHGLHAVYKPAGVNCTLHAHYPSLVYPFLTRELPWRARGAVAADGSD
                     RNRGAGASSSPAPCVPVLRQQGLVNRIDVGTSGVVLVARTAAALHSAADAMIREHHMR
                     KTYRALVQRWPPFSSSSSSSASTVPCGDDSAATAPLFSVSPFLSPMASAVVCAPVYAA
                     GATASSIRRRSALPLSHGRQLQPPGQPSADALAASRASSTLSWSSSVHVSPSSLENVH
                     QQYATLHAALQDQRNAITRYRVLEYFASAGVAYVQVELRSGRRHQIRQHFAQLGFPLV
                     GDARYHAGVVAGHAGTTFGMQRAALHAYTVDILATTDSDGLASGEEVPDRVVVQAALP
                     ADMHRALLALRQAEQAKSGQQQQQRQPQQPRG"
     gene            <83452..>84258
                     /locus_tag="LDBPK_040250"
                     /db_xref="GeneID:13390699"
     mRNA            <83452..>84258
                     /locus_tag="LDBPK_040250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858040.1"
                     /db_xref="GeneID:13390699"
     CDS             83452..84258
                     /locus_tag="LDBPK_040250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858088.1"
                     /db_xref="GeneID:13390699"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z1"
                     /translation="MALPSPTSSASAPPSSRDKASYCLQQAQAAKAAGNAALQAGNPR
                     GASFEYKKVYLYLAEYLPSDVAQSASSVALGYSNGGGSNADGNSGLVQMLQQQQRRKQ
                     PKNVAAAAVTGHESSASPSTAEEAALLKLQEEMTQLYATTLNNLALAHMKLGRYQEGV
                     KCATAVLEQPALRAALDAGAEQCTSARFSDTPAGKALLRRAACYVKLSDWALAEADIR
                     TLRRATPEGAPAASGGDALDTAVVQLTQAVEQGRKAEAAKEKKMMRLMFA"
     gene            <84896..>86338
                     /locus_tag="LDBPK_040260"
                     /db_xref="GeneID:13390700"
     mRNA            <84896..>86338
                     /locus_tag="LDBPK_040260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858041.1"
                     /db_xref="GeneID:13390700"
     CDS             84896..86338
                     /locus_tag="LDBPK_040260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858089.1"
                     /db_xref="GeneID:13390700"
                     /db_xref="GOA:E9B7Z2"
                     /db_xref="InterPro:IPR010729"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z2"
                     /translation="MRCSARRANVAALYEFVDGNFLNNKRPAIPGGAWPLESLRRKSL
                     ADLQQIWLSLLKERNMLSTIKEHYLRHQEELGAMPAPSRLKMVEESMENVKKVVKERD
                     AEATAEAVRIFKERLAKGIYRYPPGPPPPPGAHDPTSTVKLVLSRRVDEERLRELLGR
                     FDVFEAHKGIVTLTMQLPEDVLTQKRDAEQLWQQYMAERRDVEEYYKWPGSSTGSAES
                     ASVYDHTVVELAPGVYSGHRGTSAAESNCVDNSNAGDHGVIQAARLPVPPPKTRPPPP
                     RNPLEHIKYQQRSVLSKAVIQLGYFPNITITAPRFTKADDVPRPVHPDEIEGPWEVRV
                     TYDAKDGLDYVQSLGLTSIDGAAVLSVEEAFPEAAQPYAAVDPVYQEAVRREMAQEET
                     LMKWPNVPKWKYQYDLYTKKHLAQVVQYNYSNVVDYVDREVLLTGRSVWESPIDIDPT
                     CGGMKSVPAHAKKPKRYMTHGLGEVGVTDI"
     gene            <87229..>92787
                     /locus_tag="LDBPK_040270"
                     /db_xref="GeneID:13390701"
     mRNA            <87229..>92787
                     /locus_tag="LDBPK_040270"
                     /product="adenosine monophosphate deaminase, putative"
                     /transcript_id="XM_003858042.1"
                     /db_xref="GeneID:13390701"
     CDS             87229..92787
                     /locus_tag="LDBPK_040270"
                     /codon_start=1
                     /product="adenosine monophosphate deaminase, putative"
                     /protein_id="XP_003858090.1"
                     /db_xref="GeneID:13390701"
                     /db_xref="GOA:E9B7Z3"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z3"
                     /translation="MWGGLVGARGGTAAAGSNTNASAVTNVYTLQLPGDDGGVEMAAA
                     KPLLLGALRMRETYKGVDKGHCEVGIGGTGSGASNSLTSAATLAADASRATHSMQGVP
                     HPPQPASQSQHLQTQQQQQQQQVPSPPLMTGPTTLQQVDGVFHWSDEKTPIASWAQFR
                     ADVLALAACVQDPSCVAASKYRLEVLEEKYHLHRLYNADVEENSDHYRRGGGLFANAC
                     RVDTCVGAATAMNAQVLVEYIQRTVDERGDDIVGVSDSTPLGRGLATAGASGGSSGVV
                     GASGGEQLTLARVCELLDFPEPYLLTVEGLGLQPSVNRALPYYDALDPSMNGGGRNSA
                     ALLRLFLSLDQRPQWGAYLAGVVLPCLRRNELRTGGVQATEMTLEITGALAQEWENTA
                     AWVRTHELDSFCSNQFQLAFPVTKWCSRGGSVGSGAFSFFDMHVGRAYSGEACDDRSI
                     TANNMHGVGRGPSDSVANGNAASAAALPPGASSDEAVNYDNYQQLLDHIFLPLFMATL
                     APEDPKYVDLATLLQHTGAILLTGNENADVMGSTAAGGGGHGCANGTRADGGAAAGKA
                     AALHVDAMSTDWRRRPADTPYTEPVSLTYLCYYIWANLCSLNALRRRRGQNVLQLRVV
                     ASSATMPNTSSAHDASLLLLSYLIADVVVDAVALDRQPVLQYLYGLHQIGVAMCPIAR
                     SSLGTTSLDEHPVARLLWRGLCVSLCTLNPLYYHSSQEPLLEEYTTAAKMHRLSPTDI
                     SEMALHSVCMSSFEDEVKASWVGAGLLRDGWRANAVELTSVPTARLQLRYESWTAERK
                     LLLPPSGSPAGFPTGAAGSVAEIGSPLDDTQSMVRRDMATAARRFTTTPSPHRNASNA
                     LAPDGQAGMGLTGGAAAALQSQAPYAVLDPAVDFPRATLIGPFDRDIQNAHLVQALHR
                     ALDLRHQYCSLPLPPEPSSSAGAAASDSVSNSDVKAGWLAALTHDPHAVLPHPTQSMS
                     WAFKGTVPSSSPHKKTSGGHAAGATGASSMVHGASSYLQFDEDEWKYKTVEGIIVPHE
                     VHQIPRLPQDMYHYTEFCNHVEEIRCLIDNIRVRDFALRRLQLLEHRFKLHAAVNHSR
                     ELGSTAARASHNRDFYQSTKVDNNIRMETGMTARQLLAFIVDKATHNGDDIVSHPKGK
                     EPQTLRQLLADLHITADTLTVDDLNVQAGATSSNGGAPQNPFASEGQQQDELLTLLLK
                     TDNQMNGRYFAELTKRTFEELSRDQHTFSESRLSVYGASAEEWALLSHWFDTHGMSSS
                     HNQWVVQVPRIYSSLRKAGRVASFAEYLEHVFEPLWRISLHPNSDPRLFHFINHIAAF
                     DCVEDEQRPDVPLHLAMRSPHEWTTEDEPPYNYYLYHLYANLRSLNRFRQRRRFSVFS
                     FRPSCGEAGSVDHLIGGFLLAQGVNYGVRLADSAPLQYLFYLAQIGVTLSPLSNNTKL
                     QLNYLHNPFPQFFRRGLRVSLGTDSPLLYHHTQEPLLEEYSIASKIWKLSPNDLSEVA
                     RNSVLLSNFSLKFKEEKLGAMHFLSSSAGNDVAKTHLSDVRVAYRFEAYHTEVGFLEY
                     ISGLHFHRALLTLEMEAQCMQLYGVNANDSSGSTGGGVVGLIDKTPKEADLVKLEAQR
                     TCMQRQLRELTSAVSELHRQNRLLTTKLAEEKERDQLAAQLRRRRVDAKLRELQNLVT
                     QKEVRPHTRAASEHQQPRDTPDDDKGDVDADKSGVPSVPHQLTPCAASVVSPSPLSSM
                     SLRAGSAAASVPPAAVASVATPSALPPPSPPTLHAPADSASSTLRKQQQQGDAVAQTR
                     RLLAHTESLWRTSFVQADGLHGADGGRGKQPLPQLPPLEATITSSSSQPSASPSSLRK
                     RWSPSPLVDD"
     gene            <94212..>95558
                     /locus_tag="LDBPK_040280"
                     /db_xref="GeneID:13390702"
     mRNA            <94212..>95558
                     /locus_tag="LDBPK_040280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858043.1"
                     /db_xref="GeneID:13390702"
     CDS             94212..95558
                     /locus_tag="LDBPK_040280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858091.1"
                     /db_xref="GeneID:13390702"
                     /db_xref="GOA:E9B7Z4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z4"
                     /translation="MRSSRHLCGLPTVRTVAATGWRYHRHGAPEKVLQYERYRVPFDR
                     TSGQVVVKMLAAPVHRHDKNLIEGHGGPIAVPKACLPHVAGVEGVGVVEEVGSNAKLA
                     LKEGDMVWINNPSVGSWATHIVTDAENLDVVPCRADVDIEYLASLSLFHTAYHLTHDF
                     VNIQPNDVVLQTGASSSIAQICQGYLRAKGAKLFQTMQLGRTEHAHLLAFFKLRGAFA
                     VVPYNYARTNYMRRLLSDVPPPKLLLNHTCGGYASNLVNLLGDNGVCVTYGNTSHQPM
                     QISNMDAIARGVQLKGFFLPSWIQRHTREARMRVHQNVVESMTITQGHGIFRAQRFKM
                     DGDSAFAFSNAWDAPLASRKAVLRIVGEYGEWRRPRSDQAGWNIGRAVWEDMLQQMWE
                     SAGTTENPQSMKYYTPFDDIHSSFYDAKQSKELGHRDVFFRRPNAPRHNAAEQQQQ"
     gene            <97149..>97958
                     /locus_tag="LDBPK_040290"
                     /db_xref="GeneID:13390703"
     mRNA            <97149..>97958
                     /locus_tag="LDBPK_040290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858044.1"
                     /db_xref="GeneID:13390703"
     CDS             97149..97958
                     /locus_tag="LDBPK_040290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858092.1"
                     /db_xref="GeneID:13390703"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z5"
                     /translation="MTPVAAVGSMSTSGALCVAYRHQATDQFHRFLHNPHVVQPDGVD
                     GLPRVKGDQQQWLNTEQWHGYSDTYLQRHMQYPATVELNNPAVNARHDLLYECLGLVY
                     ELYGGLAEDLQELHDDPLHPHFHRRIARIKRDRERIAAELDKRYAKLHPTVKTVYDAF
                     LVRRYYHLADWIEHVERKRERLINDLSPDVMEKTMRMRGIAEQYLRHLRVLEHALYED
                     PLMGLLEGDRDTNVLNQYTPGELAILRQKAAYFRKMRRFGANQLDADLHTH"
     gap             98519..98617
                     /estimated_length=99
     gene            <98681..>100474
                     /locus_tag="LDBPK_040300"
                     /db_xref="GeneID:13390704"
     mRNA            <98681..>100474
                     /locus_tag="LDBPK_040300"
                     /product="beta-fructofuranosidase, putative"
                     /transcript_id="XM_003858045.1"
                     /db_xref="GeneID:13390704"
     CDS             98681..100474
                     /locus_tag="LDBPK_040300"
                     /codon_start=1
                     /product="beta-fructofuranosidase, putative"
                     /protein_id="XP_003858093.1"
                     /db_xref="GeneID:13390704"
                     /db_xref="GOA:E9B7Z6"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR003014"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018053"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z6"
                     /translation="MIAGSVRRGVILLLVAVVVATMAAAAVAKDGVPYEPIFHIRPPK
                     NWINDPNGPYRDPVTGKIHLYMQYNPNGPLWGDIAWYHVTSEDYVKWTRPESPVAVWA
                     DKWYDKWGAYSGTMMNNNYSEPVMVYTCTEPENIQRQCIANPPKSDLHGKRTLDNLVK
                     SALNVIMSEDMIPGIVAMENFRDPTEWWQDPTNPNRWLIAFVARIKDREGDNAHVIVF
                     STEDPSFQSGYSFSHSLYVYKYDLDHMFECPDFFTLKQGGEHYLKVSTMPSHRDYIIY
                     GSYQLNTTSKQYVFVEDPARSFTFIDYGPFYASKTFYDPILNRRTIWGWTNDELSNEQ
                     IIANGWSGVQNMLRTMVYDHTEKKIKTQPVPETRGLRLDKLVDLRDVAVTATPTEIIA
                     SNTNNTLYHEIVARFTLADPTTFAAATTYLSDSDVPEVGVMIRANANLSQYTTVSVRM
                     PGGGPGALRSTEQTETYPPIKIFAGSSADNCSAECNKMRLCESYTFWGETNTCKLYWK
                     TNPMRSKDDATSGTVREPLLYLGRTQSGTIGSTAPLHGRAPFATATPNGFELHIFVDD
                     SVLEIFKDEGLETLTGRLYIDNGADTTGIAV"
     gap             100535..100633
                     /estimated_length=99
     gene            <102582..>102692
                     /locus_tag="LDBPK_040310"
                     /db_xref="GeneID:13390705"
     mRNA            <102582..>102692
                     /locus_tag="LDBPK_040310"
                     /product="beta-fructofuranosidase, putative"
                     /transcript_id="XM_003858046.1"
                     /db_xref="GeneID:13390705"
     CDS             102582..>102692
                     /locus_tag="LDBPK_040310"
                     /codon_start=1
                     /product="beta-fructofuranosidase, putative"
                     /protein_id="XP_003858094.1"
                     /db_xref="GeneID:13390705"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z7"
                     /translation="MTAGSSRSSPASRTARATTRTSSSSPPRTPASRAATA"
     gap             102695..103326
                     /estimated_length=632
     gap             104538..104636
                     /estimated_length=99
     gene            <105520..>108084
                     /locus_tag="LDBPK_040320"
                     /db_xref="GeneID:13390706"
     mRNA            <105520..>108084
                     /locus_tag="LDBPK_040320"
                     /product="mitochondrial exoribonuclease DSS-1, putative"
                     /transcript_id="XM_003858047.1"
                     /db_xref="GeneID:13390706"
     CDS             105520..108084
                     /locus_tag="LDBPK_040320"
                     /codon_start=1
                     /product="mitochondrial exoribonuclease DSS-1, putative"
                     /protein_id="XP_003858095.1"
                     /db_xref="GeneID:13390706"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z8"
                     /translation="MRWRLFAFARVRGTAAVATPTVGVVAALQRRGAASKVTSTTLGS
                     PAKSSHHTTSSTAPRTIIANAAAQFSGTYLDVAWTRQFILGSLLQRYDPLRYAPSSPS
                     SPSSITARLVESALLESQRLLSSTWKLPVRPLDAVSEARILRLLARYAAGEGILSDTA
                     LEMLQRVLARLPGAPACISDPVHMRTLLELIGYVEPGDNLNRVAYAGELRYPPQAHAF
                     MTELLAEVRQRDGGDAFDAIRERRAGPGYAIDSATTSEVDDAIGVSVDGATGAKYFVV
                     YVSDATVYCPFDSTLEQLTARRLTTTTYLPEGVFFMLPKPIVEAATLREDRPCRTFNV
                     IFQIDESTGEVKNYSIAVGWLDQLRRITYDQVQEIINEEEGREDGDEHDSTAVVAAAH
                     DKHTSSSPPLLAECAGSAHPPPAWMTREDKDNLFYILRCARLRLRARLERQQRQRQQH
                     HRGAGGKDCGDEGVPATPPVDFSLPDPLIEVKGTEVLSVTDQVISTQDARLAVAELMI
                     AANEVCSRVAQANHIAMPFRGTRALSSDHLVAHYYTEPEGVRTLTSLDASHIFLAEAM
                     QSSVRRLSTVTRAIYHHVPLHHAGLDTTFYTHSTSPLRRYADMLVHHQLKTWLWQQRR
                     GGGSSDHTSAASTSAARAAMVAAPQQLIPEHAMASLCAMISAKQERASLLQDNSTRFW
                     ILRYLEDLERASANAAAAARGGSDGDAHHKKTYLCLVGETRRVVAAPAYSRFACSSAE
                     MSQLLSLPLTAPSTTSSTVRRPASLQMDAVARWRQETPEFTYVSDVYIPEVQLAHTIT
                     HHRDDVLVGAVLECHITRVQPTQGVLELAIERVLPGGDERHYERLWMGGFVSQLDA"
     gene            <108720..>109274
                     /locus_tag="LDBPK_040330"
                     /db_xref="GeneID:13390707"
     mRNA            <108720..>109274
                     /locus_tag="LDBPK_040330"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_003858048.1"
                     /db_xref="GeneID:13390707"
     CDS             108720..109274
                     /locus_tag="LDBPK_040330"
                     /codon_start=1
                     /product="ADP-ribosylation factor, putative"
                     /protein_id="XP_003858096.1"
                     /db_xref="GeneID:13390707"
                     /db_xref="GOA:E9B7Z9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B7Z9"
                     /translation="MGQLFTSLWSMFKGNKSYKLLILGLNNAGKTSILYYLQLGHSIA
                     TQPTLGGNTETLTITHPQTNNTITFTCWDLGGQEQLRESWKLYYDHTDAVLFVVDAAD
                     AVKFPKAKEVLHQLLHGEPSLQHATLLVLANKQDMESAAAPAELIEYLELGKLRDRTW
                     TLMGCSTSTGESLREAMNWIAENV"
     gene            <111256..>117669
                     /locus_tag="LDBPK_040340"
                     /db_xref="GeneID:13390708"
     mRNA            <111256..>117669
                     /locus_tag="LDBPK_040340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858049.1"
                     /db_xref="GeneID:13390708"
     CDS             111256..117669
                     /locus_tag="LDBPK_040340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858097.1"
                     /db_xref="GeneID:13390708"
                     /db_xref="UniProtKB/TrEMBL:E9B800"
                     /translation="MRYPRPTSSQKGDVISDARSSNSPTPLSLDVPSPEHAWTGVELT
                     HTLDGTPAGGEGGAALGAARTSAIFSFPFNAAAGRPLPSFAPLLPTQRTPLWVDATST
                     DGSAHVPKQKMGDDAAATPQPAPPCSISKPPFPSVSVSGATTKGCGEGHEAAAASPAA
                     RRQVQLSQWAVSPLNSPLSVPSVAASTRSRNKRRFEDLTPLEQRLESPVASSFTDLFV
                     GLERPRLRGRRPREGLQRRGHHRRVHADGVSDVEAQASLLSSSSLSLHQICSTSHCDD
                     TFSDEDDIDDDSYESATEDEDGANTPTVYRSPQLPHWWRSIAAPVPGTRVSLRPDTCR
                     HEFWWIDRLGFEAHEIVRVVLKHSLEGVVLRRSGETAVVVEFRILPKLLKSTNYDVAR
                     RSRQQRDASPSLAADASVSESPRMPFTDSARSLTPTVSLTGSQPVDAAEAADLGDQRI
                     RSGNRGSRTVGISSPDVRLQLPELVRADSGGKAECSQREFAEPATSTANGTTTTAATT
                     VTTTITATAGSIGGQLTSPSSFPLSPKRPTRESVSGGREENTPSTQVSVRTSSLRSPL
                     SPSAHPSLSLAVGSIAVTVAGRSADSLAEQDPQWPVLARVLDTTTNQHQHQSLRLPVA
                     QTSPRTSAVAATVKAAESMSGNGEAEADASVTNGGGGGGGESARPLAPTSVKPNANGS
                     STSVLPVAMSPVRRLIQESRPATKLDAVHNTSIVGGADDVVASVEPTSSMGTQGSIGC
                     PSPWRSSPQPQLPCGKLPPTVKVNSMVANGTGSGSSHSCIRNNHSGGNTHLSSISEEG
                     TFLVHVELHHNLKNVGVNQRRNGGAVVAPPAASAFNPLPSASSHSVPALPGNSNSDWQ
                     HGSQRSQQPHPWTVGRQLSPRQPHRQHTLSSPISAANLYPDTTEKVVAAAAEAARLED
                     AIVPTTAAAATPSQQQPAVWGTPQHAMDEDDDSVVAILTLPISVCTPIVVARLHAMRI
                     LHPLLPAITALHGPAFSASIAGDYRNSDNTDTDSSNEALVTAPQPSNATPPSSPAAGA
                     QGPDYAGAIRLLSEAIEFFKEEKNAEEEAPPSMMPTPEDHAPTRARDLSILYTVRSHL
                     LFHASPTCLRDSLQDAEAALRCCPARDHINPTYEVLAANLISFGYVSEVEGLAGHLRH
                     RWRAASPLLLRLGRVTQVMVSYASIFLRQQLPTSTLRLCAGGSANMMLPSNTSDTATG
                     SPSLTAISLSPRSTPLPTEHTSSYLGHRGDERSSRPEVAAATANTLLQPHKLPYEVCP
                     LPLGRHGRTLHNRDEPPRQSSPISTSPLSFPATGADSASADSMPHLRSPLRGSRQSSR
                     PFRPGADVCHRRLFLLEMLFPSMNPAPVSPLPLPVSRGYRGATGRRGWQPNSTKVTIS
                     GGNDNATPSNVVIVPKTETTRPVRAEDFMYDRNSMLALLVATADTTMQWGTVPMCYFC
                     RHIRLSATRRIQKDEVIFVERPAILMPFWPLLPSRLASASTGAAAPRSSSGTGAGVSD
                     RPVSTTPEPSCCAQCGRQRLAKPVNCPGGCHSVYCSEQCRQRALRLYHVVECGGVPPD
                     PNNAGVLEPGDDVGARVRRTVAVLQDVFSDWNSYLHHLARWDTPSTRLTAQHAACSPV
                     TTPGASPVSPSPVGEMPRHDASQQQQQPGGSDGETPAQEKRSCAPPPILTVTAMRVVA
                     RLEAMMLSLALPLELLPQMQNHPTWTAERHAMMRAAARTLRQRGLMVPASTTRGVNLY
                     CTHVDPQRLLLLEVLLQQLSVPFFADFNYRASPTVWEKLSRIPCEVARSSGNAVVTTG
                     PEKSVASPVDGLGPDMFRSLPLPHTPSPVPAKAPQQRNCFVELTPAQLEELLCDLHSM
                     LHRVYQVVAKELADVPSIPLCGAEGEEKNSLEWGLPGRWNCVELLGFLNSTRAFQQIS
                     DFALTSWAVVYPRDMEPPNVAAAMAADHRNTPQARPIFVGDDRPLNINPHHHHHHHHP
                     NQSSTITNEFSHANPSDMNTVAVPLVVISPWSCLTVDLHPILGNVPSGVIHSRFMIEH
                     EQRRRMLAYCAAAAGRRGGDGIGGGSVSEDSFLSVHSASSTSAAALLTGDDSARTGSL
                     RDDLNLQLLEEAAQRSCSNLHISLVYTPSKEPAVLAVAKKNITHGDVLWWESLSCREY
                     LSALL"
     gene            <118710..>119282
                     /locus_tag="LDBPK_040350"
                     /db_xref="GeneID:13390709"
     mRNA            <118710..>119282
                     /locus_tag="LDBPK_040350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858050.1"
                     /db_xref="GeneID:13390709"
     CDS             118710..119282
                     /locus_tag="LDBPK_040350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858098.1"
                     /db_xref="GeneID:13390709"
                     /db_xref="UniProtKB/TrEMBL:E9B801"
                     /translation="MALLAPKALHKRVKGTNVEVRKEVTDDNTDAQLALLYSIHADDE
                     TELRWLHNTLRPERNLVHPSDAFLHGMKALHPAAVFNTFDVKKAKLRRLTKYEKDKET
                     AMKRRKKEVAPTAAYKAAVNPHKTPRTGGAAPADEVRVLSRGMNKAQKARSRTRAAHK
                     SGKVVNGAEAPKAFFTKWKKRKQEKIGRGL"
     gene            <120350..>121411
                     /locus_tag="LDBPK_040360"
                     /db_xref="GeneID:13390710"
     mRNA            <120350..>121411
                     /locus_tag="LDBPK_040360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858051.1"
                     /db_xref="GeneID:13390710"
     CDS             120350..121411
                     /locus_tag="LDBPK_040360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858099.1"
                     /db_xref="GeneID:13390710"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:E9B802"
                     /translation="MRRALHAAALPSRAPLTPRRYKSYVLKFLRGQLPHDLKDCAGAL
                     GCLYGTLPDVDEYRQFVVPLQVLQQYHQLGYAKLPRPVLDPPQVDILADEVNQLANNV
                     EHHPKSEHLYATSLADLTGGPLFYCQGQWRCAWGMHDLVYLPTLTVAASQALGNRLVR
                     LWYDEVFMKEARTGPCVPWQQNYVRWQHTTPVNHVSIMIALDTLNKDRGAPCLIPGSH
                     RWREGQLLPPVPYDPTQSEAQQLNTIWDITNDDEQEMLADTPPATVDLRRGEALLIHP
                     KTLFATHGNRSLDAARCCCVHYMGEETCAVQDGPLLPHTTRFRAGTRVSGPFFPVVFD
                     PAMTEDLLMLDNKADGAAA"
     gap             124034..124132
                     /estimated_length=99
     gap             125637..125735
                     /estimated_length=99
     gap             128451..128549
                     /estimated_length=99
     gap             129763..129861
                     /estimated_length=99
     gap             130668..130766
                     /estimated_length=99
     gene            complement(<132459..>133187)
                     /locus_tag="LDBPK_040370"
                     /db_xref="GeneID:13390711"
     mRNA            complement(<132459..>133187)
                     /locus_tag="LDBPK_040370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858052.1"
                     /db_xref="GeneID:13390711"
     CDS             complement(132459..133187)
                     /locus_tag="LDBPK_040370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858100.1"
                     /db_xref="GeneID:13390711"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="UniProtKB/TrEMBL:E9B803"
                     /translation="MAVLLALAMCLAASIASADMLLAPSDSIPFTTFGQLQQVCAATQ
                     AGSTPVAMYTATMTALVANLMSEKKVTHAYVSAYLNADRRWTWFVYEGDEVIEMLMNS
                     SQWATGNPTGAHTTYRHVVYSTTDKGLISATGYDNYPVVCKYENQTDYSPPGKRFPWW
                     SILIVVVVVAVVVTVAVCCLCCKRKQFDDAGDEDSELTTHNGSFRSYGTSHTDSNKSD
                     GSSLFTSRRSSSSGSESQSDGSSS"
     gene            complement(<136986..>138008)
                     /locus_tag="LDBPK_040380"
                     /db_xref="GeneID:13390712"
     mRNA            complement(<136986..>138008)
                     /locus_tag="LDBPK_040380"
                     /product="anaphase promoting complex, subunit 10-like
                     protein"
                     /transcript_id="XM_003858053.1"
                     /db_xref="GeneID:13390712"
     CDS             complement(136986..138008)
                     /locus_tag="LDBPK_040380"
                     /codon_start=1
                     /product="anaphase promoting complex, subunit 10-like
                     protein"
                     /protein_id="XP_003858101.1"
                     /db_xref="GeneID:13390712"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:E9B804"
                     /translation="MEYNDDEYGRESSVEELAQSQESEQVASAASALPASSSSDASAK
                     PSFRILSTPQLAQWVRVHNQMDVGCSGNTVWTVSSAKHGNGVRHLMRHHDLNNFWQSD
                     GVLPHVIRIQLGQLTPVEAMAVYVNSAVDQSYSPRVIRVKAGTHSGDMTEVAKADIGA
                     GQECGWVLITLREMAGDDGDDLEGGGANDGGGGVAAGVKVQHTQQEVRPRQRDGGAPA
                     GGAASSYSPPIPYSEVAAVLGHGNHATPSSAGAQTSAAMPMNPHNTSNAADRWLWCTL
                     IDICICENQFNGRDCHLRGIRLMGPRYEELERVSNADATDTVTCARPLRGGEPLEGTA
                     DELQLR"
     gene            complement(<139499..>142864)
                     /locus_tag="LDBPK_040390"
                     /db_xref="GeneID:13390713"
     mRNA            complement(<139499..>142864)
                     /locus_tag="LDBPK_040390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858054.1"
                     /db_xref="GeneID:13390713"
     CDS             complement(139499..142864)
                     /locus_tag="LDBPK_040390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858102.1"
                     /db_xref="GeneID:13390713"
                     /db_xref="UniProtKB/TrEMBL:E9B805"
                     /translation="MRRGSRHAAAALPCSQSASNSVVSSPNSATVTTSGDVFGGNSPA
                     AASPSAGRRQQRLSRGSLSKACPSPPPSVSTSQQQQQRSQRQMKKGPRHHRGGGGRRE
                     AQRRRLPGSSASDAAMSKPKVPPSSSLPGRRSSSGGSSGGYGDVAAGMCTVEDVVKSA
                     VDPQAQFTMSSNTSRTTTITADDDGNEADSSCSPLPHQQQQQRPPDQSRRTKGNRDSK
                     PRAVRGRANTQLWENVQKQRRHLQSRQDRRRIAAKSSEASVEAGAAAHNVANEEDEVA
                     GNVQGSAAAPEEEEVTVSCKPRNGSRFSSPPATTAAAAAEETLENEELVPAAGTRRVP
                     GQSAKNAMATPSRRPAVTEGGGRSRHRRRLSPAHPVASSPAVSRGSSINDAVGDAAVD
                     EETQPLPRLSHAGHDDKAAVPADGPRRPLRAGNKLSRRQKQMSTAVPQPQSGPGVATG
                     MAPVTAVAAFSTRPPLPPFVPQDPIIVAQQVRHTAHAVVAESALPDPAPTVMRLAAFS
                     PAKGSITDPCVVAAVLPTSAGAAAHAVGPAVPHGGRVKDTAAPSTAGPPTVVSSRSMP
                     QQQQQQQSEEDKQLSRRGLRLGAAPFYPAATASLILAMTPEAGTNGGDASLPSLAAAV
                     PSPQSLLGSYSMSPARSPPLVRPTSSPLGDSVQNHSRSSTGGLMSGQSTFAAELAAAT
                     GTPWTLTVIAPSHSSPPSSIGRDDTDGDGPSSGTPSVPVKSPAHGAAAAASYSSNTEM
                     PNGMGDRPSMRRSALMVTNTATGARVSPATVTTPSGSPTALWSGSGGNGPQMRTSGHT
                     SGASSSTAAAATTSPGGAGHHSATHSGSTPQGVVVREFPQAPYPVVSRTTEPHQSQQQ
                     HSMRSPRLMSESDLDCVQHNRVAVSDVVAKDEGSLVDTLFADVNMIEDDESEVDGDDL
                     LSSRDGGERWTMQPAPSPVASGDGSPLVASSPDVRTPHSMNQQLQHRSGSFSAGVRML
                     GKEAGGQVFGGGYWYPSGPWASTDATGRGSGSGGTGTGSHRGGGGDVKTTLAAAVTAS
                     IGSGSGAAAWRGLSTPPHRHRAFSASCASVASTMSLIDPKQPQADGAAYDMMGEDDEW
                     EMNSSAYADSLDEAQIQWIEEQLRATENPAGYF"
     gene            complement(<145193..>146278)
                     /locus_tag="LDBPK_040400"
                     /db_xref="GeneID:13390714"
     mRNA            complement(<145193..>146278)
                     /locus_tag="LDBPK_040400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858055.1"
                     /db_xref="GeneID:13390714"
     CDS             complement(145193..146278)
                     /locus_tag="LDBPK_040400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858103.1"
                     /db_xref="GeneID:13390714"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B806"
                     /translation="MAEAQARKRTESLSKMYSKKPISEGYALWDREYLLAAMRVFTFK
                     AEGAPPFVLAPYLDSVAEITLQMHDLEDAAEQFAIAAGKYQLIDQKVLADLMRFKVTE
                     VSSSAEIALEQVQAYLAAQDPQGNGGGENSTAQTKSAFARVYAYLADLLLGSVDEEQA
                     SEAVLAQALTAAELAVQLGWDRDHCGWLIVGDVHAASGNYEKAKEAYGKALQRCPHYA
                     KALERQIGVVQQLVRAAEECGDDAGKATLNTELLMLLSRSIEVHPLANTFREKAFLLS
                     EMHGDDAALAFVAETLEHPPQEEIEVIGSSAKEMTSTLLKAKAAILADGNQLDAALEA
                     ATKALEVDPNDEEAKSIIRDLHESMAA"
     gene            complement(<147591..>159950)
                     /locus_tag="LDBPK_040410"
                     /db_xref="GeneID:13390715"
     mRNA            complement(<147591..>159950)
                     /locus_tag="LDBPK_040410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858056.1"
                     /db_xref="GeneID:13390715"
     CDS             complement(147591..159950)
                     /locus_tag="LDBPK_040410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858104.1"
                     /db_xref="GeneID:13390715"
                     /db_xref="GOA:E9B807"
                     /db_xref="InterPro:IPR001304"
                     /db_xref="InterPro:IPR016186"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="UniProtKB/TrEMBL:E9B807"
                     /translation="MSNACSTAARHTPAFGSFTTVRAGEPPSPSTSRALARWTVLPVA
                     LLVVAALAPGVFQPARADGGFNAATVASCPYGWSLYSPPMAIPTTDSAAEAHLCARVF
                     IRTPVPASSAESLCTSLFSSGSDAPLSTDGITPWPYATYASPHGVAVRSAAENAFFRS
                     LFSDAYNAGAEDDGVVVLGGAAGYGVVHWYADVSSNGGNALHQRQQMPTRAELLEMQS
                     PSWLNSSRAAHTRGGLPQQLAQTTAVEAASAAEVSAGSAAYTNFAADVDWQRHSGLIA
                     MRASGQWTLLTSAASAHAFACAFKADFTVIPPATASSSSGNAHGTSSSGSSDSSSEGG
                     SNSGVPQRGCGHAKRPATPQPAPPCLSGWTALPASVDTSDGAVNAVCYRLFANASEVG
                     GRLGKNFEGAREYCAAVNPKGSLASVMSQQENAWVVSALLSAMAAPPTPCTCDGSNMA
                     EAPAHAASVVTMSGVTDSARTVFLGGSFMRDSSSAGLIGSWYADQYLFSASEYAAASP
                     SSPAWPTSTNLYYSNWGEGEPALSYGVVGITPPPPTECDCGNASTSFPSPVSAAGMWV
                     GLDPRSTQPFLCSYLNDGSIFPSVPPTPMPNPSSTTSPAPSPSEHCLSGWSHLALTNS
                     CYRVFPSASTEAEGGSAVTAATMEEHCEQVLRGQVVVTKVGRVRAVAMQSIAESDYVG
                     SLLGLYLKNLRNAVVVPEGGSSGSIDSTSSPLPVSLAGVSFIDHGAGGFYLSGVRELD
                     PLLADRLWAAGEPASVKGCVAVDVGGLWYYIPCSSSSASMPANEAVRVLAYTCQYRAS
                     DIDPKQDLIPEATAQPPIPTSGPDWPSDSDSSSPWLPLGQRVQALSGAVHVVVAAGST
                     GIYTLQGPNATIPPVASVRGLHFFFAPLSAYYTYPAPRRAVDGTVIVPPVQTAPGMSV
                     DDLLSIAITGESSPVAPCDGQKDQPRIARVRANVITVRHTNHSEVGYVCVSQDGRNYV
                     PTAITYEVTEVTVDGFISTPSRSPGANSTAAWLPPLFCGTAIEVATTSPSAAASACAL
                     QRDIAIAEHATGTVQLVLRRSGGASAAGTVTTVLSPEVDTVVSHMRLSSSADCMGEQV
                     PFQLLDSEIEVRHVSSRRYTQSSSPLRAADGRGRGNASLKYSVFSYQHASVHAARLAS
                     LDPIYNSSEVSSVLAQSQHPAEYYVCVSVHKPPLTLTSDVAKIGAASRRLLALWGASV
                     NAGISSNSSGASTTFSLSIAERLAARTSVSPAGAAVRTYTAVPGLKAHLVPPPVSVKG
                     MWALPPRRLRQQRAWFTATSGSSTAAGSPWATLVPAAAARNRSAHYLLRTQHPFDSTD
                     PMSASSSSTVLPSTVHLHIPQYSSPIILLDGHNAERGMLALLSQNPKDCNRHQPLPLD
                     DPTRAAATWPRHLDTMVPLSTVTMTVEGSGTAAATATVAYMQLNLNHTGLWGHHPTRT
                     DGPAATRQTWYVCISYGALSPFLPVRQPTLRITVHRQRVDRFLIDSSVSFSSEAVAAA
                     EAADASTTHLSVNTGFAGMLWLHGLDVRLWSTTTLDSAQVAFSVVLPSSGTADDTAAQ
                     CSNANLFYAQRALGLLTPESCRHTRAAGGNSSADGDADCEGREAARVGMVVPLGFFTQ
                     HSLRRMQLCLSVPLPFATNTTGGSSELVPQRRFFAPLVNTTLDVRPIQLLYMGRYSSI
                     PASAAAVPPNPAAPPSTGATLIRLAEGARDVVLPLTGYGIRPDMTMFLSLQLCHGVPI
                     SSTGRHDNLVKEQSALNISVVSLYDLPSSYWAPMEAVNDVQGDGGSESGSAYQPRVFV
                     VLKHSDLLSKSAAQRLFGASTATADAARKPLNVCLYAPGTATLVFPTNFQLVVEPPRV
                     TAIRNLPSDAPLLARATAHMPPYNSSSSPLPPSSVATVVYAGTMDLIVEGFGLDGPNA
                     WLMPAVDCGNASSHLWRTPVQLSGLPSSTTTTVRIAVESGNVTSPLYAESTRYVDPQT
                     SYSSWFISLRQAETARVGADVNVSSGTYVDRFQWCVRIGETSEDVAVSPYVSTGLPYR
                     LVIPATDGFVVEDSPVHQNHISTVLALPMQHATGGQWFSMKLAGPIVDVVQAIGSPLY
                     MFLAPQDLSCYALKNSYVHQGLHSFGSASFSAVNGSAVLLPRWLTVPGIYQLCASTLY
                     PTLDSADEGIEAALQFFSLHGLQVRLANAVYGVSALNHTTSVTVEQGQEWALPISGSL
                     LTNRSLVRFHTSALQCSQPMVATKSSGGAELPDIRVQDAFTWFSLFGGKDDNRDSEGS
                     LTASAHYIVLSQSLIRSLAAPATYVLCFQPQSHLDWRVAPAISLVVETHVRRPTAYNY
                     FPADGSEDVALLTALPPSKVALEWNTGEESMVNVVGTAGRQVSLALWCLPAPTKSISG
                     GVGVEEDLVPCGDHRRVMFVKPMDNDEDPCFVDAEAVPDDVVRGPYVLHIGVLTMPYA
                     LSTRGSGNGDDAVPVIIPSMTQPWIMCLETGPERWREPVQPMFQLQYTHAMPTDFRVK
                     ADDASNTTAPFPAHKVGVAATTSAEVDRGTGMPAGGNTTLILYAQDSSQVVYLNGYGI
                     ERGHRLRFGARCEETMEPPASSRSRGGVSSGGGAGMVNTTLSDMADYHHRVAARQLLA
                     NTRLYTDPLPIEDDNGVFLVPSTHILLSEEATSGAGGIAACISTDGGATYAKTSLTLR
                     VLPSRLRIDTETTQRNLLAQILADTLLVPENSHGSVDLTALIKAGQVIGSSTEAATAS
                     PSSVGDSGMRDADMYLSPGTQVLLSASCSYNSHGIPLLTVSVSNVLTLAKHHTGTVTP
                     QRLRVCVRDPEAAVAAAAVLDSGVSEDDGGTATAFFMASGVYYRVISVQVGRVSLHAW
                     TPTEAMQADLIEQVVVRRGAREDLLLPVLLKSTAHAETAVAVASSPGDELLQRLELSP
                     SALSLLSLTRFYVGRPCYRSAQSPDPASAISPYVSSYAGMQLNFGADRITVSPLPLSR
                     RQQQQQQQPSSLSLPDSLSKTLVAALPSGNTYSVPHYTLESRGSVCFSVDGGLHYLSV
                     GIAHFTEKWAPTLRVTVNAEDAEKGKDVREEADATTAATPSTNAMRVYTQSSTTRQLL
                     DTRYVDPGTLPPWTATANHTEAHVLADLGQLTTAMLWTGFLGDNGFAVNGLLYLPAST
                     HAAPSAEASPSGLVPSGGPQPQPLLFSLDNRLQNISTNMTVTVAPWSLTCYGDAQQRE
                     FYVHPLDVGLLVTTAPGRCSAGMRDGVRVRVVPLSMAECNDTVAVDTFYLFDLATVQP
                     AAWGATAAAGEAASSPARAMQLPIGLRYTPVGLYALCLRQDLPYVSSLLSDNNARAPG
                     DLVTATYTATPLRLRVARNWTVVSVSSATVSNSSDNVVAIAQSSYAELPVTGTAVRVR
                     GMPVLFAFAPPSAQMVMRRGGSGPWTWSGGCAAVPEAWDPVTGMPLVSASASSASGPD
                     GLLLTAPWRNAQGGVLRVDAAYVSRVEWDTAAVVPAAATNGNSTTASPRYADRLRSYA
                     LCYSVDGGLSFQAAGTAGQTSPRTLAAVVVPPTITSLSCNRTTAADPTQRPLGWSADN
                     ATATTVRVQYLYSSPGADASITSSPQVVTYAARPPTYTYAWTSAFVGNGMGAASGRRL
                     PTVTTTAADVSTVAAAVALVRTSRYGARCDGAAAVSANFTQFYGATVFGADAWNVSAV
                     NASSPLAMPIFLINLQHGGVWSTADTAAVVAWRGAQTAKRVAQFERMNPALSQETWVN
                     QTAALWARYKDVPGAPLNGQSILGWATDAATAASRSNGESIVVCLSIDGTHFYSADVA
                     RAAALSSEAQAQQQVVIATASASSSSSSSTTTTTVTHLSPWPLYLRSTVGPSISNASA
                     NTTMASVTTQLLWMREISMVMELLARPNTNAATATAAAASGSPYLGYTSASLALFQEA
                     MAAALGVDPSVVAVQLHMSGFVALPKAAASLHAVESVAVAAVQARHRAAAILGGLQRA
                     STALMDNATADPQPVLLPTYALVLSIIADAVAYDAAVNTSTLSAAPDLLYRGVQLLRD
                     NVSGPALLATLARGRDAVATASLSSLTVNFTLRNGIDLHAANATMSAALPWSPAQEVA
                     WRRLFLSIPHATLTPGPVLDDKDNDSTSKVRWWTIPLLLVLPGVMVYGTYYVYKKYLQ
                     PANEPTKAPVVENRQ"
     gene            complement(<163515..>166925)
                     /locus_tag="LDBPK_040420"
                     /db_xref="GeneID:13390716"
     mRNA            complement(<163515..>166925)
                     /locus_tag="LDBPK_040420"
                     /product="serine/threonine protein kinase-like protein"
                     /transcript_id="XM_003858057.1"
                     /db_xref="GeneID:13390716"
     CDS             complement(163515..166925)
                     /locus_tag="LDBPK_040420"
                     /codon_start=1
                     /product="serine/threonine protein kinase-like protein"
                     /protein_id="XP_003858105.1"
                     /db_xref="GeneID:13390716"
                     /db_xref="GOA:E9B808"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B808"
                     /translation="MNSPSYTPYILHTHGRSGDGTAAAAAPAMNMQTTAAAATNVGSS
                     SSSMVGGAGSSSSVGPSSGSCVPTVHGVGYFNTFVKAIHPSDMKQALLPPNMRDRAVV
                     LDMTHSNQVAEATAAHRRPFSSGANSRRNSSFCGNHGRVHHHPSVSRAQAVSQRSYAS
                     GSNGGLRSSSSMSGFHTAAGIYNGKNSNHHHAAATHGVNDCALPYPESASAAPHPQPH
                     QQQQPGHPPSPAWRGHLSSMPTVNLGTSPRLLPSAVPAAASDQEDQHRRHYRARSYTV
                     GGRVSSSRSGGGAMVAATAADATTPSASGSVGYVDSATSPSPNRSVSLASSSPAAAAP
                     VFGAVATTAAGQCSRTSTLIRHPSVSRAGSSVETTMTAITATLPPAPPLPAYAESRAS
                     SAVTGTMTPRTPRPANAAIEAAAAGVSSARRGTRLIEHPSHGAFSGHQRSVSSDIVNG
                     LDDSVDSVRCGSLPSASNTSAANMMGSASGTSDCYNYGSATAASRHGGTAVFAASHRY
                     ARDSVASEDKADDEGRRHRGPLRRYSTTLTNTTTEDEDEPQQQLAQPSTLELLRGNHL
                     RRESGACAGGGNVNVAVVLSRARAARTSATGAAVAGSTNRDGSPTTAIERWRAQEQQR
                     KRDEERKQQQQRQRLSARQWREAFHRLQEKRVQWRMRGYIGRGTSGVVYEGVLEDRKQ
                     TPVAVKVLEVGVPIPVDLDTSGDDGDGQSSRQARYTENSGTPTSAAAAAAADAAYMSP
                     SQQEALLVLLREVEMMEKLHHENIVTCLRCQVTPVQDRYLELHQQQQQQCRDGGSTNG
                     KGLSGAAAAGRDSERVGERRYDSAGRHYVDNGKAAVCDGAFSASQSPQRNAAARIPVQ
                     VEIVMELCNRGTISSVVRRSPGGQLPVRVARRYLRDVLKGLAYLHRNNFIHRDVKGDN
                     VLISADDVAKLADFGCSRRIVLTNNVHGTADSEGTTSSIATTRTAATDSRFTTMAEYQ
                     WFDTTGVAQTMVGTPMFMAPEIIQASGPPCMATPTASSLASSSGEGNDGGHGSSRKAT
                     SPPAPVGYTASADIWSFGCLVLEVFGRTPWPTSGSNAYHLMKQIEQSVADLPPGVPDG
                     TPAELLGLLRCCFHRDPHRRSTARALLRAPWMTCKDEELEEMPPRRRY"
     gene            complement(<171805..>174372)
                     /locus_tag="LDBPK_040430"
                     /db_xref="GeneID:13390717"
     mRNA            complement(<171805..>174372)
                     /locus_tag="LDBPK_040430"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003858058.1"
                     /db_xref="GeneID:13390717"
     CDS             complement(171805..174372)
                     /locus_tag="LDBPK_040430"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003858106.1"
                     /db_xref="GeneID:13390717"
                     /db_xref="GOA:E9B809"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9B809"
                     /translation="MSYPPTEADVISNDSLFSDSVEFDAAEKPIAAEDVHGFAEAKEQ
                     PLGHDDRGLPTDDAVMHAGSRYPEEEPAGPPPPVTNAFMKPRKTATKPPREWVPVNLQ
                     VPEEDQEDEFDIGTAQKPVYESPETPAATGGAAAPKVRFVNGEPDIRGEVTNCFEEPG
                     LLYRIVDRPNKTWAFYNDSRSFEVHVVCTFGKHSKITPLENTKMTRDESTGEYVMELT
                     VYPGETEPFIKGFVNGFSSKLSALPLSQEYFQARSEAQNQQVVQVEMDAIRAIAGDET
                     DAERILQICLENGLPFVDLSFPPVQSSIESGAAKPFKRLPWGRPRMYVKPELHDQIRL
                     FRNRICPGEVEQGELGDCWLMCAVTTQAEDPTVVMQMFRHPKGADSARCERAIGAYRV
                     SFNKNGLWRSILVDDYFPVIAGAPAFAHSRDLCELWPAVLEKAFAKMHGSYAMIQSGD
                     PMHALTDMTGFPAMRIDEMVAKAAVHNGRDLESQMIQWQRKGYQAILTTPGKAPAIPA
                     DAQSSPDFSDQPEMEEAFAGTGFLPGHAYSVLDVKEFQKGQIRLICLRNPWVHGSGWT
                     RAWAWDALEWQQHRDIATACGFSKHKGDTSIVWMTFEDALKYFIGGGVLFRAPAAHDA
                     RVPITFADCKPGAVFQVSVKAPMDVTFILSNMDHRGMHVDEAGAAESDPNNIDYPPVM
                     LSLAAPVPKETDVYQVVQNSSTDMTQPSDNAWLFLQAREIAMTCHLEPSAAPYLLIPR
                     LMEGDETVGNGNGGGEDMRDFVHPIYYVNDYVHLFRNAPSVKAKEIAVTIGFEADEEI
                     GDNIVVVMCKIGEGNAVFENFPKFPTDDVEPHEEELYFQTKESNCGYAQEKAGTAIY"
     gene            complement(<178510..>179949)
                     /locus_tag="LDBPK_040440"
                     /db_xref="GeneID:13390718"
     mRNA            complement(<178510..>179949)
                     /locus_tag="LDBPK_040440"
                     /product="adenylosuccinate lyase, putative"
                     /transcript_id="XM_003858059.1"
                     /db_xref="GeneID:13390718"
     CDS             complement(178510..179949)
                     /locus_tag="LDBPK_040440"
                     /codon_start=1
                     /product="adenylosuccinate lyase, putative"
                     /protein_id="XP_003858107.1"
                     /db_xref="GeneID:13390718"
                     /db_xref="GOA:E9B810"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR004769"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR013539"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:E9B810"
                     /translation="MSLPSAEEAAAPAVTTTAHKAPAEISQDSPLYSLSPLDGRYKRD
                     TTPLRAYFSEYALFKYRVQVEVLYFEALCKEVPAITQLRGVTDAQLGELRATTFENFA
                     VDDAKIIKGIEAVTNHDIKAVEYYLKDKMSACGLEAEKEFIHFGLTSQDINNTSIPML
                     LRDALHHHYIPTLDQLIALLKSKLPEWDVPMLARTHGQPASPTNLAKEFMVWIERLEE
                     QRTMLLSIPNTGKFGGATGNFNAHLCAYPGVNWLDFGELFLSKYLGLRRQRYTTQIEH
                     YDNLAAICDACARLHTILMDLAKDVWQYISLGYFDQKVRAGEVGSSAMPHKVNPIDFE
                     NAEGNLGMSNAVLGFLSAKLPISRLQRDLTDSTVLRNLGVPLSHALIAFASLRRGIDK
                     LLLNKDVIASDLEGNWAVVAEGIQTVLRREGYPKPYEALKDLTRGNAHVTEETVHRFV
                     QQLEGITEEVRQELLAITPFTYVGYTAHP"
     gene            complement(<183589..>183798)
                     /locus_tag="LDBPK_040450"
                     /db_xref="GeneID:13390719"
     mRNA            complement(<183589..>183798)
                     /locus_tag="LDBPK_040450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858060.1"
                     /db_xref="GeneID:13390719"
     CDS             complement(183589..183798)
                     /locus_tag="LDBPK_040450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858108.1"
                     /db_xref="GeneID:13390719"
                     /db_xref="UniProtKB/TrEMBL:E9B811"
                     /translation="MGCGGRLPDRYFSRIEAQQLLEELVCVCVCETAPFTCRPFTTIP
                     HLSLSMDAHCYTLLSPFCYFCNPSW"
     gene            complement(<185952..>186524)
                     /locus_tag="LDBPK_040470"
                     /db_xref="GeneID:13390720"
     mRNA            complement(<185952..>186524)
                     /locus_tag="LDBPK_040470"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_003858061.1"
                     /db_xref="GeneID:13390720"
     CDS             complement(185952..186524)
                     /locus_tag="LDBPK_040470"
                     /codon_start=1
                     /product="ADP-ribosylation factor, putative"
                     /protein_id="XP_003858109.1"
                     /db_xref="GeneID:13390720"
                     /db_xref="GOA:E9B812"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B812"
                     /translation="MGNVFSSWFEGLFSNKKASIVMVGLDAAGKTTILDKLKLGASRE
                     TVPTIGFHVETVDYRNVTFHLWDVGGQKRLRALWKMYYEGANAVIFVVDSNDRARVGE
                     VREELRTLLSDPLLAGAALLVLCNKQDLPHRLTPAELVEGLGFRDLSDNGLGRYLAGH
                     KWYVQGCCAHTGDGLYEGLDWMCSHLPDNV"
     gene            complement(<188219..>189190)
                     /locus_tag="LDBPK_040480"
                     /db_xref="GeneID:13390721"
     mRNA            complement(<188219..>189190)
                     /locus_tag="LDBPK_040480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858062.1"
                     /db_xref="GeneID:13390721"
     CDS             complement(188219..189190)
                     /locus_tag="LDBPK_040480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858110.1"
                     /db_xref="GeneID:13390721"
                     /db_xref="UniProtKB/TrEMBL:E9B813"
                     /translation="MAKSSRSKWKKMHRRQRAQAEATNTVKRIRLLNKKLELTVKGGI
                     SAVPPQEPEKRFHFLNPVLDSRVPNTRKNLNNNYRAELNHVQYDYTKPLKLAPPKTNM
                     YGKTDVDAPHPMTVMYETIDADAPLAGHALTKADMERLARRQAQQEREASAAVADAEE
                     DAGEEDGDNDSGDNADDGPEEYVFGMEDAAPRRTRGQQKTSAKKKGSVAPKALKGAAS
                     ASAGASSSVSVAGSSSRMLAAAAAAMANEEEEADHHPRHGGVTAVNKIASMQAMRKKN
                     GAMVSAGGASKMKKVGKLGGSSGTRVVSSGGKVARKDVGNAKNSTKR"
     gene            complement(<190130..>199150)
                     /locus_tag="LDBPK_040490"
                     /db_xref="GeneID:13390722"
     mRNA            complement(<190130..>199150)
                     /locus_tag="LDBPK_040490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858063.1"
                     /db_xref="GeneID:13390722"
     CDS             complement(190130..199150)
                     /locus_tag="LDBPK_040490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858111.1"
                     /db_xref="GeneID:13390722"
                     /db_xref="GOA:E9B814"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:E9B814"
                     /translation="MNSSRSSPPSPQTSATSWSTLPSPATAAGAPSPVSEPHVVYPAP
                     TDATAAPRAVPVCSRFAALRSSVLSPASSTLNLSASNKPAKSVPALEVGTSLLDRRKP
                     SPPSPRTPKAATLTTATTTSAAAAACASHSSKAQHTRRHPLADADSVQGRAGGGVGGA
                     STASSLSAACAPLSASLTAIAASSGKLYRPPHAREDSSKQRWSAGDGSGSGNAATTTD
                     AGTTVSGAPPTPLDSAAAVAGAAAGPTASSSSSPPPLRPSVSAAASKSTDASWWFPVS
                     KANSLLSVAPQRGGSSISAAPSSTVSMPATVAAEASGASPVATLPPPATCEDDQHGPA
                     GKSPAVHSSVTATPREPGAAERPEPTEPLPKPSRSAKRKQKVRAMAAAAAAAAAAAEA
                     EAEAEAEAEAEANRQPDTEVEVEVAAERREVVVAHPKGTSMAATSDRASARIGLGAHS
                     SPARTGSAPTKAAAAPNTSSVSRRPGWHPSFATSAAVSATVEGEGAVGVAGDAEVVGS
                     SGNGGPQMMANGLSSVMPVSFAGALPSKSYAGQTSTMPGMSDTAVQLLPTEMATAGGV
                     GGGGNAGYMNGYGYQLQQLLRHPHQSPTQQYYAASLLSQQQLQMAACGYYSRSHMASP
                     QQQQQQQHRSHARPSTSGVDRSSAAATTSPDSSCASANALLAAGAANTSAAGAAATMF
                     DPANTVMSASGGGAAPPPAPHRVPGLHRGRGAAAATSQSTAGQLAPSASPPPAPAATG
                     CAPPSALLPLHSGHLPSIRVGVSTTMNADSSASPSMTATGGTGNFAAPRVDTLSSNAT
                     AMGAGCTGDTMLSMASGMSQHHHYDHHTPPLAHPSSVSGQFSQRPHQHHHQTMSLGSL
                     SLDGGGGGQVNTTHHEDMESQPSMSPGAAQEHISATTSPNMPSRSQGGPSAAVNWGSM
                     GGSNHGRSANAKHKGAPSDCAHSRGSNSHSGSTVAGFDNSRRSGSRQSHTQQQAMMMN
                     QPGNYMSSMYGSLPNPDQQATGHIGSSGGGMMPMHYNALNVGGGGAGRQPIFHHQQPQ
                     QQQQQQHTMAKPPPIPYYDFITVLPTFVATCLTLKPEDEANREQLCWIIEAVLRKHLN
                     QNAEIRVHGSITTGLALPSSDVDLLAVGYQPIAPLEALQRLSKALLELDEDSKNDALR
                     LQELIEAEAQHRRRQLMEEAKKRAKQVALAAATGAGVAVAPDEGRHWARESRCSASEV
                     CEAASLRDSDSDADDDDTGRRSEENASEGEGTSGLSPKRVARAGSIVKSLLLSSTEAA
                     EEMPVIGEMDEAARAAPNRRVSSHSRRSPCVPQDGTATTAPQRSVSASSLSTESSTTC
                     FSATAFPLDTRKVFLTSSATVGDDGEFVRLASGSGTVPGAGATSTCAKSAVGHTDSVS
                     ASRLHDPDVATADTEVYGTVGDVEQAEEVFRGQIEKDYNFSTSVDLSALFAPSMGGGM
                     PPVAPPVAAASGLSIGGASSSSSGLAFQTTTTRLHDSASLSSPRESAAASGSADLKGS
                     VRSLPPAMASGLHVDEDNIAAHAQPLPRSKAAPADADKLANEAELRSSQARLADGGAA
                     EPEGRTVSGGGDATAAEAEAAHAGTETVAADEAAAAQSSSVSPTAAASGERAATVQTA
                     AAPPASQDAVTRSPIVLGDTDGRGRGAGHLTYVPVHEGPLFFVQSITATRVPVIKLTD
                     KATGTKVDITFAGGEHWRSMQLTRSLLEVFPHARTLILFLKYCVRSLGAGESEPGGVT
                     SFAIYLMVLHFYNECRQRILLLLRERNAASSPAQAQSRQAGADTGEHQQPQKDRAAEE
                     ALRRGGAADNSATSPTAGPAPLTLGLLEYMLGEYLARVEQRHAQLVEETGARRSVSLD
                     AAGSDDVAELYSSSGNIQKAAPALGRASSSTAVATGACATIKAAYASDDKERLRAIRQ
                     TILGFVGDPAAATTAAGASVTAAVALALAPQTTTGATPEKEGGAGRTQQTRPTSSDAA
                     ESASGGGAAAGASSSTSTSTPSPLREHQPPNLTGTAGLGGTTTTTTPSAGEELAAVVD
                     AAPGRLAPPPHHYLLKTVEPQPHERVVGEGSHVDTPGAYEVAGRDEKVAEDTSAEHST
                     AAMATPEALHQETRADAAAAAVAEGTETPEELVSAAAGSAANVDPVKAGRGSAQSASL
                     PAETETAGAAGAHASRVAEAAAAAAAAASTSKRASEQHSDADSEDSAFDAFAADFLRR
                     QAEVSDLFLDFCHYYGCAFDYETSGIRFTIDGRSEVVAKPFLCSRRGQHFHMTSPFDP
                     EYDLTARMTHMRDFQWLCWWFAEWGAARQSPQYYGSCSLQYVLQCLSPMSADADCQAV
                     HQALMKQAVAAARRAESTAAATLTQHYSNGGAAGEGGHPHHSMSAPMLAFQESTGRSH
                     HMMLMQQQQQQQSAPRQPHTMMMSMDGNTKLYGAQQQQPQSMRSSTTTMMPMTLRAHP
                     QQPQQHAGGVPVPPMNVYNGPSVEQQRCGGAGVAQHSVAAPFPHLQSTMMSPGSPVHA
                     YQQQQQQQASPSEASGMDTDTHVRGGGLGEHDHRSAPHLKYGGSISIASTAAKKGSAT
                     AHETAAIRAASSGSRSRPASECGATAAAAVSARTRARRRPPLQLPYVDSREEAFEGSS
                     SHAAITPTAAGMMAVHSYPTENNDDVDGGNSPRCRVDVMLTPVKGDEDEEDEAGGRYG
                     DRGYGSESVVDYTDCLDQCGGRGDANAVMPQHYPQQLAPHDAQATAEGNAGVGEHGAG
                     GLCNGYSPNMAYAGNQGYAASQQQQVSYGSPHPMNRAAGVYVSPQQQQQFRQQQEHAA
                     AAAAFYYQAFAQQQQRQQQQVPYPPSPQLKQPQPIISSTSSGFVATAGTSSSSSYPFP
                     ALYYDLQQHLWQQQQQYHTTRNSSGFVGVAPTAAAADQDGGSSHRSDGTSSTTATSAS
                     AQQQQQQVFPYTPYVGYPSVAFGVGGTHNTDATRTAAGGGEMPQQHQQPDMVAMPSMM
                     TYQSAAAVATGSPVNTSSDDAGVSASEPPPKQQQQQSAHGGYQHPASHHRSGGGDGRR
                     AASQ"
     gene            complement(<202536..>207278)
                     /locus_tag="LDBPK_040500"
                     /db_xref="GeneID:13390723"
     mRNA            complement(<202536..>207278)
                     /locus_tag="LDBPK_040500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858064.1"
                     /db_xref="GeneID:13390723"
     CDS             complement(202536..207278)
                     /locus_tag="LDBPK_040500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858112.1"
                     /db_xref="GeneID:13390723"
                     /db_xref="UniProtKB/TrEMBL:E9B815"
                     /translation="MPSPLLHREPQLISSPSSRECQCPFQGGRKLLPLADLRHQHGKG
                     NDAGAGGTKELSSLGGRNVSTANASSAAASASGLPRLAAVAAVPPSLELFLTASSEAV
                     ETVVVCDNESTQAMHSGAAFPAAAVAPAAAAQPLKFLAVSPSTAPVSLESSSSAAASA
                     SLSCSSKPLIRSTAMPTEEGRILPLPTAAATLEEAYLESRVSYPYKGADAMATFDLAN
                     PPPAPSLHVDSADQGGSAATTTAPLLRQQESQISLSGSTPKTPPICQERLSPAAGAMK
                     PTNVPVGPFSYPAAAPVAEAAAAAEAATTCTTSTTVKGVASSSAALTAHSADYGRRTN
                     SIDGTLSREAGGAAAFERAPQQQSPSCPLRTSESFATAAATHPTTAAVPGSPSGSSKM
                     QPSSLLSRMTTPAAATSRASAGVGKRDDSSDIDSTPPRLITSVASSLVVPLAVSETST
                     ERTRSTPASSIGSLRVYGAPPPPFPRAPSSATRSGSPTPFSPVAVTERTGVVMDVVGY
                     LERGYDTLWRTLARFFAAAFLPHIFLWHAVPALIPQPATSAAAEAAAPPRVHLYAVAC
                     NHPEVVLFALELLVAGVMLWSLVRYLQLSTVQRSRRHHSLYGGLHRSSTSLAARPSSA
                     GVGQASVAAARIAAERCTAHLPTTTATPKKFVDNAESPSTSIQMAGMRLLSSARGLRL
                     RPLRSPSAGGIGSGLNNCGVPGSSNSVRSSGHAHRIFSHSSVPLLHLPLRSFGGVRSA
                     VAMAARAATSGSATPVRDPVTVSSCPSERGGIMRCFGGRSVSDGIVSGSTLSGRSSAS
                     SVATPSLSPYTFMGLATPAAEVMQCGFSDAHGIDSLLTPGDGGGGGAIATLPTPFKAE
                     ESRAGGSLLHGYHPRTALWDVPRLQQPSRELLSGSGAGCQRGLPASPPTSMDLHASPF
                     SVLNSAGHASLALAGLADRDGTLAKSTNGTVSIQPSVVTPAAAAVAESAMRTDSLLLS
                     SGGAVTAALAPSSPTFGRDGFVPTMTYFGIGLGFLVCTGLAVWRLSVDYYFARYSFAL
                     STNAALWFWLVPVCLLGIAAYVVLLIGGHTLRWRALRQLQESNARGCSKNDEDQEEAA
                     RQRAAAAALCRLRWMSWCFACVPYPNPDVALFVDLPESVIMRPDATALLPILTSRGSM
                     VGAFAVDESDAVPPVVPRTPKKRGFCDGGDETVYDSEVSARGSAVRQQSGVLKGLSKD
                     KEGEGVFVTIDDTLEPADDILRVKREAPEPSTPVPDISGDVGSLAAATALDNFKTASL
                     RATTSAAAADVSGSPCKPLLPPLLPHRSSSRFFPTGMVRSFLLGRSNLNSRGASSSFA
                     PSQSLWSFGQRPQRGCAVAHVFAASRAWVEHAARELHIPDFIMRLRRSCGLAQQRRVE
                     RRSRQRTRVAAPTASVERRLRTWWSCERGSLERLVAWTYLIMLFLFSQALLSLMYFTW
                     SWRSIAREAATATMYATDTGRAAMPVPPSFVVYGCTKWQRSLRNALWVIPPFCVSGDG
                     SVSSPRQSTTWSMASQVALLFTLLGQRRFQVAYLYTNVALPIGFVISLCIFAHEIRLH
                     IKSRRVLRLLALAKSRVETARKVRDAML"
     gene            complement(<208716..>211919)
                     /locus_tag="LDBPK_040510"
                     /db_xref="GeneID:13390724"
     mRNA            complement(<208716..>211919)
                     /locus_tag="LDBPK_040510"
                     /product="huntingtin interacting protein (HIP), putative"
                     /transcript_id="XM_003858065.1"
                     /db_xref="GeneID:13390724"
     CDS             complement(208716..211919)
                     /locus_tag="LDBPK_040510"
                     /codon_start=1
                     /product="huntingtin interacting protein (HIP), putative"
                     /protein_id="XP_003858113.1"
                     /db_xref="GeneID:13390724"
                     /db_xref="GOA:E9B816"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9B816"
                     /translation="MRVFREAIEKNGGPLPLLYYLQPDAGNTPDPGSAHYRDKSIDLL
                     NTRVDRRTFFECVLSDADFAILTTFLMSGVSVNATRDEDGASALHVAAAGTLEVLNHS
                     DSQGGGGSGQMASGEGAGGGNMRGFHAATREKDELADDGDESSVSTSSILNPPCKNQL
                     IISFLIDNGADVNAAMRGGQGQTPLMMAASRQNMRVVKLLLAKGADLSVQDAQGRTVL
                     SYAVAYPHVMEVLRLWMGEEAFYAAAVRERLLHTACRSLGNAYAALYLIEQIGLDVNM
                     SDDVDVAAAAASPAPVLPGHVLPVDPRNPRRDCIQNRPCAPGTAAMFFAADASDGRHS
                     AWSLAQSSANAAPPTMNATTTAAAGNLAHPPCAGVGSLGAAAVEVVHMGTLHSGDTPL
                     HCAVSAVDVALVRALLSKGADVHAANHSGVTPLQLARSPSSLAQSWKQYWKDELMVML
                     RPTSASAAAARRRHRELQRDNSPGKVRALLTAYSHANTTQSREKVVREEPALYLWKLY
                     APMDVVLLVATATLPHVFFYICCCVIRNFFVLLCLLPLIYGAYVGVQRLDRRRAQSRP
                     LTDLGWCVGFVLAQGLCLPLCTTYYYYQYYSFNLEDHTAFSWWLVPAVTATGVLAAYV
                     VLSSPGLVTSTEGQRKGIYASMRNVQGEYERELLYSIDLRTMVKKPLRAQYCPQLRRV
                     VLRYDHFCGYLNTAIGGGNHRAFLWLQVALLSMLCCFYYYACEYRRLMNSVVGLARTS
                     AAAGRAPGHSTTRVAAAMEVDRVIMEKFETALLATAWRRLVYTYSQVILPLMILMVVY
                     ALCTQLHAIARNLTFYDVEHSEDESSLYCFTLGSRVYSLFDNGIWANLREFFGWSSLT
                     QKVYRVPQINPYLQQVVKDHQRWQLTGGDACCDNSDRQHQSCTHASGAVCKSGAAAAG
                     TTTTAGTIARPAELGEGESTRAQQMLRAPHHEALAAAAASANVGGLPQGREAAQQERQ
                     SASQAEEGGEEHDEAEYYAGNGGRNDGSALAMHIFQEMVRSGRTDVGRRDAIEVMAHG
                     GGADAETQQEWDAAVEKARQMYRFYLQSVGGAGDGDY"
     gene            complement(<213721..>214764)
                     /locus_tag="LDBPK_040520"
                     /db_xref="GeneID:13390725"
     mRNA            complement(<213721..>214764)
                     /locus_tag="LDBPK_040520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858066.1"
                     /db_xref="GeneID:13390725"
     CDS             complement(213721..214764)
                     /locus_tag="LDBPK_040520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858114.1"
                     /db_xref="GeneID:13390725"
                     /db_xref="UniProtKB/TrEMBL:E9B817"
                     /translation="MPLPLMSSLSSAAGVMKSIAPTASAPEPSFASFVLERVSRNPFL
                     IGETPRSLRPPPSQPAATEDALSIPSALDAAQRAVIAQASTSGTAATSSPASALAVTA
                     VLQRALIDAPLLPVGGCHLLHEHVWTHFLASAEAAKQVGCYRKALQLCKVRQAEPGTG
                     VNAPLQEQPQAPRTEATASTCDGALSSTTRGAAVDLFAASPLASSPTDNQQRSYQGGV
                     GLLQTPEELSLALTEDALQANIEQALTRLAGSREELQRGLAKLRRLLDGLRAYDAVPF
                     EELARQEQEAVRRLFAPVAATAADVSARSNTDTSSSSAVLATGAAAAVERVAQAVLGE
                     ANMLADRKRSREG"
     gene            complement(<217418..>219196)
                     /locus_tag="LDBPK_040530"
                     /db_xref="GeneID:13390726"
     mRNA            complement(<217418..>219196)
                     /locus_tag="LDBPK_040530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858067.1"
                     /db_xref="GeneID:13390726"
     CDS             complement(217418..219196)
                     /locus_tag="LDBPK_040530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858115.1"
                     /db_xref="GeneID:13390726"
                     /db_xref="GOA:E9B818"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B818"
                     /translation="MDVPLPLRQFTMVPGQNIDPLFLCPLCHDSWADPVELVPCGDIF
                     CKRCIGAARAQHAAQPMIMQNFQCPLCQTILQSEKKPNRMLLNSVLMIEVECRYCHWR
                     GTRESSEQQHTCTGVDGAVKSNHHSTGLSDVAFSTASTPAEGMPTREGGAQASPSPPA
                     SSPAVRNGPRRAQREIEDGYIPIGDDPSSATLRASDMSPLRDSVDPSHNCVPAEAVSV
                     NSSCMATSPLQTPHTGPTNDSASHTCMSTSASPSHAQELWRRYGLSQIEYDQLVGVFM
                     MFDGGAGRLSAGQLRDLCFCMNFVQREDDVGVIFASMDHACKGYVSQDDFLRWLSTHP
                     PDPSALFGLSRYEYTDALLQFRTADPEYNGVIDASGFRYLCLRHGYAQTPEQAMRHFR
                     LCDEQHTGYVSLRQFLQTLKSIKTGYEGDLSTPPPAISITVSSSSHSGSGRPQPVAAP
                     GSSSPVHLSRRACASIGGGGASSFSGSSESASLQVSECFFSDTAQASLHPYTQLHAQH
                     YGASSYSSLAQPPMSPLRAPSQWQQRQQQRFVNSGGGTVGGVAASPVIGQQRPEASPT
                     AKAAPASRLHRQNGRGSRGDEECVVM"
     gene            complement(<220133..>224785)
                     /locus_tag="LDBPK_040540"
                     /db_xref="GeneID:13390727"
     mRNA            complement(<220133..>224785)
                     /locus_tag="LDBPK_040540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858068.1"
                     /db_xref="GeneID:13390727"
     CDS             complement(220133..224785)
                     /locus_tag="LDBPK_040540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858116.1"
                     /db_xref="GeneID:13390727"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B819"
                     /translation="MTATILRTNYALLLFYVREKYWHHAEEVCMSVIQSTDDHMFRVW
                     RALTLDRQGMANDAIREYKTVESRRATAVPALMGMQLIYRNNRDQEGVAQTEAKLDGF
                     EVADNMGGWVQAAALCWAAGDINAARDILLKFTDNEAAMAYRDEYTNYGTIRGWVDLL
                     SGRGALLEKAGALFSRMLEMEEAQYSFFQSSNEAGGGGSGTTKWTDMNAALGYVAFLE
                     HKTQLMKAQSLLDRLVVLYPNCSIPPLVGKARLLMQADDWEQAIEVTHRILAHDKGNV
                     EALALEALYAIGKDTRQDAAQVRLRRLLDAVRAKEPRNVALLHQFALVFSRLAGDRLD
                     LLNITTQFSEMACALDSRNGDVLCGLGYQQLYRHDYKTAVATFRKAATLTDSLGPLLG
                     TVTCLLHQGDVEEAAAQLQFCNQLQPAAQRNAELSMLNAQLRWRRRGMEEETAVLRYL
                     DQAAEAIKQDVKERAGSGMEVYVHLNAPVALAIAHAYLMHCRNEPPDPMFKHTDVVSE
                     KCGRHLEFVVQHLPACMEAQLMLAKVWFVRGDVRKAQNLLKNTLLMQEQPLPDAFLLS
                     SHICQYMGDVKLASQALERALTLDFSLQEQPLYNLLLGTVQGTTGKYAEALASLQRAY
                     STVKSAAAASSAGKPTNPLSVPETVTLYLQLAQAQLRVRDVEAARATLAEAALQFRDS
                     AQIGRVVIAQAMLAARTDVDKGIELLRQVPSKSEFYTAAHSQLGKLFLTQKHNLGMYI
                     QCFQEMAEAVPSAQSYVALGEAYTVIQEPEQAIAAYEKARALSPSSSELSVRVGRALV
                     AAHDYAKAIRYYQDALMSDPHLSIVRADLATLQWRLGRIDAARETIVMSPVYELPSTN
                     GAGAGVASAAAAGSAETVGTAIERINLYLLLYKVLRDQPWTVPLSEQGTAHTGSDGDH
                     GDAALRALLTARSLQRRLIEQQLRAETAEVNAEQRVVMSGICTELGARCIYSTPAPPP
                     SSVIMTDKKVEAAAALALQSAIAARLTNAREYLREAITYDESNECAQLESAQLCYRTG
                     DMDGCERHCTTVLRMADGSSSNADAVILLANLYTQQGRTEDARDMFDDLLRKTPQHYE
                     ALVYYLILLYHAGQLTEAKDALGRAAAAVPAGQRADPGLSYARGLYEHLCNNNAEALR
                     HFNLARLPTDNAWCTRALVRMIRIYLVPTTQDLWVRGANPAAAGLPLTEQQHQKSAPQ
                     SKGPAAAASTGGTELHENIRYAEQLLLLLPVHSEERRILQAYCTMATRRPEELETALH
                     LFLECIVAAEAGGVSGARAACGATTAEKKGRSGSDKDATKAGKKPRRVGDSDSDDDED
                     LQLLASMHEAAAELAQRSSGSSTATLAFALQCKVVHPEAFLGLAISLFVSGQETAARN
                     VLARLLESKKVMAKMPVTKQADKSKGDAAEPPAPITVSPPIAILTCSEDDTIERAMLL
                     QAYMDTQEGQLENARFVLQQVLAANQGCGSAWNALGMIYERNQKHKDASRCYQKAWEL
                     VQESDPAVGYKLGFNYLRGGEPVKAIDVCKRVLAHHATYPHIEADVMDVAYSMLRP"
     gap             225616..226481
                     /estimated_length=866
     gap             227316..230437
                     /estimated_length=3122
     gene            complement(<231718..>232647)
                     /locus_tag="LDBPK_040550"
                     /db_xref="GeneID:13390728"
     mRNA            complement(<231718..>232647)
                     /locus_tag="LDBPK_040550"
                     /product="tyrosine phosphatase, putative"
                     /transcript_id="XM_003858069.1"
                     /db_xref="GeneID:13390728"
     CDS             complement(231718..232647)
                     /locus_tag="LDBPK_040550"
                     /codon_start=1
                     /product="tyrosine phosphatase, putative"
                     /protein_id="XP_003858117.1"
                     /db_xref="GeneID:13390728"
                     /db_xref="GOA:E9B820"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9B820"
                     /translation="MPTASASREPLVPTINFSMVCPGVYRSGYPTKKNYSFLCALRLR
                     SILYLCPEDYAESNLKFCEEKGIHVLRFPTEGNKEPFCDISEPLMHRILSAICDTRNL
                     PLLIHCNKGKHRTGTVVACLRHLQGWSLVSIFEEYKRFASDKARVGDQQYVELYHPIV
                     KLTPPFVASWVTVTPRVTLVTSDRELMEAEAMQLGYSLLAPDKHLMKKNGSSTSKSTG
                     NTAAAVPGAASVTAAPAGPAAAAAATAGSGPTVTASTSGPSAAVAMQQQQPSQPVTSA
                     APTIASSSGHSTAPSIMATAATAAVAASLGEAT"
     gap             233035..233133
                     /estimated_length=99
     gene            complement(<233313..>238019)
                     /locus_tag="LDBPK_040560"
                     /db_xref="GeneID:13390729"
     mRNA            complement(<233313..>238019)
                     /locus_tag="LDBPK_040560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858070.1"
                     /db_xref="GeneID:13390729"
     CDS             complement(233313..238019)
                     /locus_tag="LDBPK_040560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858118.1"
                     /db_xref="GeneID:13390729"
                     /db_xref="InterPro:IPR001194"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:E9B821"
                     /translation="MFGGTVGGGGGAGDGVPLITRLLLLRATAHFQLSPSAPSASSAG
                     ETAPALPKLSIVSHYAQGPPLTSTSSPRSATATPKEAAHFLEAHPSLHGVLGCLAADR
                     LAQRVKLRRLQTDVVRTSVKLTRAVALASSAEVAPASRSRGMDSSQLQGVVAAATANF
                     VEDVAWCSTVTPHSPQLNPWCLLPVSAEGCYLTLPSSQFVQWCEQQAVRCCAGEGTAP
                     SAEPDVRGGPMRYNDVVHYAGAGEDGGYVHGYAFILEGDVFSGSGGVVDAAAAAAKAA
                     LDSQRLDASLRDDSDEEASVLVWCVLSDAPVFNFMRALTHEAVAAMSYVAQRLYREHV
                     ASTESASASAAPPHDIYTALLDDAIQEEVVLPLAKELLHFGSVSSRTLPGDTFTVQLA
                     LTSSSGGAIASHPLASSVSDLLTFCRPLDLLYPYADVPLSLLLLSFNEDALRVLQSLL
                     MQEERVVVLGATPQHASACVVSLLALLSPLTWVSPLVPYLPPHLAAVTGLLQTLLKPP
                     FAQQQQQVSSGKPSAAVPPSQRTESSGFLVGSTAAIQPYLILLSSASPGEAGVSVTGY
                     GGSGKRALRVWIADARTGCVGVCPQEPVARFSQADSPASTDPSDGSVATVAASSRSVN
                     AWATRAHVNLRRIVSHNCEGDGSRSATDLYGAVRSSLRAMAKSNVMNAAALDLLPAFS
                     DNLRDQLRRVVSVDKRRLFRHSLEAVAQHTQARLKDLESLAARLARGLRQAIMSTGAG
                     SNMSFESTLNDTLANRSIYSDAEDGNGELTATHTGDDDGDDTTSLRSITEALARSFSK
                     SFAGGPASLTASFAAAPVPQFPAPSLSEVWQVQAGVFDYMVSRFTGAYRRGLSATTLG
                     SGGIGGVGQRRAPAIELSVFLVPGMDQHHALAERVARTHIFKQFECAVLAAEQVGLRR
                     VFSGADPARVGKAQAPRHHGRGEEGHPLLANVRYLALFALLCSRARLHYAELYPDMAS
                     VDAVGLVYTALVTRWFANRPGASSSMSVPRAIRLLAGGCNGAEEGAVAAAKHAACSGS
                     GSGVYGGSNDGGGGSGGGGGFRGFFSKVAKAMKHGYGGNGRSRGLRTAYLPAAIACLH
                     TFSVPLFSELPVARQSFAVTSHLEKTSIESSSGEAGGAVSDRRGRRLHHRNRNAQVFL
                     KTCMPPPQRIKYARQQEQQQHIALDTDFTLHDCVNVVRVAGLGSGGHSVPEAGFYSGG
                     RAYGNGLGIESEMFDPIARAGTDPDGRRDKTNISADAQKHDRGLQAMSEASLYICHAL
                     PLDIVHRFDAYESLLRPVTPGGAEISPASAGGDALDAGSAAAYLLVGLLFPSCINMWH
                     EVEARAMRAVSEPSLSQATKPPASAASSSASSAQSRLLLPSRAEKPAETSVPQDSRYS
                     VPASAQSTAPQPSAWSAFTSGVPQDYPSVSPVLPDRSPGGDAQQHQASPMHASTAAST
                     THHRDVWDSWGIQAPSAMVSVQPAPVQGTAAERPQTQVADSGGSGSEGGVWSTGAPLG
                     PPMMLGGMETTPPCISVAFSLTPAADVAPAPRGVMDNLFADTPTHSTAYAAAAGNVSQ
                     QQPTAASRSHALDNFF"
     gene            complement(<240031..>240933)
                     /locus_tag="LDBPK_040570"
                     /db_xref="GeneID:13390730"
     mRNA            complement(<240031..>240933)
                     /locus_tag="LDBPK_040570"
                     /product="spermidine synthase, putative"
                     /transcript_id="XM_003858071.1"
                     /db_xref="GeneID:13390730"
     CDS             complement(240031..240933)
                     /locus_tag="LDBPK_040570"
                     /codon_start=1
                     /product="spermidine synthase, putative"
                     /protein_id="XP_003858119.1"
                     /db_xref="GeneID:13390730"
                     /db_xref="GOA:E9B822"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B822"
                     /translation="MPGPGLLPDGWFREESTMWPGQAQGLKVEKVLYDQPTEFQHLTV
                     FESDPSGPWGTVMTLDGVIQLTDYDEFVYHEMLANLSLTCHHKPERVLIIGGGDGGVV
                     REVLRHKSEKDGIVQSVELVDIDGAVIQQSKKHFPQIACGFANPCVTATVGDGAAFVK
                     RAPDSVYDVIIIDTTDPKGPASELFGADFYTNVLRILRPGGVVCNQGESVWLHRPLIE
                     MMMGFLKKDIGFATVKYAMIYIPTYPCGSIGTLVCAKSADTDVTVPMRPVESLGFADQ
                     LKYYSSDMHKAAFVLPRFAAHLNE"
     gene            complement(<241678..>242481)
                     /locus_tag="LDBPK_040580"
                     /db_xref="GeneID:13390731"
     mRNA            complement(<241678..>242481)
                     /locus_tag="LDBPK_040580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858072.1"
                     /db_xref="GeneID:13390731"
     CDS             complement(241678..242481)
                     /locus_tag="LDBPK_040580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858120.1"
                     /db_xref="GeneID:13390731"
                     /db_xref="UniProtKB/TrEMBL:E9B823"
                     /translation="MRWLNRKRPTTPLYIPDPRRPSIVFVLTSPEPVLSALLLGVSCY
                     FLTVVTGSTSLDGPGGLWQAFGRKSRARMQSRESELRPDPPLAISFDMLIVVLCIFAS
                     NSVLAACSRVLAREQRRVEDAAEAEWLAAVSNPETRSERLAKDAQELAEKVKFWQEND
                     ERRKAGQAARRERIKKLDVMADEVMTNIIIIVSVVVSLGAAYSILMQPPNQVRGLGVA
                     GMLVVLIGGLIVCGLDRYISSMRHYCNYVNLLCIFSLLVLAARASVLAE"
     gene            complement(<243250..>252570)
                     /locus_tag="LDBPK_040590"
                     /db_xref="GeneID:13390732"
     mRNA            complement(<243250..>252570)
                     /locus_tag="LDBPK_040590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858073.1"
                     /db_xref="GeneID:13390732"
     CDS             complement(243250..252570)
                     /locus_tag="LDBPK_040590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858121.1"
                     /db_xref="GeneID:13390732"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9B824"
                     /translation="MTKLAQVCLVALAGYVLTGLVGTYFLVRFRRLHCVRQVQPWYCI
                     VHYVCYGGFLAYLMSAGSMRRCRGSQDIGKRTASLWGASSQLLPQWTMTSAGALPPQL
                     DRAQSASQSSSASRVWQVCVLLGQVVLDAFLSPWTEVVPVSPSPAAATRIVRLYDIYE
                     PLLQAIAATAFFSSFALLCNARWRYAVMGTAERHPGLWSAIVGVNTTTATAAALARAT
                     EEANKDGASILDGTSTYAAVVASLSPPMRRGSVVAPRILVQRSLAAQRRHSARAPSYV
                     NRARDRGDSTQGNLADSGVSTRISISTPGAEDVCGGGDLPATVRANQVKRATGGLEAA
                     AAAAASMDDVLVEDATLRGSRRKSWRRSVRPTRPQQQQKRAPSPINDDYDDIDDDDEK
                     MWNSVEPGSSASHVTSSSLFRDNEDPSSTSSSLWRRLMRCSGRRLWPFSACVCEEGQD
                     RTSRNGSSGDGCRGRSSRERHRHLQHLRQRLLAAFWLSDAVVVLLTFLMFALLAVARV
                     AAATATASAWAAVEASKTQGSSGLERGRRGGQRLLTATAAVPCPTEGFVGVAGLLLLA
                     AERVLVGRWMRLPGQLLASVSAAAAAASVETPAARQQQLRPRLPCRSWRRLGSSTFRS
                     SLDLWHLPSTGRLHGVETAGSAAMSATATAAVASMTPVPFHFRHVLTVALLLLMLQFF
                     SDAAWAWAAAVLLTTGSAVANLVDAVADSLRWVSTEYRRLLCRTWWELFFSFSFTPAS
                     LESVNAQEQHVAGSMPAATPGSIGGLGLPAAVGRELLVSRGNSIGMAVSATVMPPFGS
                     RLRRHSIAHRSARLMKAGGGTGPLWMVRRLGASFAGTAVDSASSLSPPSAVTAMAATV
                     LEEGATSVVVGKDREDDGLLSGDAPGSHGVAGGGAAVVTAISPMQFWHSVAAKVLQQS
                     GKATGEAAEPGSSSSHALGGAEDVNGVGVVPTVAAALLHPMPTVNPLAMLSPTPGMEH
                     LSSASARFTRENLKGSMLLKLPTVARVGGKAEAAELDMRERLLAMERAELRHEERAMR
                     AQQLSASDTMAAASTLSDENEEKLHAGNPPAHSVVPGAREHAGHHDDDGGALENAREA
                     QQQQSVTQDGWLSRALATVMPGFAATRCCSCEGDGVPISSLSTQLDSTSTVLNVSFNE
                     NLSLSSSATRAWINEEEGFARFLDCVRRDGDNTYALQSLLAVYGHTYRHRVDAKGRGA
                     LHYAAMGGFVQGAIFLSRIGAEPNILDKAGYAPLHYAVLYRTEVHTSPRITTESPSTA
                     VQGARHVVGIPIVETTAVQAAAQATRRRRRDQQQRLKWVQAQLQAAYSAGSDASSGVE
                     GRNSSGRSPQETTLTKTGRETSLRTRSDPVTTSIPGKPLAVSPLQIFTPSSQRPLSSM
                     GVGNAAAGSTSSAVRGPNPAAIPATATAIPAAAAAAAAVVEPEEGHWYGMVGALVRLG
                     AQVDLPTAKGLTALHLAVMQGSVGLVNTLLREGANPLLGPELETRSLASIINAASCWE
                     SDKENTEVLMKGAGKTAAPCSSGGQANDQVATHPTQQQQTLSDTPQCTSNKGRDTTSL
                     VSSENDNSRTALGDASGSLALFTQHCEWVDMHITNAGNPIVNGHCKSPLLLAVELDAD
                     LAVASMLHCVALQATTARVVAGLSQSMVAAPRMFERPPSALLAAPQGAASQAQGCPPL
                     ASLPVAAASGDLPTSPAPRSRAFAASAAHPLADNGAGDAAMALPSPMSAAAAALSTSC
                     SSTNVCRPGSRRMSPHTPGIADTSFSSSTTTTITAAAAIPDSPSTRTWWERCCLHGFN
                     PVHIALVLGNAQVARVLLLRWCYTEDVAHNRDAAAAPHKCVRDAEKLGGRARELSSNE
                     PRTTISTTPALPESALATTTTTVPPLLSSQATAGPDVTDSTLLDFASGANISFHVDGL
                     AAEQQQQQPVLAHVAAPLSEEADGCSQYTSVSGEAAAAAAPTAAISLGSSTGPAAFWV
                     RSLRLNLFHLAAVGDSTECLAYVLRWRGAPDYVPCALDEVFENEQRAESVRRESATAT
                     QDAYQRRRQRRRLRAYQSSQAACDLAGVAESLAMVAATTEPSAPNMEEYVFPADAGSS
                     SAGAPGVGHMMASGGGAAAAEAAPLLEKMVELDDFSRSPSSLPAAATTSEVVVGIEEA
                     LQRSLGPSSTDPSRTCTTEMSFKSDTDVIASSSTSDIFNHTWSSATLSAESNEAASTA
                     GAPTTPPRERRTRAKQQGFVRALVTLLQTNIRVDAVRRRVRKTVFGSSTFRKTTSPRR
                     VNSRRQSSQRPRMGRGDDEDGDGSNDNTVMAKTCFGSISAAAALHTGMAVCYASMDHP
                     PRRRKRGEYGSEKDADGSSSRSRSSSSSSNHENVKCHIVEAPGAPRELYRQAKGAERP
                     RRLRQQRTRAFVSAVAKLRHCIAGVPIDITHLAAVETAVDRACAQMASSSARRALQQA
                     LLIVARRLQNQHRRAQLVTGLSCVAAAATAAMEAAAAQDDGQASRAESDDEPTTIPTT
                     LAAVEASTGDVGGNRDSVSAGTSESLISSLSRSRQRDRATEAAHHHHRHRCSSPSCPS
                     PDSASALSYYSSLHSIITTTTTTVRGSSPAAPDERASVSASDEEKPRGRRQHRQQSTL
                     RLLRTLSAELNALDTRGLTPLHYAIANQNASMVYLLCAYGATFVFASEQTEAHLMGRS
                     AEVIAAAAAVEHHTDGCDMMTVAASDTQPAASQDELQSTTAPTNFMSQAWSLPTAWAY
                     ARAQLSSPSINVSTDTLSSFGKRYYAQLTPPMQEALRRAAKTGSAEYLLWMPTQEDRE
                     AERQQRKLLSPLPVSEARDAVPTNPQRSVSLLAPHAVLSPAAPTTTVMSATVAKRSSP
                     ANAQLHSASPVMVPASCLTVASQRPATMAATLTAALGISDADVATRAAATAPDAFLST
                     EEPLAKASMMTGSVKDGSGGGDALGAQLQTHLIHQDIKTLQSMIAGKASSKVNGGSGE
                     DLAACLHPPPQRLRASPNADVSLDEAKDEATVAANLMAGRSFKQDVARETPRQPNASS
                     SSAPKTSAAMRTPAAATSVGAEGTGSTGITELTRGARGAAVPPSSPSSNAAAAAVEYT
                     LLEPHDVFITHVVRNPAKAESIMRAAMEGTALRYLFLASVVSGDSL"
     gap             254072..254170
                     /estimated_length=99
     gene            complement(<254565..>255068)
                     /locus_tag="LDBPK_040600"
                     /db_xref="GeneID:13390733"
     mRNA            complement(<254565..>255068)
                     /locus_tag="LDBPK_040600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858074.1"
                     /db_xref="GeneID:13390733"
     CDS             complement(254565..255068)
                     /locus_tag="LDBPK_040600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858122.1"
                     /db_xref="GeneID:13390733"
                     /db_xref="UniProtKB/TrEMBL:E9B825"
                     /translation="MSISSSSGNNHGGNAPPPLLTPEEKAARDARLQREHESYIRSIA
                     TMRSLPRLRSTIAGAGGKTNTNTRIAEEREEVRQQHLRAAAAAAAELQQRRQVHHEKV
                     TKLESIQAKKRSRRAAKKAKKKQRLEEKLRSRLDSDSDVSSDGSALSSSASASSSRDS
                     DGDGEDA"
     gene            complement(<255905..>259774)
                     /locus_tag="LDBPK_040610"
                     /db_xref="GeneID:13390734"
     mRNA            complement(<255905..>259774)
                     /locus_tag="LDBPK_040610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858075.1"
                     /db_xref="GeneID:13390734"
     CDS             complement(255905..259774)
                     /locus_tag="LDBPK_040610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858123.1"
                     /db_xref="GeneID:13390734"
                     /db_xref="UniProtKB/TrEMBL:E9B826"
                     /translation="MQQQQHQRSFCPLSSASAPKPPPQTGQAEGKNDGGCAPRADEAH
                     VIQASAYALWEQLYAPARVPLTLERLLYLRLSAKGNGESNDAQGHHYCADDRRWARSL
                     FGEVTTQLDTSAPSASMAPSTAPAAAIAPGEQSRGAPSNAATAVATTASLQESRDDKG
                     GNESQRAWKGSLPDVASSVAAPPTEQCTSADVEQTSVSTPLRVPQACANAQSASGVDR
                     GRASESRSAATALSHPDAVIASASVPAPLSSVQRGSDSNRDVDNDGGRGSAVLLQPYR
                     GCALSAASPPHRALLAPTSDVSLSCASAAPMSLEQDDSANCIDGNEEAEPCVNTWSVE
                     AASAAPALHMHTPSTSAAAVRTDEKGRRDGSGRDAGCSPPLEHSAYRGSDGESRGAVD
                     DEQAHTLAQQEKAAESCGAWESATATTTPVRSYHLYCHYRSSHDTGPSAEGGGRNEEE
                     DAEHGERGEEDGNDVGFLSLATSPSAGAPEQWRPCPVVGTYAGLSTPSPKPIVVLEDT
                     MTALAVSALPCGLTRNGEDSSQLDSPIRRRHTTRVSTSMSPVADPNGLVFSPPCRQQM
                     RLRLQRRRPRQASEGSDLEYSPHTPVPGSPSQSPLPPPSCWSTPLPQERCPRDAQTPP
                     TPTALSAASQPPASPAPSPTNMADSGAGATDELCAGNHAADAAVMGASPPQVIHLKKE
                     KAVMTVSNISQESRTSADTAAKEDDAKPRDATAPDSPVDASSSAEAGDDGQGRRDGGS
                     VAPVAVGVEDERVGGDEEDAEGDAGEPASTVSLSPQRPSLECPAQRRATAAPRGVPAE
                     GHAECGLSSVKKAARTANPVPASVADVSVPPSSPSTSPPSHASHESFNPSKHREEPQQ
                     RHPHPSLPEDRAARRSVSNMDFRWADEADDILRRQQQRVHSLQAARTATLAGGDTRCS
                     PSTSRCSPGGGPRRYTPLSQDGETTQGSQSGNGTRLARAYGGSEASYSVSPQPQDPRT
                     HHYHERAMMRPEGMGVEAVASHTDGSSIVTEQGDVAPSSYRAGRSEELACLSVTRSGE
                     GRADIAFATASSSTPPTAPLRQPPLASVAEATAADDASMPHTDRLHQQQQQPSPRHAG
                     TKRLRENNGGDDGRSDAVHARRSPAPSSVPASSQTVTKRKKSGCSGGAQSTERRHRAD
                     DRARLRQNLRGDTAAKATTRSILCASPANVFALPRTISADPGASIATPTFTTAAPLAG
                     PSLSLLRPRSGNCVSDPPSAAKAPKSAKGKSTHVSAPSLPITAAASPPRENASSSRAH
                     KTAQWAARCTPSLEATNKRREEVKRHQ"
     gene            complement(<263024..>264040)
                     /locus_tag="LDBPK_040620"
                     /db_xref="GeneID:13390735"
     mRNA            complement(<263024..>264040)
                     /locus_tag="LDBPK_040620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858076.1"
                     /db_xref="GeneID:13390735"
     CDS             complement(263024..264040)
                     /locus_tag="LDBPK_040620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858124.1"
                     /db_xref="GeneID:13390735"
                     /db_xref="UniProtKB/TrEMBL:E9B827"
                     /translation="MNDGREQVIALLRELEATAIPKFVDSGEALTYMAYKDGVLEKAI
                     TLLNAAHIEPKASSIQPLRVNSEQLANAVIERVFDAHTRVLRSKLAEAEKAADMWKKV
                     ALCGGAEEGKSARHTALAQSTLCVPARVSVGSQVCSIDEDAAASDSNTSVQQCKLVCE
                     AVKEWLAGWTTKMMSTVGEKLELWCSSQLGLTPVRISQHEHEVRRPSLDDSLMVLDSR
                     NSASHAPRKIDNARLHGGNISSAGKSKISEQKTSSSLVLSPGENPVQPLILSPLDAAA
                     SSGPTPSHPKVGTHSPQYAQPGSQLYVMRTMSLKARTKQLIGKQQAANSSTPVSRMPH
                     LPHI"
     gene            complement(<264723..>265325)
                     /locus_tag="LDBPK_040630"
                     /db_xref="GeneID:13390736"
     mRNA            complement(<264723..>265325)
                     /locus_tag="LDBPK_040630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858077.1"
                     /db_xref="GeneID:13390736"
     CDS             complement(264723..265325)
                     /locus_tag="LDBPK_040630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858125.1"
                     /db_xref="GeneID:13390736"
                     /db_xref="UniProtKB/TrEMBL:E9B828"
                     /translation="MTMNFGNMTLGGAMATFGGQSNPMCNYTSPLAKKFVYKEVGKVY
                     YPLRRHVFRTKVRTAAEIRFNEIVKRYMKEKMAFKRGCYAATITNTVELDHMGSIIPK
                     DEYEVKRLTSYMTSKKMSNDYKKHMQELWTRVLFVCESTNLVGVTENAMHQNSRPGTD
                     EEFMSIIWYSSFVTTLMAFVVTLCIWWYRYGQAPQYAEFK"
     gene            complement(<266664..>267650)
                     /locus_tag="LDBPK_040640"
                     /db_xref="GeneID:13390737"
     mRNA            complement(<266664..>267650)
                     /locus_tag="LDBPK_040640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858078.1"
                     /db_xref="GeneID:13390737"
     CDS             complement(266664..267650)
                     /locus_tag="LDBPK_040640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858126.1"
                     /db_xref="GeneID:13390737"
                     /db_xref="GOA:E9B829"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B829"
                     /translation="MEHRPRPERTFAQARYVNKSHPATATFPAACNIFASVSSGGSMA
                     LNLLRVAVPALALVMLVLWIARFVVMHIEARRMRQQATHWRTLPSYTEVQAMAAALRP
                     TRPTSSQEAAEDTTPAAAAEAGDEVHCIICFSTVVDHPVELLPCGHQQFCARCLVQIW
                     QCSGIYRRLRCPLCRQPAELACPVPVANSKPSVDDVLLLQNYNGGFCGTKKVSLLDCC
                     VLRLRVITHARLLPIVIGLRIAVLHATMFAYMLMPTSLTEVVDGAVQQQQAVKPNVPS
                     SALAAAYASVVHVFTVVVYTAARYADDFFLVAVSIILTGHLLQSALFKDLKL"
     gene            complement(<269439..>273227)
                     /locus_tag="LDBPK_040650"
                     /db_xref="GeneID:13390738"
     mRNA            complement(<269439..>273227)
                     /locus_tag="LDBPK_040650"
                     /product="serine-threonine protein kinase-like protein"
                     /transcript_id="XM_003858079.1"
                     /db_xref="GeneID:13390738"
     CDS             complement(269439..273227)
                     /locus_tag="LDBPK_040650"
                     /codon_start=1
                     /product="serine-threonine protein kinase-like protein"
                     /protein_id="XP_003858127.1"
                     /db_xref="GeneID:13390738"
                     /db_xref="GOA:E9B830"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:E9B830"
                     /translation="MTRTPSSLAPLPLSSFKQLSMNAPVQERSGTSSSNAPPAHKKQR
                     HEGGCSGKVLDDRDADSVRVWGVLVAQNLPSRENGLLAHAPRCRCPVEGADAPGKESV
                     TKLIASSSLREPEEDWLWRHVPPALRQFYFPACSHSGSTYPCAPASAVCSEKCWAASL
                     QQEGDKSHPSPSPRLLLPLCGTRSNNGAVRLGRLASNDVVFATNPCVSNVHCTIAYQP
                     GSDPRRGDAAAAATVAAEDKEAQRAAYEAAGAVAKVVAPLHRSPQPATDAPAAPHPRG
                     DATGRNAARIMLSDYSTNGCIVNGQKVGKGRSARLRDGDVVELINAGPRRTTDYNLSF
                     LFLTAEAFVRWVAEQPHQASTTQGTDEDIALAEKEQQQRQALQTAARRRALLCRAQWN
                     VEAQVRRMYGHSVDEYYSLDRAHPLGQGTFGTVYRAALRAEASASSQSPSLLDAGGGV
                     AAGVPSSWEYVFSGDGVGEWTANPAEAAELREAYIRGKERRAPASVLHVSASAASTTA
                     AEADAITTDDAAPQVFAVKIIRKQRMLFEALRQQQQQQQHGEEGEGGTDRAPVSCIRN
                     AATVATPGTAGAVPGTISAADAAVIEQLLLMETQPDDLAAQRRKEWTAGVLASLQLAD
                     LAPAALTPSSSLSALRKSQHKPRDDDDSSDDGDAQPLSQQDREQRRRELIRCLPEALR
                     RTYERELQHRRRQQREINILLAVRHRNVTALYEVFDQPDHLALVMEQATGGEVWDLLQ
                     IYKRRERGGKTGARKSERGANNHRNAGAQRLGDGKSNSTTAAATAATCDDDDDVELVS
                     VGGPLPEFIVKIIIVQVIEAVLYLHTMGIIHRDLKLENLMLQRPCDRYALNALQLQTL
                     VHQLRAYSHSHHASDASTSAATTCEEDSEAVEFTNPLSVLYTVHVPRHMWPVVKIMDF
                     GLSHVLDHLQTHPFDSAGALHGFAGTLSQMSQGVEGRSAAAASAATEAVPERVKLIYS
                     RNDATTSCGTPIYAAPEVTNPALRPDKMGYGAAVDMYSVGVIAYALLTGRAPFPSAKN
                     PRRPGGPPVVNYDAPLRFQRHRRRPAVPKGATGPPASAGPLPSSRPSSSAARPPSEVA
                     CLPPLSVVESVRVVLPKERAETSAAFSAASEQTRQWHRRAEAVAASVRCAEQKRALAE
                     GSDGGSSATPADTLFATTVEQLCASLTAYADMCASGGLEVDLDRLVYVSADAAATGVQ
                     ANASVGRVMAPDGHVADVLLPPISALGTSFLRGLLEKYPSRRLTAYEALRHPWLRECV
                     "
     gap             274174..274272
                     /estimated_length=99
     gene            complement(<274298..>274450)
                     /locus_tag="LDBPK_040660"
                     /db_xref="GeneID:13390739"
     mRNA            complement(<274298..>274450)
                     /locus_tag="LDBPK_040660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858080.1"
                     /db_xref="GeneID:13390739"
     CDS             complement(274298..274450)
                     /locus_tag="LDBPK_040660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858128.1"
                     /db_xref="GeneID:13390739"
                     /db_xref="UniProtKB/TrEMBL:E9B831"
                     /translation="MCGRSRIRHSSLLSLLRRLSLHKSLSTPVPAACQDPHCFYTLVC
                     ARVCPR"
     gap             275235..275333
                     /estimated_length=99
     gap             276697..276795
                     /estimated_length=99
     gap             277491..277672
                     /estimated_length=182
     gene            complement(<277674..>277781)
                     /locus_tag="LDBPK_040670"
                     /db_xref="GeneID:13390740"
     mRNA            complement(<277674..>277781)
                     /locus_tag="LDBPK_040670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858081.1"
                     /db_xref="GeneID:13390740"
     CDS             complement(<277674..277781)
                     /locus_tag="LDBPK_040670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858129.1"
                     /db_xref="GeneID:13390740"
                     /db_xref="UniProtKB/TrEMBL:E9B832"
                     /translation="MARSRAAPRASGGSSHHAAASPPPKKAEPLHQSTPH"
     gene            complement(<279063..>279509)
                     /locus_tag="LDBPK_040680"
                     /db_xref="GeneID:13390978"
     mRNA            complement(<279063..>279509)
                     /locus_tag="LDBPK_040680"
                     /product="ubiquitin-conjugating enzyme e2, putative"
                     /transcript_id="XM_003858082.1"
                     /db_xref="GeneID:13390978"
     CDS             complement(279063..279509)
                     /locus_tag="LDBPK_040680"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme e2, putative"
                     /protein_id="XP_003858130.1"
                     /db_xref="GeneID:13390978"
                     /db_xref="GOA:E9B833"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:E9B833"
                     /translation="MLTTRIIKETEKLQKECPPGITATPTKENPRYFMVTIQGPPQSC
                     YEGGLFRLELFLPEEYPMKPPKVRFLTRIYHPNVDKVGRICLDIIKDKWSPALLINKV
                     LLSIQILMSSPNPDDPLANDVAEHWKEDEASALQTAREWTRKYAKP"
     gene            complement(<281466..>283634)
                     /locus_tag="LDBPK_040690"
                     /db_xref="GeneID:13390979"
     mRNA            complement(<281466..>283634)
                     /locus_tag="LDBPK_040690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858083.1"
                     /db_xref="GeneID:13390979"
     CDS             complement(281466..283634)
                     /locus_tag="LDBPK_040690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858131.1"
                     /db_xref="GeneID:13390979"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:E9B834"
                     /translation="MRAVKSRNAGGLRSVRDVGSNRDAAAAAVHAKEAGAAATLTVAV
                     HHSDASGTHSEKGAPDDATLEVSVGTTGEKDKYPEDPLAVAFALDAPLTFTARDDPRV
                     VARLPLRFKDVLPTVCHQLQFRQRQATHQTSVDADSYTTKSNPLSSPVPPTADATSYA
                     QPPYQHAHLSDMVMRLLPVAVGQGRSCKTAMMHPSDSEEDPTAAATTVAAAAAHGPEN
                     TDKHLHQQQLAASAKARAGHEAEDAVLCAPARVPVLEDQLYRTWAADQILDYLFSPTS
                     ADGAGSVDRDEVRRSFTVAACLSGMREVPADTVEYVELLRRMLSLADSRRGAEPNNDA
                     DDADVDLPAYVRDVLVGVLPTENAPAAAANTASAVERVPVVTTTLRSTLDAVLPPRLF
                     LYYLIHQETAVAVQRQRQAAQQRQARLRRHLETHPDDVSVLEEIETLREALASEYTEV
                     PVGAVLVILERTSDVQAPRDYLVKLERTLDEVLEKVKARCCGRPLQLIRTSTAHPSCS
                     RQQHTASAPAASAKGREGAAAAAILATPDKWVCTHTLKPLPVQPVATSASGGGSATVA
                     ATLNVLELNKERTLVQLSLLGEELLRQVTVDLPERGILLRRLLDEAQLSIDARAILAR
                     ERCNATQAHLLDGQDTREATAAQCKVLESEVAELRSRLASVTARKAALGAWVEEQKAR
                     ELTASRERALFEHNLRERLVAHTERVKAAQDAERRSSLPG"
     gene            complement(<284728..>287592)
                     /locus_tag="LDBPK_040700"
                     /db_xref="GeneID:13390980"
     mRNA            complement(<284728..>287592)
                     /locus_tag="LDBPK_040700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858084.1"
                     /db_xref="GeneID:13390980"
     CDS             complement(284728..287592)
                     /locus_tag="LDBPK_040700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858132.1"
                     /db_xref="GeneID:13390980"
                     /db_xref="UniProtKB/TrEMBL:E9B835"
                     /translation="MLDGMRVSPPLVTTAAHGSSGAASADDEERRAEHASELSWNPRA
                     RAHPLNGATHHGGNAKLKRCLGYRPWSASDGRPPPASPQQQPLRTSLRGARPYTYDIP
                     ATLASLLCRYLSRTPPLSPAAAAAGVPMPEDGTACTHFLSVRWGCVEVTAPQSQSSPH
                     RRTPAEGCSWAAASFSPSARHPPRPPLRATSSPSPPPRPSASHVINKHDADKEQRGSS
                     SGCSVTSCHVPHRSQQQEHLWNLLTHYPRDASACLALGLSVCAALDAMRAAPPPVLPV
                     AVLQDIAATTATEVCFFVHACEEAWQTPEKASSEPTAAPPPLARSVDDSTCTCGCLAA
                     GQLLDPALYRFHLLYYRHHHRYAPLRRGDGGEGQAGESAMSDAHNDGERNALEEARAA
                     VFGHPHPQRQPPRHPRYAPLPPHDGWQAPGTAAERAPGPTATSPSPPPPPHLARAQGT
                     SPTVLLPLLAVQTLSRFVGVSNARRSSAMSRQRRRWGLRETRRSCRRSSAAPPGSTAT
                     AAPPLPGADSANAASLDKQAISRPSTTQPSQTAKGKDDEAEADPVSNYAHFCDETERL
                     WAVMASVLLAWKQLEQCVSLTVLVPRLEVLPSSSLHTRQFAPQSTSLHVSRSSALSPL
                     ARAAASMRLHRTTVEGMLLHAAFERAALARLRVRLLSLPPRPRDTSEANLSDDVASSL
                     LMMESFLCSELQGRIAHLPLWCAVAVEVLQLYVEQSRHDRALRERRAQEENDGTAVPG
                     AAGRNDHAAWGFVYSGRVQQVVLLATRIMTLPCVFANDASTPALAAARAEAPPPPPCR
                     TCRWHRASLANHAARAVRECGDSQHASHDFQATAATPASPAGAKVAVPVSAATVTQLS
                     EVMSRHPLFGVAVAVVGGGVPLHWAEACVAPRAMNVHSLATVPLPPLPAQINSRSGDG
                     VDAWRTPVAAMVAADAEAQTELRRLVQLLHKWLREAERRP"
     gene            complement(<289013..>291397)
                     /locus_tag="LDBPK_040710"
                     /db_xref="GeneID:13390981"
     mRNA            complement(<289013..>291397)
                     /locus_tag="LDBPK_040710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858085.1"
                     /db_xref="GeneID:13390981"
     CDS             complement(289013..291397)
                     /locus_tag="LDBPK_040710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858133.1"
                     /db_xref="GeneID:13390981"
                     /db_xref="GOA:E9B836"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9B836"
                     /translation="MSAVDALAAAPSQPREHLNIIYSDEGKRYKLSLRTPIGRLTIGK
                     VKQCLAAASSCPIPLQDMVLHLNGVPLSNDKDLCSSLGIGNGATLSVEPRHPPRQCNG
                     GEGDGDGGAWQRHSPRMRGARGTQSPVGAAVAGSPASSSLSSPFPMSRQRRLLELQTL
                     QQQDEMLRKDDVVRDDVLRHTMRHVEEEMDQANLRRRQLQRQRESAEEELQRMNEKEA
                     EAARERERLAVLRAQEAARATERAAKLVERREQLRAEQEAARAVAILKLENEKKKALL
                     AQQQAFFDAERERAQLEQENFEATTKARELELRAREIDIEHLRLARIREARALDMDRR
                     LAVKQRLHYYAQLGVEAPRALQREAAALLLTEEGEIDDNAEDEVPAGDGSSHWPSAQR
                     HGLNSKMSVTGFKSHTRKSVASAQDTSNNDLVRSRGPSSSPLSHAGHSVAAVATVPDG
                     GFYDARENAEENLRRLGDDLGLRDGLQFDDSNTCVISVDGEYTLLVMYDAATERLYLY
                     STLLASLPPVVQATTEGRLKLYEFLLEASLLGREMCGGGVGASLRNDFVLMSASLYMP
                     TSQPWSLRTLAPQFLHCLRHWRTKLTEFLQTLEAQEGHGQSGGTGAVPATPPAAARQP
                     PQHHVYTSAASSLSPSMARSAPHAGSAATSIASPHPKSSAASPSPLQASNTAVVAATP
                     LAAPYTSSFGGSAKRVIPVLGLEVTGTVLVNGVPTHYQDGVLVVNAAGPSVLAGVQPN
                     DLIEELNGTRVRNVGDFRRVIEEQLTPGMLVPVRINRGGVAMVVTVRVEAGRAL"
     gene            complement(<295274..>297409)
                     /locus_tag="LDBPK_040720"
                     /db_xref="GeneID:13390982"
     mRNA            complement(<295274..>297409)
                     /locus_tag="LDBPK_040720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858086.1"
                     /db_xref="GeneID:13390982"
     CDS             complement(295274..297409)
                     /locus_tag="LDBPK_040720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858134.1"
                     /db_xref="GeneID:13390982"
                     /db_xref="UniProtKB/TrEMBL:E9B837"
                     /translation="MDSHASLTSLAMAFHTAVDEQQRPSNKTSLPSSCAWPDAGGHFS
                     DHAYRGAQHRASSLSLSNEGATDRTATSSAVDGASRPAPATAAAVVGAPSQRRALSPL
                     SCPVHHRSHSSTSSRHDLGSVVEEFLQKATYDADVPPGLLRFLQIQRNHQLQQQQAQQ
                     YSQLHPRAHSPSVPTPSVNSVRNGVQRTPPPQSWAVPSRGLDSATSRKAATAPMAANS
                     NDNDALFHDYSSSGTVGRQFCWLTEAAPPESPSSVAEEDEKKGKALTASGGGGSSSSR
                     AHTRPRPTTATATVKQLEEHIFQRCRDSSHAMAAPRGNSQDATERYSLSASALQRRYR
                     TITDFCQGVRGGDGRGDGTTACFNSAASLTRLQRAYQPLSSTAAVSGSHSPASSGFLG
                     SRPCSQPEGVPRVSAAPVYEAAGVQPWGPPQPPHSAPNRGADSAGAGAAEAAAAAAVA
                     DCGGGDTDATYQPASSASLIPSPPSLMPSVLRGITTSASARFTVSGARRPPHVVDDED
                     WKSRSCAPPAPLLQLSLAAPRASSRLSVSARLFSGAATANTTILSSASITDVSCANLP
                     SSVAATCGMLAPTPPSADWESFGSLGMSSVQQHHYYPHHHHHHQPRFRRARAGGASNH
                     SSSVVKPTGAEAAAAAAAAVGLIDVITAGSASGRMSSYGEMEPSLTAGVTWIGQISSH
                     AASVTSPTTGTFTSTTNYCCSGASNSMTV"
     gene            complement(<298397..>300307)
                     /locus_tag="LDBPK_040730"
                     /db_xref="GeneID:13390983"
     mRNA            complement(<298397..>300307)
                     /locus_tag="LDBPK_040730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858087.1"
                     /db_xref="GeneID:13390983"
     CDS             complement(298397..300307)
                     /locus_tag="LDBPK_040730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858135.1"
                     /db_xref="GeneID:13390983"
                     /db_xref="InterPro:IPR010378"
                     /db_xref="UniProtKB/TrEMBL:E9B838"
                     /translation="MQSRAAPGRVTAAAGPSASSAAQQGTAKGAVAASGTAMLTAPLG
                     LQATVLSQPSFFPSLGEDLGDIAEEGDILFPVLGDPWSRVRRGQPPCSRLTSTSTASP
                     QQQRTREAVTMPVNLCFSTSLCVQPVLTLPRKMGALLASEVFRALLCFHNAANYSLTQ
                     AHFHVGVAQPSAPLRRALLRCTVETLPPKSHYTLVAAVPLSEASTYALAVAVDYYDPS
                     ERQRQLKWSSTFKTEQPIMEVQPRFLRYVRPTWTSAEDQPDGSDNDNESELHSSTSSR
                     AYALYQLSVGLKNMSSVPLCLADSKLVLPSLTHHRGAAVFREVVASGGRVESAKLQNC
                     CSTSSTAAEESRVPAPVLLMPGDTHLLLFTVGILLEELRHATVVHGRGGLMTRRLSPR
                     LASLGYVQWTWCRANGETGTARSAQLRVKELLAEAEVELRVTRVIAESAAHPSKRPPS
                     SSTTTLEDGDFAAADPHYHALHKQTPPAPLLAGSPVTAHFKVVNHSNVHRYDVAVKVR
                     VERLAPQWLYAGPTVRLLGLLESASSLTFSLTLLPWQAGWRSISRDAIELVDARTSQA
                     VLWPPSATVLLQSVSGESDVVLGKAASVSGDKADAHEDATLAATAPAIAAVAMKALPA
                     ADADTLCDVLVL"
     gap             300751..300849
                     /estimated_length=99
     gap             301698..301823
                     /estimated_length=126
     gene            complement(<301826..>303757)
                     /locus_tag="LDBPK_040740"
                     /db_xref="GeneID:13390984"
     mRNA            complement(<301826..>303757)
                     /locus_tag="LDBPK_040740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858088.1"
                     /db_xref="GeneID:13390984"
     CDS             complement(<301826..303757)
                     /locus_tag="LDBPK_040740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858136.1"
                     /db_xref="GeneID:13390984"
                     /db_xref="UniProtKB/TrEMBL:E9B839"
                     /translation="MESSISGSGESSGSSKSRSSNVDSARAVAAARAYDTAAIAIIPG
                     LVVPLTSASSKGGCAALASAVASLEALADTVDTVLDRLDKAAASQQRRLNGVQRRICI
                     CADFIDCLRGRRTSTLLESKPRYPQLVPFKPRSRGGGVRAKTVKSQRGAQDGANAAAI
                     VISGVPSAVSTAHSHRFLRPRRSSPLPPVAPSSCSGSSTDDSDDDAAQQPQQPSYQPP
                     MRAVPVVSAFADSERTIATAHRGFARCGGSDSNVSSPAPPVNAVAAMRLAESMPLETV
                     ILDGEESSAVAVGHGGRGEAAAGHLSVRGTLMNAASLQPSSSSALAWQPRCLPAVRGG
                     QAMHNASEMPGTLSALVSYPAHRMAYRHLVAASSSNDGNAKGAIASVQHGTPIYRDPY
                     SPTGLAATARSATRTWLHSTSTVDIQCDFTTPLQAQQYAFVPGGDAAAASSRALLRDM
                     PRNLPLQHLASVRRWDQRGGDMQGRTGGSTGSEDDEDVEEHDENGGPRQQRRASRRGP
                     RDFETIAPGQEQRQRRARRRHAVGDGSTASEGSDDDTEAAARAVNRRRESGRARPKQQ
                     QARDTSTQPTAAALSAPPAAPPSLAPPPPPGVTRSTTAPPPPPLPPTALLQGKPNPPM
                     FPLGSGGGAPPRVPPPQPPP"
     gap             304866..304964
                     /estimated_length=99
     gene            complement(<305087..>305728)
                     /locus_tag="LDBPK_040750"
                     /db_xref="GeneID:13390985"
     mRNA            complement(<305087..>305728)
                     /locus_tag="LDBPK_040750"
                     /product="60S ribosomal protein L10, putative"
                     /transcript_id="XM_003858089.1"
                     /db_xref="GeneID:13390985"
     CDS             complement(305087..305728)
                     /locus_tag="LDBPK_040750"
                     /codon_start=1
                     /product="60S ribosomal protein L10, putative"
                     /protein_id="XP_003858137.1"
                     /db_xref="GeneID:13390985"
                     /db_xref="GOA:E9B840"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:E9B840"
                     /translation="MARRPSRCYRFCKNKPYPKSRFCRGVPDPKIRNFDIGRRRATVD
                     EFPVCIHVVSRELEQIASEALEAARIQANKYMVKRANKDVFHMRTRAHPFHVLRINKM
                     LSCAGADRLQTGMRGAFGKPNGVCARVRIGQILLSMRTKEAYVPQAFEALRRAKMKFP
                     GRQIIVMSKYWGFTNILRTEYEALRDAGKLEQRGTHCKLIAPKGKITMRNVMA"
     gap             305975..306073
                     /estimated_length=99
     gap             307727..307825
                     /estimated_length=99
     gene            complement(<307826..>308377)
                     /locus_tag="LDBPK_040760"
                     /db_xref="GeneID:13390986"
     mRNA            complement(<307826..>308377)
                     /locus_tag="LDBPK_040760"
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 2"
                     /transcript_id="XM_003858090.1"
                     /db_xref="GeneID:13390986"
     CDS             complement(<307826..308377)
                     /locus_tag="LDBPK_040760"
                     /codon_start=1
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 2"
                     /protein_id="XP_003858138.1"
                     /db_xref="GeneID:13390986"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:E9B841"
                     /translation="MRMYCSAFVCFRDHVGEEALTCACMLSVFLHRRPPPRSHPRFIL
                     SLLCRIPFMNAPGACAGRCVDALLQACIDSHSFSSTASRAHHHHHHTLSITMSVEEAQ
                     NAAAMADEEIPTLEAAEVPQNAKQSKRYAKAMAKMGLKPEPNITKVTIRKVGSLSFAM
                     VQPEVYRFPGTNTFVIFGEAQLED"
     gap             309588..309686
                     /estimated_length=99
     gene            complement(<309785..>310303)
                     /locus_tag="LDBPK_040770"
                     /db_xref="GeneID:13390987"
     mRNA            complement(<309785..>310303)
                     /locus_tag="LDBPK_040770"
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 1"
                     /transcript_id="XM_003858091.1"
                     /db_xref="GeneID:13390987"
     CDS             complement(309785..310303)
                     /locus_tag="LDBPK_040770"
                     /codon_start=1
                     /product="nascent polypeptide associated complex
                     subunit-like protein, copy 1"
                     /protein_id="XP_003858139.1"
                     /db_xref="GeneID:13390987"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:E9B842"
                     /translation="MSVEEAQNAAAMADEEIPTLEAAEVPQNAKQSKRYAKAMAKMGL
                     KPEPNITKVTIRKVGSLSFAMVQPEVYRFPGTNTFVIFGEAQLEDTSALAQEAAARAA
                     VSGAASASSDAAASVPAAEEDDDEEVDAGDLDEKEINVVMSQANVSRNKAIKALKNNN
                     GDIVNTIMELTM"
     gap             310609..311848
                     /estimated_length=1240
     gene            complement(<312641..>314371)
                     /locus_tag="LDBPK_040780"
                     /db_xref="GeneID:13390988"
     mRNA            complement(<312641..>314371)
                     /locus_tag="LDBPK_040780"
                     /product="heat shock protein, putative"
                     /transcript_id="XM_003858092.1"
                     /db_xref="GeneID:13390988"
     CDS             complement(312641..314371)
                     /locus_tag="LDBPK_040780"
                     /codon_start=1
                     /product="heat shock protein, putative"
                     /protein_id="XP_003858140.1"
                     /db_xref="GeneID:13390988"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9B843"
                     /translation="MLPRQCSGELYQVLELDAQCTTAEISQQYRRLALRYHPDRNAGA
                     TVEQFQRIEEAHRVLSDLRQRQLYDTVGREGLKQLGDYGGGMLGSLLLAVGNVAAGCL
                     LLGFMTAALFTSLLISCYKIDAPREWPSWGVVLIPVWCFLPVLLLASLTVMTTSVRRG
                     MYILLLPSARLLLCVVIAATTAAALDHRIAPLTAFIPWLIWYVLGTVSDLAMLVPTVY
                     SRTRTPLFGEGRAAGVRGNHRTNTSVEDPFLRPGSGHGEASSIDESEATHSSGAEGGF
                     GNDSFLSQPWKTARYWREVAEVLFEAVCVYAFLALAFRRAMQQQAHLGSLYSLPQSRG
                     AAGDRTGAAPPVLSFWVILAPLMTYFGVHVLISMLEGSFVESTVATTPPSPEETPVAR
                     STSTNAAAPSSSQQQCAHPCHVSCRERVANVIVRAFPSACGLYMTCMWALKEEYEYNK
                     RTGGPDPSAFLAFLPILVVLGALAFLVCCGGCVVMCIGGALFPAENAAADSAAAGVSG
                     ASHGSAGRNGRESDYRSTVSRASPTSTASGNRSHTRSRPSQHAGGTGAATMPSWRGGS
                     ATDVAIEQVD"
     gene            complement(<315385..>318789)
                     /locus_tag="LDBPK_040790"
                     /db_xref="GeneID:13390989"
     mRNA            complement(<315385..>318789)
                     /locus_tag="LDBPK_040790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858093.1"
                     /db_xref="GeneID:13390989"
     CDS             complement(315385..318789)
                     /locus_tag="LDBPK_040790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858141.1"
                     /db_xref="GeneID:13390989"
                     /db_xref="UniProtKB/TrEMBL:E9B844"
                     /translation="MGSNVSVLLHADTPVPNSVITTQHKVRASSNFGGSSGDVVVRCP
                     KIRVMAAEKVKQLLRGSRAAKVAWAAKRASPLSAEESPVLVVADCAAPGALTTSRTYV
                     PVLNAILDYAEAHRKARAAPADAPSGSKVVCPIGIEFDPTLCLGDRLNRSEARAACTE
                     YCKLFFTHLIDALENVGKEVPVIAGGVVAPPRLSILYLDVRSCRLDDTTGPWLASSLI
                     MRAVRRARPYALVSARANAAGSSEDGFMSYFSPDVKADMVWASLQHVLLAHNNMSIQG
                     VEAVLENLLADDAMHDVLLQQQGVDAKALKSKEVIRALTHDRLFPRQDSQLLPHLYLV
                     DVRYNQYSDAELQRLQGKTPASVRDESARRPITGTAPPSQVPVPTPGLAPLRQPREVR
                     SGVADVSPTEYGHQPDADSHRYSAYFYARPTVSQAQHSSHSGAQAYMKLSNDASIREV
                     WDGHNGAAPDAIFASNPSSSATSSPVLSAAMSQLSMATTSTESDHLWAKKASAATPPP
                     PSTDARERREAAAPARAPLRTPSPPLTPRGELRKAQPVHQPSGIQVRSRQASPASSQQ
                     AYLTNMDAAATSPTSATQQQTAMPTSPRVLSARHPTHSPYRVDVVEPQQVYKVLTIQP
                     PASAREAPAAATPSHPTAPRQSVPTAPSQGSSTVARACCLSELKREESKLDDAEMEVQ
                     KLLLHQHRHLHPHSQHHSWQRSNSGGHNPGSSGADDEPWLDEVYTQSHGRSTSPELGA
                     GSRRRFYDIPALAPPEQPFAASAARVTPTMWETGLRKRHESPAQVVSRRASPTSSRRR
                     RRTIYDGVQPRVNSQRHVGNERLARAEYEAATAAEARAREWLREHAEQRGTAGLSSGR
                     GDPVSARQQPACHPSPSQRLESGMKWGRHSPLSKLLSPSPAPQRPAEASSLTPAKANG
                     AWASTRRRRVHQNHHAGAAALSGTAQDSSAWWSHHPSTTASAITPAKRRLSTVESPHI
                     VPRETVTSRLRKVTSHRQRHFSEMEERENTYCARNWQPRTTFRTASVTGAMCASRAHP
                     FEMAAVLQEQKQCTPADPHRGSDSSAYSAAMMMETSLLRRGDTAPQQEWSSPVHGTSR
                     DRSVIPMSVPSHQSWYSAAATSTPKYNKNGAELVHVKLRTRARAAY"
     gene            complement(<320397..>321476)
                     /locus_tag="LDBPK_040800"
                     /db_xref="GeneID:13390990"
     mRNA            complement(<320397..>321476)
                     /locus_tag="LDBPK_040800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858094.1"
                     /db_xref="GeneID:13390990"
     CDS             complement(320397..321476)
                     /locus_tag="LDBPK_040800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858142.1"
                     /db_xref="GeneID:13390990"
                     /db_xref="UniProtKB/TrEMBL:E9B845"
                     /translation="MCVRLRANQRHTVPFLLFPASVCIINTTAVAPPPRPLFPSHASP
                     GIPSPLRSPMMDPYYGKARKPYVPIDTCSPGGTWVEERRYNRVRPTVTGAAAAAMEPG
                     ASGASSPGADSLTAADRRPRRVLCGNWKEEDALERDLLAIQEAQLQQQHKQAGGELLT
                     SSSAPVQHMQAFLKSGWNPTATMEVITEKPNGIYTGGHTSTPYLTCDSRHPAMRSLDS
                     TYRVEFSSTSSNVASLRRPDLGVRSQRLMEQARVAAKEMQAASLRARQEQQQLREASM
                     KWMSRSCGPNVSEYRATMCDENEVLPIVEELSQDYLSDEPITLYTGNPNTGKTMEVHG
                     KTPVDPVSSSRFGKHTHFSEFKYAY"
     gene            complement(<322473..>323789)
                     /locus_tag="LDBPK_040810"
                     /db_xref="GeneID:13390991"
     mRNA            complement(<322473..>323789)
                     /locus_tag="LDBPK_040810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858095.1"
                     /db_xref="GeneID:13390991"
     CDS             complement(322473..323789)
                     /locus_tag="LDBPK_040810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858143.1"
                     /db_xref="GeneID:13390991"
                     /db_xref="GOA:E9B846"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /db_xref="UniProtKB/TrEMBL:E9B846"
                     /translation="MLSFLEFYLEMMKFVLFKLESDLARDEADRLAAEDEEGVTRANA
                     EDFANGGALAVLDVGANGAQAKEVKEAESKRSLMGEELHKVRELFRGLTFFISREVPS
                     RRFALVINACGGRVATDYVPSNITHVVVDRPALPPGMKKHDQLEYVQPQYIFDCLNAR
                     LMLPVTGYRIGEELPPHVSPFSVSITNSAEDNAAVEQVKKDHPRIVGYVPARVHEIRK
                     LINPSYSAVDPEGKVAHLEGEYSDEESHVAVPEMDMEDDVSLSGDELAEARRKPAWQE
                     EEVTEEVQRPKLSAFKVKKQREMNLMNAPTNEVVARRRQALRKAQEKSRQTETSEARL
                     QRKMSEVKRQEAATRKMQLQVARKKAARFYKMISGVVQGTAKKAATLEAKAKHIAEGK
                     LHKTEDGKGLVNTRLEARRQRAEAKGKKLKERKAGNPYKKLPKWVQ"
     gene            complement(<325190..>326371)
                     /locus_tag="LDBPK_040820"
                     /db_xref="GeneID:13390992"
     mRNA            complement(<325190..>326371)
                     /locus_tag="LDBPK_040820"
                     /product="metalloprotease-like protein"
                     /transcript_id="XM_003858096.1"
                     /db_xref="GeneID:13390992"
     CDS             complement(325190..326371)
                     /locus_tag="LDBPK_040820"
                     /codon_start=1
                     /product="metalloprotease-like protein"
                     /protein_id="XP_003858144.1"
                     /db_xref="GeneID:13390992"
                     /db_xref="GOA:E9B847"
                     /db_xref="InterPro:IPR000181"
                     /db_xref="InterPro:IPR023635"
                     /db_xref="UniProtKB/TrEMBL:E9B847"
                     /translation="MRALHTAFGVAGNSCGTSPHATVASARLAVAPPPHSGLTLPFFT
                     RCGASSAVFTTRAHSVGCCRYAAAVEQHRLCSSHGCHSNSSGSSADSSRPYVPGQAVQ
                     ETYPIIQLPARSLWCRQYALDARRVAQGEYAGLVSQVREARHYYQYPSMSAPQTGWNV
                     QMFTLFDNSVFINPVNLDEEAWRAEAAQQGMSWVAFEEEKMRELRTEGLTGFAWEPCA
                     SSGFLLHYIERPLTVRVRALDEHGKPFTVTLDKMRARMALHELDHLQGVLFTRRVVDT
                     DHVVPMEGFVTMSDWSDDYPSLEARSTFLYTIFTPPYHFVSDAVPDGNLLDRKFEDGI
                     YPGCEQDRQQRIELAAMEEIQRNAWRKEKAKRKEGGQQCGRGDVGTVEDDDGSGTHGA
                     S"
     gene            complement(<327350..>331540)
                     /locus_tag="LDBPK_040830"
                     /db_xref="GeneID:13390993"
     mRNA            complement(<327350..>331540)
                     /locus_tag="LDBPK_040830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858097.1"
                     /db_xref="GeneID:13390993"
     CDS             complement(327350..331540)
                     /locus_tag="LDBPK_040830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858145.1"
                     /db_xref="GeneID:13390993"
                     /db_xref="UniProtKB/TrEMBL:E9B848"
                     /translation="MDSAAPDQAHGPASGTDYSRASRRHNHRSSADAGRNGDAEPSGS
                     RTSSSRHHRHHRHHRPDDSEHSSRRYKHRSHRRTDSAQVDDTTAVPSENNFAASSAKE
                     HQDSQAQEPQQPSLDDEAPSSCVSTHSSRLPPRRHERLSVTEAPGEPQRSFASPASST
                     AVPGSSAASEIIRSGSALARRNGAAINGRSSAGSSAAAAAAAVGALKAAAAPSLPSWG
                     RKSSSSRTFSEKPPAEESSDAADGAAPALKTPAHQQPPPPPEAVVASPSPAAASLASL
                     EAAVVKADAMVRSWQQCIDPNMENLPSSLTSSVFRSGHSAAPAAPPPPAPPSASAAHP
                     AHRRDAAEEASQTSSRLKRTSQAPSRCGAGEVHKKASEDAAEGGMNPARHESAAASPV
                     GVPAAAEAVVTTGQPSSVRSHASSAVVEDARRSNASVRPDVGEEHGVTGSSASSVYQR
                     LPRADPFDKESVSSSHCDSGALPPPPAFSSFASVPSVAAAMSFKSPGQQASQRSFPAA
                     SVSSQSPAADAAATPKRVRGSASPRSFSGSCGGALPPQRRDCQGSVTSRSTAGFEPFH
                     LNTERRSAVRRSMSPCCAPPDPLASVPAQERQRLLNLPHQLSTAPGTSRLDMNFEQDV
                     KELYRQTHLVDPLLLSRPGRRQFYIPEQADLFGMYPEPPMTTDEDGNEIVKHLAPIPI
                     QAQSFVPSQTRKSSQPPPMAPASRVQHGKAAEADATGGSSSGRAVVRPGRGLSSFVVG
                     YGEETTAKGRGGLTQPRGRIVSDITAPYRRNMAANTGRTGHIQREALMANCLLPPCGS
                     ETPLPASARSLSPGMMAADESQASTPFTIMRPTPSSEPSNGIPISDSEYGYARVTTAR
                     MMPAAVSLQDHQQPCVNAVAAFAEDEEYSYNVQSAAVMVSSKPTLTVSAAVVVQSSLG
                     GGAGSSSSHSEGISVQVKPTVAPPPTCVDASTAMVLAAAPKLTGTPRSTSTDGAAAAA
                     TERRSCPVRRGEGAVNAAEKASASSLVAASASLLNEAITGASSSNSSSAVTSEPKKAP
                     KDSRRSTGILKSLPLQQQAEQLQPGESEAVAAAASQSTAPTPKTAPSSVMDKSTHSLA
                     FSVAASSTVVDPSPEPPIPTARRHADPVPVSMSPLSESSLPSQRNRRERFQPTKETRV
                     SPSTSLTGTPPALPPPPQAKPAAAVSSEPDKPSAVHEGYGSALERYRRKEAAMSKDGN
                     MRRVYRRSRRSESGATVEAVAEVPAATAAHGDTLACFPPGSKPASALSMAASTSSPNV
                     VDSAAAGHRSRCRETPLALDRGTQTEFVFVLDDLQGRQLQQLQQEQLLKNLQLMQLQL
                     QRQPLLILNAGSYSPSTFTTTSTPRMSLSPQPQTSGSTSPSMKPRQHSAGLSPTRQRR
                     GYFVNDSRAVRDALWWPR"
     gene            complement(<332789..>334870)
                     /locus_tag="LDBPK_040840"
                     /db_xref="GeneID:13390994"
     mRNA            complement(<332789..>334870)
                     /locus_tag="LDBPK_040840"
                     /product="tyrosine phospatase-like protein"
                     /transcript_id="XM_003858098.1"
                     /db_xref="GeneID:13390994"
     CDS             complement(332789..334870)
                     /locus_tag="LDBPK_040840"
                     /codon_start=1
                     /product="tyrosine phospatase-like protein"
                     /protein_id="XP_003858146.1"
                     /db_xref="GeneID:13390994"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9B849"
                     /translation="MDVENGAGHNSPSSLSTSSQSLTASTGLGGGAGSGAVGGSHLTT
                     PPTTRGTPAAAAATPVAAPVYVWHSSSSMAGAAPWLRLHRPASAAAACVGGRRGSAAP
                     AAGTGGGTGGVGTPQNPGSSGAGMLASPPHLSTVFGATDEDAAQRSSTCSVSGRDTGG
                     SVPAVARGLSQPHHQQELHADPVAGSGASDSLSAALPLTLVPPFRFARVESGVYRGAY
                     PVLRNFPYIRRLRLRTMVSLIPEPPTYDLKCFAEAEHIQLHHIHAERAKGEVQLLPSE
                     LSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALRKLLQWDAKVANAEFQRFTREVQD
                     EAAFIADYTGPLLVPPHLPVWLWGGSIYDAATGQQKRLPAAIRLRLSTAVSGGAGSAS
                     ATAGGVAAAPGAGLGRVSASASGGTSSATGTGPVNGPQSATSAAVSHKPKGGTLRGPS
                     GDLRPQAAAPWMCVPQAETVAADGQHYIDVDRLPVALPLRGSLPGPAAPHWIPSTEPS
                     ATASTGTVSGSGGGAGTLNVHLHLTRSSAHSSRSTSEKSSMAGLPAAVSAAAASSTGG
                     VGGGSRWQSTTSWDALQQHQRRLASSLIHSDAAPSKGAGASGLLDGRVSALLWTSGLI
                     VPSATVGGGSGIPGSGRVSGGSAGSSGGGGGAAGGNANGGGGAVVGINGPPTASSPPP
                     SARTPKRSYSR"
     gene            complement(<336876..>338066)
                     /locus_tag="LDBPK_040850"
                     /db_xref="GeneID:13390995"
     mRNA            complement(<336876..>338066)
                     /locus_tag="LDBPK_040850"
                     /product="rhomboid-like protein"
                     /transcript_id="XM_003858099.1"
                     /db_xref="GeneID:13390995"
     CDS             complement(336876..338066)
                     /locus_tag="LDBPK_040850"
                     /codon_start=1
                     /product="rhomboid-like protein"
                     /protein_id="XP_003858147.1"
                     /db_xref="GeneID:13390995"
                     /db_xref="GOA:E9B850"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:E9B850"
                     /translation="MQQPCFFAARCGAQRISRLATAAAARVSSSPAIMRCAMSSSTSS
                     NRLLTVHASATAMRALHSGSLPVSSTLTQRKLSALPTSLTALRTMRGAATIVVPARAS
                     FFAGAAVSPMATACSSLFAAQRCYGVARATRVARSPKKSSEGGGQLQGVNKLARYKGE
                     EEDEQKDGGGNEQESPFNMNSGPGYLPFPPPFHTINIVMILFLANVMCYLIMNLGNDD
                     WRDFVVEHCTLSHENWTRIYPLFTNAFYQENILQLLIDCWLLWQFGDTMLGFLGNTRM
                     TFFALLCTLGGSVIHVARQKFELYYGMDELEVRGRCYGPNPFIMGLVAIEGLIFRHLN
                     FIQQPPIPFLVLTAFVMVIDVWRIFTTKPEEHGAATGGALMAYLFWALPTRMLGLDKL
                     TATL"
     misc_feature    complement(339564..339632)
                     /note="Short protein (LDBPK_040860, CBZ31424.1) was
                     converted to a misc_feature."
     gene            complement(<343275..>346829)
                     /locus_tag="LDBPK_040870"
                     /db_xref="GeneID:13390997"
     mRNA            complement(<343275..>346829)
                     /locus_tag="LDBPK_040870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858101.1"
                     /db_xref="GeneID:13390997"
     CDS             complement(343275..346829)
                     /locus_tag="LDBPK_040870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858149.1"
                     /db_xref="GeneID:13390997"
                     /db_xref="UniProtKB/TrEMBL:E9B852"
                     /translation="MTAERVRSGSASRALNGMGLPESSRVAAAPQRQRGSLAVVSVLP
                     RTDSSSQQQMRPETTSRDGEPAHGMLLGSLTEYRPVSAVAYANSAAAARTSTGASAAV
                     SYPSASAAPALRTSSSRDHSAGYPLEALSLSALGSSENLFEHNTPGARQSGVRGSGAP
                     PLAPFQQQTSLDAGLQGGDVIASQDLRGSKHSIAVLKVTPGGKAQECTRPPTSDSTAQ
                     GGGGWSTPGMHAAPVQPPCRTSFNQVGSTTQLGSASAGVQVEKIAPIGETSLSTAPRA
                     HAAMPQAVAAAELRQRPPRRSSTSASAAIVQSSPCVATTTAAPMAAAKSTQPAAFMPS
                     STTTSSPAASTQHTGSRLSWQSSRGTPRSTHTPERSTTALAAVSTGAALHHRSSCNGA
                     VREAGEPLLIGPSTLQVSTTTLTKTTKKVRYRLPDEPFDPDAPDPSDIGSLRAEEEAA
                     LLDPVSYTCAVDEVAGRYPMLLRRPGAHGGDVLHGRRGSASSRLGDGAPRPTFLLDDG
                     NRWARATNRPTVATTRDPSGTATTQLPAPRILQKTGVAGKTAVPDTSSEPFPAHQRVA
                     ADGSTTQASSGEEAGGHLLQRHVQQIAIGKQLVKGTVFQPPSMGKRHTERCRREQDED
                     RMNAAAAAQPALKDKGSSAGAAPPEPRRRRRGNLEGLYDEILRRTQQNRRTTLPNTIP
                     PAAVPPQALPLQPPGAAATAARPTTERRSWRPHLPSAEPAPPQRGSGVNPGVAPRLPH
                     TAPQPWSSSQPCIPISHDEEMPSDSEMSSQNGYRTPLMYSATQREQQAPTPLARAGAA
                     ATGCAGPRLSNSVPHPSPGVPQPHQQQVVPPRESYSLARGPPPLAGGGRPVEPKQQLD
                     SVSPRLQQQQQCPSPHVRPGYGVAAAALSTGSHMPEHTSGRSGKYTRAVFAPPPPARA
                     QPSQHALSSSSYGNSAYRHDEEDDDRYNPAPSGSHYPADEAYAAGTHTPSAAVTAFGR
                     NSAGAPEQHTCATHVHGAPQINNGTGSSSQQRSRAWQHAEENLSQRTEAVHKENLRAE
                     GMVRPHNEGRSHHRTHSSALPPPPHPPPTTSAAASSSTALRTPAAAANTPAPAPHTVF
                     VTSQAEYDEALMSTSSCTTDTQPVAVSECGEDEMINDENDGLVKKGPPVLVLGDEVFA
                     PDGYEYVREDDEYAEYDEQYNTESEDSRGHHQELEEAH"
     gene            complement(<348793..>349314)
                     /locus_tag="LDBPK_040880"
                     /db_xref="GeneID:13390998"
     mRNA            complement(<348793..>349314)
                     /locus_tag="LDBPK_040880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858102.1"
                     /db_xref="GeneID:13390998"
     CDS             complement(348793..349314)
                     /locus_tag="LDBPK_040880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858150.1"
                     /db_xref="GeneID:13390998"
                     /db_xref="UniProtKB/TrEMBL:E9B853"
                     /translation="MRSTPHGPLLHPRTSSVRQDAITYPYAYAAPGGQTPSAGCEHDD
                     NTAAEAGPARRCVPVRGNRATPASNTNPYPSDVSCSLSYPEPAPAVATTQPSSTFQDQ
                     KPVVYTVQNTTTDTHTHETEYGGVLTIRTTTVTRTITERLVASDEDDDSSENGEVHLE
                     DARSEASLPSLPH"
     gene            complement(<351182..>355009)
                     /locus_tag="LDBPK_040890"
                     /db_xref="GeneID:13390999"
     mRNA            complement(<351182..>355009)
                     /locus_tag="LDBPK_040890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858103.1"
                     /db_xref="GeneID:13390999"
     CDS             complement(351182..355009)
                     /locus_tag="LDBPK_040890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858151.1"
                     /db_xref="GeneID:13390999"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B854"
                     /translation="MGNAASSPRRAPAASSSPARASSTAPATEPRPRKMLVNAAPRAS
                     ASNFRSPAAITAASVNRQARSQSPEAKSASLQQATLQRRQRIPGMNGSGSAGGTSVRG
                     DVGNETDVLLAFTRNADPISLRVLELIQQADAVPQDSPGEKLRLLQECYPLLARVPND
                     CFDQLAVTVYQKEGDVYHQQGDIENAKNTYSRAITLAEKRVARQDADMYMVLKRYVLA
                     MVGMARIWYDHERDHQGFTFVDHKHPKVQAVDGGDAVHDANSSMSSLESSLMSDGGSV
                     FSLNEAILKSMAPRPPRRQTGPLFQRVKMRAPHVMQSSQLNREDEFVLHSRMTRELVA
                     SPCELLLLRCCEVVQIGHNSQSELLIPAQIELAQIYEDLALYSRALLLVRRCVGILCS
                     VYDYDHPWVIHLMHRADRLEGRLEEQMRNNMATKIQATWKMHRAMQQLEYTLGHPVRR
                     HQRIPRKYRAIPGLDFLHEYVGDMPADELLGDDADDGVYGGPGGDHGHYRQQAAEPEQ
                     WTEVPPSAPVQASGRHSADPRHPSGTPGARQERKSPYNATALVRYAPNEHAERGDTFT
                     TVVPNATVVGTTQDTQTDTDVHHTEYGDVLTVRTTTVTKTITEGLVDSAGDDTDEEPS
                     EDEGQPAAPVHVGAPPPQQQQKQPRNPTHPTHPLQPAPAPYPSDDDADEYDEERECSW
                     AERTPTELQQHQQQPPPQAPPPPMRREEQTQAQPCGHVVTTQTPRPPPRANKQTEAAW
                     PLRREEEEEPPRTSRQAATTSPHSQRHETATQCNPDRGAHRAPAHQPPPPAPTPQRQP
                     LVQSPLPPSWRHRASVSRPAGASEADIALDPTDDTPSIVARAPESRENPLPERPPPKA
                     ERTRVHLHNSREAENAFDDGPSRWAQRGAPPQQRHTHTAPPAHRSGAALEAPLDNYED
                     GNAPYQEEEARSEVIAGSDAHPSSSAPSRPYVPDVRHNSRRELFRDLVEPNTAFQAEW
                     NGYPAFLPLLGHRRSSGRSSQSSSMPRTSSESGQLVPHALGHSGSHPSKQQKAPMQLC
                     DRRHQRGSDGQGQQSGTPMHLTAPANVYPLTLPQAAQQPRTVKTTRDYKIIKTRRVRT
                     YTREPVSNIMDSENTSSRSGSASIDESMSSARWEADSASVSGSTHVEYMEEKDEQVDA
                     ASVNSKLSNASAPRQQQRQRQPSVKAPAGNVKVPHRPHKPRMPTPPTKSLAKATGDGN
                     GSSGAAACRPSTLPTKAETVRVVSEKGSEDRDSDVLPNYSSSATTVTRHVKSDHHGAT
                     TRTTRRFSTSTNS"
     gene            complement(<356401..>362025)
                     /locus_tag="LDBPK_040900"
                     /db_xref="GeneID:13391000"
     mRNA            complement(<356401..>362025)
                     /locus_tag="LDBPK_040900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858104.1"
                     /db_xref="GeneID:13391000"
     CDS             complement(356401..362025)
                     /locus_tag="LDBPK_040900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858152.1"
                     /db_xref="GeneID:13391000"
                     /db_xref="UniProtKB/TrEMBL:E9B855"
                     /translation="MSTARAGCSIRTTRAPSETSRPHTGRAWPIATSANTIYDSSTAN
                     LHYRHPNGASPATAATCTSAAHATPQQQQRAPSSRYPHSASSRLGSSHNRDVPFHTAP
                     PASAGLALPPATAAAQRGSSPQHPLTPAPPQVSPHPASRGRQPTLAQLQHTPLVGRNG
                     RRSAGSQTGFISRTSASGHSHGSPAPSSQHMPESPASAAAPSSSLSPQPQVSSDVASL
                     MSGSHRRPPAPNTPCGVENSSKAAGARLEHACFVARANSSRPLQRPPPTSQTRRSVVY
                     VEPTVAIADARPAPQLQLDTDLQAHSTTPRAAASAWRTGNDGNAAAAASPQQQLQPSL
                     PLNYYALEPSLQLAQHRHVRHIVAGDLSSAPSSSHPQQQPVIVFVPQPRPAPPQQERL
                     PRLYSSTTRPAGRPSRGAVQNNIYAGMAAEDTSSVASEATSTRSSFTRQVFRGATATA
                     SDIPTGSPYGAMPTYAVVMPRRNLTAPQKAGASAASVGHPPPSAPAETAKQPQHNSRY
                     PPSSSRPSPQESRGHAAREQPRPPPQPPREKWPVLPQRTETANSQPPPRMRLPANPFY
                     SEEMIPEQRRQDAWCGDASTRQSGHRGGDSVRVPLQRQLSLSHEEVLSLSAMLSSATV
                     AAPIPTKTDPYADHTAPDGEPRPLHAVMPPPIIQCPHAAAEEEGAPRFSVRKAIPPQR
                     EPDAVPPRHSPPAEHTLPHGRSAADAGEAAAKETREQLSAAKAAAAAMTAAGAQSSKK
                     PQQPQHQPDCSPYGENVDELLEADDRIMQPSRPQSSRHGAAVLSSPIQSIHSLQSPAV
                     KCFSDAPRSVHTVTESETTTEQQQQPEPQLRPTSLGRVAVASVERGRCAVVKAELVPP
                     PSAQLLPTVMDDITERDEDEQLNSVDPDRMNMTLPQKMDAPRCGGSTAVHGATEGLEP
                     PRDAAVDAMGTAEERREGKEALCGPSTGADDGAKTLQEADDTSKPTEASAAPLVLGER
                     YVYVDPLEEASMDAAYMLDTLEQQYVRINEETSEEMEDVMHVVELNRCDRAAAMPRSF
                     MPKGRYPDVLPMLRYPEDEVPADASAATTTGSRSRPASSPSAEKLKYFPLREAAYLNL
                     CATVWLSRFHAAEAQDLLASDDGTAASGEGHEGARPSSAAVIYHNLDHPSANLLAALD
                     GRVSAYVQAFISETCAGRDGADPCNYEAACVRLRDENNIGCRPHGVWAEAAPQTLSFA
                     DHVTNILLTATVPHEAKRRRAEAARKTTAEEVAARRTWLYFLGASPWNYEVVAANEAY
                     AAMPTAGARLAYAFMYKARTRNVDGGLGSLMFSMLSQQVPEAAFVDCLLMQEKLRLAL
                     LHSCSNIVACCALRQQALRKPRVPSKETPSASASVWTSPVLSTYLTLYEDSATPPTRR
                     PPDGAPELFRLDRSPGVDEGASGKGGPSRTALCQHEDSHPKEEATPCGAAERVDLYSV
                     AVQLNYFFPTKTQRGMHQLCAALIEDLIAMDALPVPEKVVTPEGVVLTDRTSIVDALV
                     VEGAQAMQHIIMTLSARRKEVQPETADSYRTLRGSIDTAAVRAAMEKRLILFDPAIMC
                     FLSTPVPINDLFEYAVTDGPPSMQPQSTGRKSWLVEVLRLQHVAETVQYTMEMQDAIL
                     VARQLNHLVVSAQQQRALADKHDPGQKHGRYSTRSVAEELQMDAVVVGQSMDQVLRRA
                     SSASLLGMLGVGNGERTAADEPSLEDLRDPNTNRDRSDVSVRAVLVALCSADPEKPKA
                     EVQEYLRHLLALYFEVRTPDGNTVDSDDTQQVAMARLMTAEMATWDWFGDTMQNGTLR
                     AGAAPAHCDKIRVSAEELASLCPRVLGRRVGVASTVVADATAAVIAASTAEAVEPAPR
                     AHDEGNDDDSVLVAESAPRLPHDPRRSFAQEM"
     gene            complement(<364207..>364950)
                     /locus_tag="LDBPK_040910"
                     /db_xref="GeneID:13391001"
     mRNA            complement(<364207..>364950)
                     /locus_tag="LDBPK_040910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858105.1"
                     /db_xref="GeneID:13391001"
     CDS             complement(364207..364950)
                     /locus_tag="LDBPK_040910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858153.1"
                     /db_xref="GeneID:13391001"
                     /db_xref="UniProtKB/TrEMBL:E9B856"
                     /translation="MANSRASTLAAAAAAASTAAVKPLSYVSLCSHDGKRIILPVAAA
                     AGSRVLHGIFQGLYVMRLHQCNSPADQPPHEQHEQYPMAEEDEHQGELHIPRPGSSSS
                     GSDAANKAHGSAEVKVDDPIPIIEDEDDIEEAEARHQANGAAYRSYAAVFPSNVECVP
                     PPPPPLLSTSPPATPSPRVPPLLEVPIRSLESSTLMRVAEFLVVKITLASHPHYLHEA
                     NVFGDLDRTSERDQLVAMQVLLGADFLNC"
     gene            complement(<366518..>368305)
                     /locus_tag="LDBPK_040920"
                     /db_xref="GeneID:13391002"
     mRNA            complement(<366518..>368305)
                     /locus_tag="LDBPK_040920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858106.1"
                     /db_xref="GeneID:13391002"
     CDS             complement(366518..368305)
                     /locus_tag="LDBPK_040920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858154.1"
                     /db_xref="GeneID:13391002"
                     /db_xref="UniProtKB/TrEMBL:E9B857"
                     /translation="MEQPPQEQWSSRSPLTMSGRLAPLPQPPLSGFNYRRDPALMMAE
                     EPTPPGTITIQDARAAPTAGLRRPHCGEPHFNAANAASSSPVPPIAIPYIALHNVGWK
                     DSNFKGRKWVIMPMVAGFESTFIANTLQGLLCLPGCESAMMGESAVTSSGDGGGRHGS
                     AGTLGQDDSRRCGESGVVLQSSGSSSLAELPQPQQQQAHGAAADDDDGLEQHSHARSA
                     SPDGADEHSLSSSVTSDPTATEDRTARSLSEEGGDAGKGSSARRAEAAKSRDAGHSPQ
                     VLRGGIRSQWGTRVKTAASRTYAAYVMQHLSDANIQLRAPVPHDGLPSDAPVTDTQVD
                     DAEELESLRGQSATVPRCLAPVALPKEPRTAPQVSGGSGASKSRAHVSIFLTHEAKED
                     EVCTSTCGTTSAAGAEPSERSVTTTTVAPAAMPPGTASATAIAAVSPPEKAAVLMGLE
                     EGHSSDDNNSPTPSSREEEEEEELWGSTEDTNTGQAGGAAHNAEATRMTNRQVAQDGS
                     RYTCFASNCVDNMPNYPLPQLQSEDLVDLAAFMVVRSSLQPDEATDLHLGTHVLGDPQ
                     NVRMLPPEQRAALMSRAARLMEAAVFLQV"
     gene            complement(<370189..>370635)
                     /locus_tag="LDBPK_040930"
                     /db_xref="GeneID:13391003"
     mRNA            complement(<370189..>370635)
                     /locus_tag="LDBPK_040930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858107.1"
                     /db_xref="GeneID:13391003"
     CDS             complement(370189..370635)
                     /locus_tag="LDBPK_040930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858155.1"
                     /db_xref="GeneID:13391003"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:E9B858"
                     /translation="MSLYGARESGGDEMLTPGITGMSGNYRNESNCHRFWNRLMTCMR
                     ESQELDVLYDCRSRMLDMRECVVRHKQSTWVMRETMTSIRHEGELRKWLRDYDEKMGH
                     PPLLEAVAAVRKKVDAEGGVDIMNPTVFKDPDMYIPRRVKVASADR"
     gene            complement(<372589..>374070)
                     /locus_tag="LDBPK_040940"
                     /db_xref="GeneID:13391004"
     mRNA            complement(<372589..>374070)
                     /locus_tag="LDBPK_040940"
                     /product="chaperone protein DNAj, putative"
                     /transcript_id="XM_003858108.1"
                     /db_xref="GeneID:13391004"
     CDS             complement(372589..374070)
                     /locus_tag="LDBPK_040940"
                     /codon_start=1
                     /product="chaperone protein DNAj, putative"
                     /protein_id="XP_003858156.1"
                     /db_xref="GeneID:13391004"
                     /db_xref="GOA:E9B859"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9B859"
                     /translation="MKASPCRLAASRPPAAARLYRAYGPVHLLPRTTAMRRLAAASVM
                     MATAGSLGETLLSSAAVSAGGAAHSATGGSTALLQHRRWQSGGGSKKDLYSVLGVARN
                     ATPEQIKSAYKKRAKALHPDVNPSPTAAEDFAEAKQAYETLSDPQKRSLYDMTGNASA
                     AGGFGGPGGTGGGFNPFGAGGNPFAAGGNPFANMGGANQPGGGQGGFSFNDFEEIFQK
                     MSNSGKDKTRKPQGPEPGADIHYKLVLSFLDAVNGCQKEISYNTMRRCGACTGSGCQD
                     TGSRTKCPHCGGRGKKVMSTGFFHMQQDCTHCGGTGELGRTTCTQCSGKGIVKDRSVQ
                     TLPVPKGVDNKERLKVTGKGEAGVRNGPPGNLYIEISVEDDPVFHREGSDIHVITPIT
                     LSTAVLGGTARVPTLTGEVETRVPVGTQQGDKLVLRGRGVHRPNHNKTGDFYIHFAVM
                     LPKELTEEQKKAIADFSKDERPLHLNDAQLQELKGRYRSWFAT"
     gap             375832..375930
                     /estimated_length=99
     gene            complement(<375932..>376024)
                     /locus_tag="LDBPK_040950"
                     /db_xref="GeneID:13391005"
     mRNA            complement(<375932..>376024)
                     /locus_tag="LDBPK_040950"
                     /product="60S ribosomal protein L10, putative"
                     /transcript_id="XM_003858109.1"
                     /db_xref="GeneID:13391005"
     CDS             complement(<375932..376024)
                     /locus_tag="LDBPK_040950"
                     /codon_start=1
                     /product="60S ribosomal protein L10, putative"
                     /protein_id="XP_003858157.1"
                     /db_xref="GeneID:13391005"
                     /db_xref="GOA:E9B860"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="UniProtKB/TrEMBL:E9B860"
                     /translation="MARRPSRCYRFCKNKPYPKSRFCRGVPDPKI"
     gene            complement(<376923..>377552)
                     /locus_tag="LDBPK_040960"
                     /db_xref="GeneID:13391006"
     mRNA            complement(<376923..>377552)
                     /locus_tag="LDBPK_040960"
                     /product="adenylate kinase, putative"
                     /transcript_id="XM_003858110.1"
                     /db_xref="GeneID:13391006"
     CDS             complement(376923..377552)
                     /locus_tag="LDBPK_040960"
                     /codon_start=1
                     /product="adenylate kinase, putative"
                     /protein_id="XP_003858158.1"
                     /db_xref="GeneID:13391006"
                     /db_xref="GOA:E9B861"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B861"
                     /translation="MSGETQQQQPQGMTPLKVFFILGGPGSGKGTNCARLVEDFGYTH
                     FSAGELLREAARSGTGNLAKIGDIIRSGNIVPSEITVELLRQAIADHPNSVGYVIDGF
                     PRKEDQARMFEEGIAKPTGILYYDCSEATMEERLLSRGANSGEKRDDDAAETIRHRFR
                     VNVQECMPVVEAYKANGRCHVIDANRDRDTVYADTKKVFLEMGEKPLKA"
     gene            complement(<378442..>379908)
                     /locus_tag="LDBPK_040970"
                     /db_xref="GeneID:13391007"
     mRNA            complement(<378442..>379908)
                     /locus_tag="LDBPK_040970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858111.1"
                     /db_xref="GeneID:13391007"
     CDS             complement(378442..379908)
                     /locus_tag="LDBPK_040970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858159.1"
                     /db_xref="GeneID:13391007"
                     /db_xref="UniProtKB/TrEMBL:E9B862"
                     /translation="MGARSPTSAASNAATAPRHQRVKRTLRRYCLAPRAATATPAVAA
                     PGDDQGAAQATTSSAAGSPRKSAAVAPQKPQCPSLPQQQRQPKRCTGRCPGQTSHATP
                     ILSAVNGDGDAGASPAGLVAPTPPLHTAAKARSGERGISAPSAALHQGRSHASPLFTR
                     CSVPQRPISTTVGVARRLLASRPTEHCGRGSGAQPPSSSSITAPVPPVPAPSAPPPSA
                     PAATAAAAHTGYHHRTKPHYSLRPSYAAHSAQWWRSPVPTIRVADRYRSPPAAREYRL
                     RARQVRHASREDFVEALRSCMASGGQEVVPDGVVGALTDTRDAGSFDPSLHNYNVMVT
                     DAFQNSIEERAARLQATENRMWERIILNVAPLAVAHQHVAEVGGWSVLDSGHVSSPIR
                     ISSAPEAAYVDDGVAEVDEAMAVVVRPFSDELLGDSEALRVAEAQRRWPKGREWDRQA
                     AIQRAVGSTAQEAIIDLGIDPRYRQPGERPGCVSNRRA"
     gene            complement(<380969..>382414)
                     /locus_tag="LDBPK_040980"
                     /db_xref="GeneID:13391008"
     mRNA            complement(<380969..>382414)
                     /locus_tag="LDBPK_040980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858112.1"
                     /db_xref="GeneID:13391008"
     CDS             complement(380969..382414)
                     /locus_tag="LDBPK_040980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858160.1"
                     /db_xref="GeneID:13391008"
                     /db_xref="UniProtKB/TrEMBL:E9B863"
                     /translation="MASTVPWYCRHGVHGDLAKEVNVDGTVVYRTRERRCDCTPPRLC
                     PLVLPTAHPRPHPPPPRRRLSGPRTAPPRKCGRGRVVGTGRERIVPSWQKAYAPLPDS
                     SLPCPSGEMDDTRLHVLVPPLAFDSAVGDFYAGYVSSTSHDAAATLPFIPVINPQPAL
                     AGVAPFTAADDPISAATAPLGVGSCVDSLPVGMSPVPQPPLQESQPAAAAELRSAAPL
                     ASGAGNPQPSPSAAAVAAPSSPCTVESHVMDRLCGFLHCPTCGQRVAVATPSGLEAVQ
                     DMPAMCPMGPHVAPGAEHRTQARGAASVGRFCFLCGIDKQAPTCKAEASVPPPLPSPQ
                     QQPLAATEGHTANAPTKEEACARQTLPPAATCENAAAAASATTPPPPSVPATAGAASP
                     DLHLDQDLRTVDEVISHLLRNATENGGRVRPPCGLPQCRLCDPSAAAATAPRVTPSRW
                     MCPLWQCGWWGRQPVMCGSPAVAIIHHHYAK"
     gene            complement(<382764..>386489)
                     /locus_tag="LDBPK_040990"
                     /db_xref="GeneID:13391009"
     mRNA            complement(<382764..>386489)
                     /locus_tag="LDBPK_040990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858113.1"
                     /db_xref="GeneID:13391009"
     CDS             complement(382764..386489)
                     /locus_tag="LDBPK_040990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858161.1"
                     /db_xref="GeneID:13391009"
                     /db_xref="UniProtKB/TrEMBL:E9B864"
                     /translation="MSQRHSSGVVSGQLAQMPWNANGPADDDGDELRTLLEDARTAQA
                     GHLGKSRPTPGPSLSRFPVASSPQGSGHDHLRHRDNADVDLWETRQAQELGDDFFALY
                     TSQADAASPNGRSGRGGVTPSSANASATAAGSRGDGDDVASPSDQEDEGTSRDNDVDV
                     PGEVRVGRADDHHAQQSQYVPECTEDLEEEDGIADSSESPVVSEQPVEGFRREAQQPP
                     SRSGTTPATERPWQPECWPHPHPPPFAALPRPRQTRVTFHTQRYGAFIKAYLGLSDAE
                     VEQAQRRGRGICMIGVRKAPPSSSHLAASASYAIPFSPPSSSSASATATGYTFQPMHR
                     RHSHHGFGEPVKVQRAFLRHSVLAVEGDAVFSELIDRAEVLYAVEQHRLDAAWKTYAH
                     DTGAAGEDAAAAAATTVPGTPAQPPLYPQFRKLPRVTEPYLRPNARCIALHYGLPGRA
                     ASDSNDGSAGRMATDTAAVKPKEGEGEEGKPHTHRTSSTSVPPNPYPRASLMAVVCTT
                     RLEEGEEIYVSLESYYRCLDEVSWYRRCYSELNKKCGCPDGVTAPCTAAEGGGGMKEA
                     TAGQEDLIGNVYTGVKRFPEWPAHLAYYHGVGRRHASHVAEAAFPFTLVSLAPAPELG
                     DNQKGVVASAWLPYGTCLLYCGPAVATRKVERLVSERALRGDNAVAHTKTTAQHEAQT
                     HPGGDEEEDDLSFVTDDTYALGLGRHGVCFGQGLTRYINHRYNASRFGNVELCSVILS
                     VPSEFASAQGTAAAPAGGPEELKSAGERVITKSAGVDASPSLTAEERVQVVRAATAKR
                     PYHRRRVQRAKKGPPPPVAVASGAAAVPAAAVDDRLAALYAKPKRRPPRRRAPCLFLE
                     ERSFFVTVPFFLATTDIPPGTSLLAWTYGEDYDAKLERQAVAEGHVVPYADAVLLNRR
                     LAASPATGYRFQRYNGDYRFAVGVGDVVWRRRPVRLGIPSSSVDCAGGHDIVDVYVPP
                     PEEDLFVVVQTLRSSVERVLLRPLERVPLTSRQLGTLLREQHLADYVSPHAPSNARLG
                     PQKGRRRVGRPPSANSKRQRAAALTHDWAAHWAVFRLTDISALAPAPFAGTSSCLTPH
                     ALSRYEEALRTCVVATTDSVGLLLMDIDYSAVHRTRDTGGEASDTGAPRRITGDSQGS
                     TARASPGGGGGPTANQSAGRGGESAAHRLILVNLDDLHHATSLVRTSPGRAAAVPALC
                     NGLLWPLYCMSQRPRAAAAAAFGAADDVLRARPGSRV"
     gene            complement(<387164..>388018)
                     /locus_tag="LDBPK_041000"
                     /db_xref="GeneID:13391010"
     mRNA            complement(<387164..>388018)
                     /locus_tag="LDBPK_041000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858114.1"
                     /db_xref="GeneID:13391010"
     CDS             complement(387164..388018)
                     /locus_tag="LDBPK_041000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858162.1"
                     /db_xref="GeneID:13391010"
                     /db_xref="UniProtKB/TrEMBL:E9B865"
                     /translation="MSSDAALDEKLTELLRVMVSRLPVNKTLPAAVVQKLLLAKYGDT
                     YPEAYVASRSTFIGDTVMKLMIEKEKAATAVTANGDASEEDDDGSNASDEDDSDEGDS
                     GEDEEEDAASDSDDEDFDSDDDDDDDDDAEEPKKKSARVEEVDRTALKDQQEAATPSS
                     AVSVAERCKAMAECLRKLSYHVRAPTAEESLEDYLREYLLVEFEKHGMDPDKYSKSDI
                     KRYRIKREVELLQQDGASLSLDRRNRAGRGFSNLAVSKEAGGSGSQASPSPSAASARQ
                     TSMFLDDE"
     gene            complement(<388972..>392508)
                     /locus_tag="LDBPK_041010"
                     /db_xref="GeneID:13391011"
     mRNA            complement(<388972..>392508)
                     /locus_tag="LDBPK_041010"
                     /product="chloride channel protein, putative"
                     /transcript_id="XM_003858115.1"
                     /db_xref="GeneID:13391011"
     CDS             complement(388972..392508)
                     /locus_tag="LDBPK_041010"
                     /codon_start=1
                     /product="chloride channel protein, putative"
                     /protein_id="XP_003858163.1"
                     /db_xref="GeneID:13391011"
                     /db_xref="GOA:E9B866"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:E9B866"
                     /translation="MQLSPDDFEGAVARPPLHYRQSWLEWFWRALCETANPNTMHTEY
                     LTPAELEKQASFESLDYYKPYPDMYVEYLRESQEGRRHQYAQGDAAAASPAADVNGGI
                     SHETDSGSAGRTRYSVSYPLGSMAESFARLQMDTAERHVTLRWLLHVLIALSVGVVAT
                     VVSYAVDILEKYRAEVLYGIMASQRHRSIGNLQGLLYTVIGSVVLVAIAAGVVVYFEP
                     AASGGGIPDVMAYLNGVHLRKAMNLRTFIAKAVSCICAVAGGLPVGLEAPLIHLGAIT
                     GAGVTQGRSRTLGFQTSMFQAFRNNKDRRDFITAGAACGVSVAFGAPIGGLLFVMEEV
                     SSFWDQSSNGQIFLATMLCFTFSTIINSIVEGRRLLGWVSNAAAVLFEVNITIPLNLV
                     SIIPSLFLGIVMGSLAAFFTKANLILIKWRRRVLRPYQFRRFLEPVVIGAVFSSCMYV
                     LSLVSPCAELHDIGTVNETVQQWGTEGGWRLFNNTCTKPRTYSPLGTLNMASGKNTIR
                     HLFSRQTAGEFPVMTLIVYFLIYFASACMASGTSVSGGLVVPSLVLGAVFGRLFGLLM
                     FHIGVAKIPGVPRGYAAADAWMDPGVFALIGAGAFLAGTSRMSMAICVIMVELSAELH
                     YLLPVMVAIVMSKTTADWLCEPLYHQMLLMDSVPYLPPNIVKPEFEQLTAADVMASEV
                     VTLRMRERTEVVLAALRDSTHHAFPVVEAVPIDDAAADGDDEKATSPRRGSASAFALR
                     QQDGTKRGSGEASAPPVAPAGALAPRSAMNTSTTASAATQMRYKFVGLVTREDLQVYF
                     TLPQLQEYSESLSTTSPMTAVPLTAKDSDGFGGRLAPCVQAIRHLSWTQWTWQKSRLF
                     FRTSDRYEWVRTHMPNGIPGGAEVRAENDSLISENRLPPVLDLSLIVNRSPWVIPPFF
                     NLQMTYQTFRMMGLRHMVVVDGDTVAGMITRKDLLVNSLRHRMKELSARLATADSAAP
                     SLPPSYTKHGILGDQVQRSHSEGGRDEVDGGLPTRAGARANSAAAPLEFRDSASTNDR
                     GSASAWKSSSPNVFASAGGEAPTKQHWSFLQPTEAAAAPTTSSAPISSPLTALFGSTS
                     SPSTVRGSGGPGFPTAPMVAAAAYRTSTSSPPRVTAHEPGSEAAAALAWNGSRGVAEA
                     DTRGSSVASMFANGHQAPATPPLPADVASLFK"
     gene            complement(<394097..>394765)
                     /locus_tag="LDBPK_041020"
                     /db_xref="GeneID:13391012"
     mRNA            complement(<394097..>394765)
                     /locus_tag="LDBPK_041020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858116.1"
                     /db_xref="GeneID:13391012"
     CDS             complement(394097..394765)
                     /locus_tag="LDBPK_041020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858164.1"
                     /db_xref="GeneID:13391012"
                     /db_xref="GOA:E9B867"
                     /db_xref="InterPro:IPR009292"
                     /db_xref="UniProtKB/TrEMBL:E9B867"
                     /translation="MNDDGPPPVHDAHKRPRRTTSSRGAKSSTNAASSVTSAVAQRRI
                     DPRFDPMFGRADKRMFEQNYGFLREAEEKEEAERRFRIKCLRCVIRRCELEEAGEDLD
                     EYDLSDYEQEVFGEDHQRELREMKLTPPQRLYAELEQLQRASQLYVSKTRDASVKDRR
                     SSVKRELLRKEVVAVKAGRKARPYFPKRAEVKRAMTADTFSRLNDKGGKAAVDRYVIR
                     KRKK"
     gene            complement(<396183..>396767)
                     /locus_tag="LDBPK_041030"
                     /db_xref="GeneID:13391013"
     mRNA            complement(<396183..>396767)
                     /locus_tag="LDBPK_041030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858117.1"
                     /db_xref="GeneID:13391013"
     CDS             complement(396183..396767)
                     /locus_tag="LDBPK_041030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858165.1"
                     /db_xref="GeneID:13391013"
                     /db_xref="InterPro:IPR013714"
                     /db_xref="UniProtKB/TrEMBL:E9B868"
                     /translation="MSRAHNGELRAPSRQSCCHRSWPVVFLIMSLIVVVLAFVCVILA
                     FLHSIITPSIGFLGVYCLIFSLLGLSAEVLQFSSLNGLLFIWMKYFHVLLYYRPRGVF
                     YILFGALLLGTSVIEIVAGTVAIALGALMLLVSMVAGMPEFEEAPEEEHHRRHGGRTS
                     SAAARETSPGTRSSAKTKTSAAPTGSKSHREPNV"
     gene            complement(<398333..>399259)
                     /locus_tag="LDBPK_041040"
                     /db_xref="GeneID:13391014"
     mRNA            complement(<398333..>399259)
                     /locus_tag="LDBPK_041040"
                     /product="acyltransferase-like protein, copy 1"
                     /transcript_id="XM_003858118.1"
                     /db_xref="GeneID:13391014"
     CDS             complement(398333..399259)
                     /locus_tag="LDBPK_041040"
                     /codon_start=1
                     /product="acyltransferase-like protein, copy 1"
                     /protein_id="XP_003858166.1"
                     /db_xref="GeneID:13391014"
                     /db_xref="GOA:E9B869"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9B869"
                     /translation="MASNSVVFVSIACAIWYVLLRQRLVPVKLMRAWFLMVNILTILP
                     VSALTKLVVQLGRLGVPTYYVQRLCIIPLVVAFRMVWWLNPQIRMQLCFDLDGNGQRL
                     SWEDISQHHGAYVGNHASFWDVYAFIGLTPFRQLLNTRTMMKSSLRKIPIFGGVFDRV
                     GHFPVYFKSGEDGNFEVDKEKQAQVQKGADAHIASGGNLAIFPEGAINKNPRVLQPFR
                     YGTFHTIFKHRMETYYMVHAGAEKTWPWWTMIGGMPTDMHVRVGRFPIDYDHEDSKDV
                     SRRMQQHMQKVYNEILAETEGKDAISAEAKAS"
     gap             399864..404226
                     /estimated_length=4363
     gene            complement(<405703..>406773)
                     /locus_tag="LDBPK_041050"
                     /db_xref="GeneID:13391015"
     mRNA            complement(<405703..>406773)
                     /locus_tag="LDBPK_041050"
                     /product="acyltransferase-like protein, copy 2"
                     /transcript_id="XM_003858119.1"
                     /db_xref="GeneID:13391015"
     CDS             complement(405703..406773)
                     /locus_tag="LDBPK_041050"
                     /codon_start=1
                     /product="acyltransferase-like protein, copy 2"
                     /protein_id="XP_003858167.1"
                     /db_xref="GeneID:13391015"
                     /db_xref="GOA:E9B870"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9B870"
                     /translation="MGAAVARVVHETAARLPHLTGRQQGALLAVALGTGYTLLRQRLV
                     PKWIMQKWFLLSSTALIIPSSALVYLIDPLRYLGVPRRCVQSICVFIFGCVFKAVWWV
                     NPQIRMHVQFDANEHGKPGCWDDIARTGTAFTLNHTSFWDAFVMVGITPMLHLIQMRT
                     LMKSSLRKIPIFGGVFDRVGHFPVHFKSGEDGNFHVDKEKQAIVSQHMRWHLRLGGSV
                     AFFPEGAVNKTPETLQPFRYGTFATVIEHRLRVYYVVSVGSEKTWPPRMACGGLPADV
                     HIRIGAYPIDFDRDSSRNVAVGLQVRMQQVRDEIAAEVAAAEERRRRRRNGPVSEAKG
                     AKTLDIAPPHTAREAHPTRATA"
     gene            complement(<407935..>409392)
                     /locus_tag="LDBPK_041060"
                     /db_xref="GeneID:13391016"
     mRNA            complement(<407935..>409392)
                     /locus_tag="LDBPK_041060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858120.1"
                     /db_xref="GeneID:13391016"
     CDS             complement(407935..409392)
                     /locus_tag="LDBPK_041060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858168.1"
                     /db_xref="GeneID:13391016"
                     /db_xref="UniProtKB/TrEMBL:E9B871"
                     /translation="MSDASASPSPSVEPSPEFTLRDYVVHQRVLQQLLRSQPVWLLDD
                     VLSLRYRARLRLCLSPRPQLHFTEDAEDDPHSFETDRPSSKHHDAAEHGDSDSQASAM
                     DDGYPVVPLTPACSIEPAAESGEACGGGLRLRIAPGAACGAAASADSLSFLIIPASTA
                     AGLTSASAWVTVLRRLCRLSSAPPRVSGVVDAANRLKGGWGTLSAPCHADPVSADQNG
                     AVTPSAINEGDEGMLPIATPPPSSCSGYASSPAPVEAPPVSSPAHLMAGAILDRDVEE
                     DRRQLERLTEALRARTREAAELKAQLRQVTTTTPSLASARLDPTLSTRSAVVDSTAAA
                     TPAAVAAGEEVERPPTMAHVGSGLVPALQGFPPHLAEMSSEDDDDDESGGDDDEGGSS
                     GERGTGLAARNCFRSNASSAAFVLSEDSARPQAPRSGHVCNLGSLGPTCGDEDALRIY
                     NEIHGGHSSSCSSDRRSSSSSMSSATSVSMPQPAG"
     gene            complement(<409859..>410248)
                     /locus_tag="LDBPK_041070"
                     /db_xref="GeneID:13391017"
     mRNA            complement(<409859..>410248)
                     /locus_tag="LDBPK_041070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858121.1"
                     /db_xref="GeneID:13391017"
     CDS             complement(409859..410248)
                     /locus_tag="LDBPK_041070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858169.1"
                     /db_xref="GeneID:13391017"
                     /db_xref="UniProtKB/TrEMBL:E9B872"
                     /translation="MWPFSSAAANTRSSSSIEASLPLERRLIRVSKADISRVTADDIK
                     RVSARLTNDELTTSLRLLVETNRLGDVLASASSSAWAEAVAEVTEARMGLSSNVMRDR
                     MSLLYNILPYVSDNFLSAMGSSYSRDP"
     gene            complement(<411010..>413640)
                     /locus_tag="LDBPK_041080"
                     /db_xref="GeneID:13391018"
     mRNA            complement(<411010..>413640)
                     /locus_tag="LDBPK_041080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858122.1"
                     /db_xref="GeneID:13391018"
     CDS             complement(411010..413640)
                     /locus_tag="LDBPK_041080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858170.1"
                     /db_xref="GeneID:13391018"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:E9B873"
                     /translation="MSSRQMRRLQDLVDRATGLDADDFDDDAVPRTMQVRKSDHHRQR
                     KKSKKTESAAPHVPGTDILAGPPTLSSSTSERPKKGKIDANEAAPSAPAPPPSTSVTT
                     DDWEEVSEDEDHTNGSTARRNSKKTPMEEAAARAEETAAAAEDAKKRRRAEKKKSRRQ
                     QQRQRQAEEEALLDAVLARRQNEQVDPASSSGVGSPVAEHHPGGGSVLVAASSTGTGP
                     STGGAVTGGGAGETSFLQLVMACDAHQLDTRLERIRMFGAEAVEDVGDGRTPHRRADG
                     RVRDTGSVSFFPAHHMTVKFVHSAFATPNRYRWIPYDSLGIFLTTEEAHDVWGQVWRA
                     YLLVCSSHAFQRAQASLEACQERLGGVQDLVDCLARNRVYHIPTLLQCVYAMEATGES
                     AFAMELLDVALYQVGVVLRRFALSGTWVSRQLPCHRSANTLIFQVLQRGVHAALKRGC
                     LRTAYERTRCLLSLDPDDPCGMLLLLDYTALRAKRWVWLLEVRHRALAVRAARRQPRR
                     GAAAESEEADVKEALAAAGLTLRDATLAEDVLCLPNYAFSWALAKHFIEREEARQRSD
                     EVSGGACRPSKVLRGLTDAQRASLAATPSAVELLSAAVLRFPQAAVRLVDALGGVDVV
                     CGTEGATLSSSSQASAWQQLMWQADGHPDSAADAAVHNRLADLFVARHEELWKLSECI
                     SLLRHVVRRMLSEPATGVRAADSGDSSEENANELSSVTCVGQSRYRNITRDSVMGASV
                     APIPADLLEPDAAELAMAQEAAALGLGAGEDGAQPATVQRVMQMLRGNLETFGENEYV
                     RNLLYEVRREFQDRIWGGAREGSGDDEAGGEQRDWYDVDGSEDKEEQEWYSVASGGSE
                     DADDDAAPGDGDEVGEAARQ"
     gene            complement(<414110..>414337)
                     /locus_tag="LDBPK_041090"
                     /db_xref="GeneID:13391019"
     mRNA            complement(<414110..>414337)
                     /locus_tag="LDBPK_041090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858123.1"
                     /db_xref="GeneID:13391019"
     CDS             complement(414110..414337)
                     /locus_tag="LDBPK_041090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858171.1"
                     /db_xref="GeneID:13391019"
                     /db_xref="UniProtKB/TrEMBL:E9B874"
                     /translation="MPPPPAGMEKEGGGAERGSTPLVSFRAVTRVPSLVVEHRTRLTE
                     FALCPLDIYVCAWIAQEARRLLYLRPHSTQL"
     gene            complement(<414465..>418385)
                     /locus_tag="LDBPK_041100"
                     /db_xref="GeneID:13391020"
     mRNA            complement(<414465..>418385)
                     /locus_tag="LDBPK_041100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858124.1"
                     /db_xref="GeneID:13391020"
     CDS             complement(414465..418385)
                     /locus_tag="LDBPK_041100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858172.1"
                     /db_xref="GeneID:13391020"
                     /db_xref="UniProtKB/TrEMBL:E9B875"
                     /translation="MLRPPAAHPPHRQRYREDAVHDKSGLDDHEADAGWDGDAFTAPS
                     PSVATTLAPASPSRSLYADVEAARQPLPPAVETPSMGSHAPTPVSSTPQSAAKGSPHD
                     NIAAEKERAPEERAGDDDDDDDDEAGAAVLVTHAEMEAVVAAALRRYEKERDAEEEAV
                     LRQVSKEVEEQASRYADLVEAYNTVCADRVTLQEKLTEAAGECEELKHALQKARQTQQ
                     AQQDSMKRLEVELCHARDAQQQQQRQEEEQRMLVKAAGADWEAQRARYEKHQDTLEAQ
                     LHQARKELQEMEARVAAQDDELAALRERAAKASAETEDEYADIHLRMHQLARNMASME
                     GALRERDATIAEQAARLREAADRQEAEVRAVTTEKEKAEAALTSARDALQRQTDDSRR
                     RMHRVTELQQQREALKDEVKVARHTLQAASKDQGRVVQSLQDVLFTVKQRLFSRTDGA
                     GRVRPPSPALSSRSRRQFPANWRRDHMNSTLVYEDDHDENADDLRSCSAILQSHSRSS
                     SATRTLELSSSEDDDDAQSGRLFSRAAVTAREEHCSTASPKPRTHRASSLPPPAATPG
                     QRRARTSSPPQSACVATRAAPANNVKGSTSASRISHELRHQSKQAVLLLRELHRCVSS
                     LPSQRRKSSPGGDVAPAGTRGSADRSGATAAKLEQACRYLKSELDRAHAALQEAQAEC
                     QWRTLSMKKYEEDVQAARREVLAAEKQRLACETQVETAVLVREELEAQLTELKATCAA
                     VTAKQRASEDAVAEAKAAAERSAALAEEAAQLKDAAESALVREQAKGARQATALRDHA
                     AAQTALTDELDELKEKHKAALAQLQTCHAREAVQLLKQQQEESQTRGTAAEAWKTERA
                     SLEAHISSLETKLRASIGATTAAKRRCATLEEQLALHLDVERTTLKTIGDIAHAPPFP
                     LSVDAAVVGDSSCTPHFHGAVLPTEKQLFGGDDEAPEVEEVFMVSAEATPTRKGVRKE
                     LAGAVSHTRTTTGRTTALSLVSARLSTAGATSPSVVSSAAVSPAPPASSPHLGGASLE
                     TTNSSAITALAPLRQHIVAAVQQLALEVVRLRQGAVLASVKSPVITQPRTTTRRPRDI
                     TCTEVWYGGATARNGVVGGDVPVESCQTWGSSGDVKRPSAVTLGPPPPLGAFIAAQPQ
                     RQYQHQHQPPRTPHREHPSADSVVQTRTSGEVPQSGQRSGRSQSRNPPTPSQPSPPAA
                     AGSPSASCSPPVSAATAAAAGEHIYNVSPWPRLRPQRSLSSSSPPVSHSAVAAHGKLW
                     NEARRSASMKDGLSGYSYSTGRGSVDGSCSPARPPSLRALSLPR"
     gene            complement(<420421..>420750)
                     /locus_tag="LDBPK_041110"
                     /db_xref="GeneID:13391021"
     mRNA            complement(<420421..>420750)
                     /locus_tag="LDBPK_041110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858125.1"
                     /db_xref="GeneID:13391021"
     CDS             complement(420421..420750)
                     /locus_tag="LDBPK_041110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858173.1"
                     /db_xref="GeneID:13391021"
                     /db_xref="UniProtKB/TrEMBL:E9B876"
                     /translation="MSRSRQQQAEEVALHHFFKTERVIRLECERREAKARLKLIDIMS
                     GDLDDQLLCVAQFKKEWLQSRRVLEEARQAVVQEEASKRAYVEEEYVRAINKMIRHYH
                     PLSSRAV"
     gene            complement(<421360..>424233)
                     /locus_tag="LDBPK_041120"
                     /db_xref="GeneID:13391022"
     mRNA            complement(<421360..>424233)
                     /locus_tag="LDBPK_041120"
                     /product="proton motive ATPase, putative"
                     /transcript_id="XM_003858126.1"
                     /db_xref="GeneID:13391022"
     CDS             complement(421360..424233)
                     /locus_tag="LDBPK_041120"
                     /codon_start=1
                     /product="proton motive ATPase, putative"
                     /protein_id="XP_003858174.1"
                     /db_xref="GeneID:13391022"
                     /db_xref="GOA:E9B877"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9B877"
                     /translation="MSSNSAAASPVDGSVGAPESWLPLNSVRAPPRALDSTAVYEARQ
                     RFGMNEVRLTVAPLHRIVVGALLSPSTALVAAGAFVYEVFGGSHCLWFTLAWLVVMQV
                     AVLVTTALVDRARVRRLQRCLLPGRAVAYREETWAMVGSAQLVPGDLVQLVAGSVVFA
                     DCSLYSGSVLIDMSDVTGRTRTEAVTAGQLLIAGTKVVDGAADAVVRYTGPETFVGQT
                     IELVERLPHGFEERQRLSRAYAGTYFLVAAVAVTAEVVLFGALSGWDGYSVWKVARET
                     TLLALLCTPLDFDLAVYVAVSRGASAAMQRSQAVLLRLRALLSLASVDMLLVDKTGTL
                     SSGHCTLAAHHRAYLAGYPSRAAVVQLMALACRWRQPSLHATKRAVLRSADLDACDEY
                     TQLDYVEHEGEHRSSALLRRRDGTLLRVTEGRLRSVLALVQHPESAAACVEAQRLVFA
                     WSQSGLRCVAVAVAEGDDPWRLAGLLTFADPLRSDAAPLVSDCSRLGVAVTLISGDEH
                     RAVAAAAEAVQLKSEVMCGRDVPPLRLWEAEHRSPASAMSVTVDLSAAANSASEYAAC
                     RAYAEMQPRQKAALVRALQQSGRVVAVLGDGVNDAAAARLSDVGIALLSAEQGQAAAR
                     GALWGADIALTSDHLGAVVELLVVSRELFGTIYSVFFWVTAAALQLSVLGAALAVAVP
                     RRCAGESSNEVGLGLPPSGLHVLTLVYINGLTLMWVSTEAGDDTYWTAAPCSLSYRVA
                     LLQASTMAFIGLVGGVALGIAGGLACDGRGWWPLVSPSMLPVITEERLGGILTFYILY
                     LNLFLTMSCASPVRAGWRFWRRSRLRVVLALAVVYGLYMTWAIDARPIFAACLCVYCG
                     AVAVLQDMGKLTVHGICYCLGFRTYRACVDGMHGLQPHGRVDADEDAAAARPRRTTST
                     PSHDAAARRSSVPSSLNAVVGCIASLDVKLLCRARPTPMAPAE"
     gene            complement(<426161..>428350)
                     /locus_tag="LDBPK_041130"
                     /db_xref="GeneID:13391023"
     mRNA            complement(<426161..>428350)
                     /locus_tag="LDBPK_041130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858127.1"
                     /db_xref="GeneID:13391023"
     CDS             complement(426161..428350)
                     /locus_tag="LDBPK_041130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858175.1"
                     /db_xref="GeneID:13391023"
                     /db_xref="UniProtKB/TrEMBL:E9B878"
                     /translation="MMSCRSGSGTATAVYEALPSTPVRRQLGTSTDDAAIFLEDTVDR
                     VTAQCIDASPSALALLSPQHMPTSSAAHVDVTEYDVSYLGSLSASHRKSAGGGSSGKS
                     RPSHHHHRALHDVTNMSVTKMNFSSASASKSPNPKAAGRSMSHGSHPNSVSHSTSLAR
                     STPRRSTHDRSPAASEPMVPLAEYEALQRERNRYEKMYEHQRALYEDMAEKHADAYQA
                     LQDKIIEVVALSTRNEESKRFIRQLKREMSESRTRVMDMQNKALEEAKLERSAKMRYE
                     ALIKEHERKYERLVERHETKLAGMESLVRDLTCLRGEQDSIHVSQLDSLLKAAYSKST
                     ALFSDLLRQGKQIDLLYEAKGSLEAQVEQQRKEKREIEATLREERRNMAGEMERMIEQ
                     IEEQQQSILNLRQMLIRTMDNRDNVFAYSRGPRHVQGVEGDEDGSDNGSTSSSLTSSP
                     PTSPICDGGVAEEVEEDEEDENENTGGDGVYAAPARGEAMKSGADVERSPVRVRGSTT
                     ATEPIISASSGYVAPLASNSVVAPRRMTTAGSQSSVPLSRTRPAAVVPPLPLTSRDGT
                     SSFRQGPYRNQRSSGDADRRIAETAADDGQRPCKRSLSDKGSAANSESAEALPSAAAA
                     EAAATTVASRRRLDFSTALAAVAEKRRRDRAIREEIGLKHGSDKENSKPSVPHRVVVR
                     SCAVGSITTARKAVLVERDGANTGAQRGEDDEAEPRLFPRNVLTPRE"
     gene            complement(<429354..>430286)
                     /locus_tag="LDBPK_041140"
                     /db_xref="GeneID:13391024"
     mRNA            complement(<429354..>430286)
                     /locus_tag="LDBPK_041140"
                     /product="cytochrome c oxidase assembly factor, putative"
                     /transcript_id="XM_003858128.1"
                     /db_xref="GeneID:13391024"
     CDS             complement(429354..430286)
                     /locus_tag="LDBPK_041140"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly factor, putative"
                     /protein_id="XP_003858176.1"
                     /db_xref="GeneID:13391024"
                     /db_xref="GOA:E9B879"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:E9B879"
                     /translation="MHRSLLRCAVRGESMMESYRSDALLRLRCHFGAMRRGSPMGSAA
                     TEAAALVNITITPLTCSRRAFRQQGAVNPNNPDATEAAELEKDWQALKTYGMIGGFAL
                     LCIATLWYGSRQAKKRYFGAEGSARVSVETRGRPALGGPFVLVNTKGEPVSQAEFLGS
                     WAFFYFGFTHCPEICPVELNRMSHVVDAVRAARPQERIAPLFVSCDPRRDSLEAIDEY
                     LSVFHPDFIGLVGTPKQVNDACRSYRIYYSIPTEEDAEQEDYLIDHSIAIFLFDPQGR
                     FVDFFGNRYDEREITEKVLHYMSEYAKDPTWTNW"
     gene            complement(<431110..>432012)
                     /locus_tag="LDBPK_041150"
                     /db_xref="GeneID:13391025"
     mRNA            complement(<431110..>432012)
                     /locus_tag="LDBPK_041150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858129.1"
                     /db_xref="GeneID:13391025"
     CDS             complement(431110..432012)
                     /locus_tag="LDBPK_041150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858177.1"
                     /db_xref="GeneID:13391025"
                     /db_xref="UniProtKB/TrEMBL:E9B880"
                     /translation="MSSTPNAPRPVIAKRHHPPQYLAPGQHLKVASRKPAPKHGSAAG
                     GDTFAGGPPRDPWEDFDESSEEPRPSSAGHSASQRHQHTTTGGGHPYSGRVSVSRSTE
                     RTSPHSKEGSIGGCAVPPKAAPPTDSRAGVGDEGIDRGAAVSSDEDDRYYTITSEPPK
                     LSAAERAKQVLEAQHRALEAKQLKALTQQGVARRPTTLVRNRHGRLNAIAAQPASRAA
                     EEGGPALLIAAAPVSASVQPEKSRVRYSKAPEARTAPSAPRGGEGGSDGAVESPRDSH
                     DDLVGSCPSTTIQATTGSLEIDLD"
     gene            complement(<432715..>433221)
                     /locus_tag="LDBPK_041160"
                     /db_xref="GeneID:13391026"
     mRNA            complement(<432715..>433221)
                     /locus_tag="LDBPK_041160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858130.1"
                     /db_xref="GeneID:13391026"
     CDS             complement(432715..433221)
                     /locus_tag="LDBPK_041160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858178.1"
                     /db_xref="GeneID:13391026"
                     /db_xref="UniProtKB/TrEMBL:E9B881"
                     /translation="MPPKFTHPRLVHHVSLFTRVKAWWLGIENPEVLSRYGERGVART
                     VWIEWRGTLAMCAGGFVLFIGRQQSKRANDILDNIELNRQRFYQRDFTPTYVPDAPSG
                     VYDGVRGYSYRDEPSGLMINADNKLVSDESRAARVERLAKTEVTPEMVAQARNLLHSR
                     RYEGTPEG"
     gene            complement(<435420..>436475)
                     /locus_tag="LDBPK_041170"
                     /db_xref="GeneID:13391027"
     mRNA            complement(<435420..>436475)
                     /locus_tag="LDBPK_041170"
                     /product="fructose-1,6-bisphosphatase, cytosolic,
                     putative"
                     /transcript_id="XM_003858131.1"
                     /db_xref="GeneID:13391027"
     CDS             complement(435420..436475)
                     /locus_tag="LDBPK_041170"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphatase, cytosolic,
                     putative"
                     /protein_id="XP_003858179.1"
                     /db_xref="GeneID:13391027"
                     /db_xref="GOA:E9B882"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:E9B882"
                     /translation="MDVRRTPTPTTLTQYIIKSQPPHSRGEFTLLMMAIQTSVKVIEK
                     NIRRAGMKGMLGYIAGQSANATGDHQAKLDVISNMAFKAYLLSSTSVCVLGSEEEEQM
                     IIAESGRRGDYLVFFDPLDGSSNIDANVSVGSIWGVWRLPKDANINSVEDANAVIRML
                     KGTDMVSAGYAVYGSATNLVLTSGHGVDGFTLDPNIGEFILTHPHISIPKKRSIYSVN
                     EGNYGKWEPWFKEYINYLKMNKTTRYSARYIGSMVGDIHRTLLYGGIFCYPKDANQVE
                     GKLRFLYEAAPMAMIVEQAGGKAVGSNGRILEQSITRLHQRTPVYLGSRQEVDLCMAF
                     RDRNVKTETLAPTSSKL"
     gene            complement(<438442..>438837)
                     /locus_tag="LDBPK_041180"
                     /db_xref="GeneID:13391028"
     mRNA            complement(<438442..>438837)
                     /locus_tag="LDBPK_041180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858132.1"
                     /db_xref="GeneID:13391028"
     CDS             complement(438442..438837)
                     /locus_tag="LDBPK_041180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858180.1"
                     /db_xref="GeneID:13391028"
                     /db_xref="UniProtKB/TrEMBL:E9B883"
                     /translation="MTLAQSQRRRRCASSVIPAGARKSEGTCARRRRRVWPFNSWRPR
                     RRCGRALAERACERCLDLPASYVPHARTLAPLPPPSHKHRHTHICAPQRLQLPTPQRG
                     STTLIYTPPPPHIVARAVLPQRYGAHAAN"
     gene            complement(<447684..>448619)
                     /locus_tag="LDBPK_041190"
                     /db_xref="GeneID:13391029"
     mRNA            complement(<447684..>448619)
                     /locus_tag="LDBPK_041190"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_003858133.1"
                     /db_xref="GeneID:13391029"
     CDS             complement(447684..448619)
                     /locus_tag="LDBPK_041190"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_003858181.1"
                     /db_xref="GeneID:13391029"
                     /db_xref="GOA:E9B884"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9B884"
                     /translation="MYGQQFVPGQMYGQPNMMPYQPGVLSPPMSTGVSVMPNYAPPYQ
                     NGMPPGSVQQQQGQGPAQGQAMPQTQPRPRNNEVGNTSSVIHMRNVTPEVTQLSIQNL
                     AQNFGDIKHIVMLRQMNQALIEMKSPKSAEQLVDFFKEPGYAEIDGRRVYIRFSTHQN
                     LTATQHATRTLLVSMFNTQYDVSAAAHITPEIVYQIFASYGTVERIVVLPKNESSQWN
                     HNRVQALVQFDARESAEHVKNILQGQPVTLGETITFTLDIQFSRMDEIKTTNPTTSLV
                     VDDEGAHRPAGTMDPMAMNAAAMTTTGMYPPMGWS"
     gap             450886..450984
                     /estimated_length=99
     gene            complement(<451534..>458721)
                     /locus_tag="LDBPK_041200"
                     /db_xref="GeneID:13391030"
     mRNA            complement(<451534..>458721)
                     /locus_tag="LDBPK_041200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858134.1"
                     /db_xref="GeneID:13391030"
     CDS             complement(451534..458721)
                     /locus_tag="LDBPK_041200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858182.1"
                     /db_xref="GeneID:13391030"
                     /db_xref="UniProtKB/TrEMBL:E9B885"
                     /translation="MNAICLSSYSAVWWRPGKAGFMDVVGAISLTEVPKQKSSTRGVA
                     VAAPIALKCVKQPEQDLVVWLGWKGSRNFKKSGKGLHKVLYVCTTATHSGVFFTHHRG
                     KRLGFALIAHDSRNPQKLSSKPTLYKKELFRLMADVLHDGESKKTTNKEGQLVTVRQA
                     VLRQTLEGHVLAAVFVNQRGDVYAVVAHLAKNTWRKWRMEAAVGSMPCIHVPEGGRDV
                     RFVHCDIDAPVDHTSAVVAPSLPLALSTFDRVSASSANLSAQVAAATPPLLCVTVREV
                     ILPTRGSGVAAVRVFQSQCVERVSGDVRVMPQPCLTHVDEATAVYTVVVLGEQSSCFL
                     HMRHSLFGSELMTSCATVAGLHRPISACTLLIPNPHRPRGARVSLVLCDDMRVYCCEH
                     FGQVVSVSLSIDGVDCSMLTLPVPLVKKSSKKMKTAITLPARLIPVNNETEVLCTNGT
                     VGLFLRVTSAAFSEAVPAPPDLAVEGTGETAGCGMVGEAEVGAAALRLCLQSLQQLSV
                     RANRHDLPDVVFRHILPHLRYVGTSQQEVMLIQRVYEQLLQMAEPILEPEWSYLWALT
                     SLLQKVLGKRGRDNQLRYTDAFFLQLADTYRQGSFASPSEASLVGDGVRAMVSTEAQD
                     VIAASTVIFPAEAIYVLDGLAAGVAPVTLSEEVVRRMVNTDTLSNGAGVVASQAGVAD
                     CVHCMGCVLLASCLDLTVFVIADEARGLRVSLQRPQDGVCVAVQPHTFATQKGFETAL
                     GLAGDLLSVSSADASFRPDVALLTLGIGGRQHCLNAFLQLFSPVLRHAVDALTPLSSN
                     RTWFEGCVATLTQPTTEWVASLLRKGGSDSFTLTATLCHMLCAAQRGVDAAFFRSLSH
                     TLSEEFCTTALVTILFHQTELLLAAIQNYASAVAACVLTKNSEAERGANWQATDVGRT
                     RLQAALAQTSALWAQIDSLSPYRVRDVAESYRISASMSLASAASAASASTEGTMVSRT
                     LVLCFRILCLVQYSMAAEEDTSVAASAESASWTASDAAVRDCQGVLETLYLIAGGPLP
                     LEWFQWKFMSFVKRAAAMKPTWAPYLVRLMQLSNVHQSSSAALKRDFYILLDTLQSRG
                     ASSTTTVEEGDMQRAAAAAESAVGALAAQVEHRGASAATEGLSLAPSTSTAFFIFSHQ
                     RDASIPSWSRLHSLPERRHLFSATWADALWTLERIPSALDRACAAALARVQLAASEVA
                     TTGQGGDQPPALSEELALPLYAHLYRLRPPVRMHAVIDATPAESDGACLGVQQRVDRA
                     QQHEEAPCEATAIPENVAAKPHQEDAQVAVAPAVGAATSAPLPSLSAEPGAAVCTDTS
                     EAMPTEQASSVANAGTPAAPAAASASVAATPAPAAPARSGLYSPASVAWWDTLETTPS
                     RPRALDVKMECATANSTSPATADDNGESSDSATTYTTSTSNYVDPVSTLESFHRRCYT
                     RGDSHAAAESVGSSWSDSELHLCKHRYAAARSQAQHRARKRCRCCSRPMRVDYRGRSA
                     GRRGEAAGDTTPVRVQWSGTAKKTTAPYVRSPLVTAKGPTAAVARPTLLSFSARLQPP
                     EEPPTLRAQSARTSLAAPALKVTPFSLLTFPFASKGQQASRVRLYTLDGDRVRYVDGQ
                     DTVPLLTTSRPGVVASAGALLNVPPLPATSVFPAPQPLVRLPSQPAAAQLEHRDTRVS
                     CAAEAAQPVRFVEVGHAYPQVPRPPAGVAPPAVDAATLQATATSAPVPVRAAEAIAFP
                     SVGVATPAATTSAPPAPATVPPLPAPTTLSISAPSVLSPAQMSDFRRYTDNLLARQTG
                     STRLHAMTAASVPSAAPPTADRPSTVPAAAVAVDTAGIARLIQQQEEFLRKAEAIMEK
                     CRAEKDGFYRRVEESIRSATAAFQQHQGLSPVEQAQLVQNSIKQRNELLTLNHHLLEL
                     QLAAARAGGEAPPAPAAASATSQAAPSGVTATGATQTQPQLRESAGVPWAATGGSAAS
                     TAAAAAPVLPPAISARGREGMNEILSDLQRLNAELTASSASAEAMDRAVKETREVIER
                     YERNKTAEALTAEGIALISAMRHRTAAIERQLAELPQRVEEKGATDAKSSSSVWVSQF
                     SVADTVEGSPAEAPPAAPLAAFTSRTAAVPPSSLHFTAQAGTSAGSAMEALLSRNLNQ
                     HLPSSNPLGVVTLSSSMPQTAKPPQPERAPAPTALVLTAPVVSYATPRASSMFTSVSS
                     VPIDEPTVLRSATPKGAFPPSASFHAERAAGGEVPSLHVCETVECTTLDPPRAMPSSV
                     NAPRVATQLRDLGSLFVETGGRYETRRNASAAPSHRRAAASPLRSVPVRSPARKPHAA
                     ERRFSSPAQAPGRCHHKHEERYAMYRATSRPAKVRPAATATPYVPAPGAPFTPAPRCV
                     STGNVFVDRQQSRLMASIAKRMQQLEQDLFM"
     gene            complement(<460008..>461579)
                     /locus_tag="LDBPK_041210"
                     /db_xref="GeneID:13391031"
     mRNA            complement(<460008..>461579)
                     /locus_tag="LDBPK_041210"
                     /product="tRNA nucleotidyltransferase, putative"
                     /transcript_id="XM_003858135.1"
                     /db_xref="GeneID:13391031"
     CDS             complement(460008..461579)
                     /locus_tag="LDBPK_041210"
                     /codon_start=1
                     /product="tRNA nucleotidyltransferase, putative"
                     /protein_id="XP_003858183.1"
                     /db_xref="GeneID:13391031"
                     /db_xref="GOA:E9B886"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="UniProtKB/TrEMBL:E9B886"
                     /translation="MLPRVVRLEAAIPPAHQSVFDFLLSVAAENKLKATLRVAGGWVR
                     DMLLGLHSNDIDIAIETHAGTKLVTGEAFAHRVSEYQLAHGGRGHTVSVIRSNPALSK
                     HIETATVRVHEIPVEFCALRTDVYTNESRIPQVRPAAPVEDAQRRDFTINALFYNLHT
                     GMVEDYTTGLEDLRLRIIRCPLEPRTTFMDDPLRLLRGVRFVGQLGALNFSLDESITS
                     CMDDALLQVLQQKVSRERVGKEFVKMMAAAHPERCIALLHDMHILQHVLLVSVVMRQV
                     PGKKQLSNEIERVERLVDLYPDGSKRLETVMRLSAVGLPCLANVGVAAELSEGQRVEV
                     ALFVLVIPFFRGATESVEETVRNVCMNGLKLPLASCDCVRRLIDAYNHLHAQSMRMDE
                     LVAETLRPETVRKVFGALNILSDKHVFRHALQVVLLVYMLIEESAPLLSGGRLQQATS
                     DFSAAWARVAEHPVLLDAFQLRLPINGKDLQKVYGIPPKNVGSTLLKMRLKLVLCPRM
                     TPEDVAQWLVEGAQV"
     gene            complement(<462419..>462982)
                     /locus_tag="LDBPK_041220"
                     /db_xref="GeneID:13391032"
     mRNA            complement(<462419..>462982)
                     /locus_tag="LDBPK_041220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858136.1"
                     /db_xref="GeneID:13391032"
     CDS             complement(462419..462982)
                     /locus_tag="LDBPK_041220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858184.1"
                     /db_xref="GeneID:13391032"
                     /db_xref="UniProtKB/TrEMBL:E9B887"
                     /translation="MPPKRPTKPPGGKSVRKPAANRTKMRSLSLQEMYIRSCAEMGLR
                     PNSAFASFLHDRCGVDYAEDTVDLSRNYVGDKGIVPILATIEKIPNVRALILSENGLR
                     NRGVELLCASAANLPNLEFIELSDNFISEGAAVALFRLIEHHRQLQVVVFENTKIPVH
                     WRVKLLDMLASKRSTRQKQLRASILVS"
     gene            complement(<467751..>468857)
                     /locus_tag="LDBPK_041230"
                     /db_xref="GeneID:13391033"
     mRNA            complement(<467751..>468857)
                     /locus_tag="LDBPK_041230"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858137.1"
                     /db_xref="GeneID:13391033"
     CDS             complement(467751..468857)
                     /locus_tag="LDBPK_041230"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858185.1"
                     /db_xref="GeneID:13391033"
                     /db_xref="GOA:E9B888"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B888"
                     /translation="MPETSSEVAPAIKSIFQGRFFLTKLLGKGGFGEVYAAVQTSNNE
                     MVAVKMEKNNGRNSFLFHEARVMQDIQKTPTKDGISGIATLKYFGQEGDYRMLIMSMH
                     GASLEDFHERLGRFSLKTTVMLAGQILSRLEYIHSVGYVHRDLKTDNFLVGKGSFSNR
                     IFMIDFGLSSKFIGSDGKHRDMFTGRYFLGTSRFASLRTHQGYSQSRRDDLEQLVYIM
                     IYMYRGRLPWSGLNIKDLSAKERKIGQIKADLSYSHICAKCPQVFEHLLFYSRNMEFA
                     ETPQYDMCHALLQSVLDSMSPRETMDYVFDWNVPASKPARQSLSPRDEIAPANANAAN
                     QPNMLSGADGKGMFSGFGSSNPPENIFSIGGHGA"
     gene            complement(<469852..>473037)
                     /locus_tag="LDBPK_041240"
                     /db_xref="GeneID:13391034"
     mRNA            complement(<469852..>473037)
                     /locus_tag="LDBPK_041240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858138.1"
                     /db_xref="GeneID:13391034"
     CDS             complement(469852..473037)
                     /locus_tag="LDBPK_041240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858186.1"
                     /db_xref="GeneID:13391034"
                     /db_xref="UniProtKB/TrEMBL:E9B889"
                     /translation="MSENGRSAVPEGAVPNTLGNGDADYPDPRTPKQGNFAAVNSSAL
                     NSSEGNAISSFLLIGKLKSVVYEVLYNLENHAHLHDIDEFIAVTEDCLKALKTVKVER
                     RIEARRMNLSMRNQVNSLVNTLATPSNREADDALGEAVRTSATTVSQSPQNYKAALLK
                     QKLPSPKHSPVRADVQTRGDVEAARYASALRAEERQRQAEERRFDILQEMKQKSEVAD
                     ARSLRAKARREEAETKQRMETQDRMDNGVRRAEEARRQTREKAQRAHSRVEEVLLTKE
                     LQQQNKALLLDKKMSDVEHNQEQMREKLQKQAQERQEAVRAAAERRRNLSQERQEKQQ
                     QREQHRVDNLRRVDEQKKVEQEVKQQKAREWEKKVQQHHVDTTAEAEAKSRKTEEKFQ
                     QSAQLLEEQRERRQQKLERQEQKLREAKERRDRELAARPTLEEMMPPLSEQEVEQQAS
                     RFSRLSTTAAHHGKVFADTYQKMSAHSTKDLNRSRLRVVFSRLASAVATPSVVQCRHP
                     LSEITAATLGNVDYEFVRYFNAFETLVKVLVEARKARDFGVMRQTTDILLSWFVDEKE
                     GRENVVYFIKSGCTVLLLTCLRDEAHALLLQQNAEALRCTMEALGTCLERISAEAQGA
                     AKLAPVRDQLLNEMEVVGVDRVCIAVLQTCTEEGELQLAYTALCIIHTELSVVTRRKG
                     EVKRNWFQQITTSLFTLLQNMLTPNGSPLRENDASLSCERVTILFCLFRTLNTLARWQ
                     LTKFQELLHDGSTDAGAAMEAMQVRKGEMKRTPSADSLPALITRTELFHILNGFFMFI
                     HGHLEELETIPASEDAEGATGKGIKSSFTEALQFGITLNIFPAFPCSSGSDAGDSQKL
                     GGKHYHLRATLHECILLVGYLCFDDAPLQDMMGWGKKKPLLGTMLNVLPITYFSNARH
                     ILFPTILSAILQNNRNSMIVREEMSLAELQQFISQEYDPLTKKAKMYAQEHHKQLVAH
                     KMETDPRFALMVKLQGKSWADMADDDDSPPATARSSETTSTTPAVEKEKLCKGLRAMS
                     LNQSNYFKLERRLPISYWPAAMEQLEKLRQL"
     gene            complement(<474221..>475351)
                     /locus_tag="LDBPK_041250"
                     /db_xref="GeneID:13391035"
     mRNA            complement(<474221..>475351)
                     /locus_tag="LDBPK_041250"
                     /product="actin"
                     /transcript_id="XM_003858139.1"
                     /db_xref="GeneID:13391035"
     CDS             complement(474221..475351)
                     /locus_tag="LDBPK_041250"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_003858187.1"
                     /db_xref="GeneID:13391035"
                     /db_xref="GOA:E9B890"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:E9B890"
                     /translation="MADNEQSSIVCDNGSGMVKAGFSGDDAPRHVFPSIVGRPKNMQA
                     MMGSANKTVYVGDEAQSKRGVLSLKYPIEHGIVTNWDDMEKIWHHTFYNELRVNPEQH
                     NVLLTEAPMNPKQNREKMTQIMFETFNVPSLYIGIQAVLSLYSSGRTTGIVLDAGDGV
                     THTVPIYEGYSLPHAVRRVDMAGRDLTEYLMKIMMETGMTFTTTAEKEIVRNVKEQLC
                     YVALDFEEEMTNSAKSANEEAFELPDGNVMMVGNQRFRCPEVLFKPSLIGLDEAPGFP
                     EMVYQSINKCDIDVRRELYGNIVLSGGSTMFLNLPERLAKEISNLAPSSIKPKVVAPP
                     ERKYSVWIGGSILSSLTTFQTMWVKKSEYDESGPSIVHNKCF"
CONTIG      join(FR799591.2:1..479467)
//
DBGET integrated database retrieval system