GenomeNet

Database: RefSeq
Entry: NC_018232
LinkDB: NC_018232
Original site: NC_018232 
LOCUS       NC_018232             452426 bp    DNA     linear   CON 30-MAR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 5.
ACCESSION   NC_018232
VERSION     NC_018232.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 452426)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 452426)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799592.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..452426
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="5"
     gene            <4393..>7140
                     /locus_tag="LDBPK_050010"
                     /db_xref="GeneID:13391341"
     mRNA            <4393..>7140
                     /locus_tag="LDBPK_050010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858140.1"
                     /db_xref="GeneID:13391341"
     CDS             4393..7140
                     /locus_tag="LDBPK_050010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858188.1"
                     /db_xref="GeneID:13391341"
                     /db_xref="UniProtKB/TrEMBL:E9B891"
                     /translation="MEKASLKHLEFQLQREKALTKDLDARCKLLSAQVAQLEQDKAEL
                     RREKLFLGEEAKKTSKLDDRVHILQKEVENRDAVIAAERALTQAARAEAEEIRRNANA
                     SIALWTAAEEQWTVEQTALNEAAAQCRSQIDDLKKEVQVQGDARAELAKQLHTEKERS
                     NRLTQAREAMEVEVKSLHSQVEKLQNKVCDLEQTVFKLDLAGDKQREVINLKDTEIKT
                     LEATIARHIEAEERLEQTISSLNDRINAAKMMNLEGKCENEKLQCDLVDAKKEVERLH
                     LQAESLKRDSNFLSQSHSSVQKALEDLKEKHRQLQEDMRDKNVEIRRHELTISQLNME
                     LKKSENQGGEWSFQYSTLETELQQTKEALRKSSASVETLLRENSELVERLKEQKQLTE
                     TKEEEMVVLQSQCDERAEAFSRDIRDLEKEITARQAVINELSDQLNSASEKNAVYHSK
                     ILEESEANGKMRQHRAEMLQRLESNEHHIFFLDCVVEKEKIFSSFLAYWMEAPMLLCA
                     NLVGHCQMLQGKTCVLLEHEEELSRESCLKTSQLKELQCQNEDQREQIAFLQRERNAQ
                     AERLSVLSRESLASEKEANELRGALEASRNENLSLTSAVAALHEQVVAKDAELVRKKA
                     ALTDSQSRVYAFSDAVSTLEGAILRYAMAQMEEVQDLWKNRLEAVGLHFTSLVSHLVA
                     EKALLQCSKEQAEASCRELSAFAKEAKISMNKSDLAAAERQEALTSRAALLEGQIAVA
                     RREKDQAAMQLASLLRRFEADRNSFESFKREAKCTMEEERERREAVEKECVKLRGCID
                     AEVKRKCEYKQALENLKKLRSESEELRRAEKARAAEAIGKANIECNYWVKCFDHLKEM
                     IEKSHRTGDRLPSIDTDTIHRLEVAKTKISPMQAREVNKALSSLPKLKRVREEASGAP
                     T"
     gene            <7599..>8018
                     /locus_tag="LDBPK_050020"
                     /db_xref="GeneID:13391038"
     mRNA            <7599..>8018
                     /locus_tag="LDBPK_050020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858141.1"
                     /db_xref="GeneID:13391038"
     CDS             7599..8018
                     /locus_tag="LDBPK_050020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858189.1"
                     /db_xref="GeneID:13391038"
                     /db_xref="UniProtKB/TrEMBL:E9B892"
                     /translation="MLKCGGTLLKARLTAFNPWKRRPGGLQLNGRPQMINPSYFRGRY
                     KQQNPDDPCRLLKPSHVLLKRCPACKRTMFVQIKDKDTFHMCCEGVPMKVYSDMKTVM
                     NIEHKILTLTRQWDVENERPWSNPHRPRPKGRSKLKK"
     gene            <8527..>9114
                     /locus_tag="LDBPK_050030"
                     /db_xref="GeneID:13391342"
     mRNA            <8527..>9114
                     /locus_tag="LDBPK_050030"
                     /product="ras-like small GTPases, putative"
                     /transcript_id="XM_003858142.1"
                     /db_xref="GeneID:13391342"
     CDS             8527..9114
                     /locus_tag="LDBPK_050030"
                     /codon_start=1
                     /product="ras-like small GTPases, putative"
                     /protein_id="XP_003858190.1"
                     /db_xref="GeneID:13391342"
                     /db_xref="GOA:E9B893"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006687"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B893"
                     /translation="MGWFSWVWDWLSYLGLSNKTGKLLFLGLDNAGKTTLLGKLATNQ
                     VHVHRPTFHPNSEDLTLGGIKLKTIDMGGHQQARRLWKDYFTKVDGVVFIVDAATPQR
                     FPEAKSELDMLLQSEELAKTPFLILGNKIDMPGCTCSEGQLVMEMGLDGALTGKATPV
                     TDPNVRPLEVYMCSVVKNVGYGDGFRWLSQYLKSS"
     gene            <10220..>11965
                     /locus_tag="LDBPK_050040"
                     /db_xref="GeneID:13391343"
     mRNA            <10220..>11965
                     /locus_tag="LDBPK_050040"
                     /product="paraflagellar rod component par4, putative"
                     /transcript_id="XM_003858143.1"
                     /db_xref="GeneID:13391343"
     CDS             10220..11965
                     /locus_tag="LDBPK_050040"
                     /codon_start=1
                     /product="paraflagellar rod component par4, putative"
                     /protein_id="XP_003858191.1"
                     /db_xref="GeneID:13391343"
                     /db_xref="GOA:E9B894"
                     /db_xref="UniProtKB/TrEMBL:E9B894"
                     /translation="MATKKGKGKKATSAKAKADELRLIQLRTLEAEAEEFQRSENERR
                     QHDEQEEHIAFLRDEQLRIMHQKDRRIEEVMQELTRVTSAMQNDKSSYESQIHQLSTL
                     RDALLNEENLLKVEMEELHGILQQERGSHAAYAQQLRETLETERSLHQEERQHLRSQV
                     CEATAGMEDSKRQLQLACELRESAEHEFKVKVRDLERELEKALTMNKALQDAVEGREI
                     EDRKNVTLLQLLNVQLESDKRRYEEDLCEERERTSRTQEEVINLEAKLKETQRELDTF
                     KEEARTARQSCVDELHECKLLTEQLKFDEKYLQSEMESMRAEHVAEVEKREAAQAAMQ
                     AELQQCRVELEASQRKNDELESLLVRKEREHFDKVTFLNAQVANGRTAIEQLQGKMEK
                     ERVKHGNELQRHNDTIQQSMQELERINSAESAQAREWHMYEQQLITDLDKFKETIRDL
                     RTRMVAKDEAYEQLRELKEGEIERLRGILDAHFIPHRQNVEVPRESSRVDELFLVSEQ
                     LRALKKEMALKETAAKETERWLRARIAEQVEVIDSLQLDLKRTELSRNEGIRTLKDEV
                     ERLRKTLEVHCIPCS"
     gene            <13165..>15666
                     /locus_tag="LDBPK_050050"
                     /db_xref="GeneID:13391344"
     mRNA            <13165..>15666
                     /locus_tag="LDBPK_050050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858144.1"
                     /db_xref="GeneID:13391344"
     CDS             13165..15666
                     /locus_tag="LDBPK_050050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858192.1"
                     /db_xref="GeneID:13391344"
                     /db_xref="GOA:E9B895"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9B895"
                     /translation="MQPSPRGKTTGVYGAERIPGNYVKTLTGVVRGEELFCRPDLERP
                     WRSADKQRSAATIALKEKEIEELMRLCSNLRTELSNTKSDSLFLEYSLTERTKSQLAE
                     KQNEVDALQRRVEVLEKEKKEFAAATESQIRLLRSQAENESIGFKNEARIATERCAEL
                     VKAFQKQLEDVKAAGVREVDFVEARFAAKVDEVTTELKSVRESKKALEEHYRAVEAQS
                     SSTVHRVEANYKERLRSLEQRIEEQRIEYEAQLAKERNEKEAAVGEWKRTTEKVVVLI
                     ADKEELLQKQKLWNSYILSHLDTFYHSFIAAAPELAVDPAGVQLQQVPGLYAPRCVLE
                     DPESKVNVERIAYRIAQLKLLKALQPLGEAAVRRGAKPPTAAQLDQVVESQERLWRAL
                     SELEDQQSELEATVRNFTSRLYFFSDNLEESLRRGPRPVPPPLRDVVFLCLCVPNGRV
                     LWAANTELMRTSVQLLYSTLRLKMGEYGAYECYSDDVSMLLAFADATAACRFCTESQE
                     WLMRLPWPSALLKLPEAQEERSDGGRLVYRGLRVSMALHAGEAYVEPSGIPLNGVYRN
                     HYYGKAVSQLVHLCSLTQGGQIIASIAAWNLCVRRQHELGAVVAKSLGTLPIASFNSQ
                     SGVQEKQNIELLQILPIELEDRTFTPPGKAVIPPVSSLTGVKESVLAAEVAAVEAQRE
                     RVHDALAILQEECNSIQSSMGTLVARARAALPHFHLLPPSEMVTQMNDLYSVMERVAV
                     RAEELYTDLQDVAHAQEELGAQAQGIKDYLQQQEISAAREDDLRTKTEAVRRSMNHTL
                     QLEKDRHRAETESLQLALQDREQLIRKLHQESLSR"
     gene            <16894..>19395
                     /locus_tag="LDBPK_050060"
                     /db_xref="GeneID:13391345"
     mRNA            <16894..>19395
                     /locus_tag="LDBPK_050060"
                     /product="major vault protein, putative"
                     /transcript_id="XM_003858145.1"
                     /db_xref="GeneID:13391345"
     CDS             16894..19395
                     /locus_tag="LDBPK_050060"
                     /codon_start=1
                     /product="major vault protein, putative"
                     /protein_id="XP_003858193.1"
                     /db_xref="GeneID:13391345"
                     /db_xref="InterPro:IPR002499"
                     /db_xref="InterPro:IPR021870"
                     /db_xref="UniProtKB/TrEMBL:E9B896"
                     /translation="MTDSVIRIKRYHYIHILDNNTNVTRTISGPVVYTRKEHETCLFD
                     PCPCVSVPPRHYCVVKNPCVRDEAGEVVLESSGQVKLRLGDSEIRFEGEPFPLYPGEE
                     LDCRDGKGVQKLQLIPPNTGLHVRCVRDFKDADRRVGAGTEWMVAGPQTYIPRVEVVV
                     VEEVKATVIYPNTALLVQANVNFTDRCGVPRVAGEKWLVRALGAYLKSVEETVLGLIQ
                     GTMLSDLKALRLSAVRSFTDVYGKARRAGEQWQVTLKDAPVHIVDAYETKVADVAAVS
                     LSAKEYVIIHHPVDDTGHNRFGETLVRRGECTFFLQPGETMPRGVEQVLVVGKEEALL
                     LEAVCEYRDGGEKRQPGSRWMVHGPLEYIPANEVKLLEHRRMMALDKNEGIYIMNTTT
                     GEVRAVIGKPYMLDVNEVLWEKHLPLAVEELLESPNGSIQTSERNPGFVSHREKYRIV
                     RFNVQHNAAVQIYDYRKKQPRIVLGPNLVMLAPHEEFTVLSLSGGTPKVPNSLQSLQL
                     FLGPRFSSDTIVVETSDHARLRLRLSYNWYFDIDRANPSRRTFSVPDFIGDCCKTIAS
                     RVRGAVAAEDFDSFHRNSAKIIRTAVFGVDEAGETKKNLRFTANDFVVTNIDVQSSEP
                     TDEKTRDSLQKSVQLAIEITTKSQEAAARHGNELKDQEAKGQLERQKLLDKIEVENAR
                     TKWLELQAKSEAVQASGQSVAEAKARAEALLIEVRSEMQQAEMRAKAYRISAEAELQK
                     LQQRQALELEYTQRQNEIDVSKARAAAEAEAEKVKRMVDCIGRDTLVAIARAGPETQV
                     KLLSSLGLKGYLITDGNSPVNLFGTAQGMIGEPKK"
     gene            <21521..>21796
                     /locus_tag="LDBPK_050070"
                     /db_xref="GeneID:13391346"
     mRNA            <21521..>21796
                     /locus_tag="LDBPK_050070"
                     /product="dynein light chain, putative"
                     /transcript_id="XM_003858146.1"
                     /db_xref="GeneID:13391346"
     CDS             21521..21796
                     /locus_tag="LDBPK_050070"
                     /codon_start=1
                     /product="dynein light chain, putative"
                     /protein_id="XP_003858194.1"
                     /db_xref="GeneID:13391346"
                     /db_xref="GOA:E9B897"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /db_xref="UniProtKB/TrEMBL:E9B897"
                     /translation="MPLKYLEMSYNADMPKDMIKEAQNLIIEAFETESLENAVATHIK
                     REFVKRYKGVWHCVVGKNFGSFVTHEMKGYIYITWGQISILLWKTLS"
     gene            <22675..>23280
                     /locus_tag="LDBPK_050080"
                     /db_xref="GeneID:13391347"
     mRNA            <22675..>23280
                     /locus_tag="LDBPK_050080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858147.1"
                     /db_xref="GeneID:13391347"
     CDS             22675..23280
                     /locus_tag="LDBPK_050080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858195.1"
                     /db_xref="GeneID:13391347"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="UniProtKB/TrEMBL:E9B898"
                     /translation="MAGKFRGDVGKLSKPKKNKAAKRAKSKKVVSLVKRSPKLAQDTL
                     QSRIAELTSLDSAARVSIGGPKAGKAAAPPSAGKVRIGKAALEVVGKRKRERVVPEKE
                     APVQRSTAEAVGLKILHQAVKSQSHGRLLPHQNRHDYEYRLRSVATMGVVQLFNSLAQ
                     SRKASAALDTEKKMTSDKVMEKKQLVSKEVFLAALRQPQQH"
     gene            <24603..>25142
                     /locus_tag="LDBPK_050090"
                     /db_xref="GeneID:13391039"
     mRNA            <24603..>25142
                     /locus_tag="LDBPK_050090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858148.1"
                     /db_xref="GeneID:13391039"
     CDS             24603..25142
                     /locus_tag="LDBPK_050090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858196.1"
                     /db_xref="GeneID:13391039"
                     /db_xref="GOA:E9B899"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:E9B899"
                     /translation="MYRPNVCVFLFNEKVEFLGCQRMKTDHFQCVQGGIEACDVDIRL
                     AALREVEEEIGLKPQDLIFVQEIPPPNGDPMKFAYTLASNANLRRFGYVGQKQRILLF
                     FTPSENISKVVLIPPPELHASQEFRKVEWMPIEQLIAKSLPEKVHIFKAVGEVAPGIA
                     RAFLKKRGLLAEPQGAAKY"
     gene            <26954..>28867
                     /locus_tag="LDBPK_050100"
                     /db_xref="GeneID:13391040"
     mRNA            <26954..>28867
                     /locus_tag="LDBPK_050100"
                     /product="phosphoprotein phosphatase, putative"
                     /transcript_id="XM_003858149.1"
                     /db_xref="GeneID:13391040"
     CDS             26954..28867
                     /locus_tag="LDBPK_050100"
                     /codon_start=1
                     /product="phosphoprotein phosphatase, putative"
                     /protein_id="XP_003858197.1"
                     /db_xref="GeneID:13391040"
                     /db_xref="GOA:E9B8A0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9B8A0"
                     /translation="MDPPSVPPSPQQAPIETPGGHHHAVALRTESSISLDTIQAVTIN
                     REKLSEWHHKIRAKLFPMVSGFFVRCRVEDSVDGRALYKVGRIKNLKPDWSVELDLLT
                     TDEIRAGRNNTNYDCISNAKLSAAECNSWLARVSPDLLPDITSTIYRMEERMHMLEAV
                     ILAEPAFHSRRRDERRRDEQATSSAPQLPEKYVFSQNVLLCEDDYVSLPQTVTIVDLF
                     QNAVGPKGVAEPDTPRAGCAPNTRSRVGDEAVASHSTMMQLQDMRNYMNSPTQPPVDP
                     TRLIDMIRRAANPSHNSFTYDNLPEFCKLVISVCSMCREVVAKEPLFVHLKSPITVFG
                     DIHGNFADMGYFLEKVIAFDDVMLKYTMQNLLFLGDYVDRGVFSLECVMYLFALKVIN
                     PTKVTLLRGNHESPEVNGDMDVYGYSSFKYQCLDKFGRDRGMDVWVAVNEVFQYLPVI
                     ADIDKKIFCVHGGLPQYSGGEDKRLEILSDPNFPRIPVVQCADPTNVAQRMMVNDLLW
                     SDPAPPDQQLDRYGFGPNPRGPDIKTFGSRAVDMFCERYNYQYIFRAHQEKADGLRLS
                     DNARVVTIFSTSDYAGHQNGAGCIFVANGKMRMAIKKPQRQEVQRETKGPVSPRTLSK
                     SAPGFVVRMKKPQ"
     gene            <32506..>32877
                     /locus_tag="LDBPK_050110"
                     /db_xref="GeneID:13391348"
     mRNA            <32506..>32877
                     /locus_tag="LDBPK_050110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858150.1"
                     /db_xref="GeneID:13391348"
     CDS             32506..32877
                     /locus_tag="LDBPK_050110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858198.1"
                     /db_xref="GeneID:13391348"
                     /db_xref="UniProtKB/TrEMBL:E9B8A1"
                     /translation="MQTCGLVRLQFLLNTPFDHQPIAVPAVPTARSVIEDIIPPRSEL
                     SRVDEVGLLLKHLPAACDKAKQLQHDAQYASRYYRARFSRGSQLQWKHATQVAAASGP
                     AEVQQWARSRLYPISDPFQCE"
     gene            <33880..>34896
                     /locus_tag="LDBPK_050120"
                     /db_xref="GeneID:13391349"
     mRNA            <33880..>34896
                     /locus_tag="LDBPK_050120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858151.1"
                     /db_xref="GeneID:13391349"
     CDS             33880..34896
                     /locus_tag="LDBPK_050120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858199.1"
                     /db_xref="GeneID:13391349"
                     /db_xref="UniProtKB/TrEMBL:E9B8A2"
                     /translation="MLRRTSRQLRPVAAVGLAVVGAGDGTRQRNSLQRLLRDHDEGVA
                     ANAKGTITVTSTYDVESALYYDQYNMAVMPCVSGGAARQALRAKLIESGAVAGVRERL
                     LAPWQAEGERRVVVFGCRSVAYLKRQLLADTTHSFLIVDPSLKELMGAAAALTPAFAR
                     RVFFLRCESMFTCLQVLQPETADVAVVPMPVPFWSKHGSHRRLVHFDFYCAAHSVLRV
                     REAPTDPRGVVLFTDCEPYAAFMMEHLEEAKLVVPYTRKNPAQLFQRWLPQDELIEDV
                     EGGAQRRRREFPKQRDEDVVALAAAKSGATTPDARRLLSAYNYSRKYYRDFAEERVQQ
                     AGGV"
     gene            <36535..>37833
                     /locus_tag="LDBPK_050130"
                     /db_xref="GeneID:13391041"
     mRNA            <36535..>37833
                     /locus_tag="LDBPK_050130"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858152.1"
                     /db_xref="GeneID:13391041"
     CDS             36535..37833
                     /locus_tag="LDBPK_050130"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858200.1"
                     /db_xref="GeneID:13391041"
                     /db_xref="GOA:E9B8A3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:E9B8A3"
                     /translation="MTSLPFPLIEDIGELYMLDDIYDFLGEGTFASVFKAVSTTNRDV
                     VQENQTVALKMIAKRNLSSDKLVRDVINEVHVLRQTAHPNCVRFIECVQTPVYVVIVT
                     EYIEGVELFQALKDQKFTEAMVLNVMRQLLNALAYLHNTLHIVHRDVKPENVIISTHE
                     APFRVVLVDFGLARSCERKRPRISRELATHFQRQRPIPVRNMSVESLDCDSPMLATPC
                     GTLKYAAPETVQSITQSAQLSTTKNLLSRLDVYAAGIIMYVMLSGALPFKNFANKASL
                     VMEMRNSLSFEGPRWAGISAEAIDLNKALLNFDAVSRPHAAEALQYPWFKIYGSALRP
                     LSTEEAQSTPGIPLDSSICERGAMTHAFEAMRATEAALYYNEEETASTSAPVTSHSGL
                     RTPNSRCVSVPFGTNTSAFSNSSSTTTAAQTAQSGYFDFA"
     gap             39676..39711
                     /estimated_length=36
     gap             39832..39930
                     /estimated_length=99
     gene            <40959..>42995
                     /locus_tag="LDBPK_050140"
                     /db_xref="GeneID:13391042"
     mRNA            <40959..>42995
                     /locus_tag="LDBPK_050140"
                     /product="nucleolar RNA helicase II, putative"
                     /transcript_id="XM_003858153.1"
                     /db_xref="GeneID:13391042"
     CDS             40959..42995
                     /locus_tag="LDBPK_050140"
                     /codon_start=1
                     /product="nucleolar RNA helicase II, putative"
                     /protein_id="XP_003858201.1"
                     /db_xref="GeneID:13391042"
                     /db_xref="GOA:E9B8A4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012562"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8A4"
                     /translation="MPRRAREESEEEKPHRITKLAGSSDDDVPVKASKISAKASDHGN
                     GVAAEKRKRTEGSCKVAVTSATAPAEEKDEEVPNNGCAATARPFSEFEMNPIVVKALQ
                     SRGIESMFPVQALTFNAIMRNTDVLVQARTGSGKTLAFGIPIVERLLKLPSHFTRGRG
                     PAAVIFCPTRELAIQVQDVLCGISCGLVVTALYGGVAYANQERVLRSGVDIVVATPGR
                     AKDFLEKGTLHFDRVVMACLDEADHMLDIGFKDDIELLLSQVAEQNGSVGAERPVHQT
                     LLFSATVPEWVHTCSFIAKDKEFIDMVGKEAVRTASTIKFYRRKCNFSEISSMLADLI
                     KVYSGAHGRTLVFTNTKKDCHDLSINNTKLDSQCLHGDMQQEQRESTMKSFRDNKFSV
                     LIATDVAARGLDLPMVDLVIQCAPPSDIDAFIHRAGRTGRAGRKGVCVLLYQPREEYV
                     VERIERHAKMKFDVLPAPTREEILKAVARDAAEDLARVERRATDLFMDQAAELLKDAD
                     PVEILASALAVMSGYTSNITTRGLITGTPGYVTVQMTSDRPLPVPVYCSILRNNLGDE
                     TFMRCRDITLLQDDPGCVFDVLEQFAERVMSTPMRGITFQRIETLPPIIARELNSSRG
                     GRSGFNYGGGRGGFNNGGGYGSGRGGFGGYGGGRGGGRGGGRGGGRGGGFQRRY"
     gap             43223..43321
                     /estimated_length=99
     gap             43848..43858
                     /estimated_length=11
     gene            <45042..>46367
                     /locus_tag="LDBPK_050150"
                     /db_xref="GeneID:13391043"
     mRNA            <45042..>46367
                     /locus_tag="LDBPK_050150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858154.1"
                     /db_xref="GeneID:13391043"
     CDS             45042..46367
                     /locus_tag="LDBPK_050150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858202.1"
                     /db_xref="GeneID:13391043"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9B8A5"
                     /translation="MPASARKRDKVPAPGAKGEKSTCFYTKKKWKSVLQETRVDLAGR
                     ALGPRGALIVGTALFKNTYVTSLDLSQNELGDGGAIAIASMLRFNTQLQHLNLSHNDM
                     TDIGGIALASAFIPNVSPSGQPGQWNRTLFSLVLMGNKFGDDTLLAMSNAAACHRDLT
                     RVDLSWNNVGQNGTKCLMRAYQRNPLCVYQLAANALGDEGTVYLCEALQRYGGKSQTT
                     LNLYRNSISCPGTEAVGRLLANSSIVQDVSLAGNTIGFKGVQALQRQLTDAAVIASCS
                     LRILNLSNNWIGDEGAASVAAIIKANIPSLERLDVSENKITDVGATAIVTAALQNTHL
                     LLLNCEANCLGSKAVDAVVRLIHETRTLTSLNVAGCVNSADHRRTLTIAVGETDGLHV
                     ELGPNPEDAAGAEGTALIEKITEHLQMLADREAQRQKESMAAKKLKKVR"
     gene            <47440..>48981
                     /locus_tag="LDBPK_050160"
                     /db_xref="GeneID:13391044"
     mRNA            <47440..>48981
                     /locus_tag="LDBPK_050160"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858155.1"
                     /db_xref="GeneID:13391044"
     CDS             47440..48981
                     /locus_tag="LDBPK_050160"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858203.1"
                     /db_xref="GeneID:13391044"
                     /db_xref="UniProtKB/TrEMBL:E9B8A6"
                     /translation="MPIIKSRVHADELHAAKKALAAANGEADVLRQQVLEQRAQLDER
                     AQQNARLAAELVQAETKLEEAHRQLTEMQAHTQVREEHHCEQMHRMAQNVRTLEDMVQ
                     ASRRSEREGSSSMYHRWQSAGNGSTDDAGRARQRGKLSHSQTSAALQRPPAVPTRGDK
                     AVREQHRSPPSPSPAASLPISAQVLYWQEQLLDFSQRAAEGFGEVQQQLRRCLPPSPA
                     AAGCHAHAGQEPLAASASPGTDAHRWCRQLRRLHAHFDEVVQADSKLISFLLLVAQQQ
                     GQQLRTLQERWAEAQNTVREAEGVLDEANARVTRNAQESAVLRQECAVLTEAQTALQA
                     QLTNRTREHQAAVTALHRLQEAHAQLTNAHTRQEEMWATRLAQAAELQQQASNYAQKL
                     EAALLDKERLMSAAAASTEQQLRREVLEAAKKRVAVFLKQLNACAEQLQGSLASLSNS
                     PPSSALAASTVAGGTVQKVSSTASPEPSPPGASSSAYSASLSPLPQSFGQSLLLPESS
                     AAASM"
     gene            <49508..>51787
                     /locus_tag="LDBPK_050170"
                     /db_xref="GeneID:13391045"
     mRNA            <49508..>51787
                     /locus_tag="LDBPK_050170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858156.1"
                     /db_xref="GeneID:13391045"
     CDS             49508..51787
                     /locus_tag="LDBPK_050170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858204.1"
                     /db_xref="GeneID:13391045"
                     /db_xref="UniProtKB/TrEMBL:E9B8A7"
                     /translation="MVSVLVQRQQHETARRKERLRAAHQAAAALSIQQARAYQKQKRQ
                     QEACVREDARQLWLQSNARDLAAIDRLVARATTEQGEAEEAAGHYEANLQAEACEEAA
                     AWQAERQLEEARHRLAVAYTRTQTHERTKPARQAEQRRTAVRVTEKVRAARVAAAAPA
                     ALSLSSVLGSLQGAPVATHVPRASVPVPRPCLEPLRNVAGSTAGAALADAPPAAQSPL
                     RRWRISHVAPHVHVTLHGDPTHRVTAREESEISALAAADDAVPASADAYAAECAAVQQ
                     QRDEVLKVGRERAAQRAASLLRHQRAKELQEEEEQQTQRERLAAVKERYRHPHEEGAP
                     SGGKKAAAPEVGTHPATATTGSSSGSNGSPNHQHRRPQRQRTPQRLACHQQAYIKGEE
                     EFRAAFVEAPPLVVRLDEEPPRRAPLSELLRPVKVAELLYSIANSVPVDPTPVTPAPH
                     HGSGAAAAGSPSFPMTGEVLPSAQPSARARVLPSVPLRMLPLDERSSAARAKAESAPE
                     DRAAATTPLSSGEEGCSLPPPPPAPRGSSGAPRASLRASAEASTAPSPTRLDVPVSRT
                     SRARTPSPEKAATVEELVALSPLTPAPPAAGTCVPESPSPPPPCAGGALRELAQTAAN
                     MGASDVTMAYRQQPLTAPGGRRATSAHENAPASPSALSSMMERTPAHHRHRRSATPPS
                     SLSSSTPTTTETAEPPSGSSSPASVEGSSSSGTDASSSSYDSVSTSGSSRHPMPVMTA
                     EQLKLALLRLRSRIRSAQM"
     gene            <53222..>54655
                     /locus_tag="LDBPK_050180"
                     /db_xref="GeneID:13391046"
     mRNA            <53222..>54655
                     /locus_tag="LDBPK_050180"
                     /product="dihydrolipoamide branched chain transacylase,
                     putative"
                     /transcript_id="XM_003858157.1"
                     /db_xref="GeneID:13391046"
     CDS             53222..54655
                     /locus_tag="LDBPK_050180"
                     /codon_start=1
                     /product="dihydrolipoamide branched chain transacylase,
                     putative"
                     /protein_id="XP_003858205.1"
                     /db_xref="GeneID:13391046"
                     /db_xref="GOA:E9B8A8"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR015761"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:E9B8A8"
                     /translation="MRAASCMAHRCIGAAAGAVTVARAPGWPYTASQRHFFATACALL
                     GRSIPYKLADIGEGITEVQVLGVRVKAGDTINEFDPICEVQSDKATVDITSRYTGVVK
                     AVYLQPGATAKVGSVMLDIVPEGADDAPEAASPSRGAPSPSSASHSALQAAYSAPQPS
                     SVPSAGKVLATPATRYLAREHKLDLAHVPATGKGGRVTKEDVLQFMDASMSAAAAPST
                     PSTASVAATAPPGTVVSGVQTEAGDTVMPITGVRRGMVKTMSQAASIPTFTFSEECEL
                     TRLMAVRGSLKDMVKDRSKGKAKLSFMPFFLKAASIALQHHPDINAHCPADCSALVRK
                     AAHNIGFAMDTPNGLIVPVVKHVERKSILDIANDMQVLIERGKSNKLTTQDMTGGTFT
                     LSNIGVIGATVTAPVLLPPQVAIGAIGRLQKLPRFDANGSLYAANLICVSFTADHRVI
                     DGASMVRFANTYKRLLEHPENMLVDLR"
     gene            <56206..>57291
                     /locus_tag="LDBPK_050190"
                     /db_xref="GeneID:13391350"
     mRNA            <56206..>57291
                     /locus_tag="LDBPK_050190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858158.1"
                     /db_xref="GeneID:13391350"
     CDS             56206..57291
                     /locus_tag="LDBPK_050190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858206.1"
                     /db_xref="GeneID:13391350"
                     /db_xref="GOA:E9B8A9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:E9B8A9"
                     /translation="MEAGGDDLFVINDVEADQMEEVRDARPVEQAQETEAEAMESVKG
                     LVPLCAQHAQGPQLSSATFGYDIALMAKRPWAEPGAKLSDYFNYGFNEQSWRVYCAMQ
                     EKGEESLLANATAMLQKLELAARPGAGAAAEAGAGGHAAPDEPPMLMFGGIMDGYSDG
                     GPYVGGHGMYGGQEGPGRGGGYGRPYQPREFHQHGGGGFERLHNANYKTRLCKSFAEG
                     HCNRGDQCNFAHGVGELRQPGGGEPIPPPPPQQHMPQQLPPAGLAGGGSAPPPMAQIY
                     GDHRPGFNSYYTPPPPQAMSGGAPPQAPERLNYLMPPFQGGAGMPPMMGGPAMPMQDS
                     GDGAGSGFRQPPKRPRQDGDGVYEPQY"
     gene            <58180..>60540
                     /locus_tag="LDBPK_050200"
                     /db_xref="GeneID:13391351"
     mRNA            <58180..>60540
                     /locus_tag="LDBPK_050200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858159.1"
                     /db_xref="GeneID:13391351"
     CDS             58180..60540
                     /locus_tag="LDBPK_050200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858207.1"
                     /db_xref="GeneID:13391351"
                     /db_xref="GOA:E9B8B0"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8B0"
                     /translation="MSSSLGKALQRSKRATERQGRRNYRDALENERNAALEAELHQQE
                     IGRSKTQLKSIWETNDLENFLSIADAREEGYFAERDVRVVIGGRVHVVQHDKVVPQQM
                     PTDEAHVDWLKLSELLTIPKRPEWDCKMSADELQAAEKKAFADWRRSLAQMEEEHKVL
                     LTPYERNLEVWRQLWRVAERADVVSVILDARNPLMFRSFDFEKYVRSTKNSKGEPKKV
                     VLLLNKSDLLTEAQRRAWAAYFQQRGDDFFFFSAKPLQPLTADGAAAAAASSHAVTSN
                     DDEDEPEEDGDVPLDSDDVQLTAAQKAALDKVMRHKKEKTRHQKKTLRAPVEVKNPYE
                     LSAMREALKRQAHAPKVKEERPLTEEELARNSRTAAAASAAKREPWTVLDPVQLLDQF
                     ALLREEAGVTDMNTPLMVGLVGYPNVGKSSTINAILGCKKVVVSATPGKTKHFQTLMI
                     PNERRVALCDCPGLVFPSFATTKAQMVCDGILPVDTATDTLEATATICRRLPRPVLEG
                     ELNISLLAEDDIDESDSLAERLLHALARRRGYMASHDRPNKARAGKELLKLYVDGYFV
                     YVEPPPTYRPDAAALSLDRYTEQHASASPAAASSARGGGAAAEEGDEDWEDDDDASGH
                     ELNSEEEDAWADLDSANDGRALSEPGNGDSYSVEMDLEDAAPPMFYARPHALRSTFTR
                     YELFNMEANEARISVLKKAERRRKKRTNHQLEPDTYTFVNRQGEVELRIDDDDGVLEL
                     VTPTGGPVRPATKAKPKSKRQQRRELKQMGVGPSNRYGQRKGIVEY"
     gene            <61306..>65793
                     /locus_tag="LDBPK_050210"
                     /db_xref="GeneID:13391047"
     mRNA            <61306..>65793
                     /locus_tag="LDBPK_050210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858160.1"
                     /db_xref="GeneID:13391047"
     CDS             61306..65793
                     /locus_tag="LDBPK_050210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858208.1"
                     /db_xref="GeneID:13391047"
                     /db_xref="UniProtKB/TrEMBL:E9B8B1"
                     /translation="MYLRKPLVQRGVLRCHPHRCHRRAPAVTTSAPLSSSGSIDGGSD
                     FACYVEAEFTDALFAASSPTEAGANSVEQRVNSSFYLVPAAAAAAAPAGAQRHHRRRR
                     SLHCGSEVSGLPPTHAILNHLNSSLWLQVLARLHSRGALCGEGCAGALRYLPTFTYRP
                     LMPWLWSPATLSTPAEAAQPSSTSHRSEAGRGSDAENVSGARDSSEWEVDLGTEVHRN
                     VCVPALAMSCRPAAPPAPPATAPLTVYTVTDISTAAPSQWTVIATSVVKSTLANAPPA
                     TVKDLLKVWHDLFFALRYHAVWVSTPEQLRGSAHPQLMRLFECFYADVRRHSQISSAS
                     EACGMAQLLSSEELPLQQRRANVITEVVVRTLTPPILLRKFRSLYRPHRHSAMLFAEL
                     YAMCVEEEETFVCLRRLHAHSPGGMSAQEAAQPAARMRQRQQLTTTTLLMDVDLAASY
                     ATLPGRRYSGLSDAGEQWAATLQHLRFLLPRVHFLQECRRAQRAPPMSSGNAAEEAVW
                     QPWRQVASILMNVCVWVSNDNAEAERCVDALRCTVEVLQSMNAESSTPGRGGAHRLLA
                     PPTFQDVGAFISCLVVAARDSMRTKAAQLQYGPTDGLLGVYLLSVAVAAVIPGSGRSR
                     KSAADCRQTGDGVHMPSTDADEDAAELLHRLRLLVHPSKSTPGEVWAALRRSPTAGEA
                     ARHGLVTVGHHLFSECVMPLVSQPKVFSTAQRLYGRLRAWATEVGRPLGLHGEPVSAL
                     WKLRWLQQHLTTDGDSGEASALLGRLTSGRVQTGSDRVAAQDTTTLPSPVSWRCGCGF
                     ENESISTGAHHGDAVRVACVACVLRTLTPLSWECPSCHAVANSGVCVPYCLRCGETHP
                     LADQLGIAVKTPSVADAHTCGMTFCKEHPHLGTVTLLQPRGLPKSSLVYTPTPPSLLN
                     APEATEGVARCCWDCGHACGGAPVDVGDVHVATLSPRYAAPSWHGEDDAALNGLSEDG
                     NSLKVGGTGVVVYVCSDCHAISAGPHSAALPKIPDGAPATGSSTASCSSCGTTEPGYY
                     TAAFTWTCGCGACNSALHAYCHACSRAAQQPTVTCTHCSHAQSVRGAAPWAGSRGACE
                     RCHHPHPRVLAAVNQHRLVRCPACQGRVPSTSVQCPHCACTAVAAVAALLPTEADQPW
                     LCHHCGTTHAVRDRTDGQLRTPVHLTDPSSVHTLLPLLTRAEDGYCTKCGTCRLPPTS
                     WERGRLWGCSKCGEPFNSELACRRCAALAPGVPAGQVYVWRCATCGAYHPSWEVQCRA
                     AGCGGRGGAEDVGARFCYSPWACAECGEVTLSSHAITCATCGAETPKPLRATPCTYGD
                     ACGTTAAATAGAHAKRHSGRVEANRSARAQECTMPKALTGAKEDVRVPSAGTCSALSP
                     SLSHTPLALSPAHAATAPDSRLAEVETFLLQAAAHPSLPLLTEPLDAPLVKAVSCTSL
                     WPHKSGDASAPANEPAGDSEKSLTDPTHRDGVRAGGAAGTSALAVEPWEDAYAATVIS
                     F"
     gene            <67374..>69380
                     /locus_tag="LDBPK_050220"
                     /db_xref="GeneID:13391048"
     mRNA            <67374..>69380
                     /locus_tag="LDBPK_050220"
                     /product="dual specificity phosphatase-like protein"
                     /transcript_id="XM_003858161.1"
                     /db_xref="GeneID:13391048"
     CDS             67374..69380
                     /locus_tag="LDBPK_050220"
                     /codon_start=1
                     /product="dual specificity phosphatase-like protein"
                     /protein_id="XP_003858209.1"
                     /db_xref="GeneID:13391048"
                     /db_xref="GOA:E9B8B2"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9B8B2"
                     /translation="MAPSSTAIPETAAAPGAPRSVGVPASPSRGSRMSKCKRCLQNLN
                     GPAFDLKAVQEAQHTFLEEESVCNAAKVYPMSDITSLLAVGSWKDASNPELLKAHNIR
                     YVLNVAKELIPTEEAKMIAQNNDIVSEWIPMSDSHTQDVSEHLIKAFRFIERARSEHS
                     RVLVHCRRGISRSAAIIVAYLMASEHRSYEDALKFVTERRSCVSLNLAFQERLSEFVP
                     SSEFFHGPPTQQQQQQPGAASPLSASSSNSLLPTLAGVAPRTDSAHANHSSQPQPLQG
                     SDHPLLLPPECRSVTSSTGSSHGSSRASSGVRVAPSQSLGLQKADKQASVLCSATSTA
                     APASTRATSGKSGKSTSLEKAFGSHALPKQQQIRRGSAAPQALALTGTTTRLSARSVA
                     AAVTPGIQSAEDEVTATPAPESVGSRDDGDDEVEEPCSPMGIHGRRALARLSCAQASS
                     SSASAGPRKHLPRTYSAEEEVLTTTMAMTATVTTTLMHANKCGPDGMPAAANEEVGDG
                     EVRCSSSSANTSESHLHLHHSPRAPAQRGSAFDVSDDEADDNGSIAGTGTPLSLQKKS
                     QRNPRVRKALSANSTGAPASENEGNSSEGRQDLAAGERNRSPTATGGGDMTGTAVAMD
                     ELPSTRYGTQSAFNEEGVAPQSPTAVHPSSVVAGATSRASSLSG"
     gene            <73666..>75567
                     /locus_tag="LDBPK_050230"
                     /db_xref="GeneID:13391049"
     mRNA            <73666..>75567
                     /locus_tag="LDBPK_050230"
                     /product="hydrogenase, putative"
                     /transcript_id="XM_003858162.1"
                     /db_xref="GeneID:13391049"
     CDS             73666..75567
                     /locus_tag="LDBPK_050230"
                     /codon_start=1
                     /product="hydrogenase, putative"
                     /protein_id="XP_003858210.1"
                     /db_xref="GeneID:13391049"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /db_xref="UniProtKB/TrEMBL:E9B8B3"
                     /translation="MDYIAPSSACIKPTLISSGGIHAVGPADPTASASGVVGMKRGGN
                     APPLGPGIAAAAQHADVVKITLQDCLACSGCVTTAETVLVNAQSRHEIVSALLTSPAS
                     TSSSTTGTGSVSRPRLVSISSQSCASLAAHLHMSMAAVYELVAGFMRATLTTAGLQEA
                     ARNAEIAAAESPRDAMKNEEVSGASTTATTDAAAAVLSESEPPIYVVDLEWAEQLSAE
                     LTAQEYDRRRRGGGTAEVGPLPLIVSSCPGWVCYCEKQGSALLPHLCPVMSAQGIAGS
                     YAKRAVAANLYHVSIQPCFDRKLEAARDSMTSSTTAPPADGADMPVFYTDCVLSTAEL
                     LEWMKEADPTLPWRGRLDTNVTAAAVALVGGNCPGHTAQQPTQLNEEEAPTSTSSPAA
                     SAIFAPAHDAARFAGSGGYHRSVIAHRLRVEGAAALPSSSSPSPDTPASIAYEVKRNR
                     NHQLATCAALPEEVFCIGYGFQQIQNVVRGLKKRIPAMRGYTFIELMACPDGCLNGGG
                     QVRPAQQPHAEVLNAVLDAYARSMEGSREKGGLGAATAAASSGSALACTFASAQPVSS
                     DAQAEDGEVAMKAQRRRVEAAWKPFADATIAVTAPSLGDALWRCTFRDREKEFAAMLN
                     DGNVHSLKW"
     gene            <76969..>78267
                     /locus_tag="LDBPK_050240"
                     /db_xref="GeneID:13391050"
     mRNA            <76969..>78267
                     /locus_tag="LDBPK_050240"
                     /product="viscerotropic leishmaniasis antigen, putative"
                     /transcript_id="XM_003858163.1"
                     /db_xref="GeneID:13391050"
     CDS             76969..>78267
                     /locus_tag="LDBPK_050240"
                     /codon_start=1
                     /product="viscerotropic leishmaniasis antigen, putative"
                     /protein_id="XP_003858211.1"
                     /db_xref="GeneID:13391050"
                     /db_xref="UniProtKB/TrEMBL:E9B8B4"
                     /translation="MAHTLRTHPQHGRGALLAAPDAVTRVSMLLLSSALFLSCVVPAM
                     TSTTFMRMAYAATAAEPPRCHVDRSRYTGRTTSKGSWAGLHFHLVFTLGLCTSDPDDG
                     VMSVQLNDRHVNFTGRSGSVAMPHLGLVRFNLSASTIGPQYFTSELCYSDVNCTNLCT
                     DALMGHVRACKVDRAIMPVIIVLFWMVTAVACIGFLAALYLRKLAEQRQKALHQLPEV
                     FGTSPAASRTWRPQQRAPTTPRSLSSSHAVFADDHKASHGGSHEADLEHAFEAPAVIP
                     MQGNDESLTPQLRSTASSATTTSCGLPKREEIEMAALRAVAPPSRQHPSKKHRHTHTH
                     DDEVTGTTTMSLRQARHSGPDLPASTATLDTIILHYSTHTLMLQPDRKNIAYQLNCSA
                     QQQQPKKNRVQALEHAARLRAELEAAEEAARLGAEHEAEQT"
     gene            <80844..>81137
                     /locus_tag="LDBPK_050250"
                     /db_xref="GeneID:13391051"
     mRNA            <80844..>81137
                     /locus_tag="LDBPK_050250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858164.1"
                     /db_xref="GeneID:13391051"
     CDS             80844..81137
                     /locus_tag="LDBPK_050250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858212.1"
                     /db_xref="GeneID:13391051"
                     /db_xref="UniProtKB/TrEMBL:E9B8B5"
                     /translation="MPRAYYKPFTAYEEAFGFHATRRNAYIMCSVLFGGLLLKCMLLV
                     KYSSVVNPNRTSPLEDDPRYQELMERRLVLTEDLSTQESMKRAIRARRSAPPA"
     gene            <81826..>82986
                     /locus_tag="LDBPK_050260"
                     /db_xref="GeneID:13391052"
     mRNA            <81826..>82986
                     /locus_tag="LDBPK_050260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858165.1"
                     /db_xref="GeneID:13391052"
     CDS             81826..82986
                     /locus_tag="LDBPK_050260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858213.1"
                     /db_xref="GeneID:13391052"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9B8B6"
                     /translation="MSTRPRDICTAAFEGDTARVEQLVTAAGVYSGRWHSPFVVDTSA
                     AARDALAHWEGVGNDEDDEGYGGAEEDIEEVLGEEEMAKLKAHPVLRGIVKAYSLDEQ
                     ALGGAAEDGEGAGAYMQDDDAALLDEEAEEAAEVDRRAQQGDILLYKRLLAHQLHRDS
                     VAEHIQQHGLLRMSTTPPVDMTLYGILFSCREVPTAAVGAAVSEESSVPLQVRWQPSK
                     RSRYAGTPLHWAVLARAHDTVRFLVEHGADCSAGLKAVTNDGAAPDAQLAMCDQKVLG
                     SLTPARMAADNESHGTLEVLERAVAAQEARRADEEAFFIMLEKRLRRRREEYLRRFEE
                     ARAQRLREAEEARRAEAEEGEEAEESDLSGEDKNDSGSENIDTGEEDEEADG"
     gene            <83731..>83877
                     /locus_tag="LDBPK_050270"
                     /db_xref="GeneID:13391053"
     mRNA            <83731..>83877
                     /locus_tag="LDBPK_050270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858166.1"
                     /db_xref="GeneID:13391053"
     CDS             83731..83877
                     /locus_tag="LDBPK_050270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858214.1"
                     /db_xref="GeneID:13391053"
                     /db_xref="UniProtKB/TrEMBL:E9B8B7"
                     /translation="MPPCRTRLLPHVPCTRHQRTVRCIAHPLHRHTGKQTHAHTHTVS
                     CTGG"
     gene            <85536..>86210
                     /locus_tag="LDBPK_050280"
                     /db_xref="GeneID:13391054"
     mRNA            <85536..>86210
                     /locus_tag="LDBPK_050280"
                     /product="protein tyrosine phosphatase, putative"
                     /transcript_id="XM_003858167.1"
                     /db_xref="GeneID:13391054"
     CDS             85536..86210
                     /locus_tag="LDBPK_050280"
                     /codon_start=1
                     /product="protein tyrosine phosphatase, putative"
                     /protein_id="XP_003858215.1"
                     /db_xref="GeneID:13391054"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:E9B8B8"
                     /translation="MGIKDMYLLAYNAGMCVGWGTILVKVIGHLAEGRDPASVYPGIA
                     RLLCVAQTGAVAEILHAAFGVVRSPVGTTFLQVLSRLIVLYGAVRIGDTDSTKSLVFV
                     QMLVAWCLSEIIRYSFYGANLLRVNLASLTWLRYSAFMVLYPVGITGEIGCLYKALPY
                     IKKHKPWTVELPNKLNFTFSWYNTVWFILLGIYPYGSYVMYSYMLAQRRKTFAKSASE
                     RSKKSA"
     gene            <88005..>88526
                     /locus_tag="LDBPK_050290"
                     /db_xref="GeneID:13391055"
     mRNA            <88005..>88526
                     /locus_tag="LDBPK_050290"
                     /product="ARP2/3 complex 16kDa subunit, putative"
                     /transcript_id="XM_003858168.1"
                     /db_xref="GeneID:13391055"
     CDS             88005..88526
                     /locus_tag="LDBPK_050290"
                     /codon_start=1
                     /product="ARP2/3 complex 16kDa subunit, putative"
                     /protein_id="XP_003858216.1"
                     /db_xref="GeneID:13391055"
                     /db_xref="GOA:E9B8B9"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="UniProtKB/TrEMBL:E9B8B9"
                     /translation="MASAGAPAAPTSRLCAELDALETTSLQRLPIDDARRVLSRLDDV
                     DAQLCRSAGVAVLISDSSEGAVPCTAERGTSPSAHDSSMGTLKQLRSTFAAQLTISQQ
                     DALMRVLYACMASCASGVTAPTSEASCWAPIGAHNAHAPLSPAGVRRLYEWHAALHDA
                     AGDGAVVRALMSR"
     gene            <90064..>91521
                     /locus_tag="LDBPK_050300"
                     /db_xref="GeneID:13391056"
     mRNA            <90064..>91521
                     /locus_tag="LDBPK_050300"
                     /product="phosphate carrier protein, mitochondrial
                     precursor-like protein"
                     /transcript_id="XM_003858169.1"
                     /db_xref="GeneID:13391056"
     CDS             90064..91521
                     /locus_tag="LDBPK_050300"
                     /codon_start=1
                     /product="phosphate carrier protein, mitochondrial
                     precursor-like protein"
                     /protein_id="XP_003858217.1"
                     /db_xref="GeneID:13391056"
                     /db_xref="GOA:E9B8C0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9B8C0"
                     /translation="MFPVPAGFAVHNRNTGSNNSEGDGHGSRVDERSTVLGLVAGVGG
                     GSTTEADVVSAVITTSLLPPGGVNGVGAASFVSPIVGSRDRVCFQHFLIAAAASALAA
                     VLVVTYVWQSTSAFNIDPVTGKVRPHSFQYFVYCFVGGIAAGMVHLVVAPIDILKCRV
                     QVGEYRSFKDGFVHLFRVEAGGSVYRALPLFFRGWLPMLWGYCIQGSIKFSLYEIVKY
                     VLLIAFLEPSVEAKAAAAAAGGVANSLASSSAAHVSGVYQFFVFLFSSCLAEVVADLG
                     LAPWEAVKIRMQTSPSFPVHLRSALPRMWETEGLHGFYRGLVPLWGRQVPYTMMKFSS
                     FEFVVVGLQSLFHSLGVMDAAEPGVLGKLVVSLLAGVLAGLLCGVVSHPADTVLSKMS
                     QRSSAPTSSAVPALANTLADATCGSVGHGRAGAAHGGAMHGVLEVMHELGWRGMWKGL
                     APRLLMVVSLTALQWVTYDGFKVWAGLPTSGDVEK"
     gene            <92087..>94402
                     /locus_tag="LDBPK_050310"
                     /db_xref="GeneID:13391352"
     mRNA            <92087..>94402
                     /locus_tag="LDBPK_050310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858170.1"
                     /db_xref="GeneID:13391352"
     CDS             92087..94402
                     /locus_tag="LDBPK_050310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858218.1"
                     /db_xref="GeneID:13391352"
                     /db_xref="UniProtKB/TrEMBL:E9B8C1"
                     /translation="MESLDLFSRAHVSSPSTHDPPRSPSSFLLSSRLCFPLHGVLACL
                     PIRSPLLTHLPTQNGGGGGAPETSQEGDPRTLAPSLSQTTAYAVRAMDSATCIPSRVL
                     HLPAPLLQPRGSRWASVQPSPDRASLLLCGRHECQLLSVSSFALQVPRAAVLAQPSSS
                     IREEDTRRSVAQQWNERGSAPGNSAVGGRGRCIVLPQPHRDLTSSCWLSAGLDTGNED
                     DDEAAASDDIAPGAVVGLGDAASVVTIMRPSPLSRALSPHGTAARWLQATIFLKDEED
                     AVFAGGTPLTWNHQRHDHHGRLGKATALGRPCQWGRTPPLAPAWKAVEAVLPCSYVPS
                     HSSGGQTDMHILCQRVDEVYEGSGVAAGGRSARRPCSGVWLASVQRESAWRVPLAMPP
                     GEEDVMDSGGDGAAARSLAEARHVVRRSPRLFDVRRRMPPALQHAPPHQPSHLCPATM
                     PAPAHQRASNAATGPMGLVFAAAFRRHVGLYTAATVTPTVFFELPSWLTGGGGTAPAA
                     ATSSPSQCSSWCVTSVVEEPSLVAPAAVPQTSNGGGSGYSYLVTAMHNERGKRRSRPY
                     PVHAKVSHVDESWQSDGDNNGSGDGSCYCSPLSSSGSCWWLLYDCRNPSRPVWVAEEA
                     LAAPPALDEDDLWHDAPVVTEWLASTSPASHASLRRSPVCATYVPLATTSAEGSSALG
                     VLSACGVCLVLDGGATMPDGAGLDAEDDDDVEGEEAADVFAPIMYELSPPRSLLSPTL
                     SAHREVIAKPPRVRALTFTDGVLHYACEEAL"
     gene            <95108..>95650
                     /locus_tag="LDBPK_050320"
                     /db_xref="GeneID:13391353"
     mRNA            <95108..>95650
                     /locus_tag="LDBPK_050320"
                     /product="glutaredoxin-like protein"
                     /transcript_id="XM_003858171.1"
                     /db_xref="GeneID:13391353"
     CDS             95108..95650
                     /locus_tag="LDBPK_050320"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="XP_003858219.1"
                     /db_xref="GeneID:13391353"
                     /db_xref="GOA:E9B8C2"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9B8C2"
                     /translation="MRSLSRGLSLAASGRLVCVSRRSSVTASTALAATYASANAVPCS
                     SLSSSMAASAHRASAAFFHTSRVHRAPSDVSDDLAKDLHDIICHDRLVVFLTGTPSQP
                     RCRFTAQLVDLLDQLGVKYSFFNIMDDEEVCEGLKAYSDWPTYPQVYVDGELLGGFDI
                     CKTMMLDGTLTTMLKDKQLI"
     gene            <97040..>100024
                     /locus_tag="LDBPK_050330"
                     /db_xref="GeneID:13391294"
     mRNA            <97040..>100024
                     /locus_tag="LDBPK_050330"
                     /product="DNA replication licensing factor, putative"
                     /transcript_id="XM_003858172.1"
                     /db_xref="GeneID:13391294"
     CDS             97040..100024
                     /locus_tag="LDBPK_050330"
                     /codon_start=1
                     /product="DNA replication licensing factor, putative"
                     /protein_id="XP_003858220.1"
                     /db_xref="GeneID:13391294"
                     /db_xref="GOA:E9B8C3"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8C3"
                     /translation="MGGRQGGDGATGAKSAGLPAAAAASAKADAWMDALWEIHCGTPL
                     AGAVRYTDAIVKTMWEVFQPLLSELDVYPLAIADVQPETVTATTAATVPFTDFIVLRL
                     IEPATPARHGHRQRGGDHGDAEEDPQNEFGNALTAVMRTALLEQPYIVLSLVEFFTAV
                     WLYQYEARKLSTSQNVPHGKRRQGDGGAQRARSPTVASAASRAPALRRVYAAVSGDVR
                     HATPFDHLGAAQLGRVLTIKGTVVRMSPARISCVCMSYRCGHCGVVKKQTTQDGVLTY
                     PGPCASARCRGYKWTPLTDQAVCEEVQLLRLQEHTTFFDASSSPASPSGGSGATQQHG
                     GGGNRGNAGGSDSQRMGSGGMHVMIEVELRAPWLDAVTVGDCVCVCGVLETRRGEGKQ
                     GGGMQQVCLRARAVRSLRSQETSASSPSLSSIAALQRRQRDGALLSATIGPGGCRDGP
                     WRLAHGGGFAVLADGTSTGGALRGDGEGEADDELMLGAAAQLGGVGPTAMAAAAAASA
                     ITALPSGARVSFSSGFDTWSAEEMGRFYEVARHPQWFARLTASVAPSIFGMELVKQAL
                     LLSIVGGNRDKNGGETRSSIHVLLVGDPGLGKSQLLRAACAVAPRSAFVCAHTSSSCG
                     LTMTLTRDPVSGETTFEAGAVVHGDGGITCLDEIDKGVQEHKALLEVMEQETVSLAKA
                     GMIFSMPVRTSILAAGNPIGGRFDARKSLAANVNLSPALLTRFDIIACLRNPHGSSGK
                     AQQALTDHILQWHRRGPAAGDGGEGGNGDGQGRGHGAGPLPLPLVQRFLLFCRSQCQP
                     TLCREACDVLQAHYLAQRQHLPEPQYGLAHGATASCAGGAAGHLSDSGSVSGPLPRAA
                     MGLEATVTPRYLQALIRVAEARAKLELRHVATREDAEYAVQLLQSCLNSFDGLAASGS
                     AADVGAGRRPAKLSQRDAVLQRLKLAIVEDNSGVNLLTEQAILDVCESVGCRSAAAML
                     RQLNEHGFLLQKGNNKYCLRGC"
     gene            <100821..>101936
                     /locus_tag="LDBPK_050340"
                     /db_xref="GeneID:13391354"
     mRNA            <100821..>101936
                     /locus_tag="LDBPK_050340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858173.1"
                     /db_xref="GeneID:13391354"
     CDS             100821..101936
                     /locus_tag="LDBPK_050340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858221.1"
                     /db_xref="GeneID:13391354"
                     /db_xref="GOA:E9B8C4"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:E9B8C4"
                     /translation="MLKSSIVLLRRGKPRPRAGMFPEKYRRVPALLKPQQGGQQYFNE
                     FLIRSANDALEAQQQGYGSAFRAGGSGAARTLADANATAAGGSNGGEISSVHPRLPQA
                     DIDGVLQRSRAETIQEELKQLVAQDGFVSQRGFNERMWYEQEHHRLRTHGDGVEASPS
                     EAAATTAASSSTAEAGSATGEGRVLPERILGDDYFQSKFGYSLLKGRSPDASAAADIV
                     KAYAQLDLWGEMPTYSRDFVFLYLVSRRRNTYAVAYDYDGKRLLPTYTAGNRGLKGGD
                     RGFRGDGSTDNGHQVTSMYLNDLLPKIREARAASGRPLGRGEKIDLVVRVMGFYNGRQ
                     GAVRAVQDRSADFRVRYLEDVTPFPLNGPKMPRGVFR"
     gene            <103406..>104881
                     /locus_tag="LDBPK_050350"
                     /db_xref="GeneID:13391295"
     mRNA            <103406..>104881
                     /locus_tag="LDBPK_050350"
                     /product="trypanothione reductase"
                     /transcript_id="XM_003858174.1"
                     /db_xref="GeneID:13391295"
     CDS             103406..104881
                     /locus_tag="LDBPK_050350"
                     /codon_start=1
                     /product="trypanothione reductase"
                     /protein_id="XP_003858222.1"
                     /db_xref="GeneID:13391295"
                     /db_xref="GOA:E9B8C5"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001864"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:E9B8C5"
                     /translation="MSRAYDLVVLGAGSGGLEAGWNAAVTHKKKVAVVDVQATHGPPL
                     FAALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEMDRESLCPNWKTLIAAKNKV
                     VNSINESYKSMFADTEGLSFHMGFGALQDAHTVVVRKSEDPHSDVLETLDTEYILIAT
                     GSWPTRLGVPGDEFCITSNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPQGGYVD
                     LCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEE
                     DYDQVMLAIGRVPRSQALQLGKAGVRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVML
                     TPVAINEGAAFVETVFGGKPRATDHTKVACAVFSIPPIGTCGMTEEEAAKNYETVAVY
                     ASSFTPLMHNISGSKHKEFMIRIITNESNGEVLGVHMLGDSAPEIIQSVGICMKMGAK
                     ISDFHSTIGVHPTSAEELCSMRTPAYFYESGKRVEKLSSNL"
     gene            <105837..>107714
                     /locus_tag="LDBPK_050360"
                     /db_xref="GeneID:13391355"
     mRNA            <105837..>107714
                     /locus_tag="LDBPK_050360"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003858175.1"
                     /db_xref="GeneID:13391355"
     CDS             105837..107714
                     /locus_tag="LDBPK_050360"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003858223.1"
                     /db_xref="GeneID:13391355"
                     /db_xref="GOA:E9B8C6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8C6"
                     /translation="MTEFQRLGIQRWLSEQCTYMALETPTPIQCKCIPAILAGRHVVG
                     GAATGSGKTAAFALPILQALAADAYGVFALVLTPSRELAYQIIDQFIAFGAPLRVRTM
                     LAVGGVPTETQVDALKARPHIVAATPGRLRHLLGVFAPEVKKAFAHLRYLVLDEADRL
                     TEGDILRDVQSLIRLLPPTRQRQVLMFTATLHPRLTTLEAPQAEQGLPASSGAAGERE
                     GQNLASSHSPPLQQPQNGEVDEAAEHFSLLAELGITDASTLEVAVVQGAIQEGLGHAA
                     ESGSTGAAGGPISSATAPTLPGRPTSFHLPATLTQNYLFIPNMVKLPYLVAALRLQGK
                     EQSTIVYVNSCLRAELVRLTLQLLGFPVCSLDSLLTQQHRLDSVASFKLGIARILVCT
                     DIAARGLDIPAVSLVLHYDVPKHAETYVHRVGRTARAGREGTSVALVTEYDVSLVQRI
                     EKKIGATLTLWKSPAAKESAILSLLDEVSSAKIQARQQVTEQFGARVQTNKAHAARKK
                     AAAAAARSARSPRQRQQQQEQRLPSAEPNATASMAGTASPTSLSGLKRARRSAATAED
                     APTQAGVVAKKAKKGAAVRGLAADATASRRSATQQRPAKKSATGESDHSPARKRVKEA
                     T"
     gene            <108528..>109514
                     /locus_tag="LDBPK_050370"
                     /db_xref="GeneID:13391356"
     mRNA            <108528..>109514
                     /locus_tag="LDBPK_050370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858176.1"
                     /db_xref="GeneID:13391356"
     CDS             108528..109514
                     /locus_tag="LDBPK_050370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858224.1"
                     /db_xref="GeneID:13391356"
                     /db_xref="UniProtKB/TrEMBL:E9B8C7"
                     /translation="MPSDRDPSGDGFNNPYANTTLVGNWLEDRLQQRIVHKRRGGAAA
                     TWCAQGIFEDPAVTMARHPAEAQAALLHSTYEVDYGHRLGMTQRTGSGGMDNSAAVST
                     LMRGSRHNANAAGPGSGSSTAKGGIDKVLLFSVDPVADPAAPLPLSTNADTYGAFYYE
                     TGDGSVDVNGARYAGSSTGATTSSPADRGDGGATAPPAGADRNLYDSVSRAVAAAAAP
                     SSSFRMPRAQMQRGANADATSSSLPVPRRHMLSRGVATTSTFGHTGWTLASSSATSAA
                     GHVSAAPWRPPQRHRPPNKNSMDGERWCSSKQAADTPVEHFTLQQRLPPVRM"
     gene            <111206..>111388
                     /locus_tag="LDBPK_050380"
                     /db_xref="GeneID:13391357"
     mRNA            <111206..>111388
                     /locus_tag="LDBPK_050380"
                     /product="microtubule-associated protein, putative"
                     /transcript_id="XM_003858177.1"
                     /db_xref="GeneID:13391357"
     CDS             111206..>111388
                     /locus_tag="LDBPK_050380"
                     /codon_start=1
                     /product="microtubule-associated protein, putative"
                     /protein_id="XP_003858225.1"
                     /db_xref="GeneID:13391357"
                     /db_xref="UniProtKB/TrEMBL:E9B8C8"
                     /translation="MSGAVATFTNPRLLERPVNERTEYEDAYQWRGLPEKPQDTQEDI
                     NSTNPCVDPAMYNTTTK"
     gap             111389..115401
                     /estimated_length=4013
     gene            <122795..>125164
                     /locus_tag="LDBPK_050390"
                     /db_xref="GeneID:13391358"
     mRNA            <122795..>125164
                     /locus_tag="LDBPK_050390"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858178.1"
                     /db_xref="GeneID:13391358"
     CDS             122795..125164
                     /locus_tag="LDBPK_050390"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858226.1"
                     /db_xref="GeneID:13391358"
                     /db_xref="GOA:E9B8C9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B8C9"
                     /translation="MSSRSYYSGSGTTAVVPHTISISTAETTPSQAPSSHTEQPSSDQ
                     QHESSLHQATASLPMSLNSTMNNKGASAAAAAAAAAPSSHGGDSHSIGAAAKASGSER
                     ANWNNPSFAAALRNSSGSINVDGYPPAQAHQQPSHPSLLSHSTDVDDEGDGAQHAAVN
                     EPLEYCGVRLLPGVEQIDFDEGYYVGTIDENGEMAGYGKATWHSGDTYEGEWLNGMMH
                     GKGTYTWADGDYYQGDYVRGRMEGRGEMKDATGLYTGEWADDMRQGYGRMLYAGGNVY
                     EGEWLAGMRHGSGKLVEPAAHVTYEGEFNRNEKEGRGVQTNSDGDVYEGEFARGKPNG
                     RGTYLWADGARYIGMFKDGVKHGDGCEWLANGDWVAGLFVDGEHVDSQSTRHKATVLT
                     PDSSDADGGSEDGAGDGGAGGSRGSIGLSESTAAAVLAPLDAEKLRRIADQVHAPSFS
                     MNVSAAAMRSLRSSLRKNSSSHYQDFSGPGGVTIEEASSPFLRSLAAPQMLLDDSDLE
                     GWTPLKTIGKGSFGAVYTALLRNGRTVCCKVIELGTVESEEEMEKLRNEIALMRRLRH
                     PNCVQYYGSLEDKVQNTLNIFMEYVSGGTLTSFVAKFKSIPLETLRQWVYQMVCGVKY
                     LHECGIVHRDIKGDNVLVSVDGIVKLADFGCSKAIDDVCSATHGCSTMVGTPYWMAPE
                     VIKCEAGGYGVKSDIWSIGCTIVEMLTGKPPWPECNSMWAAVYKIANSTGLPTEIPAD
                     IDPELMDLLQRCFERNPKLRPTAADMLSHPFLAKVTEGVASPLEKSGRK"
     gene            <127213..>130845
                     /locus_tag="LDBPK_050400"
                     /db_xref="GeneID:13391359"
     mRNA            <127213..>130845
                     /locus_tag="LDBPK_050400"
                     /product="structural maintenance of chromosome (SMC),
                     putative"
                     /transcript_id="XM_003858179.1"
                     /db_xref="GeneID:13391359"
     CDS             127213..130845
                     /locus_tag="LDBPK_050400"
                     /codon_start=1
                     /product="structural maintenance of chromosome (SMC),
                     putative"
                     /protein_id="XP_003858227.1"
                     /db_xref="GeneID:13391359"
                     /db_xref="GOA:E9B8D0"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8D0"
                     /translation="MRVKSIVIDGFKSYAHRKELADLSPHFNAITGLNGSGKSNIFDA
                     ICFVMGITNLKRVRAEDPRELIFRAGTTGVHAARVTIEFVNDDPASAPPGYSCEEYPL
                     ITIGRQIKLGGRQQFFFNNNVSLQSKVKRFFESISLNVDNPHFMILQGTVHKLIGMRS
                     QDILSLIEEAVGTKAFDHRRRTAETLIRNKERKMEEIDTNIEAQIRPLLETMRADQEE
                     YNTFMQKREKMEEKARFRVALDYYTHRTQHTEAEAAMEARKADVQNAKTQLQALPRQE
                     EEAARRLLQLQDSLSAPSDAAIALHEEEDELKKAHSRLEGQLCNCTQSLEQLETQLKS
                     LRKEQERQSSRQAAFAARQRQHEQLLAQIRAGKETCARLKKGLKLLRSGVQAGASGVS
                     LAEERQQVDLQLIEQQSRVRRATERLEELVKQQRRVEAHQAEENGRVRHLEHEYAKAA
                     ASLEKAKAVYTPLALKQERKEALEAEISSLKREYQAEYENFQRQVSTATARNYDLDYN
                     RYACPPDTEDKVLGRVGQLITPTDPQHALGLMVGAQNQLLRVVVTDDRVAEAIIRSGL
                     RQRTAFFALDKLQRQPTHFFIDGAKLQTARLIAEQQGGWVHRARDLVTVQEASSHQQQ
                     QQLNALADFVFGNFLVCSSLRLAQELAYNPSIKAKAVTVEGEVAEPNGLMTGGSTRQL
                     RDVFADLKTYTAQKQPLKALQQRTRALEVEYAALRDTLRQHQHDIQVYKAAEEAAELS
                     KQRYIVAANSVQSGAAELTEQMERERTALAEAREKVEVLQARQRELATQAQTTDLNSV
                     RQEMEDQLAAAEAHVARLTADEERGAAEFERLEADMEQQAADLSRKTQDTEEDMVQQQ
                     SQKLKLAAQVEEVTQQLAAVQARSKQNEERRQRLEKDIDDAQEELTRLAERKVTLDNL
                     VKNGEVELREQSRCLESLRRHVHEAEQRYSWLLEARAAFNQPGGPYDFSDAARTAAIL
                     QELRDVEARAAVMSSKLSQKSAILYEERRREYEELVKQRTALGEDKEAIQRCITEIES
                     KKWGALDRMVGVVSSIFGKLFATCLPGATAQLLEERDAANHLSGLSVRVSFNGKPRES
                     LSELSGGQRSLLALCLILAILRVRPAPLYILDEVDAALDPSHTQNIGRMLQLYFPHSQ
                     FLLVSLKDGMFNNANVLYHIRNTQGYSEVARIEHKPPSQPTSADSDPQNVASGAEKQG
                     AVTSSA"
     gene            <131864..>134626
                     /locus_tag="LDBPK_050410"
                     /db_xref="GeneID:13391360"
     mRNA            <131864..>134626
                     /locus_tag="LDBPK_050410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858180.1"
                     /db_xref="GeneID:13391360"
     CDS             131864..134626
                     /locus_tag="LDBPK_050410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858228.1"
                     /db_xref="GeneID:13391360"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B8D1"
                     /translation="MSATPPPPSSNASTAYPHARASPGTYRGTGSGAYSRGSSYQPSE
                     SSPSSSPIYTSSHSRRGGGSTRVRAHTYGSVYADPAASRAAAPPASRTSAPRATPDVA
                     TPPLPSASSAASPPLSFISIDVLSSLNASVQESLSGYLYTDAIELAQRLFDLEASYAH
                     LHLLAHCYTVSGAAGTAYRLLQHYYPFLELHVTRPWTAGASTSAAGGAAGGVGSGFLP
                     FDARRTWTASYGVHPPQHPFSSGMSSTAAAATFSASSNENNVTSDEFELGYETVDLQS
                     QWDCQYLLGVCCYRTQHYEDGAKVLSQLLYVCHQVTTISSVLRRRLQQLRQQQQQQVA
                     GRSDTSEEDDAGVAAAVRTTERQLRTCAFVTEARTSQVLYWLGLCEKHRQRHPIAAEH
                     LRRAYVAHPLRLDAFHEYVHLAWPSEQVVQSLLAVKESLIEEEDRAEVDVTEPPQQRQ
                     RPPQRRGRDATDIAVDVDADADDEEQRAPRSAAAVAALASGGGGNHSAASVSPHATQL
                     VRAGPSAVTLPAPCLTAQQRRCAQQHLRPFLHAAFLGITYRCPEAVETLHALLAQEQQ
                     QQRAAAAAAALGSASSSTVASLHGSARAGMMRSSSSSSAPLWKNQGGGSAATGAVAST
                     ASPWLLRQLALAHFHNGDIQESADAFEQLLRTAPWELMSPALIFYSTALWHLKSESAL
                     GSLAQRLTDAEPLSATTLCVVANAYSLIKDPRDALVMLKRAVQVAPTLAYAHALHGYE
                     LLGQDSKAEAEAAFKAALAVDASLYIAYAGLGERFMREEQIDKARGYYKEAVKLNPTP
                     AIINRFALTYHRQGKSLADLKTALRLYTESLERHPNNVTARRQRADVLLRLDQPLQAL
                     EELKALLVECPGEAVVYVTLAECMVCLRRPHEALQHYQTAMHLDPRRESYVQGCIDQL
                     VAANML"
     gene            <135601..>135936
                     /locus_tag="LDBPK_050420"
                     /db_xref="GeneID:13391361"
     mRNA            <135601..>135936
                     /locus_tag="LDBPK_050420"
                     /product="dynein-light chain-protein, putative"
                     /transcript_id="XM_003858181.1"
                     /db_xref="GeneID:13391361"
     CDS             135601..135936
                     /locus_tag="LDBPK_050420"
                     /codon_start=1
                     /product="dynein-light chain-protein, putative"
                     /protein_id="XP_003858229.1"
                     /db_xref="GeneID:13391361"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:E9B8D2"
                     /translation="MASDDRITLADDASVICEDVVNALFSRETRYQHSKIAGLVSAIS
                     DQVVQRLTQEAKLPRKYVVLVTILQKNGAGVQMISSCSWNPTSDACYVYKAENKAMYC
                     IITVYGVTV"
     gap             136847..137802
                     /estimated_length=956
     gene            <138603..>140630
                     /locus_tag="LDBPK_050430"
                     /db_xref="GeneID:13391362"
     mRNA            <138603..>140630
                     /locus_tag="LDBPK_050430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858182.1"
                     /db_xref="GeneID:13391362"
     CDS             138603..140630
                     /locus_tag="LDBPK_050430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858230.1"
                     /db_xref="GeneID:13391362"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9B8D3"
                     /translation="MLRRGLWRYRRISYVTDVEGDFAYFQRFVCISRVLRWEPAEAAV
                     SSNPPRPFAGGSNGSRVANGRWAPLSSAVLPAPSGAFPASDAAASTQALGTTTTPAVT
                     DAYEPEYCRLVDLSRYRLGFQDATSHFVFGGDAFDHGNDITFGKALLDFKRRFPSRVH
                     LLLGNRDVNKMAMYPRMACEVEGMAPDAAEDTVFTLTPPSMKTVRAASLTEALRYRDF
                     LLEQRQRQEAQRQDGAGHAASSPYGGASCGSSGDTLRTDAVSFLQWALQYKLGGPNAF
                     AHRRQELREMAAMMAEGCGAVAAAPPAAGAEAMRDGIAYDEDAVVAASFFTAAQPGGV
                     YYEYIRAGVLSVVLDGVLFVHGGVNASNAGFVPSLEATSYAEQVAVGQWWLPEVAPQE
                     VTTTPTASSATSALGWLAALEQFKAAAFSDWVNGAALRGEALRAYVYPRVVAPHSIAV
                     GTVMNADGPHYIPLTVAAYLLQSGIHTVCAGHQPVGDTPAIIRQPGGFTIIDADNSYC
                     GRGNKFCTRFNRRGAAVMEVLFEHPDDHGGDDNVAPHDAVAAPSLTVHGYRADGTPFE
                     FDVYSDWRVGRYVGDGWWVRLPPEATAATSSSFRGNEAAHAGLYELRRTQDGFRHEET
                     RWATAAEVDAWLRQVAASGKATVPGELAPRHTKEELAEVRAHRLKTKVKRT"
     gene            <141177..>143738
                     /locus_tag="LDBPK_050440"
                     /db_xref="GeneID:13391363"
     mRNA            <141177..>143738
                     /locus_tag="LDBPK_050440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858183.1"
                     /db_xref="GeneID:13391363"
     CDS             141177..143738
                     /locus_tag="LDBPK_050440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858231.1"
                     /db_xref="GeneID:13391363"
                     /db_xref="UniProtKB/TrEMBL:E9B8D4"
                     /translation="MSSTWLHALRAYATRTNATPASLVARCRLFDQLCAVQLRGLPSA
                     QLHPDALPVLREARWSLLREGTTADKAELLEHIVRQYAQASEKAMYAAPTASCSPDGI
                     SGSADAQRKQPGKKSSRTRSLQDRPPQHATRSCNSGSLLSDVQLSEMSVLQQLLLEQV
                     QCLVEAKVSDIPLSARHYRYPMRSPLLATVSPELPLLLLEELTLQSTAVSPSSSSSAQ
                     SNINWEARVDCCVGLVAAGHVQEALALCGDDGSAFRAVMHRVAPLRRDGWRCAWALAD
                     AAPLSRVLDDATAAAGGTASLDWLRGVLEAVDMRHRAAVGARQVSDSANAERNHVFEW
                     VDRLRRLIVLSSKVPLAGAEGQQQQQRVSATALRLIMDTYLSVCPASRWRDAVGAVLE
                     LAAATDAAPAAAQAAGEGNCCADAVTTGRLMSILKAAEQPWMVLLFFYGDPLALQVAS
                     SGSRNDSNTKRPDSDAPARWQVSDKSVQAKVEECVRAARDADRLTVATGTILSERDKR
                     HAAIYNHAMVALAATGHHTEAMHFYRTLPVLLVNCYTHWSVLQLFLQPTRDSRAASAL
                     RTSENYNHCARALRHLIRMSTAESEAAHAHTQVNGNSSGVHPATPIRCTRNQGGVWES
                     MILWAALRRDAETVDLCATHAPVVSRYAHLIALLSAAASRSDGWSAAQAQVRHMCAAP
                     RTTLKELSLATAVMASFFPRWPAGTAAAELPVRAELFDEVAHSMAPLVGRSQSRMDEM
                     LQLLVGYSVSLRRRRRMPMTPQDEAAALDGILVKENILASTMDLARPRAGYASDVDSA
                     RSCDNGAAGDPGAWRTVVHVMISVAERQGLSAARAAPALVSAGVPAEMAIDLLPM"
     gap             143905..143955
                     /estimated_length=51
     gene            <145041..>145631
                     /locus_tag="LDBPK_050450"
                     /db_xref="GeneID:13391296"
     mRNA            <145041..>145631
                     /locus_tag="LDBPK_050450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858184.1"
                     /db_xref="GeneID:13391296"
     CDS             145041..145631
                     /locus_tag="LDBPK_050450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858232.1"
                     /db_xref="GeneID:13391296"
                     /db_xref="GOA:E9B8D5"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:E9B8D5"
                     /translation="MADEGAMDIRLVLKGPNGEFKVDRDLYIIVHCDDGKYIEVSKNY
                     IKQCPFIEEAEGEIPEFGYPAAVLEHLIRWAVHYGVDGHAASQLTRPCIYRDFSYVVT
                     DKWDNDFFNQRLCSPLNQKHYLLTMTAAEQFGMQGLLDFMCIGLGCKLRGKDDNGIIH
                     EVMGLDKETEITSEDLEEVSRDYPWFDDAVKATTKK"
     gene            <146502..>148385
                     /locus_tag="LDBPK_050460"
                     /db_xref="GeneID:13391364"
     mRNA            <146502..>148385
                     /locus_tag="LDBPK_050460"
                     /product="GTPase, putative"
                     /transcript_id="XM_003858185.1"
                     /db_xref="GeneID:13391364"
     CDS             146502..148385
                     /locus_tag="LDBPK_050460"
                     /codon_start=1
                     /product="GTPase, putative"
                     /protein_id="XP_003858233.1"
                     /db_xref="GeneID:13391364"
                     /db_xref="GOA:E9B8D6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012971"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR024929"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8D6"
                     /translation="MGKPGKKAGKGLLAPTNPNRRTDPNKTSLRDQRTIKRLKMYKSK
                     IKRDEKGNIIKGSVLKASDRIEQQMARIAPDRRWFGNTRTIGQEALQKFREEMGAKYK
                     DPYSVIIKQSKLPLSLLEEPKNTDGSIRKEMEWDKTFGDKANRKRVRLNAVDMSTLAT
                     EANAKGDYYNCNQKEKDRDLMKGVHKDRDDKTRNGILMTKGQSNRIWCELYKVIDSSD
                     VVLYVVDARDPMGTRSTFLEDFMRREKKYKHFVLVLNKCDLVPLWATARWLQILSKDY
                     PTIAFHASVNHPFGKGNVISLLRQFARLHNVTHRGSKRTKTPISVGVIGYPNVGKSSL
                     INTLRRKSVCKVAPIPGETKVWQYVALTRSIFLIDCPGVVYDRESNNDIQAVLKGVVR
                     VERLGNADKTDVVDTVLKIVKHGDIVATYGVREWRDVVDFLEKLAKLRGKLVAGGEPD
                     VEAAARMVLYDWQRGRLPWFNAPPFESNKHHRDAMEQPQEKHMKLIEHYSTFNVVDDT
                     IHRGDEEQDEADDGDEESVNEAPEEDQLDSGSEAEKDEEAVKPSKPSKTDRLPAKKMH
                     TQLATVATYVREQEEKQRKARRQQKRKAARKGQERVEAFSADADRESDDALWARFLAA
                     AQE"
     gene            <149886..>150614
                     /locus_tag="LDBPK_050470"
                     /db_xref="GeneID:13391365"
     mRNA            <149886..>150614
                     /locus_tag="LDBPK_050470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858186.1"
                     /db_xref="GeneID:13391365"
     CDS             149886..150614
                     /locus_tag="LDBPK_050470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858234.1"
                     /db_xref="GeneID:13391365"
                     /db_xref="UniProtKB/TrEMBL:E9B8D7"
                     /translation="MTSNATLPHAVALAQELEIELRHLDALQQHYAQLLVHQLSSLDF
                     LNEGDAATMVSAKEPTMAHNGGCAVAKPEVAVATTCIKQPSAVPLPWRRHTHDAARVL
                     QPPFRHSACPVPSTISSSSSPLLQPLAATSVPPPLSPQPKRSGRSAVKPVTPPPNADK
                     TCKDLPRHQPHVAAAPVVPASTKDEATRRARRALRFIREERDAYFNAKARRAEELLRE
                     GREAARKNRARRQADMAQTLPKAA"
     gene            <151630..>153354
                     /locus_tag="LDBPK_050480"
                     /db_xref="GeneID:13391366"
     mRNA            <151630..>153354
                     /locus_tag="LDBPK_050480"
                     /product="monocarboxylate transporter-like protein"
                     /transcript_id="XM_003858187.1"
                     /db_xref="GeneID:13391366"
     CDS             151630..153354
                     /locus_tag="LDBPK_050480"
                     /codon_start=1
                     /product="monocarboxylate transporter-like protein"
                     /protein_id="XP_003858235.1"
                     /db_xref="GeneID:13391366"
                     /db_xref="GOA:E9B8D8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9B8D8"
                     /translation="MQIYEACKKVDRAVTHRPADHWIGYLVAVSGALMQMMSYGIDNS
                     FSIFSNSMQNDPSLGYPSATTVSFGNSVSLGLSPVFGVLAGFLVDRVPPRVMMFTSTV
                     MLFAALWLSSSFAKSSAEVTASYSLLASISSALMLSPGAAATGSWFRRRLGLGQGINF
                     CGGGVGSAVVPAVLGSLVDVYGWRHTFRLMSAFCAIGLVATILSCRRHPIEDDVDVDD
                     HARGGNSPAREPSHDDCIAHRSFSHEERNEIMLMITPEAGENAAASPTTRMIDSMRTE
                     AEKAANHDNGDTLKKGGKPDAAASARAALASPGGSDDMSMLLGRHQQPQQQLAQHGRK
                     VHGTQACTVTDLIQDMHVRRLTWREMMRVFFSVRFLTHFFMFAIYGWSFYGLIYVAVP
                     YVSSMGSAGTVYADVTPISTSKASTVFTFWGVFQIVGSILVGGVASFTDDALAYTMCA
                     TVGGLATSLLVFCRSYAAFAVCLSVVGFCTAGIFAMMPALIAKDFHGPNLGFFMGCVF
                     VAGCLGGFSAPPIQAQLQTRYNGNYSYGCVFISCCTTFPGVLCYLLLGPEKQSRVGRV
                     FMRVVEQA"
     gene            <156607..>157422
                     /locus_tag="LDBPK_050490"
                     /db_xref="GeneID:13391367"
     mRNA            <156607..>157422
                     /locus_tag="LDBPK_050490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858188.1"
                     /db_xref="GeneID:13391367"
     CDS             156607..157422
                     /locus_tag="LDBPK_050490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858236.1"
                     /db_xref="GeneID:13391367"
                     /db_xref="UniProtKB/TrEMBL:E9B8D9"
                     /translation="MPPAPAPPFSSVSQCFSALLPPPRCGCCAYALSPSLDGIFASSA
                     LSLTALVSTSSLANHISCFTLCVRSPAATVAAPSRLPPSAHHPLHNHQQALGAEVVSD
                     SSMSRLARALAKPFTVPVAVCTRHVAAMDEPLKRHIDAYAARGEDITIAVWREYVDGQ
                     RALLPYRWAKFRSEVAYLASGQMAITDLTFADLLVFVRFLTKCLFIFIVAVMVGRRSV
                     FPSLEPTSPFVEEIVKNWQPNRLRGVAGAEYMARDQAAAADMAADKAEKSPIS"
     gene            <158667..>159248
                     /locus_tag="LDBPK_050500"
                     /db_xref="GeneID:13391368"
     mRNA            <158667..>159248
                     /locus_tag="LDBPK_050500"
                     /product="ATPase alpha subunit"
                     /transcript_id="XM_003858189.1"
                     /db_xref="GeneID:13391368"
     CDS             158667..>159248
                     /locus_tag="LDBPK_050500"
                     /codon_start=1
                     /product="ATPase alpha subunit"
                     /protein_id="XP_003858237.1"
                     /db_xref="GeneID:13391368"
                     /db_xref="UniProtKB/TrEMBL:E9B8E0"
                     /translation="MPCVLVCVSLPDLRRPFGRSPAAEKKEQAPVHHRRTSSKRHSLP
                     RQPDASERWSFWLLRTQRSLLVSSSSPLSSPPASPLRASLQGMCHPVPLPTTCSVSPR
                     HLVSAQLYNILSSFRAHARPPAWLLASALGLLPIPTYGAPSPPPPPSCGHPLETCTSA
                     TLCAGQQPPPPPPPPLPLFPVTAQASCAASWPST"
     gap             159250..160651
                     /estimated_length=1402
     gap             162281..162379
                     /estimated_length=99
     gene            <162796..>164520
                     /locus_tag="LDBPK_050510"
                     /db_xref="GeneID:13391369"
     mRNA            <162796..>164520
                     /locus_tag="LDBPK_050510"
                     /product="ATPase alpha subunit"
                     /transcript_id="XM_003858190.1"
                     /db_xref="GeneID:13391369"
     CDS             162796..164520
                     /locus_tag="LDBPK_050510"
                     /codon_start=1
                     /product="ATPase alpha subunit"
                     /protein_id="XP_003858238.1"
                     /db_xref="GeneID:13391369"
                     /db_xref="GOA:E9B8E1"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8E1"
                     /translation="MRRFVAQYVAPAMGRLASTAAAGKSAAPGQKSFFKATEMIGYVH
                     SIDGTIATLIPAPGNPGVAYNTIIMIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEV
                     QSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLESEQTLGKVDAGA
                     PNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQ
                     QILSKNAVISIYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYS
                     GVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLE
                     RAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQRPAV
                     NIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVA
                     LFNQKNPSFFMNALVSLYACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFY
                     MYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQSKMNAIKTEKEIKALKNL
                     LYSCKRAV"
     gap             164636..164734
                     /estimated_length=99
     gene            <167564..>168586
                     /locus_tag="LDBPK_050520"
                     /db_xref="GeneID:13391370"
     mRNA            <167564..>168586
                     /locus_tag="LDBPK_050520"
                     /product="nuclear receptor binding factor-like protein"
                     /transcript_id="XM_003858191.1"
                     /db_xref="GeneID:13391370"
     CDS             167564..168586
                     /locus_tag="LDBPK_050520"
                     /codon_start=1
                     /product="nuclear receptor binding factor-like protein"
                     /protein_id="XP_003858239.1"
                     /db_xref="GeneID:13391370"
                     /db_xref="GOA:E9B8E2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9B8E2"
                     /translation="MAKVASAGWRYARCGPISQVLAYEMFDITPGKEEAVVQMATAPL
                     HRVDAAVVNGTALGRKRVNMASFPRIGGCEGVGKVVRAPAAAAATPSPVKEGDTVWVA
                     PLHGTWATNIAVPVSQLHKIDPRQAEMAATASNFLVAQQLLDGYARLQKGDIVIQNGG
                     SSLTSLAVSALAKAYGVKVLTAATPSARFADAKQRHAKYGSDVFEYNGAGSRAMQAAV
                     GKRGAALYLNGVGGRYFDSLLKCVGPMAHVVTYGAQNGFGLFISGSSLIYNEVTMAGL
                     FAPTFLSSMSYGERQAKLEFVLRAVQEAGIAYPMATAPSLEKLPEVWDDVYVNGGRKA
                     VVKMAA"
     gene            <169396..>175689
                     /locus_tag="LDBPK_050530"
                     /db_xref="GeneID:13391371"
     mRNA            <169396..>175689
                     /locus_tag="LDBPK_050530"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_003858192.1"
                     /db_xref="GeneID:13391371"
     CDS             169396..175689
                     /locus_tag="LDBPK_050530"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_003858240.1"
                     /db_xref="GeneID:13391371"
                     /db_xref="UniProtKB/TrEMBL:E9B8E3"
                     /translation="MQPKLVLPSSQPLRISAQYPVGSSSAEPSSSSAAARPRGSYGVS
                     IDPAQAPNVAAVAVATPLPPPSSSSRLLQEIEETRKLLRTFRSLKERGASRAELADLH
                     LRVKALKAAQQCQQPNSGACKATALPLATSTTADAEAAAATAAARPSLACSPKAAPPL
                     PCVHRHADVAFHEGAAGWTAESSHSLHQPQQRGVEEAHVAHRDGRLPEGRHHHHHHRH
                     RHRHNDVRVDRAASLSISTSLSTAAAQASTAVCNGIFNAASSGSAGVCSAVALQPSTA
                     SAVPGYLVQISSIVFAIALAEAHTRREIAQRWERRWLRHWANFKEERIAIALRPPTTA
                     TAALSRPQLQPERWAEAAPMALPHEWQQRQQAVSPATASVEGSSVATATAARTVGASL
                     APVPAKSVGEAFTATTSSPAVAGLEETSPLSAGHRSGDEAHHVAEEQEKTIPDVDDAA
                     VAKDLLAWASPLPQHQQHPAAPVTEQELEASACAAADATAEAAAAMRNVEDEEATART
                     ATESAAAEARKRMKMAEVTARLRAEEPQESVQSFMAAEAGARVTLEGDEARLRISHVA
                     AERDGAQRVALAAAEAESRRRAQEEQVRQEAAARAAAAKREEEKEREAAARRAAEAQQ
                     QAAADTEAAERRSVEQQWQEAVRLSESLLSDRIKDAVAAAPPLAYSKGTRAPERPSRD
                     ELAMMEDAQAREAADAQACLRERQQAAEQGVAAFGAAADAVLGEWISTAAMEAEQAAS
                     VEAARRRKAEEAAAQAKAVAQERASAAEAARAAVARTEDEGRAALTASEEEVWQWLQL
                     QHGAGLESTRLAALAAEGKAACHRAEEEAAAARLTLEMSASKEAARAKAIQEAVRLQA
                     EQQAAAMTVTLCSAVAEFSKNLVDGCLAEAAQQVSEQVKAAALEELQMQRRERVEGEE
                     ASARDDTYGDALDELARLREEEAAAQVRKRMEVEAVAVAKEQQQQQQQRMQAAAQYFR
                     ICELSEALLLEFLHDAAATAAAARTAAVANDRLAEASPPAALPEGEEGAASAVMEDGQ
                     QYQHHHPSADDAAEEPNARADKRQGDGVDSPDKANVDTAAPGAVAATASLSLSPSSSA
                     GPSSFFVESVSADATPRAVTTGVLQGHAVEGLGLLSPTVFVHVVDGLLSDVLRDAAME
                     AQRGGAGAVGAISEDIASRAHAGQRAREHCKPLPNGSDASFVSIGHGSSHSTLGCSPP
                     WEPQPKPLELPLALVVRDAAGDRVPQVQYTGGEPKDCAEAGVVIGGAGNVTASPAEVS
                     DVDRCAPHRRIVSPLLIPSMDVAIVSTSSTSTASVTDGRRGCARGSAGATATASSPLH
                     CFSTASSADDDDAACSSLTAPGAPRPLNLLHHGVLSPLLCQQHGGNGGVPHDGGEAST
                     PADSEDATGTTTVAALADRPSLSENSRARRQLPESTGTGDHEAASDADGMLSAVVAMD
                     HRVMGITEDLRAFQLDAPPPPHGAAEQRAGVRIAAYDTLTADAVAAVADSLVQRAVHD
                     ASLLFDFRGQSAVPNTDSDHQESHDAVKVDHAAAPPFLFAIAQSHEQGTAEGKSSDNG
                     SGGGTSSSACAGDVDAHTEKRASIAEMGSGFTSGDAREATLRVNRSLSPAAAAVAVEG
                     IAGSHAPLASLSTLVSAVAAPNDFVARLRQQEAEKKAAAHQQNRYLTSRELALVAARY
                     LTSEAAAAHVMEVGPTTTLSARAVELVLSVGLVRAATLENRRARRRMEKAEKGDGSSA
                     RGDGSTSGGGVLVGESGSQKLTPGGGAASAMMDSPDAPLPSLGGGGDGGGFPTGTIGG
                     AGAAGDDEGVNVQLVPPTARCRSGGGDLSMPEPTASSAVGDFAHASGDVKDTGMSGGP
                     TDLGSQPLSPRSSSSMGSASQPTTGGGVKGALAANPAQQQVGVRDKLPADWATALRGV
                     AERVARDFIDYASRRVLLGQGEGQSNQDHLRTARRIHIDALEGVDVPALFTQELQPRD
                     VARLTSYYVELATNGPRDRVDPLCAPAALGEHNIFGHRGSVRNEDVASFGNLDAASAS
                     VFAPPTRPRSLFASSHLLPSHKNHLLSAATAIHVRRAGLLHLVLEQCLSNVLHDLVGD
                     TVGWLWTACLQAAPPGAAPNGTQ"
     gene            <176244..>176648
                     /locus_tag="LDBPK_050540"
                     /db_xref="GeneID:13391372"
     mRNA            <176244..>176648
                     /locus_tag="LDBPK_050540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858193.1"
                     /db_xref="GeneID:13391372"
     CDS             176244..176648
                     /locus_tag="LDBPK_050540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858241.1"
                     /db_xref="GeneID:13391372"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:E9B8E4"
                     /translation="MDSSAGGDAGVVPSNSVAKAPGVGASSSSAPTDPFKYLAEHIHK
                     RVAISLLPVDDDDGAVVRGTLLSVDDLCNVMLQHWSSTGATRLDSSTGNGRQQQQPRK
                     RARLDAAGGDDAEESVRLIRGAQIVSISLLPV"
     gene            <178060..>179007
                     /locus_tag="LDBPK_050550"
                     /db_xref="GeneID:13391610"
     mRNA            <178060..>179007
                     /locus_tag="LDBPK_050550"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858194.1"
                     /db_xref="GeneID:13391610"
     CDS             178060..179007
                     /locus_tag="LDBPK_050550"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858242.1"
                     /db_xref="GeneID:13391610"
                     /db_xref="GOA:E9B8E5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B8E5"
                     /translation="MRSSDPTPARPTGFQRYQRQHKVGEGSYGKVFLCTDVVEGGTVA
                     VKTSQWNSGEEGLSVSSIREVSLLKEIRHPNVVRLLDLFTEEKKLCIVFERMEKDLRS
                     VLSTRQTPIVGRKLKHMMYQLLSALHACHSRRVVHRDIKPGNILVSADEQTVKLADFG
                     MGRAFGLALQSYTYRIATLYYRAPEVLLGDRYYLPSVDMWSMGCVMAELALRRALFRG
                     EGEYSQLITIFGIMGTPNERVWPGVSRLPHYNAEFPSWVPTSLEKHIPTLDPEGIALL
                     KAMLRYDPQRRITALQAMQHPFFDDVRDECEARLQQQQP"
     gene            <180346..>181605
                     /locus_tag="LDBPK_050560"
                     /db_xref="GeneID:13391611"
     mRNA            <180346..>181605
                     /locus_tag="LDBPK_050560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858195.1"
                     /db_xref="GeneID:13391611"
     CDS             180346..181605
                     /locus_tag="LDBPK_050560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858243.1"
                     /db_xref="GeneID:13391611"
                     /db_xref="UniProtKB/TrEMBL:E9B8E6"
                     /translation="MVLIASCNALYFPREPRDNVLKVRWNAQDAPLEPNTSVIFKVKC
                     TAPHLFHALPRYGALLLADATGAATPSSNQTTTITFSLRESHGGGAGEISPTGVSRQT
                     APTTTRTSRASSATPGGPAYQERFAIEYVMIKSEPLAFQQISNSVADAAQLTEVVKNM
                     WSLVASGAIPRAHLGVQAGINLKVYMENVVLQPSDPAPSGGNEATKVVVPPEACLVLP
                     TASERQGRSVHDVTHPGRSRPALDPSPRVYNGGDGADHLGSTSSVFRRKPADELRALR
                     EEINTMRRESATPRSAAGGSVRNSSSPSSNTPNSKPRGHEGAAAMQPLPAHRAAGASS
                     YEDLIMKFDLGGAASRAGAPAAQKKEGLKVYMVLLLMSALYVCLLFMRRGATHAEGVK
                     NGSGNGADAAEQRYAVQLSSREVQMRK"
     gap             182225..182323
                     /estimated_length=99
     gene            <184099..>185331
                     /locus_tag="LDBPK_050570"
                     /db_xref="GeneID:13391297"
     mRNA            <184099..>185331
                     /locus_tag="LDBPK_050570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858196.1"
                     /db_xref="GeneID:13391297"
     CDS             184099..185331
                     /locus_tag="LDBPK_050570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858244.1"
                     /db_xref="GeneID:13391297"
                     /db_xref="GOA:E9B8E7"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:E9B8E7"
                     /translation="MRTGTSARAPFTHGVAGRAIKTRVKSNLGQPYAQRFYNNVWTYR
                     VAQLTTSNVRSMKKARIAVGFDSGVGGGHSGGASSQDGNDGSGSGAELPVKSDLQPHA
                     LHKFAGEEDWSIVIAVPKSSEHVRNLQDCAKGSLMLGHTDPQLFHWFKELGALPPRSL
                     LSGPMELLRGDLQVEAWERTFSRHPVIHRIAQDMWESDESKTAEEAVHIAKREQEEDE
                     KRMRRMSSSDWRAKFRDRERNPTRAEDEEAPVYVIKPETFSLFRMKPDVRLWMNIAGQ
                     TQRVWDPVVPDPDPLCRCSHRFIRMLNLGRQKLVPSLNMNYSLKLTNAFIFEINDRGM
                     WAMGTQENLAGKNGVVREEWMELRLDFGKNQVITTEQEMEWWVRGLTKLGAPELSQTN
                     SSVEDAGLNPEDFEYRHI"
     gene            <186462..>188801
                     /locus_tag="LDBPK_050580"
                     /db_xref="GeneID:13391298"
     mRNA            <186462..>188801
                     /locus_tag="LDBPK_050580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858197.1"
                     /db_xref="GeneID:13391298"
     CDS             186462..188801
                     /locus_tag="LDBPK_050580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858245.1"
                     /db_xref="GeneID:13391298"
                     /db_xref="UniProtKB/TrEMBL:E9B8E8"
                     /translation="MEHSVSSRSPSGQWYPQQQPPAFHRNNSQQQLQWSPASGTATPM
                     VMVGGVQSTAVPAGTGSAMLGNSGMLSSGSANLCGQPHLHSGMTPQQQMMIMQSMYTP
                     QSQCCAPCCGTQECSFCPRPGEPVDPFCCTPRRPDQGPRWWESIYKYFDWTFFLACIL
                     CVLTIVGFAMVMVTRNQDNIFAAFGVHNATALDAAMMPYIRWMNTKPTILIDGSSGVP
                     SNAVEAVETALLASSEYAVEATASESSIPAPILVPAHNCTRRRLFGSFGELCMEDNMY
                     ANTFAVQLSFWNDARDTLWILAMVYSFLTVLYAVLINVRRHASCASVEGARGSSFMLP
                     SITPQQQEEFVKMTPQQQQAFIQEFQQQVATVQQQNPSAVFPSQQPPGVGCCGSDRGI
                     EFYETPFYEFVRFAWLFSGLTTFAWTCNLFISFWSFSYFYIRETTGPLNAFWTVYTRK
                     MEATLIVVAVFLAWPLCNFVLELVVLVALVLPWLVIRSTWKRGIQMYRPALPPSQLPA
                     YIRADMFFMDFQDVKRLGFSRLAWIILTDSEKPFFEGCEDPTVDKDPAMTQLMQQRMQ
                     WRQMMASMLPPWIQQQQQMSVMSPGGAGVMMPGQVATQQRQFDFSGAATPPANSLMQS
                     PAQYPVEDGEHRSHKRRRHHSTHDRRHADPLGAASMEQTSAGLGAAGKENSTRHRHRR
                     HSHHRSHSRSRSRSRGVFDGGVSQPPVSDAAVENGADHTADGASRRRHRRSHSHSHSR
                     AAAGDDPSALVVAAPRSTGDAVQNGGAAAAADLDALMQL"
     gene            <191318..>194338
                     /locus_tag="LDBPK_050590"
                     /db_xref="GeneID:13391299"
     mRNA            <191318..>194338
                     /locus_tag="LDBPK_050590"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003858198.1"
                     /db_xref="GeneID:13391299"
     CDS             191318..194338
                     /locus_tag="LDBPK_050590"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003858246.1"
                     /db_xref="GeneID:13391299"
                     /db_xref="GOA:E9B8E9"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8E9"
                     /translation="MQPHPSWRVYVGDDVDVGGTGGTAAAAADQTNTHASPNMEEDVA
                     RLLDSAFARRARYTLQTLPARIRQQPSAAPSPVLRWLLQHSVDEGQRKKEQAGTAPGA
                     TDKPSATPASALSPTVAATSGCVSAAAAATSALARRGVGPKDPLVQRLLKKQQKTASS
                     ASAATSATSAAPSSATNATASTVISGSTTAPMSCASHWTQRPFSAMTSTSWKVFRQQL
                     GITVELVAPAQPPTETSGASAAQPSSFVKTLPPADTLPAIRCWEEAQLPLSLGLCVTH
                     AYALPTAVQAQCVPLALLPRPAPLVTGTNSGGVAGAATATVLGMDILAVAETGSGKTA
                     AYLVPLLHHVLCRAPKLLGHPDRISLGPLSLVIVPTRELAEQVTASFLQLCGQAPAAS
                     MYNSGGGHISQDTIRAWETHELDVSGASGHDRASSVAAAGAARNHLSELRVVKVVGGE
                     NRDAQYAALARGAHCVVGTVGQLQVLLEDRLLSLGNTQFVVMDEADRMIDEQQEERLT
                     AVLERCPQPRQTVMFTATLSVACAAVAKRYLAKAGYYLVRTPYRCASIRQSFELVADT
                     GASVTGTAEDPVPAASGAATATAEGRQKKPSRQQGHTEKGEPQPPQRQRLLHPLIHAQ
                     KFVRLVAWLVYGTGPIIVFANEKSTCDALWEELRAEAEHLDAQQEYYTIEDIVGPPPD
                     GLSFREDTAVGQGATSSSVAARRTPTLANLTSVAVVHSELSQTERRSLVAQFQRRQRH
                     VLITTDLLARGLDVAGVTLVINYDVPWAASASPSDAVTLYIHRIGRTGRAGSTGVAVT
                     FVTLPAAMVQRAEEVAREEARDAAPKPPEGRTKPPSAAPRVYGDEDDDLAALGELFDG
                     DTRNVCMAGAAALSTTAADNASGRRRRRGDDDSDDTEVDSSNDSDDDNDDEDTKKEGA
                     TGNTSNTANHNGNGMRKPPRKRRKRSVATFASDVAVLRPLWSFLVECAEGEGCRDGAA
                     ALRRGTYAKISVPAALGCIMAQLSATSQYGRITL"
     gene            <195009..>197729
                     /locus_tag="LDBPK_050600"
                     /db_xref="GeneID:13391300"
     mRNA            <195009..>197729
                     /locus_tag="LDBPK_050600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858199.1"
                     /db_xref="GeneID:13391300"
     CDS             195009..197729
                     /locus_tag="LDBPK_050600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858247.1"
                     /db_xref="GeneID:13391300"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="UniProtKB/TrEMBL:E9B8F0"
                     /translation="MLLKHIDNVEERFDQALQRVRDGVRRRDAALNDIRQSIHAESEL
                     HTSLREISNVQYRLMPQYVHRSAALARTVAANASLAERSSKRVRRLDALLQRVQQTCA
                     IVDAMKAMENDAAQVSSVLDSGDIDKILQLLHSYEAAQRVLTSASPATVVAVEAKASE
                     TGTGGGASLSAPSSAAVEVSNAAPVSDVMRHARATVQARLLRMIEDAVQVNDKLAIMK
                     GTKLLAELGEGAVASRLYSDWIADHTIAALAKLIDGEMRKMEDSATVAMTHLALVSQC
                     LDNVAAAFESDEEFTYEAFGAQGPLVLLAKLHSRATARCVPVLSDFIERRKDVLAQLE
                     KHALAGDGVSSVSRVSTTSMNAAAGANVNAVVASARRADQILEEISHMVSCGHIYLTF
                     VERKQTEYEKRMKASGAAAAAESGREESTSMAAAGEVVVGSTADNLWRTSDNALLNSM
                     QDILAVYVPLQTAYFTIAYDQAVDLQLRAIRDAAKEAAAAAARAGGGGASRTAAGTRH
                     GNAPAALVSAPSAASFMSGLQSLYMVAASSADELIASVGVGGGSASAAGGGASAAASE
                     ELASFWYFTHNGQVTLPDDVFFVLRMAIHRAMNTKSAQICSAAVISAMDVVQLRLLPE
                     IESHTVIAGTSSHAGAGGAASNSSAAGGRRRAGAAPHGGFLTPDELHWTGAAQRTATY
                     LQRMADELQQLGEATFSATPHDVTRFRELAGNMRTLGRTLQEKLIPAWLDAFADVCCD
                     SVLPPHMERFAAVSYDMKEEVYYHYELNDVWVQACLVDLGAGLQYLHQHLADAKLFDA
                     LLTAMARRVAKGTSSVLLRKRVSLFGALQVDKDVRALRSFFVERAQNDLTPIRDAFTV
                     LSLMATLLLSDKPTDALEEAANTALTADEKKKVLLTRVEFRKEAVMALPL"
     gene            <198489..>201434
                     /locus_tag="LDBPK_050610"
                     /db_xref="GeneID:13391301"
     mRNA            <198489..>201434
                     /locus_tag="LDBPK_050610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858200.1"
                     /db_xref="GeneID:13391301"
     CDS             198489..201434
                     /locus_tag="LDBPK_050610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858248.1"
                     /db_xref="GeneID:13391301"
                     /db_xref="GOA:E9B8F1"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="UniProtKB/TrEMBL:E9B8F1"
                     /translation="MDRSTPPFMPLCQSRKQSGASATPVLTPNADDRDDFADVDDNNS
                     GVGFDSTTVLLCGSAHQPANKPADGPSGGSSTSGGNTGASPYTMFEPAYAQQQQGVLG
                     SVLPDEKAVAAAGWCGGSVFPAPDASYSQPLPRLLPPPYVNTASARPPFTAGSLGILG
                     SGTTVEGVSAPPSASAYSPSTTAAESATGAPVNVAASTDVLEVPLHAPRLRVPTNLPL
                     EQTTLLDLLATAVVQGGPTTEEEIVKREMGRGNPAFAFLGEKFNHPCMLYYRWRLYSL
                     LQGDTLVSWRTQPFQIEEARRAYVWVPPPPLKVGPECLVGLHQPELLDPAFATGSGGD
                     AAATVGGAEEEDGADVIVRTARPRRRRHHRGRSAEDGTNYKRSRHEAGDDTDHANRSR
                     GRSGSSSSSSSSGSSSSSSSSSESEGEQDERKGGRGATLAGRGDGDEETTKAKSQPLG
                     QSPAGTSAEAPSSEAAADAAHVRLPPPSAQWISRQCTAHRHVFAILQPHLLEKWTALL
                     NPYAMADPATTGDGGIAALCERWLRRDEIASRMAFAIRHADAMHHLLSVLLDAVVKVA
                     YVATARSRQQPTASVDPIDSNVYCVEALWYLFVLHDIVMNASNTPEPSATSATSVNKN
                     VSNRQQPQQVLSTAAGMSGATLAGRIGLDEELFASEGSPEALEALYEVFRRQHLAIRA
                     GASTPPSPAAAAGTSSATATAVSPSSALGSTPRPRRRQRHPQRRSPYERCGDALEMIL
                     PTLMEACTAIALAVSMDKERQRSQAAETAPTAAARVRHFKVLPPQQQQQSKAKGKSKA
                     SEHESAMTSSSTTLPVGGGPALSLRLDAGCDAASVAKTPSSTLPLSSPSAEGSGCTSA
                     GGGADTAAPSTSSAPAVMLLHWLKGFLLVWMNAEQPLQLPPSPSPSAGAGMAAGAVLP
                     PGTVWPDCQADAADMPDVSLTYHVDPQNASLLGLDAASQQQRNVYHQPPLLSARACAI
                     LKDRYSFLF"
     gene            <203823..>205115
                     /locus_tag="LDBPK_050620"
                     /db_xref="GeneID:13391302"
     mRNA            <203823..>205115
                     /locus_tag="LDBPK_050620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858201.1"
                     /db_xref="GeneID:13391302"
     CDS             203823..205115
                     /locus_tag="LDBPK_050620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858249.1"
                     /db_xref="GeneID:13391302"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9B8F2"
                     /translation="MLRHRHAGNCKGWSGGVSRHDGRDAQQRYTHDDLAAAFDLIVHI
                     QLATVAAVTVSDIKDEVALRTGLPAAQQCLVYDAVLLQDCLPVCLLPSVADDDGVGDG
                     QDAAMGRSAGHDCWRLVCVPLSSDSSAAAMARQTRRIESPPRAAASPAAAADAMPYDD
                     GGDKAAATLQSLLSISPVRPRTRTSRAAEAAATSPSRRPGAVPFTLSNGTTVAASATI
                     LANTATATASAPTAARAGNTEQVVSEHINRLRRLYLSNAEMSDQSGRGGWGFAVAAVE
                     RAPEHADPSTAAMTGARQPARQQRDLLLSPLRAAPAVGAEHYRTRFGLSSSAAPIPSA
                     CTLPSPCRAELSDALIAALPPPPLRRPVTLPYESITTLSWKSSVPQTQPMQPVQITAS
                     SSVGADASGGNGGGGVDASWMSSLSASFSSAAAAAVMM"
     gene            <206497..>209706
                     /locus_tag="LDBPK_050630"
                     /db_xref="GeneID:13391303"
     mRNA            <206497..>209706
                     /locus_tag="LDBPK_050630"
                     /product="kinesin, putative"
                     /transcript_id="XM_003858202.1"
                     /db_xref="GeneID:13391303"
     CDS             206497..209706
                     /locus_tag="LDBPK_050630"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003858250.1"
                     /db_xref="GeneID:13391303"
                     /db_xref="GOA:E9B8F3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9B8F3"
                     /translation="MNSTVFAYGQTGSGKTYSITGGTESYQDRGLIPRAMAMIYEEVA
                     RRREGGGRHLRRSSSAEAAGDDGHHASDDDASGGGATTYTITMSYLQIYNDKGQDLLN
                     HGRDARTLEELPAVTIHEMEDDIMLKGLEQHSAPTLADALNLLFLGDTNRLYCETPMN
                     KTSSRSHCIFTIYLEARSASSSVVRRSKLNLVDLAGSERVSKTGVSGTILTEAKHINL
                     SLHFLEQVIVALSEKAKGVRDHVPYRNSFLTMVLRDSLGRNCKTVMLATAHVVASQVA
                     ETMSTCQFAQRVALIQQAPQVNVETDPVLLVRRLRAEVAQLKDEVAYLRANGGGSGAA
                     SLAADRTLTADEKNVCRGMVDAYIQKAAVDGDWSSRLTGLNGDMARIYCCYEILRERL
                     VRGGGGVPHDTQQQRQQKQRLEDSEAQVTALRHTLQLKENELQMLLTVLKKAGHADAT
                     SSVGGAGGGASLCAAGMRYNAVAQTPHSDGGAISGSGEAKGVAGVPFIFTISRSSSGS
                     RSANVGDVQNDEQQQAELSLRRNIYRDAQQLVAQLRRSAGAALTQATAAAAPPHAEST
                     VEAALARVTTLAQQGQFTEAEVAVATEFLESKREYQQHVANLHERGEGDKNNGGGSGS
                     GSGAGGGDARTAVDVLMDEQFLQNRAQALEAFKASYEAQHKVEEIKQLLRPTYAACKA
                     TAQQLNACVDAIKQLKTKIQRRRAERAADGSDVVDAEEAAWLAELSSMKERYNVHAAQ
                     LRHDKEEIDGMHAYLKRAQEQLVRDFERWFSARQQQVQLAVQQQELHAQRRHEEEKRA
                     ELTDGLRAALGVSPTNVPLSEKPGPTMCVTPPPSPRGDTGYTASSITSSQCGSSLPFS
                     PLFSAAQRQRPYAHSASDSMIAAPCLPNTSGSGGLSAVLLPSTTQAPVRGEHHSSSVP
                     TLSLTTPSARLAMTVKDGQLHSADVALARLSLSPTVQRDGSSTSPPATSPGLTGPAQN
                     GWTTAKASTTLMMGGGTETTPSPTRPFHLLPLGDTTTTNTTANGTASSVAPAGSAASA
                     NKKPSNPYFPLFPSTGNAAADAQLAELYKAREAMRKQFQ"
     gene            <210603..>216350
                     /locus_tag="LDBPK_050640"
                     /db_xref="GeneID:13391304"
     mRNA            <210603..>216350
                     /locus_tag="LDBPK_050640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858203.1"
                     /db_xref="GeneID:13391304"
     CDS             210603..216350
                     /locus_tag="LDBPK_050640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858251.1"
                     /db_xref="GeneID:13391304"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9B8F4"
                     /translation="MASTLPPEKKRKATKAAAGTASQRKGNAGGGGEHVREDPHHTWN
                     QQLMEACLACDAAAVRKLIERGADPVNAREVPPLSYYTGPIIQQLQLQQQASSEARSH
                     SEPLVIDQLRGDQPPRQQSPLSGSSLPLPAAAAAVPDSLPPLAAMLLSGLNTPAALEV
                     MKVLIQHGASVNDTFSFSVAPLTAARPGTDVSENESGGSTAYGASANDSGGHRKNTCV
                     SSPDPKGKQPSGKRKASVIGTALTAAAGGSALVSAAGTPGGAAVNPPEAPRHEESTIV
                     GSVLHYVVAHGDHAQLLRLLLLAATAVHSAAGAAPVSPSLPLPLQQQLATGEPHAEGS
                     TAFLPHLFPVPLPCTLLPAVEAETIVGVMRWQHQQRLGGTADAAGPNGLPSPTATPRV
                     SQSRKSHIVSNAAATARTYGSAAAAQPATAVLPAQAAGPVSATSLVSPSAAEAVLTAL
                     QQVLRQRQTSTGGYHGLPILMSVYPQQQQKEDKAELGGGAATGSAAAPVVVAAAAPCN
                     WWSLAGLCDAADAVVTDDLYQRTRLNFNLLDTCGRSAPTLALERGDTLSVRLLSFYGA
                     HVAFDGQVNASHTRLARACTHGDVARVEALLRQGDSITQISADGRYTLVHYAAAQPSV
                     LRTLVEHGLSLEFENAFGESALTSLLRHGTARNDPRYVQTLLAIAAAVRSASTDGATN
                     TATANLVNSIGSTISANAVRFAQLSTAVQRNMILCPPTPITTLMNAGGAASGSPAAHL
                     RLISNNVSHGTVAQGTASKSSGGNASRPSARQSFLGGCEVGTWWSFLPPTATTADVLD
                     SLLRAGAVMQGFVPDEELDLPYVLFSERQTSISAWGGGARGFASAADEDDEAEDDDIS
                     DGGVEESGNADGEDDYGYDDDDGSVADAGGYKASRTPLSASVATITPASEQRDRGRRR
                     QKRGDVLPARLPMRLTPLHHAIFDYHPELIRRLLVDYRVDPMHRDSQGATAVHYAALC
                     THAQSVLELLLSPQVLAPNAIGNSKGRLSSNPGPDVITGAASAVAGASSAAAGPSDVR
                     IDLNAIDMAGRTPLFYAAYVGNATAVQRLIRFGGATLLCGKADKDGYTPLHVAVQQRH
                     ADIVELLIRHSNQLMSSAAGVGRGQPVDVLAELLASTSSGGGSAGRSSRGGTRLGAHR
                     RSSSVLAPGSGHHGQGGSHSAGEPSLAGLTGIANPELLVNVEAVESVTHMTALEMAIK
                     AQQQPQQSTSSSASLSEAQELQKERLLRIVSVLLSEAQASPLRPSGLANGGALLHRAV
                     ADGNVEMAELLLSQYTDPNEVDDVNETPLFLALRLAAPASALQASSAEQKQQHRLRRT
                     SLVRVLLQYGATPYAQSSVHLQTPLHLAASSLADDDEIVQLLFYSTPDAGGGYGAVRR
                     RRQEQQRHQQAPSYAADVMDGDAPRDNYPLGGSMGGGSSARGRHSSSSGGSTAGRKNF
                     ERRVRERRAQQQQQQQQRRSSPSPSSTGRSISTFPGPRRKPWRAAAALSESDRGSSAA
                     DFDGPTDDQSLLANSSFGYHEALNRSVASVEQAGADQSLSRTGEELVPDSRAGGDAEE
                     DVLQDEHQQFLKRLAQWQCADHLLEPEKCWMLTDAQGQTPLHVLCSRSSPALQRMPAV
                     LKLLEDLQAATRTNSAIAAVAAGFFDGTRDDDHVLSLCWHLSDAHGRTPLHAAAQSGF
                     VEAMEYILKQAPKSALAVDMQGRTPLHACVLMAASPTAATAVPAHAQGDDEEEVVVVA
                     AERATRLRRMLSLLRSAVAAADSSGAAGTAKPSLPLQLQGTPLRRAAGDVLPSLSMKT
                     IKTMSNAIGSAAAPHSSVQRLVASLVQGSSITAQLQRWQQSRHWGCPALAMKGIGSTS
                     AHMRTACGDGLAAAAAVPASRDLQPSDGVLTSSGAASEWKTYVQLPDGQGRTALLLAA
                     EVGNVGAARELLRTM"
     gene            <217926..>220529
                     /locus_tag="LDBPK_050650"
                     /db_xref="GeneID:13391305"
     mRNA            <217926..>220529
                     /locus_tag="LDBPK_050650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858204.1"
                     /db_xref="GeneID:13391305"
     CDS             217926..220529
                     /locus_tag="LDBPK_050650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858252.1"
                     /db_xref="GeneID:13391305"
                     /db_xref="UniProtKB/TrEMBL:E9B8F5"
                     /translation="MEPRWRGGRLSTEQVADLRTELGRLVAALAVAFQAGRAEEEGQH
                     TQDVAADAHDAKGSAHTSSSAPLSDPLAEEAAALLLKPFEEMHLSGYRLGDAALTSPS
                     MPDLPSFLSVVSRHTRLRVLDLSFNNLTPQVLAPLLQAIRGLPLLAVLKLSGNMLGSA
                     RSDDYNGSRSEKWDLSTVSVDEELGDAATAAARLGRYLATNPALLELALFHCDLNDHD
                     VRELLSGLVHPRNTTLHTLQLSWNPACTSRSAEMALQLVTDLGNTTLCELELEGEAPA
                     TQVRLEYACTPDGVFRSGHTLIPESAAAGAATGDGNDDNSGNAGTVITSAAAADVVSL
                     EQLRQQQQQLAEIQKHLTPAQGARYVNRCRYLAEDLDGSRVLAPLVMRELKAVLSIRL
                     PPRPRVDERHGASELNVAAFAERETASASAAGAGAHSQDGSGELFTSAAAVDCGGSNP
                     HSGRAVPSPAAAANSSAGHQRRSFEGVSAMTDGHVASVAPPPQATDAPRPRTSPPMHL
                     RRRWPTPAVSTGSVASPASGRHAAQQQQHPRTPQELRDARFETPQRLAAVMADAEAFR
                     RRLQPVQLDTHAPPCAEVSRYRSGAHSASVTKTRSLWYADDGFVLRPNGLSKVLVAPV
                     LPGGATAFANVALEDVEDRPLQPCWCTPRQTSPMTGIYAGILHYHCVHEATAQQQKRQ
                     YGTSSSPPPSTAATAVKPADPSASKSRLPLLLPQPSQQPQPQLQPQQLPSTAEMYCGC
                     QGTGHLCLSACVASEGAGAGRRRHRMRSTLHVKAAKAMGKSAGSGCGASASRKSDRTR
                     ERFLDWTATNSDAVNTLLSTVAAAAPPALRLSTVRTACGGLSIALNYSPVTHFSAPHV
                     SCASGMTLAEL"
     gene            <223151..>224122
                     /locus_tag="LDBPK_050660"
                     /db_xref="GeneID:13391306"
     mRNA            <223151..>224122
                     /locus_tag="LDBPK_050660"
                     /product="nitroreductase-like protein"
                     /transcript_id="XM_003858205.1"
                     /db_xref="GeneID:13391306"
     CDS             223151..224122
                     /locus_tag="LDBPK_050660"
                     /codon_start=1
                     /product="nitroreductase-like protein"
                     /protein_id="XP_003858253.1"
                     /db_xref="GeneID:13391306"
                     /db_xref="GOA:E9B8F6"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="UniProtKB/TrEMBL:E9B8F6"
                     /translation="MLRRSRRLLLAAAGARPAAFTPRVREAAGTCGNEERDSNTSSGH
                     GGFLATLRHLVAWNRTNAAAAASSSSASCAETPACVSNNAALDAVEAVVRARWTCRQF
                     DTAKPIDLDTLKRVLAATTRAPTGFNLQGWHAVVVTNTAVREQLFKAALGQPQVLQAP
                     ATVVFVGDTEPERNAPQALEMGLETGYYSPLYGAAYLRNIYYFMHGGPMQSMAAVKSV
                     VSAWYSQAAGTPLISVPVSRAGYAWKQTMIPATTFVNLCAAAGWDTCMMEGIDEDAVK
                     RALGVPAERYTVPVIISVGYATAAEAEKRQVGSSRFATPHTVRWNKF"
     gene            <225279..>232826
                     /locus_tag="LDBPK_050670"
                     /db_xref="GeneID:13391307"
     mRNA            <225279..>232826
                     /locus_tag="LDBPK_050670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858206.1"
                     /db_xref="GeneID:13391307"
     CDS             225279..232826
                     /locus_tag="LDBPK_050670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858254.1"
                     /db_xref="GeneID:13391307"
                     /db_xref="UniProtKB/TrEMBL:E9B8F7"
                     /translation="MEDDAAAETTSIDFSLAPSNGSGDVAGGSPTESPPSDDNEIMRA
                     GRGAVHHPMPAIQVPKPTRPQPPTSPAPFGDEAADGGAPLPVASPASAHVAKPITPFQ
                     AIRPAGLRRKGHLVRPSLKRDASLDFVRAVQQLDSEDFQRSRSRSSDSEGLDDDSDHS
                     GNGASAKRRCRQGAAGDAINEGERTTQAWAQSPSPTAPSRQLLVPPQQPTRASNVTAT
                     TTTLIATTADETINFEAEKNDGADDTMAAPVVAAAPASRTSAVEQAALPLPQEQHQRP
                     GTALTPSTKARATAHESPPPLSSTTTGTAPSKDISGPKPQTPTSPPAQQPRNEQRRSS
                     PSWSRHTSPGYTVSAATAATTTGAADIVGATLPTASPASPGRIALPDAGPQHHTPHLR
                     LLSSSMQNEDDPMYCTVSEMTMANPVTPRGGVSLPLLGLSTGLQQARGASGGSLYLSP
                     ARPSLRPAAASRRVQSSDFSLDESNALLTLNTPREVVKSATAAPKESTYFRDAAFEDG
                     AELASTSTPSQSMLGLHGKPLPSFVQPALVKRTADGRTTAGDGRLSQPAPPRQLQHPS
                     APPAIIAELKRHAEREKEDEKEHTLRPTSTPSPRETRVGGGGAHREHRSASSIFKSFP
                     SKTICGHSRSSVAAKSGVDKHGEGGGEGRDVKTSGRSTSSIQSTRSSSLASGLSRLSS
                     MFKRLVSGAGHGSVDVKTQRPLQPSSSSSQQQRRTRQHEDNAATTTAVAASLQMSTLG
                     NTVKTTDSSTNPRSADTLVGCKQRQPPPAVTPAAASATAVKPGRATPKREITSSWHGD
                     SINFPTDEEEDRGRGDGVAGVAPLIPPAAAAPAVPVEGASGGAEESQGRRKRKDAERP
                     DRRRRRRRLHDAEAQDGASLSASAAGGDDRRSSGSGSAGDVDTSSSSTPLTSASGAEK
                     PRRRCRERGRRSGPRRHRHRREGRKQQKEQANGVSKFLQDRPSSPTPPLKSQSSDRSA
                     SSDGRLDRSSRRLSQRGCRQRCDANDRGLAASVKALASRKASQRHYRRALRGDGESSR
                     TFRRPCEGARHHNATNDNSDRGDPDGSSSRDCHGDAVPPLPPPIASAAILAARRRELR
                     AKSRVTSSVNHFAVSWRTRPTTRHRQELLSHAGRASLARLPKRDAERKSGSAKAAVVA
                     AEAVAASRRASGSQLWAGSRRSAVKSRQSGTAPFPPRLLTPGRLEQYEAALRRDIREL
                     DVIVEERRRRELWAAASPAAAAAAAAVATPSRQPLRGAAQRRAMATPALTAGPLPSRV
                     GITTVATASTPAPKRRSSAGNTRAAHRCHGPIVSARLSHPNDYGSSKANEVESAAVDG
                     RGGRDDSSPAPHTPRTATAPSQSASSSLFRIRTAAGVRGQPQQRPSASASYTSHTSKA
                     DSVLAAVRRPGATDSGNDDAEAAPHHSSSTQLPGDATCFAMMALQRRYEQLLEDLVAQ
                     SAPQPPATSEIDEGGNATDDEVSMKAHWRHNYSARRHQYPHQHLSREQVEGERNRGVA
                     SSSSTRGRRSAPAPTQVDATMEAEVARCAAALRAEYYQPPQRQQNQQQEPSTIMERAS
                     LPHATHEAGADTASVAHVAASYAQALRPSCAACRPQQLNEYMTLGLLSMMHRGADECV
                     DTAAVAASENAANLRQAHARPVTAPTLVQRRIREDLYAAPRRCSRRRMTQAGGKQKAA
                     CSDGNTAAAPPITSVSASCGAVLSSMHAQSADAAAAGRDVGLSPQAGTAPLPPAQLTH
                     FFTPTPVVIDGALLTRLMRRERHARRERVSKEQEARHTLQRLYIVETILVLRAMGKAA
                     ATQEQEAPAAPALPTSQTLGGAATAPVNDRGGKRSGSRSPLAATRSSRDASVEDDGGA
                     TREPVVATVSVSQQPREEASASEEEHAAAAAVVVCGDAAAASAPLPMGDTTARPLAGD
                     ASEMRNEVEVATGERDADDSSSSSASPAVLVTPSPQAAAATEVGGEVKHAKDHGGDVD
                     LAESSSSNRSASSVLSFHVEDSQEGAALQHPGPGADGADKGHYPVVASGSSAAAIPAA
                     AAQLSSDESTSSVTAAVDDLAIPPTASPQAAQARPLSIDRGEPITDSDRHGTLDDIDG
                     AAGTVDYAPDGHAAASPPSAGKHTNAASHRYPPPVPSSCSAASAAPSSPSRNLHVVEV
                     VEAARAAVLVPEGEGAVDASHSTGDAGSTGVEVVARDALQSSVTPVEATASTALASAA
                     AAEAIPESEPPASAEDDPRRALEGPQPWKREQRQQQKMATVTTCTAVPASPRRVRFSL
                     QPEVVSGDDGEVKEFSDASKQTCWEGRETSHAAGGPQTMTPEPFKRAAVDKDGLAIDL
                     LEKLNGLDALLLYSFPTYFTTGTDEDGLPGVVMRPHRHPPSASPSVQPRWWRSPLAST
                     PFVSPRPLQPYRSAPSRHLSDSMSPLAEGRETPPSSAADAAAADASPFDAHASALRGH
                     RTPPRLPPESLASQLRRKYGLPQPVQQRRHDHSAEFTLGLPATATPSVAAAAPTPPSA
                     SVSGSWPSAVPAAERPSLQEGIDTPHLAVRRSVWF"
     gene            <234816..>235856
                     /locus_tag="LDBPK_050680"
                     /db_xref="GeneID:13391612"
     mRNA            <234816..>235856
                     /locus_tag="LDBPK_050680"
                     /product="sre-2/carboxylate carrier-like protein"
                     /transcript_id="XM_003858207.1"
                     /db_xref="GeneID:13391612"
     CDS             234816..235856
                     /locus_tag="LDBPK_050680"
                     /codon_start=1
                     /product="sre-2/carboxylate carrier-like protein"
                     /protein_id="XP_003858255.1"
                     /db_xref="GeneID:13391612"
                     /db_xref="GOA:E9B8F8"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:E9B8F8"
                     /translation="MKQLRPDATLGEVPHFPQDLQPDQSMYKGRFLRFLSMTDPRTLL
                     TSPTRLALSEALLERVDRREEGWATVKVADYLDARQRVQCIVHPESGKPILMPFRFSA
                     FVPMNFINLCGMLAPSQQTPARAMFWQFSNQTYNVGFNYCNGSGKDGLPLHELAISYV
                     VATCTACGTSYQLSKVASALSASTSSAALLLQLMIPYTAVACANIANLGVIRFRDVLR
                     GIAVQDPETGKDLNDGKPSAVAGRLAVAQVALSRVMIPVPLMLLPPVFMNVLFHPTKG
                     VRFFVQRRAQLFLPVNVLTLVSVLCVALPMSIAVFPQKTVVPVSWLEASFQGQTNAAG
                     HAITHVEFNKGL"
     gene            <237189..>245192
                     /locus_tag="LDBPK_050690"
                     /db_xref="GeneID:13391308"
     mRNA            <237189..>245192
                     /locus_tag="LDBPK_050690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858208.1"
                     /db_xref="GeneID:13391308"
     CDS             237189..245192
                     /locus_tag="LDBPK_050690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858256.1"
                     /db_xref="GeneID:13391308"
                     /db_xref="InterPro:IPR010736"
                     /db_xref="UniProtKB/TrEMBL:E9B8F9"
                     /translation="MGTLSSAGAVQLYRCWRRRQQKQQRRVDAHMPRSSRSARTAAVH
                     PSSFSHTTSHLTTGTAKQDRERDVDVDVMQRSFQRLYAAMQDEGRRQGHDTVTTERVA
                     HASHSVPCSPQRRSRSCPTRSQRRHMHTASPQALDGAAAAIRVPPMDFDSDSIIVIDD
                     GDNRHRSGTKSVKAEKKSVKTQESPRPTAGSTAASVKVVSPALTSTDTSAITSSPSKP
                     STSSSRSCSPPRQPRAQRHQCPNCCRRCDSCDCIVLPCPVNAREHRSRGAVADAAHGR
                     CHAHSSPARGRWLSSADCAATNKDGAPAASKTATVDSPRLQWPGQLPATPSRRPSPQQ
                     LSSPEVRCHSTRRARHRRRRQSPAHDKHHCRHDRRVDRSCGAHRREKSTSAGAVAAVS
                     STHGRVDHGKGEAVLRDIATRTCTCYWAEFSGFTMAVNPASHVADCPYQAHDALYAEV
                     MLESKADDGGSGSASTSSHGRCSSSAFLRGRCNTRGKQSSSRHYRQEYDAGAAQLRQA
                     LDDPEARRTRGRAAVMGSTKRRTYIEIIMDAARDAPPSQPPRSGSRRSNAKATATSLA
                     AKHDAEVTAAAAPRPPTPTAQASLPSGEAPTKVEDEPQQQLPSNRSSSENDAAAAASD
                     EDKDGAPAAEDQHDEAGRSSRGKKQPLPNDESPLRALSRPRRRPAVGVPGPGSYHVDL
                     AYAASSAAHGIRGAAIPKSARMPAVKSVTPGPGAYDVYKREERKAVAAGGAAAATTDG
                     DATDGKDADTTPTAGKQVIGKGVVFASTSARQLQLRYGDAYVHTSTWAKRAAAVPGPG
                     AYNIVDGDRYDQSRPLGAARTGHQFSKSADGAHFSVVVAAAAAAAAATPLRASLVVPW
                     RDWAGGAYIGTTTSDFVAHPSLAGGNRRTIGQTVAADSYTVCCSNTSAAVAAAAAATD
                     GSLWRGVGSGVALRLTSQRFPMKTAGAPAAAVAGGHDSKTGRTGNAEGAAPPPGEPSP
                     AAYDVERGLRWVQRRAPELSMTFRHDRGPRGPLLSAAAAADDDTLASAVGSSAPRMAL
                     PPLSPLLSDDVSFSPGPGTYDVRGVDVWRMRRSPQWSFGTAARHAPSAAVSVSAVAEG
                     TNDLNGRALHAVDHPGPGAYDTEAGYRALQRSAASALICTAPRLTVDGSHRAGVQISA
                     ATAGDTVDGARAGPGTYDVESGYKVVRESIKGGVIPRAGADARAKVEGEEVQDGGPGP
                     GAYTLPALPPSGPTAYLGMSAPRFPNEQALAATEGNSGGQGAAAAAAANGRPHHPSTA
                     LFLAHLATPGPGDYDVDAATSLVNRPGAIIGRAPRVSLLVPTGATSANVGPGSYMLPA
                     LPAGRGAVMSTARAVATAETGEAAERPGPGLYDPVDMRASSTRTFSLARTGARFPCSD
                     ARVTDAPGPCAYDLPAVPMTRGVVFDTAPRFSRSSGGQSTDGVGPGAYEVVDLSPPVR
                     SAVMGSAVARPDLERKDGNGGGPGAYSPQYAQVEKNAPRVVLARAPAGRGAADYYASG
                     DASMPSHEQRAGAGSELGPGQYDPQYPSDVVQAGRGYTFGSAPRAAAVAGAVDGPGPG
                     AYEVRMTRDGRLVDGGDGSGAAGFGTAPRLAEAGASATMPAGPGPGAYMPEAYTDMSA
                     GFGCGALSPAVRIGSAPRIVGDDARAAADVPGPGAYEPNPCVLYPTVPSISFPRADSA
                     HALGDTDTPGPGAYVTTGFAAARAAQFGCAPRFSEGSVGGLAAYARNGAEGAASVPGP
                     NAYSPNDAAIRPARSAHRFGTAARLANTVGEAAEADGVGPGAYDVEAGLAHSSQGPAA
                     AAYSFPRAGGSGDYIGNPSVGGTAAGGVAESPGPGAYSVEAAYRATLPRVATAILSGG
                     EASGVNGVRGNDKGEASSPGPGAYHLPPFFPEGPQWGFGTSMRSAAADATDGSSALAT
                     ASPGPGEYAVPAPAPLHSGSSFPKAETASPTGDATLPGPGTYNVVDAAVRPSAPGVRF
                     GTAARYACADVSVGDVDTAAVGVHDGGVPWTPGPGAYSPNVNASSTSRSTRAGPTFSQ
                     APRMALSASADAVEWGAGAQGDNIGPGTYDLHGDMAASTAAAHRFGTAPRMPPATAPG
                     AATKGDVGPGSYMIEAADAQVLPRAPTHTMAPPAPHAPRPQEPRPGPGSYEYPVAVQE
                     HRRSALVLGRHGDSMDITRDTPGPGAYDTDTAYTSTQVARQPGGFTMQGRPAASMPVG
                     LAGGPGPGSYSAGASAASAAAAHRFGTAPRMLSAANGNAGVGPGAYDLPAPPAIRQPV
                     SFTQAPREMVVGSHEGNTDDLHSGDMRGGLVGGGTPGPGSYDVGSAIDCTHMGGRGPS
                     FTIPRGPRPVLRSGDVDASPLVGPGTYSPVDPTSHHHGGGGGSSTNGPSAAFGLAERA
                     VNNIQSGSDAPGPGTYDPHRPSLASGAGIGPSFGSAVRMDDVGGAALAATPGPGTYAV
                     APSFKATSATGSAPAQRFGTAKRPSAVLNENPGPGSYAVAGYDAATCGAATAPSFGHA
                     EPRPHLACCGLDTPGPGAYYRASNLDGTSTAAGPSFGFGERMRAVAGTATPGPGTYYR
                     DSAASVAAGVVEGRGASFGFGERTSPVLNNYPGPGTYFRGAGLAADVAALRGPLFGTG
                     ERHDPKLNSNPGPGTYFRDTLPAAASAAQPRPRRPTAADTLRKLASVGYPTLASKTKP
                     ATTTTATDSRSTG"
     gene            <247802..>252979
                     /locus_tag="LDBPK_050700"
                     /db_xref="GeneID:13391309"
     mRNA            <247802..>252979
                     /locus_tag="LDBPK_050700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858209.1"
                     /db_xref="GeneID:13391309"
     CDS             247802..252979
                     /locus_tag="LDBPK_050700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858257.1"
                     /db_xref="GeneID:13391309"
                     /db_xref="UniProtKB/TrEMBL:E9B8G0"
                     /translation="MALPPGAHLVKGPYPSGGGRGAARLMGPPAAAVPPGFRGKGPPA
                     QMLTMAGNQKVLVPPPSSLLAAGGGHSFATSPPLSRSTSPGTMTAPPGSPGRGPIGPL
                     HSFPQFAFVNGKKIMMPPGMKLLMGGPGPSRAPGATAAAAPPQAVVHSKMMMPPGQGW
                     ETSRRPSPTTSPPPGAMGRGAAAAAATGGGGSPSPLRVSLGQSPVRSPMQATALPSPS
                     PLQPQPTRVATAGATGKSHRFNLVRSLTNALSSLKSGSASDRERENERLRREAAALQQ
                     RPQRVQTPPELDVREKGVGGGPTGPHSSSTWMPRSRSLPHPASRSPPQKQQPMPPPQL
                     MVNAKMMVGQPPASLRGKSPTPVSLSKAGNASGGGGAAAAAPAPASSPMRMPPVQFMA
                     IKGRPGGGGVVVGAKSAIMGPPPPGAGRSMAAASPPAVRLVPSPQQQLQHPSPAGPRL
                     MKRIVGPPPPHERLIPTPSPQQPQQQSYSGSTSPPTASLPSPSLSVAPPPAAAAAANA
                     LRVPSSTVLKEDQLPEAGVRSPGHRLRPLGESSEDSDSNSGDGGGGAHAGAQVAAASH
                     SPEPGRLRDASLVKDTDSAVGSGTAQKSAAEEEDAALHKDKMQPPRPSSSSPPRHAAA
                     RETRDHSHHRGDGDGDCNDGTYHSTGAMTSKSVSASAGAGAAATSQSSSSAHRDGNNK
                     ASASSILRPVRQTATTAARSAAAAAKRRQEEEERRRHEAAGKDALASKKLRSSRSKSA
                     PRAEHASPPQPAAAAGVAREPLSPQEEDNTQKPSSMERSIHSIASTASCRAPLSPSDS
                     STSTLGDKKSPRTSARGRGRAGGGGGFAAPPGSASTRSGKRPGKAAHFDPSDTQKNGQ
                     WQRQPRSIRSKPRSRSTNARRSTSRGRSGNDDGDSSDADDEEDAESGSEKLTSRDLYR
                     LAKLLRDGNADLVGAGMGSRQRSGRRRRSSHRDDNRSGRGSGADSSDDGSWGRQRRQH
                     STAKRRSALPLTTVGIPWRYAGTRRSWEPFASPPRVRRPLGYINVGGGRYARVGGSPY
                     TRSQSRSRATSVGTVPLDTTNTRALVSDAAAYGSYSPLSGERNRWTSALLDAFRNTAV
                     AEAQRSVLPDSQPASSARSGGTDGGAAALYYGSQQRQRFGARGSPPHPHTRDGCSAPG
                     GGLDDTMSSAAESQHPYCLSTSALQSAMPSTAPLGRGTAPAYEQNEQERGRSSPLSGS
                     LRWAAAQPYSLPSQPPPPTSAAAMTESVGLLFLGKDKVDPAVEPNTHGTVAAAVKDAA
                     APVRVASWRRSSFSDQPHGLLPATSSSVDATRAAAAATRSRSVTSNRRSSISGADTAS
                     VSAAAPAPSWERAWSRGLGNHLRAHSPSTQKRWQQEQRRAQRSESCNAANNLRTCNSA
                     AAAAATAYAGRHTSDANPNACGSPARKEEPAYLSKATVARLSTLRQRRGSLGASAATA
                     ISPISRRSHGGVDGISSVTAQTCSKWLDEIIDSTTVTATGVRAGGGAGGGGEHAAAAA
                     NAIPVVDLRREFKPRIADGGTDGRGGPSSVRAASPSLHDGGTTDYTQEFTGSRARPHV
                     PGISFKYMVGARSATGSPPRTGGKASATGGGAVNVKTVNGISDGLPFSAYSSIRIHDP
                     ARKSPWALAPEREGLKVLPGQPALSRRRRIPADGTAAAENGAADSGLGVRDADDARHR
                     ARGATRTVVEEVHLDEHRRPYLILRPVPSSEEGEAQRAAVERLSRPKPIYRRANDHV"
     gene            <256259..>260446
                     /locus_tag="LDBPK_050710"
                     /db_xref="GeneID:13391310"
     mRNA            <256259..>260446
                     /locus_tag="LDBPK_050710"
                     /product="CYC2-like cyclin, putative"
                     /transcript_id="XM_003858210.1"
                     /db_xref="GeneID:13391310"
     CDS             256259..260446
                     /locus_tag="LDBPK_050710"
                     /codon_start=1
                     /product="CYC2-like cyclin, putative"
                     /protein_id="XP_003858258.1"
                     /db_xref="GeneID:13391310"
                     /db_xref="GOA:E9B8G1"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:E9B8G1"
                     /translation="MDCVEACPPHHTRSSQLAHRPPASAAGGSNGISGIVGSSGSSNV
                     RRACAAVSTARSTDRIHSAFPTYAESPQQPPQPSTTTATSAPATTATRASPFTQEKHH
                     QGCPDASAAITVSPEQQQSQHVKRLSPSTCSGSASNLTILLHSNTNASVTSAATDSSE
                     QSTPLSGVSSHQQQVQRARAQRVVDEANHLYSNPCSSLQPSLDSCSSSRARDNEDDEV
                     AADDAVSAAFVDGAAVAGNDDDQQQQHRRHSDDLSQQHRVRCSAPSSKRPRQPLRDPS
                     SPPLPPQQPQPQADLEDEEERTHPHHRCGAAMRIPDPSTFVDPSSSSRHRPTTTTTTA
                     STNKDGTDPGGPSSGRNSRTMSQLHQRRGDSGNPNGDGNRARTLDDAEYEEDQEVWRA
                     LHPPPHLRRHGGERDEDNHDPQAATAAMIIAPGGGAAVTSMSSACLSAPDATPVVPPP
                     KRFATGEGEAVALDELRYVSSSTTTTAAAASAILEEDEDDEGERASPSHVATTDANRE
                     KGASSASRRASQQQQQPQQRDSRTRRARVAGASRGNCVSSSSTGVLASRRHASDSVTA
                     GIPYDPSCFPLPSQPPKLAAPVTAAVAAAAHRTAAEPASDGPRRSTSQPSCATPPDAQ
                     QQQQGPQAAGADGGATLAPTRPPIKLIETRYAFLALSFMMRMLCKLHKGEPIPSSDFH
                     SHCIPPMTVTMYVQRLVRYCACSGEALLCSFLLLLKYVFHSGHPVTIYNAHRLLITSI
                     VLGIKLRDDVYYSNVYYGRIGGISGREMNKLELLFLEKLEWETQVHVDEYMALLDLLA
                     ELGIDAEPTSAQLEAFAAAYPDEVAAYVSDEEDSEIAEANAKLQQQGPDSAAGSSMKD
                     AAASVTALPAAEQQRLKVLRGAYRLHQWHTLVVPWLARLERCVFAKAEENAVAAAAAR
                     KEEGLRWQQYHREDEKAAALRHQRPSSASTWLSPLSAQKRATSSATTAAAAAATAGAA
                     WASEPPYQASRSHRDGSNVPHRSSSGAIMMGGGGAHSTAISSSGGSSGFDSVRYNNFM
                     NFANNANGGYFGTLSASASASAAAAAPTAVSQGSRLDRSASPPSSGQCPSQQKHAVSG
                     PAPFSYYYQGNDVARASIQVRHLAAASSSAHFDITNRVAASVAAVSTSADAGAESHQH
                     TASTQQQQLPSVAGTTVQLTSPSSSTTHGSGINVNAQPYYYVSSRMRKQQQQAAAASP
                     ASVGPSVTRPGSDLAVAGMTSTRTPATAVGTDDTVAAAQRASLSTLEGGSDARSPGSS
                     FTSPACINSLARFSTYARTTTGRVAGHPSQPSGFRSGIETVVSAMKMSGIYGGGGNNS
                     SSTSGSSAHPHTFPARPIARSGADGGSGGEQATSAHVPRRSPHADHQAPVHRRSAFAS
                     QHSLGKKRSKPDSYKDY"
     gap             260877..260975
                     /estimated_length=99
     gene            <262729..>266835
                     /locus_tag="LDBPK_050720"
                     /db_xref="GeneID:13391311"
     mRNA            <262729..>266835
                     /locus_tag="LDBPK_050720"
                     /product="phophatase-like protein"
                     /transcript_id="XM_003858211.1"
                     /db_xref="GeneID:13391311"
     CDS             262729..266835
                     /locus_tag="LDBPK_050720"
                     /codon_start=1
                     /product="phophatase-like protein"
                     /protein_id="XP_003858259.1"
                     /db_xref="GeneID:13391311"
                     /db_xref="GOA:E9B8G2"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9B8G2"
                     /translation="MPARPQQQQQQQRQRRRRPHRPPSKQLLQIREEGGGSYADSKTN
                     SPFLRGTPSWSSRTSPSATAAIDGHAGGAGGTGSVDRGSGVEMTSAGDGDDGDNNEGK
                     RIAVNLSRARHPPQHSRQSRPYLRMSPRVTSARKAKSGDRRRASSSGSGLERAAAAAA
                     LSSAASLARSLQAPVTSSSAVLGGHVIYYGFPSSRSLSDSDGNEADTQNSKSDCSSSC
                     LAAAHAAPGSEPASPVVRVGDCGGGDGGTVSGIPGSASDDARRTTASRKPETAVSGDG
                     ESDSRAYASSSPPGTTATASTAPLTYAAVASSSLHGKRLPQSRVSFSQWRKRVCCGSA
                     SMPNTIDGANTTPGTSSAAAAAFLNTFPSAPLTLKTALAATTASTPRATGKSTPTSTP
                     SVDGNGDGKASMPSGDKHDCTTGGPRHLSASAVMPPLPPSVHRHQPTHLILQLPHAPL
                     PQQARNGPESDEDMASDSSPRTAGTPGIAAAADELSSPVSLPPKSNGTATAVAAALPS
                     LPRSASEVTSATGVRMPGVQKGAQQQRQQLNVLKPVMSPSYTTFSPTTPTRGGAKSGP
                     RPKVSATAAAAAGKGMNRVPSAASSFNAAEILPGLFLGAYVDATDTEALAAHDISLVI
                     NCSYECPVTPAMVNNNHHVRYAQCPLRDHSDEVIAPFFTPVTRIIHEQLHRRQINHQR
                     MARRAATSAPGVNVNDSEDREVQGRMPWAWADEAENVWVAPPSLVSPPLPVGGQPSFK
                     ESKRETPRTPSSTRGLGARFGDGAGCSSTITSCSPSPIPGGNATFPPFAAAPITADPA
                     GATATEAPGAAAAAPGSADVSSDTQNGSNVRTNTLFNTATTTPLPEASAITALPASAS
                     SPSPLTVVDPRDCGGVLVCCRMGVSRSATFIIAYLILYGCTLAPLDDTASLFVHFLER
                     ERRIIEEAGGLTFFEDNNGGVSNTSSPVLATAPACPGRGSRCVNGALASHGSPGVNGV
                     QPFVQNLLPPNSPRTLRRSAMIPVSSPLSLGGGCVSGSLTTPLSGNASTLSQQRLFTG
                     SPATQIELASRLCQPCYLLHLQERRLQQKTQRRLLISGQQQQQRREQRDEEQQMMALS
                     ASRMAVREVGQGCGRMGSVEDNSNFGGSSSATASGRSDGGHQEEQQHHYHRRVLCALP
                     SSAPVTSYRSARGSRAVTLLEAAYADERVHADDGVDEEGDRQQEDGSRMAVEQRSESL
                     AVVSATTTPTLKSDTQKVRNNFPTHKLCVAAAEAAPTTPDHSAVAGERRGDGENVYET
                     PLPSGEQQQQQVPLRSSCAILPTQPPMRGRPHSDLNASASTLLGVSFTSSGGGSGSAF
                     GGAAPAMTYREAFDAVKRQKADVNPNIGFVLALRELAGGGDVSFSMSF"
     gene            <268919..>270748
                     /locus_tag="LDBPK_050730"
                     /db_xref="GeneID:13391312"
     mRNA            <268919..>270748
                     /locus_tag="LDBPK_050730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858212.1"
                     /db_xref="GeneID:13391312"
     CDS             268919..270748
                     /locus_tag="LDBPK_050730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858260.1"
                     /db_xref="GeneID:13391312"
                     /db_xref="UniProtKB/TrEMBL:E9B8G3"
                     /translation="MTSRSVSELSRGSRPRGAEDDLHEASTATTESRQHQQPKPVLQY
                     RPLSSSRSRTSSVLPAMNEREAAAVQPVYTTSADSTPPPSQAVAGSWKPQPRPRAQPR
                     DRMGVALTPWPIMDDRQQPSGTAAGPVDRTRSDPTPPSARLRAEENHDELPAPQYSSY
                     KRTGRPLLPSPERRAAAEELAELAAAEEEAKASSAYQQSFGGCSHSRESERNCVSAGH
                     RWPSPSSSLTSASHQLPPPPPLQGEQHGQSYWSEEQDIPYRRGSSAAGEHRSSNTGAG
                     SHVGSGRSGLSEEGPYAGIAPAAASGHRAAAAVTSHHSHPAPSHQQSSAGGRALSRTS
                     STLRGSPSDAAVAALESLSYASSCAPHRPGQPRGGAAGAAAMYAGHPVEASQAGSLGL
                     VYTPSVTPQRDSDNGAAVTAPQQLSERRRLRTYSQRPIAPKTNDSSQVESTVYHRRTL
                     SPSAGRKPLRADSPETLRFMEREDAFLEKQRQKLLGEEHRDPLQPQNNAGATLYITAN
                     PGGQPVANGGKAGKEAAPEMTAVEEQLIAEHTILRTQLEKMQMEMSIAVARHRERGNE
                     QRYTQLNTRMKRVMKDLDRVEWELRVVRNIDRQSRSQSPASGI"
     gene            <272644..>273738
                     /locus_tag="LDBPK_050740"
                     /db_xref="GeneID:13391313"
     mRNA            <272644..>273738
                     /locus_tag="LDBPK_050740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858213.1"
                     /db_xref="GeneID:13391313"
     CDS             272644..273738
                     /locus_tag="LDBPK_050740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858261.1"
                     /db_xref="GeneID:13391313"
                     /db_xref="InterPro:IPR023175"
                     /db_xref="UniProtKB/TrEMBL:E9B8G4"
                     /translation="MMSSASLLEKVPQPWAALVRPFLQRSHEFEDKEPLVAYYLRTHV
                     AFLCMRQRSKEDKEGTAFLMTLLDALEASKARLGTQLQGVDGRTVLTKFALMLFARAD
                     DAERTGNASMAIVRLFYTASVLFEATAQFTDDGAMDSVAAQKSKYAKYIATRMKKALD
                     KNEPYVSPNKLEAADDDAAGGVGSVNGAAQTNTFTTAPASCFMQPASQPTSVSNRAPA
                     PSTAHENLPAPPYTPPPATQKLDTPPPPYTQDADTQGRSKTPVQPSLMNNMYAPPQPQ
                     HPSQQQQRLSTSSAVPSLPPQSSSAQQRYAASPSASGGVGATGFKPSVDQMIDAQKLA
                     SQAVSALQFYDYENAKQQLVASLRVLNGVQ"
     gene            <274943..>277414
                     /locus_tag="LDBPK_050750"
                     /db_xref="GeneID:13391314"
     mRNA            <274943..>277414
                     /locus_tag="LDBPK_050750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858214.1"
                     /db_xref="GeneID:13391314"
     CDS             274943..277414
                     /locus_tag="LDBPK_050750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858262.1"
                     /db_xref="GeneID:13391314"
                     /db_xref="GOA:E9B8G5"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013917"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:E9B8G5"
                     /translation="MITFLLQLFASLGLPLVAFLLYSHLADSVHTRGNVAGGDAGAVD
                     DAIIFSQRVRAELEQLDVASAPPSAAPAQSPPPARMTPSPAVAVPPAPVAAEILIAYA
                     TQSKNSLALAHKLFSLITAQLQTAPPAAAEDVICPLVRVMEMREEVGIKNVCRVDTLL
                     EQNQYALIIFIASTYTDGVAPPRSQAFEAMLKDAFEDHRIPRNTLGRKRFAVFGLGDI
                     AYGEERFNAFAKNLHEWCRGLGAPPFVVPPVYATEAKTQSLFRIFSTALLKWVSRATF
                     HTDGTVTVKKKSEMVATSPAAASATEARSCKGGSATLATANTSIISAAAGGTCGKEGG
                     PCACQQSSQQLCGSRAGGDGDDGCACRKADTIADGVAVSKSDDDDDDSNAENDGMDDV
                     EDLVWDGTDDVDFDLSKDPSELPELLYPKLRQNLEKQGYRLVGSHSGVKLCRWTKSML
                     RGRGGCYKHTFYNINSSQCMEMTPSLACANKCVFCWRHHTNPISRHFRWKQDPPELLI
                     AQGMAGHYQMIKQMRGVPGVTPERLAMAMQIRHCALSLVGEPIMYPQINGFCELLHQH
                     RISSFMVTNAQFPEQLRNLKPVVQLYLSIDAPTPEELKRIDRPLFEDYWDRCLSCVKE
                     LARKQQRTVFRLTLVNQYNTENVKAYADLVEMGQPDFIEVKGVTYCGTSSNSTLNMKD
                     NVPRHDEVVGFCKALCAEMASRHPHYRTPQMDKEEEGGGDVIVIPAEERNRPYHVACE
                     HEHSCCVLIALDKFFFDGHWHTWIDYERFYDLVESGRTDFTSLDYAAVTPTWATYNSK
                     EKGFDPEQTRVVRKNARPTTVTASC"
     gene            <278484..>283013
                     /locus_tag="LDBPK_050760"
                     /db_xref="GeneID:13391315"
     mRNA            <278484..>283013
                     /locus_tag="LDBPK_050760"
                     /product="kinesin-like protein"
                     /transcript_id="XM_003858215.1"
                     /db_xref="GeneID:13391315"
     CDS             278484..283013
                     /locus_tag="LDBPK_050760"
                     /codon_start=1
                     /product="kinesin-like protein"
                     /protein_id="XP_003858263.1"
                     /db_xref="GeneID:13391315"
                     /db_xref="GOA:E9B8G6"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9B8G6"
                     /translation="MYSGCTAARQTHLLSPTLPQSSRNGSVATDPPSTVFVSPRTSSM
                     HRSPLASFEEAQEGDGERAPHNSRYASSTNGPRSSTFIHSVSAYLSTATGKRGASSAA
                     TTVRASLANGSSITGNSASKPRQSRHQPSLIIASGCSRGAVHTRPAACSKWISGPPAT
                     AAAAAAAAAAPRKQPNRKKSVASPTVASKRLATYTATATTTRCGTLAPGVHEDSYTKL
                     ESPKGRMPESDLNDANEGVDWACVNVGLGDLVLESMQLARASAAAPQADSVASTSAGN
                     AGQDKNAGGDSGSMALPPQGRTSPAPEDGIATEPAVMVADDDVANADMNILVAVRVRP
                     RTSLITAKGAPSTSPLTDTAARRLFPASSASSHSAEQQPPCELRSSGGDWDDALSTQA
                     STAGGGSLVEERQRTTNSTPSHSATVRVRRSASRRAILKAEKNDTGNSDSKGSASKEV
                     CVSADARNGFIDCAVAVAANASGGASTPAANGAAAGQRIRTLRFRFDCILDDSVTQAD
                     IMACIGQRAVARVLRGYHSTVMCYGQTGSGKTYTIAGPHGGKLSRKALRWLASQPASA
                     GAVECDDSNVDEEEQVRVASDVGLLPRILIQLFRGLEARHGADGRLQQASAAPTSSWQ
                     VTLSALELYNNNMRDLLPGELPKNEAATLGKKDVSRPSAATRLRHHGNSSSMSGRRDH
                     RKATASAVTGGRGQLSASPSPCAVPKHTRVSQRVSSRCGNSATTRAPPTAAASTPRAN
                     SHAGASTAMGSAKTMPMKWTAPTTTKAAPQLQIRLGAPASSASQSSPPTKLKKARAVS
                     PPPSSWASLRQPAHNAGSEAVYIEGLREHQVHDIHAALEAVWLALRQRQAGSTELNKS
                     SSRSHVFFFVRVEQYERRSRDGEKPAWATRRSTLSLVDLAGSERVSHTGAHGLQLKEA
                     QNINRSLSVLGNVMRLLSSASRSSLSKNLATTSASSAAALTGARADQHIPYRDSKLTH
                     ILQSSLGGNAITFLLCNVSPDSRDAQETMSTLRFAKLCKSVKSNARLNETTADTEDAQ
                     AAAEAKICQLAVDASTAQNRLQQLATYTWWLEGHLGYFAAAMIHQQQQQQLRRRLSGT
                     LTTSASIRAVTSSSRARDSSGGRGLVVPEETTAPKVISGERSAGAGNGGMQRCDSLES
                     SGVENKEVADSGAVPEGCRRSPAPAGPTSPEWWHLSPRPSSPTAPADDDKDDGGGGAA
                     EAEAYWRSASARALLSPAYPIAQRRMELQRKLIAAAAAAITIEDAAMLSMLYSTDAAV
                     GEAEATARDRVIDGTNPLEVSSTASTASTRTRDGGSGVLVSKPTAIPVSMGVSSASEE
                     TRAPTRHPRSSPPEHAPALQPSPSMAAFSSVPLPSLTANQKQPRLECPMNAIDTTLAE
                     ERAARAATQARLVEVEQSNLLLRLRLAELHGRMRLEGGSTHFAEVHQVMNAEKATRRT
                     VGKDYSWAPSSLATAPAPLPSPAEASASRVLWPPHYSRASHDASLKVFLARCGFAAMD
                     SMAPADAAMLPRRLA"
     gene            <284819..>288961
                     /locus_tag="LDBPK_050770"
                     /db_xref="GeneID:13391316"
     mRNA            <284819..>288961
                     /locus_tag="LDBPK_050770"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858216.1"
                     /db_xref="GeneID:13391316"
     CDS             284819..288961
                     /locus_tag="LDBPK_050770"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858264.1"
                     /db_xref="GeneID:13391316"
                     /db_xref="UniProtKB/TrEMBL:E9B8G7"
                     /translation="MQSAAAAAAPFTITVGAALLPMNDSRAGVVLAASPQGHYQRQTR
                     PAATSPSPPMSTCRRLSYDSSKTGSNSRSRTRASLSSVASPHSFSHTLSEEHQQHHFW
                     QRCVTVTEVATVTASRRSAVAAARSGVVVVANACAKRDDSSLVAEARSPSIRIGPAVL
                     PSSLETTASSSVVDAHAQVTSKPGGAAGAGEQQSHKAAAAAVTAAVAAATSVGACKAN
                     SGNEGVSPFSRVHIHNTRSSKTTTAGGGSASPPSITVVQAAAAAVVTKHGTPVRANGP
                     SSPSMSSPLSAAVSPRAAAPRPLSTRRHSAGTTTPGISSLPVAQPQPQRAAPPPQPRR
                     SRSASSGLRGAGTNSSSVHFQPAPTLRNVGIGGPSPFAAEQLAMPRRPQPRLAVAPTG
                     DGASVAGCAQSGQTNAKVAAPPLQLVRPADLYRGATTATGTATAGVGGPASTAMAASL
                     LPGAAAAQDRLQLPRRSRLARTPSATSVQQRRRTPSAGSFGGGGSARKAGSVASSSPL
                     KRRTSVSSHSDDAVGPVGGSAARVASRRPRSSTPSGTLSVYTTRGASGGRSPLGHSEP
                     SRNGGGAPALVVAGSGTDTGTAAPRRSVVRSGSAPVHQRRRESSSSRTSSAVPGSVTD
                     QAPRVADRLRVPAVAPSSLVRYSSVASVHQRRSHATITTIPVSNAAAAASTSVAEWTS
                     SMSTSSAPRRSHSRDGTSGTARSSAAGKSVRSSLHTAAASAAAKTPNMGTAPTARRPN
                     VGATRPIISSTAGAGGPRARPVVSTTAGAATPAATSRAAGPRHLADRKPRDGGSSNTV
                     SVSQASMISMEESKAFLQDFQRMNDRELALFGTLLATVASEQQNRRGLGITGDATPSA
                     DKANATRLVGNAADDREAGIAPPTGVVASAEDVTVWTCKRVISLPSDQQQQQQPGQTS
                     DMPPPTTPGEPAVTAQPALHANEELIVLVRRSRSHSAGLHAPPRSSTSGPEAPPSPKQ
                     QQRQKPAKPLLQPDQLTQRADGTEEKGGGHVAASLHAFVRSPLRHPYSQQQARCTVTD
                     AAAGGRGSSGAVVLHRASRSPSPTPPSAAIARGEKENGQQARSLHSASSSPVPASPLS
                     TAAGARVLQQQQQVGALASARADRSSSGKLRPREATDVNTSANRTAAGAARKVAVETI
                     ATPARKPHKAPPSSSGAAAAATAGAVGRRAVRNRSSSSAVGRVRGGSRRRCGANDGVH
                     TPSSLQEHQRQLSVESYTDIMRCYSPKRLEGLHDGNGGSGCDATLKEERMSIDEGPRA
                     AGASASSLSSAVSEAAAPLAALKRAKELAAELAAAARARTVSADKPSVAMIPTSFTSP
                     ATFSSVDSPTSGSVSMGRASGGYATGAASEISSVRVTAAQLQLLIDSSRSQANYARYQ
                     PL"
     gene            <290245..>290688
                     /locus_tag="LDBPK_050780"
                     /db_xref="GeneID:13391317"
     mRNA            <290245..>290688
                     /locus_tag="LDBPK_050780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858217.1"
                     /db_xref="GeneID:13391317"
     CDS             290245..290688
                     /locus_tag="LDBPK_050780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858265.1"
                     /db_xref="GeneID:13391317"
                     /db_xref="UniProtKB/TrEMBL:E9B8G8"
                     /translation="MLASALRHSAAEGHSSAASAVAKISNIERAGAYLRFSTLRVHPH
                     HEPNYRARPVGWKAWNSKQYMDPWAPYPLTSPVRHVDRPFSGMWFGMGHFALKNFFGP
                     LNWKFWARVSFFGTLGWVYSLSSYALRMHRNGWEWKNRGAVFSMD"
     gene            <292862..>294025
                     /locus_tag="LDBPK_050790"
                     /db_xref="GeneID:13391318"
     mRNA            <292862..>294025
                     /locus_tag="LDBPK_050790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858218.1"
                     /db_xref="GeneID:13391318"
     CDS             292862..294025
                     /locus_tag="LDBPK_050790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858266.1"
                     /db_xref="GeneID:13391318"
                     /db_xref="GOA:E9B8G9"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:E9B8G9"
                     /translation="MLRRALPCCAAAPLRYAASTLCFPRSRRGVGPAFSSSNRLSHMT
                     RAYATTTPPPAGNHDGAADEDAHMTDDGDVDAAAADRHHAPTLRSALPPSAAELPEES
                     FLKCIDKEIFDEKVRLDKEDGPPPVPTGWTMHHTEGTSFIYGRRLWMPPPPSSSSSSP
                     STWSGEAEARRGDAGDSSTQESRGKQQQRQEREVKPTPWAMERHFLRIQLTSRDASLD
                     PECDVRGEHFPFSFFVQRVFPEEGEEGNGAGVTGRSSGEQGAAANSQDALHGDSFEEH
                     TFYHNSIEARCDVVDGELIVDGLVYHGPPPPTSHPPSSSGTPQPRYTNPFGGYPGPNL
                     DEVEEEVLDGIQSWLAERGVDDQLGEFVGQYSIWVEQAEYERWLQQLRDYVAA"
     gene            <294438..>295955
                     /locus_tag="LDBPK_050800"
                     /db_xref="GeneID:13391613"
     mRNA            <294438..>295955
                     /locus_tag="LDBPK_050800"
                     /product="MYND zinc finger (ZnF) domain-like protein"
                     /transcript_id="XM_003858219.1"
                     /db_xref="GeneID:13391613"
     CDS             294438..295955
                     /locus_tag="LDBPK_050800"
                     /codon_start=1
                     /product="MYND zinc finger (ZnF) domain-like protein"
                     /protein_id="XP_003858267.1"
                     /db_xref="GeneID:13391613"
                     /db_xref="GOA:E9B8H0"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:E9B8H0"
                     /translation="MCPLQTQANLTAICASSLSTPPLLTLHISSVRGNRTHTRIPRFR
                     HRPYHCPPHSSSRSPATPPMPPHAAALPPPPRPDPVTLDQVFAQLTAVDVAYDAKAYH
                     LVALNTVAFHPSVKLFLFEEPAAAAASSSSTESPDARSTSSSPPAAAVLNKLRREKLL
                     KNVAFMLAQRNNAVCHECRWETVSLLGELCRMESAHSGVPTSALGQLEAKLNNYAKEN
                     LEYLAQLPWFLPVIDSIIKAGGGTLDDDANGDASVAAAAAKKARQQGESSASAAASSS
                     RSALKEKLMAREAGRNSRGGADSDNGNGPEAEEEDEDVVIALLDIRRALPTCHRVSGS
                     GRSTDSADVVFEWSAANVEQARDLMFVDASTSMLHLIPSVARGCSDVCAQCQKRVPAA
                     STSAAAPLLRCSSCKAVYYCSAECQKTHWTTVHRTPCRAYKERCDKILEQYYSTSTAS
                     GKKKGLKTSEVVILEVPLEPSLFFETRRYLYDHRDESFAHVDYSDYFMKYTVRGS"
     gene            <296758..>297249
                     /locus_tag="LDBPK_050810"
                     /db_xref="GeneID:13391319"
     mRNA            <296758..>297249
                     /locus_tag="LDBPK_050810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858220.1"
                     /db_xref="GeneID:13391319"
     CDS             296758..297249
                     /locus_tag="LDBPK_050810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858268.1"
                     /db_xref="GeneID:13391319"
                     /db_xref="GOA:E9B8H1"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:E9B8H1"
                     /translation="MDKLTSIISVTTSGGLDGAEGTDSQESLCPSLTFKQRVQGCVGC
                     AALGILFFVLSWVTVFLGDYVFFGVLFTLGSLMCLGGTLFLAGPARQFKSMFNEGRWI
                     ASTVYIITMVLTLLCAVLLHSGLLTILMSIIQLLALAWYILSYIPFARDIVKGAFSRL
                     MNR"
     gene            <298211..>301036
                     /locus_tag="LDBPK_050820"
                     /db_xref="GeneID:13391614"
     mRNA            <298211..>301036
                     /locus_tag="LDBPK_050820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858221.1"
                     /db_xref="GeneID:13391614"
     CDS             298211..301036
                     /locus_tag="LDBPK_050820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858269.1"
                     /db_xref="GeneID:13391614"
                     /db_xref="UniProtKB/TrEMBL:E9B8H2"
                     /translation="MGKSNPRRRNKASAKNRPKGHQDCTEVEKDVAGHVVLAPAQPPH
                     TFTPLCVQQLRESREYAVLEDACSDIAYFALQLRHNNDFLREAVPQRLAQLLIFSPPY
                     EPPQLNTNADATPVVASPTLSAAATAGEEEPQPHKGILHMQIAAAEALRTLVVNSEQD
                     RVIDALTSAGADAASGDRFAEGLARLVQAGWQRVQQARRRMAPEDWMGVNGEEGEEDA
                     GSGGGDEAAAEGEAEPAADASARHHRRRQSGFTRNLYFILLRHLEEVLALASVCVEAS
                     EVCAQTFSSTSALLLLLDVLRVAITTTWETLLHPSADYYADEAQVPVASETALAIRAF
                     KRREAGLLASLAVSTADLLLLLSPENQSLAQVFTGSSEGNGAAVAASSSSFPSAAGSS
                     PAMTAEQTAFLNTVVDAVDLRAWLAEKPAVEVQLQERFSDASLPSFLGAQHTAVAMER
                     ERVLHDLLRATLSIQGVLLHIAPVAANLQRVLPLLDDTLHKASLPMHVWCGVLPLLMG
                     TCERADDDVRAAAATLTTHRLRSTQAAVRLLHVMVNAVGEKNDTDRYEDDEAAFAANP
                     LAKILQSGELLYAFGLLLKDVLWMSPNSDSSGNAATVEGPAHPTATRDVMAWQAQQRA
                     LRAEASSNAAATEMQMVLLATEVNVWEVASTLLLMLPVASLGDPAPTWRALLQAVLSR
                     YQLHLDAAAMEASEGEGRSAHANILQHSARTHQLLWMQLESLGQMLWTMQRKQSKASG
                     GSAAVTACNHVQATSADVDLLIRVSWEASASTLLRQSCVGAVGLLCASMQREEAVATA
                     ARFALAVVANGGPAATSYGKKLLDVYAQLVPGKTPTYPAERRVWLQQLALADAAATVR
                     CEAANTLIDLFLDERHDAAVYWPLGVQEKLSDFKRQLAIYVKRRQQLDKETKRLYHVS
                     TETPDAEQWSEVLENLSGFIDYKAHHK"
     gene            <302107..>303027
                     /locus_tag="LDBPK_050830"
                     /db_xref="GeneID:13391320"
     mRNA            <302107..>303027
                     /locus_tag="LDBPK_050830"
                     /product="methylthioadenosine phosphorylase, putative"
                     /transcript_id="XM_003858222.1"
                     /db_xref="GeneID:13391320"
     CDS             302107..303027
                     /locus_tag="LDBPK_050830"
                     /codon_start=1
                     /product="methylthioadenosine phosphorylase, putative"
                     /protein_id="XP_003858270.1"
                     /db_xref="GeneID:13391320"
                     /db_xref="GOA:E9B8H3"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="UniProtKB/TrEMBL:E9B8H3"
                     /translation="MYGNPHKEPVAIAVIGGSGIYKLDCLQDAKYYDVPTPYGNPSGQ
                     LCVAKVDGVPCVFLPRHGPHHQYNPSEINYRANICALKQMGVRYILAINAVGSLDESC
                     KPGDLVLCDQIIDKTYARKATFFEGGVVAHADFAHPTSRIFNNIAHEALLRCFPDVAA
                     GKGTFQIHSSGTLVTMEGPQFSTKAESLLNKQMGGHLIGMTSATEARLAREAEIAYAT
                     VAMVTDMDAWSDAPHVDAAQVTKVMAANVEKAQRYPSEIIKSLAQNLFDDPAHHTLEY
                     AIVTKPEHIPAETKQRIAPLVASKYPQFAP"
     gene            <305991..>310265
                     /locus_tag="LDBPK_050840"
                     /db_xref="GeneID:13391321"
     mRNA            <305991..>310265
                     /locus_tag="LDBPK_050840"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858223.1"
                     /db_xref="GeneID:13391321"
     CDS             305991..310265
                     /locus_tag="LDBPK_050840"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858271.1"
                     /db_xref="GeneID:13391321"
                     /db_xref="UniProtKB/TrEMBL:E9B8H4"
                     /translation="MGNDLSTMSGGGRNLEVWGEARARRVSNELPTPRTIPLGHGDNL
                     VPPALLLDAEMRSAADEASSTSSLRSAGTVSTYSTQHSALSKANRSPDPQPRRRSMSM
                     SDMTAATALLAAAAPSQQQQQQQQQRQLQRRAQYSMYARQMRRPGCDGGRYGLQHHNS
                     GVDFMVANEFFNCSDSTLGSEADLDSSSGIGSSGSDGNDDAGGVHHRCGMAPREPTLP
                     YGSGRRLTGNELSAHSPRRGRNEVDGAPALGSTATAAAAASATSPAHAKSSSTGRAET
                     ITTKAVSVVVSGVDCSSDPPPALTSSRNSSNGSHDSKSSAASGKKGGVTPLPSARQGN
                     WHKRLLRPVSRGSIRDDGISGSATQWGSPDAADGALSSHEEKKCKTGKRKTSKPRIHP
                     EGLLELKFPHRTRSSAAAPRTSSAAAGTATTTIGVEALVSRMKLSTTKESPSVDAKQR
                     HTSGDLSGSTAPALSNEKRGGQCDSFTCVSSSPAQQHHAAGKDGRGKPGANRSSDPPR
                     SSESPAHHHSRQVQHHHCGGDDGSNAVPETVLASLVDSKSHHRQPRRNRSLGGKLDLH
                     DESPNDFFASTQRSGQYRMLYRMDSESGSSTASMREAVCMATGGGAAAAHSFGSLFAD
                     SRAASLYSVSSSPGQAWTGDYAGRGVMQLTAAVDHRALDMQKVDDVGGTSEASRHHPS
                     RGLLCSGSCTACVNSTGTFNATSQPQQADLQRKIEMHLQRMTYTSKSPSLVTSNQVVS
                     VRPENSQGTRHSLISTLPMPLNVGAAEAPANRGQVGAAAVMREALSAGASCRDGHGHV
                     HTAASVSICSNGSGSSSFGSSSSGDRSISPDVSVRELVKSSRVKPPAKAESPPLLPQP
                     PPPQTAVMRTKTHSFRGHGGRRGPTNLSATEGLAASAVSPKRHSSCAGRRHHHGNGSS
                     NSGDALHATASVLTSVQGSCSALRPTRADSKDLILRPDRTASARRHRRGGGDENAPEG
                     SGSRQRHPQNRKLSSRTHFTSFSFSSDSFLYGKVRGHLAKAAAVAANSSSIERRRHAS
                     GCESSGGTQAHARHHAHGEVDSVALGASPSASSRKGEAECRHRGSGCGNESGMGSVVA
                     DLDDLLLGADGRAPSGNLTALYPRSASSSLSLAPSSRNSSTNGSCVSSGSVRALRKRA
                     ARARDLSASSSVDSEASGRLHPHWTAPPLPQQQQYGAAGATATASSMYRLPLVKTSNS
                     CGGAVAANGSASSAVTGGTRGMKLPSFKPNMGVGISNSPDTSSGRPVNINYVLQPLRS
                     PAANGSATMAAASPEIHSVAKSHSTSSGSGVAADTSGAMPTVHGHEKASWQPSMLPKV
                     PCALFNGSGSGAHLPRMPPASSPRHASSKRDGDTDSLTVSFPDANGRGDGGSGAAASS
                     SAASLLAGPSRDSSAKRRRPTTQSFTPWSVDMSRFKALQEAQEPPS"
     gene            <311613..>313616
                     /locus_tag="LDBPK_050850"
                     /db_xref="GeneID:13391322"
     mRNA            <311613..>313616
                     /locus_tag="LDBPK_050850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858224.1"
                     /db_xref="GeneID:13391322"
     CDS             311613..313616
                     /locus_tag="LDBPK_050850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858272.1"
                     /db_xref="GeneID:13391322"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:E9B8H5"
                     /translation="MPAGANSRTPAKDFVQDYAAKRQAQMERARQLREDRLQQQQQQR
                     QSSPQKSGGGNAYNSSPKYTAVPSASGGGTATAAPTSRQPPPPSLNMPRSRHVTPGHG
                     SADSGSSPGKCGDGCVLYIKEQDFKQATQAGIITPDQARQLWAMLSNQIIRVCSPSAH
                     ANAVSVSSLLALSNNSYNSSGRAAGGPQSTGGSEFGASISLESLRTSIAYFKREQQRL
                     QQQGGGGAAGAAPGSNAQGRHPLSSSSPALSNTAGQPLSQSRGLPQRQLLYDGNANSD
                     YYRNDGAANDDEQRALGAPMPLRGSGGGGGRGGRPAWNSDVEVRHEDDYDDDRNRHAP
                     SSMPTMSSGAAALKKPRTGRTSTVRPAVKGPAASSSPAAGASGVFGTSAQGGVGQGGG
                     GYGNDDEEASNNMYMPPQPSSAVPRGAKASGSGAASRRPPASRLTAPPPSSGAPVNLD
                     EVPVGGGGGGGGMNDWANAYPPGMVPPTSTGGNDAIAAEAAAVAQEPMQECRTCGRRF
                     RISVVMRHEALCRNQANKPRKVFNMREQRLEGVEGIKEVQRTAARSGGGGGGGGVGGG
                     GGRGGGGDAATGAAKGKLPKWKVQHEQFQAAMRAVRQQKEAGGGFGFGQMAPPPAPIP
                     EEYDDRVPCPHCGRKFAQEVAARHIPKCATTIAKPKGIRPIRR"
     gene            <314708..>315175
                     /locus_tag="LDBPK_050860"
                     /db_xref="GeneID:13391323"
     mRNA            <314708..>315175
                     /locus_tag="LDBPK_050860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858225.1"
                     /db_xref="GeneID:13391323"
     CDS             314708..315175
                     /locus_tag="LDBPK_050860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858273.1"
                     /db_xref="GeneID:13391323"
                     /db_xref="UniProtKB/TrEMBL:E9B8H6"
                     /translation="MLRRSPVPRRYRTAWRELLHPLPVWARKQQWLKRDTVEMNEAIL
                     REPYYRIKTFAQPAAFVSPRVSESATHEPDTQQSSRYGVDRQLRGPRRAVSPERLQEL
                     REQLQFVGSIGPKVPPAAGAGPAYQDEYGTRLRPRYPQSWDTVPPHQPSRSEI"
     gap             315381..315445
                     /estimated_length=65
     gene            <316097..>321913
                     /locus_tag="LDBPK_050870"
                     /db_xref="GeneID:13391324"
     mRNA            <316097..>321913
                     /locus_tag="LDBPK_050870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858226.1"
                     /db_xref="GeneID:13391324"
     CDS             316097..321913
                     /locus_tag="LDBPK_050870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858274.1"
                     /db_xref="GeneID:13391324"
                     /db_xref="UniProtKB/TrEMBL:E9B8H7"
                     /translation="MSLSTFSVRDIVATPDDADVLQTSLEELYRRRRAKRQEERARKR
                     WEQSQLLDEDAGSWGTAQELAYRREVLHTWTRQYPRLREAMVSLAAASSSNTAATAPA
                     VTTAAAFSVAETVRPSYPTLWRIPAGTIPADFYTHNTAMEVSQLLSTPQRQHATTDAV
                     KDYSAHSCLVRVRWEPVRVTDLFIEPPQSAAASFVRFSQHPCGSTSHAQLQPQRVLAR
                     WPQGKPASAKMAAVLRSIGIEERKREQWNEHLRRRQQQQQKQDEREAPQQRLRDGVRG
                     RHSAASVKLFDNLPSSAGGAEPATEAGAVDESYSAVTAASAGVVVEDGGSGGGSAAYA
                     SESALGHELYWPAHITRTRALFTGAACLQDTFHGLGQLQRYERFEPVLALALASPLRI
                     VVDVVYTVDETSEAFGLSIDPVVHFHTMTSSDACRNVATRRDSDAVRSISLGSGCGSS
                     ASRHGIAADRRATLSPSEISSSMAEDECPVLLPSSLPPVLSDLNYAFTAAPTAASAAA
                     GGGGSADSRRAASQTTSFTDDSTTTSTAALRRSTLSTSPLSLYTILAGPASQTHSIVL
                     LRPTPEVVCAARARALQELEQRWLRLRQALADRLVACEEQAPTAVLARSPMLSPADVL
                     AVELPDANTYASPFIDRSARQGEGLPAEPAGAESLTEEEMQRQTRLPQLQGGHLPRRP
                     LTYQVSGPHGVNGRLLWLSSASLQTPPADPGLRTRSLPSSARRPSRGSGAQDDGASAE
                     AAALWPVSTPPTSSRPPQQSPCTSQQSHARRADRGAWSTDEAASASAGGDDGCGALFR
                     GSERVSTAAARRGDAGIPRTPQLARSPVDPNSLCSPASCEGLDVPCTDGSSSDLDGLR
                     SALFSEGRRAATEKSRTILAAVRTSNEWPRVEESMARAPQQPATMPRAHLSALTLEAS
                     LPVSPDAWRLANGTDHVGSAAAPGSPRKASPSSTSLPSRRHRHNDGSPMDTDTVMQLA
                     HDDGDSSRHRTCSAAERYSAILSVSAQSVPDSQPMSALREVSVTSCLSWDVRNTMNDT
                     ASQHSSTGDGDGRVAPYSGGSGAALPTSPSPQLCTPTPTYLPLPSRLNKNGAPKIPDL
                     STPDIAVTLVTPYSTVSSPTSPPPHAASPMLRTKFFTLAAAPPHADDHSQSPSSVRYP
                     ILQQPPAPLCHADAASARSSTKNTAAQLSATRPPVAPAEPPLQCSRAASSSSSDATRS
                     VLTHTSRPGEKILGGCTKNEKTLSAVPARGDPRTEARSAPQATRSTALESSSSSDDAP
                     VLSGTATYSSYIQVDPLSSVAVAQGMSAVRRAGAAALSTPQTPHVAARELRGASASTP
                     STRPFSSPTFLSDKRRLQLHNLEQSQREPMRRVSPPPPSSLSTSAEARARVHPGSSSL
                     RQNDDVAALSMDLHHTRGAAPGTAPCMKAAAVEVGPQQRPRLCEGGSAGATRHSSARH
                     REHASPLQSGTDAVEATTASANHRVGHGGSSDTSGAVESDGSPLPRRPPSLASSPATG
                     ANDGAHEAASRPMSANSAASKPTAPCAVTSQPPSQHTDGAGATGLVSGEPRPSHCPQA
                     SASSRMHHRRPSPRAPETAAAPATDDNAEDLPQRHLQRQQRHERAGSVSVAVLCSELS
                     VSVDREVELPEQPVRLPEVPTPRSPQRSQPQQQPYLVTVNAAAAKSVRSGEPATGLHS
                     LDKFMHSGREGLLEAHQRATRATQSRKASADVRSWYRQAHPHHRSPGEAAQEDSASTL
                     SSAPSASSSPLPLSKSRRPAQRPSRHVGSAGSEKSDAVGPRALSTSCMHHTTPPAAAA
                     SASSAPSVNFSSLMSSAAPSPRGTSPAPHPSGRSSRSSRGGAGELLVLRPHRSTSSSQ
                     HNRRYHDRAVALSPSPLSTTRRHRVLVRRVVRRRRSEVFVEEGGTLVYRAPMATPHLL
                     SSSSGGSGRGASAPTLPSSPRDTRAERARKTPRRHSHT"
     gene            <322864..>323481
                     /locus_tag="LDBPK_050880"
                     /db_xref="GeneID:13391325"
     mRNA            <322864..>323481
                     /locus_tag="LDBPK_050880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858227.1"
                     /db_xref="GeneID:13391325"
     CDS             322864..323481
                     /locus_tag="LDBPK_050880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858275.1"
                     /db_xref="GeneID:13391325"
                     /db_xref="UniProtKB/TrEMBL:E9B8H8"
                     /translation="MQRVRLAAPAAAAASVSSSPSSSAAALWAPSRGFRKELFEGPLD
                     LKPGERNARKGPPVAHSLPVYKTTHKLHNSVRWKNANLVTNVAGGQDYRLRETQGEGT
                     FDETGMYRDWLYGDERRYANYIGLTLGALAITLFWYTMRVIGAETWDIPTPVLASQRK
                     RLAKGDVEGSGGDAAVEVLALPTEKEIRQDALAMLKRPTTLSKSS"
     gene            <324709..>326832
                     /locus_tag="LDBPK_050890"
                     /db_xref="GeneID:13391326"
     mRNA            <324709..>326832
                     /locus_tag="LDBPK_050890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858228.1"
                     /db_xref="GeneID:13391326"
     CDS             324709..>326832
                     /locus_tag="LDBPK_050890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858276.1"
                     /db_xref="GeneID:13391326"
                     /db_xref="UniProtKB/TrEMBL:E9B8H9"
                     /translation="MSHNSVAEGEDGGTGADAAAVVPVNETLLYHQTLIPTQNVTHAI
                     EGSFTLPDANDLVLIRHNVLELWRLYAENANGGVECVCRTPLMSAVYAAVAVPTSASS
                     MAKAGGAGSAASPGGNVAAVLDDATTTAHRSGVHYLAVTSETGYVTLLRYQLDEPPVP
                     TRLSYGDDSDEGNEGIGGSSGASGGATMLVTTSLKGRFIKVSEVCLGRSGARLTVPGA
                     RMVVDTSGTALLITALMRTKTLVPITANETWDPVKSVNVGQDDDDAESDADGDDEDEE
                     ADDDDAGEHQRRGPVTGRELRAARRRRAAKARRANGAINLGTPIEMQRQTVLYSACAL
                     DGYLDHAVFAVLEEEIVEARDAAAASASNPANAAAAAVEASGGTFLKSSGGPNAVVQR
                     HKHFVLYAYVPSLKQVQRTQLVHVPATAHRLIAVPAAPYGPGGVLVCTDTELIWYDVS
                     ATQQQQQNSAAAANGRVGVFKCTYAFPRRLDCTEILYDPSIIQHTLTCFGRRFFMLLQ
                     DEQGDVYRVFLEAGDVQRAYEALRTRELAQANPELFLQQQLAANGGVAPAPALPPVPN
                     PLSVHYFDTLPPSSAMALFRRGFLFIGNEAGPLHGLYKIKSNGYTADREYIVKRVRRE
                     RALPMALQMSSSSKAEKAKAEVEDGAVKKEGDGADRKRPRAAEAAGAAGKPEPQDPTA
                     PATSSGSAASSTLPRTKTEPTDGDGN"
     gap             326835..326933
                     /estimated_length=99
     gap             328736..328834
                     /estimated_length=99
     gene            <332651..>333511
                     /locus_tag="LDBPK_050900"
                     /db_xref="GeneID:13391327"
     mRNA            <332651..>333511
                     /locus_tag="LDBPK_050900"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858229.1"
                     /db_xref="GeneID:13391327"
     CDS             332651..333511
                     /locus_tag="LDBPK_050900"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858277.1"
                     /db_xref="GeneID:13391327"
                     /db_xref="UniProtKB/TrEMBL:E9B8I0"
                     /translation="MAIIRDALIRVAALATMLALLCVVSTATAATISDGSTQYFVKLW
                     SGKYPLKYVWSGKDICKYEGISCDTVKQTVTMLLPKIGLTGTIPGYGSKAGFKPANVR
                     VITINLMGNNELTGAFPEHYGQLRQLQELYLMNTSLQGTIPQAWNNLANLVILDVSNT
                     KACGNLPAWDAKSMKSLQYMHFTGNSLMKGSIPASLATFGAVSFDTTGCKFCGCLPSE
                     FSSSMYMMMQLISSQPQVNTQDCMTANTCTVQHMSCKAKANAAAIACSRASVAAVVAG
                     VLIAVASLLA"
     gene            <335304..>338612
                     /locus_tag="LDBPK_050910"
                     /db_xref="GeneID:13391615"
     mRNA            <335304..>338612
                     /locus_tag="LDBPK_050910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858230.1"
                     /db_xref="GeneID:13391615"
     CDS             335304..338612
                     /locus_tag="LDBPK_050910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858278.1"
                     /db_xref="GeneID:13391615"
                     /db_xref="UniProtKB/TrEMBL:E9B8I1"
                     /translation="MTLRGGGGSGPAASSLSTMDFPLHVASPSPTASSSSPAPTAAAA
                     ASTSLLSSSNALELMRTYHMYVRVHKTRCRYLLLLLLMLLYYFQCTLCGRHDILMNAA
                     GEGSYRGLSGGVAGSSAVGGAGLAGTGAGGPSKDGGLRLGLAAPDTEAAGDDGGLAGS
                     SEGRRRRYARPPLIARALGGIGATVGRMDLCEIEWWPPSNRTPDATDAHYEQGLNVAT
                     PNAASLSLARSEPPWSANTQRGLVAAIARSATRLSGLLFGQDPPPYERALRAFFRTRQ
                     ATSGGSCNRCQARAIDKGVQKELINYNAFARDFKLRVPLLLYYNRMPVYAMMQHLRLM
                     RARSYQLLDYMSRGHASQSRPETAAGDGADSPDLHARQLRFELARLSLVFYLQRLHLR
                     ALRHADAMRLETFHFLRYLSSTIPVLRSVWVGQDHCSWPGVSCVVVRVPLNSLIDSEH
                     PAVQAFVEDIFSVCRGPRCRQRRCAAPSCSAYTRHLTRRLFTSAAPAYWLKWDRTDDT
                     AAMDEMIWEKAPTSSRGAAGVNGMAAAPPPSPSAASTGTDGDAGRSGSTKAASASSAA
                     AAAARSSRGTPARSKRSVWTEQMFAYEHPHLVLTEPTLLVDIDVQNIIQEMVEPVVAS
                     APCNGGDNEWAPSSPSPSATLSGPPSDFATPEYAEDVERPLTGDLFSMQRRLLRTIAE
                     AAPRGLQYGKQRNDSSTVTIPYTFVKLNLVNMGLRGYLPDFYDIASAYDEQRDAVAAH
                     GKREGTNKGSGGASGTQSGFVDACEAANLPSATAAATRQCSSKSAPEASVLTPRSDLY
                     WGRRSRMRMLEPRNLSSASLAMASARRPLASVAAIGSELQWVLRRLEKIGQRNHHEDL
                     AAYFSEVASLARFQNEQWSPYRWPETMIAAMSDVSQSATRRLYSILEDSAFSPSFTDP
                     VQSIDHSVNAFGELNPRLIGLLSLDVSANPLLTHLFPRTWLSIPHLQSVRTTGTSILT
                     PPLRLRPRLYNHAAYCPASSMRFGSGMKADADEAMGERRRRDTEVTAATETALDKVEV
                     SSATGSSLHDKDFIGAVLMPPFSKIDTVFSASSPSETIFQHQDPLTGRRLLNYPASLH
                     DGFVQGIKRLLSLQ"
     gene            <339118..>342384
                     /locus_tag="LDBPK_050920"
                     /db_xref="GeneID:13391616"
     mRNA            <339118..>342384
                     /locus_tag="LDBPK_050920"
                     /product="paraflagellar rod protein, putative"
                     /transcript_id="XM_003858231.1"
                     /db_xref="GeneID:13391616"
     CDS             339118..342384
                     /locus_tag="LDBPK_050920"
                     /codon_start=1
                     /product="paraflagellar rod protein, putative"
                     /protein_id="XP_003858279.1"
                     /db_xref="GeneID:13391616"
                     /db_xref="GOA:E9B8I2"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9B8I2"
                     /translation="MLLSSPAAAAPNASGGGSGGAAAGDEVVSPTLETSTALSTAHAQ
                     LVLLEYAIRAAAASAVPSDASAQSHRKASEATRTMSATVGSQNSLLPGPVPAESGSPT
                     SIMAATRLSSVTATAPSGASERLSALHDNLRRVRRLMQQYEEASQRVIKVHLLPSSET
                     GEETLGSVATPTAHAVQRTKEVTPQQPSVSVAAAAAAADRPFLEQHSSNSANVASSGK
                     PAAEQQNTLPSLHQRRALASDAVFTRFCGLRVTPDQLLLPLPPPATPTASPASPEFAQ
                     QRMSPRGIDDDAEEKKSGNGSGLVSHYSEPVKKRGSNNKTSSSQMVGSRNAKAQHSSA
                     SSSPRHSPVSRTAQQRKRTSAEAVLEEYAKLFYRPSATAASPPAAPSDNTKVTKAGSL
                     SSSTPTDDGEVARPLQETQQQFAALQRCHLFAYEAHLRSAAALADSQGKDNDVSTITR
                     GITAVGAATAGAQVDDISWQHIPVAVQHMQDSLTALQARFTRDSHYASCGGQPIALVH
                     QLQTWTQPLIQNLNELLSNSTLEEKDENTREKLRRMKFDAEELQQAQAQAISNGDMQR
                     SEELYYEQASLAEAMAGPYDELEAIMRKYGEVCVDAPLTRVLEQRDLLTTRLTRVIEE
                     HTSKLSEVTLDAERVKEKRRAVAQARHRQRNNMSTYNHTWKKAWQTNSDQQMACYRAM
                     EQLEKQLNDLQQAQSFLVDDWISHVTQERQREADAASFACFADARAAALAETQRNLQT
                     VVDGVRQYSGAVQFSCRHVEAFVREVLRGHLSHSQVALRKDRLEQFSALYLTLGDLRF
                     KKARNAEEIEKKIEYYTLQQEVAMDALNPKAKEFSKTKQRYEAAKAEVQKQIDQLDQR
                     SRLQLERFRPTEQLLREAGVDFVSPEEELARRTQQRSQKLLEYQKLIEDGIGVRPTSS
                     AASRSPATLTTMAASQATTSSTRTEGAKGLTGTNAPSPPRLQAVGSLHSCPRPPSAGE
                     AANPTATASGALCGKNGRQLPPLRRMNHTYPPSQRTDHSDGSDEPTATTTEPSPQGAN
                     QTSTAATVAAAPTAASLSSLHATEERIMQGISKMAVTDRGRAHTSSGAASIRCKRSKR
                     "
     gene            <344449..>345843
                     /locus_tag="LDBPK_050930"
                     /db_xref="GeneID:13391617"
     mRNA            <344449..>345843
                     /locus_tag="LDBPK_050930"
                     /product="ubiquitin-conjugating enzyme, putative"
                     /transcript_id="XM_003858232.1"
                     /db_xref="GeneID:13391617"
     CDS             344449..345843
                     /locus_tag="LDBPK_050930"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme, putative"
                     /protein_id="XP_003858280.1"
                     /db_xref="GeneID:13391617"
                     /db_xref="GOA:E9B8I3"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:E9B8I3"
                     /translation="MSYASSAIKRLSNEYRRLQKPENRVREYYIAPLEENIFEWHFTL
                     RGPGGDDNSLPYKDGIYHGALIFSRSYPLEPPDILFFTRSGRFAVREKICSTISSYHK
                     ELWQPTYDIALTLTALRHFMAQEDEFGVGAFPKSMIALETKEVWAKETWSFTCSTCGM
                     ATKDVWETQMKMYPETSPEKEAQVPKLPPPPPAAPAASATAKPEDAGEKQDAPDTASS
                     PAPPPSASPSSTLSPSPAAADASETAAKAAAAPDAPQSHNAPKGTPSSPAFASTAVGA
                     TAPQSPTPGVHDTLHTPSPAGHERTAKSGASIKEEGAMSEDDDALSCFTDVSPARVVR
                     APVMAVPPPPPPAAAEPDRLYDMHLESLVRDTPRSEAGLAAAAAADATPPVTSAVADG
                     VVAADVAGASASPLSTAVAAVAPPQFAQRVVFGVNIMEVSISLRLLDRAIIVSFLFVV
                     LILLRRGLCGLLMS"
     gene            <346836..>350789
                     /locus_tag="LDBPK_050940"
                     /db_xref="GeneID:13391618"
     mRNA            <346836..>350789
                     /locus_tag="LDBPK_050940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858233.1"
                     /db_xref="GeneID:13391618"
     CDS             346836..350789
                     /locus_tag="LDBPK_050940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858281.1"
                     /db_xref="GeneID:13391618"
                     /db_xref="UniProtKB/TrEMBL:E9B8I4"
                     /translation="MIKVEAAGSSSAHAPSLPTHTHVETRMLGQLPSQMASSSIEAWC
                     DGVQHLMEKYFSRLGEVVVAHLGLRAPSIQDQHSSGGSGAAEKREIVNKLRSEHKEIL
                     ELDVQAADIEATEMALFQQLWAHHQLQQKRQRPVAADDGTEKEDRLSGASRGGASTPD
                     AVAEAALPTRDGASYIRPPSSSAAATAPEDAASATPCDTEGNPFLKTQQHPASESAAR
                     IPADLLELFRTAQELHSAAPGSTGPPPRATPSKEAAAAGENPFDATANRLSRVSVVLS
                     EEENAQAAAMALLCFRYFYSSNSAPASPVEAAAPLVSATKPPEQPSQPAHVREKVAAA
                     TIVPKQKRQRHLAPLPRATPTSPALSVHACHGADASSHISLSSPGAWRKLITKPGSLG
                     PSEHQQQPSSTPAHAADRLRAELASLFPQQAQQVQGGFSCGLPPQRAFFTGADTSVDA
                     DAAGEKSRPESKGRNNHVAFLNADRTTDGARGAGGRPLLTRPTLGSPSTEDAHNSGAS
                     RSKGGVKLPPLTLHASPTSAGERPPSAAASSSPPTPPTPTTAAAGTPHVMSDQCPVLP
                     ALDPSATAAPSSVTAATAAPGTEAAASAQKHGSGAKKAKKRGGSGQRRRAPRLLPKCV
                     VLPPNYSGVHGEQLTMAQLVQLAAGVSEDCAVAQVDVKRQYDAADAAAAELYRLQQAV
                     ARVLLENIQLEKDIYTLTATSHAYAAGDEDGDADEAGRGADAAAGMRRRHHSDGVDPY
                     GSRYSDTSKSRVRKGVMSCFAASTLSPASAAHPSAEKRKRQPILPPAPMPLPHSKRAL
                     TAASLLLHVAGEKKAVPPVSAAAAAVAHPWPWRQESAPAERAKLSPKSSCQHKARAVA
                     SAIPTAAEGVTAVDGQQEPHTILQELRSAIASREAEKAQTLAEIDALSSRVTRHDTLL
                     HAVAEYWRRNAAVMKRQHFAVQSQPKQSTSSETMTRLGDGGDGWGSENAIGTIAPPCL
                     FNASDGTHGVVTQANSSNSGHSTSSHKYSHSTVITAAMSLSGKMTNLGESPSQAQRAL
                     AQMEALSPTPLSSTPSFDLRITSPVSSTLSPPLQMRALVRRQIIPPRQRAQESEPAPN
                     KPDAINATLSAATGAAVEAESTPVRVRVGVHVTPPMENELGGRPHRKVIAPPLEIPTA
                     AAAAVAPSSTFTDTDTTATTFLRSPDSVSDTMGRSPSASAALTVGAPAVLKQEWRKNE
                     HGLAVSAVAVNLFNGSPRRWPGNILASPLGFTQVYDREEGEDDNVCGSGSFPTTPLHP
                     SRSTTANNSHSYAIGGMRRGDEDVLDHGSWRTIPALQLENVDEIAEFIYSVFERP"
     gene            <352844..>355567
                     /locus_tag="LDBPK_050950"
                     /db_xref="GeneID:13391619"
     mRNA            <352844..>355567
                     /locus_tag="LDBPK_050950"
                     /product="glutaminyl cyclase, putative"
                     /transcript_id="XM_003858234.1"
                     /db_xref="GeneID:13391619"
     CDS             352844..355567
                     /locus_tag="LDBPK_050950"
                     /codon_start=1
                     /product="glutaminyl cyclase, putative"
                     /protein_id="XP_003858282.1"
                     /db_xref="GeneID:13391619"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:E9B8I5"
                     /translation="MQHQSLAARRRDRRLARRDESAFWCRLLKRCLPCRALRWKSVHA
                     TSRTRRILMGILLCLIATLIFLIGLVVCLTWKSNRSNTPLEPAAAQSTHAPRVPPEVG
                     VHDPWAEDPVDVAVIRQREEAMVRKWRENGFRPTYWEVERRTLPRLTKRALESWFEHG
                     RRAAASATAVDVAEDVLTAHAWDAVDGGDADADLFDSLAFLYPPAQQRQYYRAAMDAI
                     LRQGPRVGGTKRDALLHHLVDEGLGRRRYDAARHAYHPAPPHLSPRGKELLEKAAASW
                     PDAPHLAAAQQDEVAGREPGWRWSLSWDNFTADIPIRIEGSSRVEMQNLVFQFPGGSQ
                     FRRKQAAAASAAASGAKDALDEFVGGVPNRRRTRADDRKEVLEAEYHPADMTGETVYT
                     QENFLQWAQDGVPFNPRPALERGVPGTRVVLSPDAKGARVPLKPSLSAQAAEPATQQP
                     MKHAVLAAHWDSKYFADLPFLAACDSAMPVVFLLRTIKNIAVLTDVAEALTESYKAER
                     SGALGGDAAAAVPGLTSTFRNATTEAEVRERLASLLSPAHHALLYQYFFARPYSVGDE
                     QQNLVAAGMRNHPTKVEVDVRTWLDWVQHLPIISVILFDGEEAYKHWSGDDNTYGSRH
                     LAQRWRSTPSVMRTRYAEGPQSLYDSVDLFALYDLMGPAGTTFSNMYPTQSGIFYAGL
                     SQREWELRHRAMKHSSAISAELLWRYHEATALPPAEARGKTDPFLRLLGPSPHEAVAS
                     INTAYTRRLLANNASRPSVASLPRSWLMYGSPHEMLTLHSVARTTHDVRFVENFDQLR
                     VYDRLDREIAAESSFDAERYLNTINHNIFFSPSQQEDLRRNRDVFVAEDDHKHWLDTQ
                     RVLHLIPVPFPKSWHTANDDGSNVHDGTSTDLSGLLWSTVLELGDYWTRKE"
     gene            <356842..>358881
                     /locus_tag="LDBPK_050960"
                     /db_xref="GeneID:13391620"
     mRNA            <356842..>358881
                     /locus_tag="LDBPK_050960"
                     /product="dipeptidyl-peptidase III, putative"
                     /transcript_id="XM_003858235.1"
                     /db_xref="GeneID:13391620"
     CDS             356842..358881
                     /locus_tag="LDBPK_050960"
                     /codon_start=1
                     /product="dipeptidyl-peptidase III, putative"
                     /protein_id="XP_003858283.1"
                     /db_xref="GeneID:13391620"
                     /db_xref="GOA:E9B8I6"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:E9B8I6"
                     /translation="MSHNALYTTPRAVPYCTLAIANAFKDLTPKQRHYAHHMMAAGWC
                     GAPVVAEQVSPESLPLLRFFFQVLSAQPLDTFKANSVNAGVDPDEVNQFLEYFAMVYS
                     NMGNYLSFGDTKFVPSIPKERFAKIVASADGSPAVDAQLLDAIYNLDDDKLTLDFPPK
                     GLTRYYSPNVTREDAAVANDFLASKKMDGVNTRVFKEEDGTLVIRVAAATERTVPAEK
                     FNGRTIAIYYGDYKEEMARVVAELRKAQPYAENETEVRMLNHYIEHFQYGDVDVHKES
                     QKEWVKDVGPTVETNIGFIESYRDPSGVRAEWEGFVAVVNKEQSKMYGALVAQGEKFV
                     AELPWGKAFEKDVFSSPDFTSLDVLGFASSGIPAGINIPNYDDIRQTVGFKNVYLSNV
                     VSAITFKDKLNYITEADWELYKASILTATSVNVGIHELLGHGTGKLLSENSDGTFNFD
                     EKTVDPISGKPVATWYKPGDTYSSVFGGLGSSYEECRAEAVSLYLCLLPDLLEIFNLQ
                     TTKEQQDVIYVCWLNMVRAGLVGLEFYTPEKQQWRQAHMRARFCILQALARAPNPIVQ
                     ITENAKEGVLITLDRERIATDGRQAIGDLLVNLNVNKATADAKRGSAYFENMTVVSDQ
                     YVHYRDIIMARRKPRKQYVQPHTFISGDTVEVREFAGSVEGVVESFVTRHREIPL"
     gene            360715..360971
                     /locus_tag="LDBPK_05snRNA1"
                     /db_xref="GeneID:13391621"
     ncRNA           360715..360971
                     /ncRNA_class="snRNA"
                     /locus_tag="LDBPK_05snRNA1"
                     /product="small nuclear RNA, 7SL snRNA"
                     /transcript_id="XR_002966700.1"
                     /db_xref="GeneID:13391621"
     gene            361082..361153
                     /locus_tag="LDBPK_05tRNA1"
                     /db_xref="GeneID:13391328"
     tRNA            361082..361153
                     /locus_tag="LDBPK_05tRNA1"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:13391328"
     gene            <361214..>361294
                     /locus_tag="LDBPK_05rRNA2"
                     /db_xref="GeneID:13391340"
     rRNA            <361214..>361294
                     /locus_tag="LDBPK_05rRNA2"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002966699.1"
                     /db_xref="GeneID:13391340"
     gap             367617..367715
                     /estimated_length=99
     gene            complement(<368443..>369555)
                     /locus_tag="LDBPK_050970"
                     /db_xref="GeneID:13391639"
     mRNA            complement(<368443..>369555)
                     /locus_tag="LDBPK_050970"
                     /product="3-mercaptopyruvate sulfurtransferase"
                     /transcript_id="XM_003858236.1"
                     /db_xref="GeneID:13391639"
     CDS             complement(368443..369555)
                     /locus_tag="LDBPK_050970"
                     /codon_start=1
                     /product="3-mercaptopyruvate sulfurtransferase"
                     /protein_id="XP_003858284.1"
                     /db_xref="GeneID:13391639"
                     /db_xref="GOA:E9B8I7"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR015206"
                     /db_xref="UniProtKB/TrEMBL:E9B8I7"
                     /translation="MSAPAAAPKHPGKVFLDPCEVKDHLAEYRIVDCRYSLKVKDHGS
                     IEYAKEHVKSAIRADMDTNLSKLVPTSTARHPLPPCAEFIEWCMANGMAGELPVLCYD
                     DECGAMGGCRLWWMLNSLGAEAYVINGGFQACKAAGLEMESGEPPSPPTPPTHWPFKT
                     AFQHHYLVDEIPPNAIITDARSADRFASTVRPYAADKMPGHIEGARNLPYTSHLVIRG
                     DGKVLRSEEEIRHNIMTVVQGTGDATDLSSFVFSCGSGVTACINIALVHHLGLGHPYL
                     YCGSWSEYSGLFRLPIMRSIIDDYGMCMQMQTPSLGDNPKANLDTMTLKVDGAPCERP
                     DAEVQSAAAHLHAGEAATVYFKSGRVVTIEAPAVPN"
     gene            complement(<370965..>372410)
                     /locus_tag="LDBPK_050980"
                     /db_xref="GeneID:13391637"
     mRNA            complement(<370965..>372410)
                     /locus_tag="LDBPK_050980"
                     /product="NADH-ubiquinone oxidoreductase, mitochondrial,
                     putative"
                     /transcript_id="XM_003858237.1"
                     /db_xref="GeneID:13391637"
     CDS             complement(370965..372410)
                     /locus_tag="LDBPK_050980"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase, mitochondrial,
                     putative"
                     /protein_id="XP_003858285.1"
                     /db_xref="GeneID:13391637"
                     /db_xref="GOA:E9B8I8"
                     /db_xref="InterPro:IPR001949"
                     /db_xref="InterPro:IPR011537"
                     /db_xref="InterPro:IPR011538"
                     /db_xref="InterPro:IPR019554"
                     /db_xref="InterPro:IPR019575"
                     /db_xref="UniProtKB/TrEMBL:E9B8I8"
                     /translation="MRQGWLRSSAALLVRVHGHLKDQDRIFTNLYNDFGTGIDAAERR
                     GDWYRTKDILLKGHDWVINEIKASGLRGRGGAGFPSGLKWSFMPKKKQDDRPSYIVVN
                     CDESEPGTCKDREIMRHEPHKVVEGALLAGFAMRARYGYIYIRGEFYNEWRSVEKAIH
                     EAYEKGYLGKNACGSGWNFDLYTYRGAGAYICGEETAMIASIEGGQGKPRLKPPFPAN
                     VGLYGCPTTVTNCETVAVSPTIIRRGPQWFAQFGRKGNAGTKLFCISGHVNRPCTVEE
                     EMSMPLRELIERHAGGVRGGWDNLLCVIPGGSSCPLIPKHICDNILMDYDALKEAQTG
                     LGTAAVIVMDKSTDVINAIERLSQFYMHESCGQCTPCREGSPWLDKMMKRFVNGNAKK
                     EEIYTLWDVSKQMEGRSICALGTAAAWPVQGLIRHFKPLMEERIERFWEANPHWGQPG
                     SPWRRWKTHRYYTMQKGDRLNWDGKIVRNWN"
     gene            complement(<373107..>373376)
                     /locus_tag="LDBPK_050990"
                     /db_xref="GeneID:13391329"
     mRNA            complement(<373107..>373376)
                     /locus_tag="LDBPK_050990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858238.1"
                     /db_xref="GeneID:13391329"
     CDS             complement(373107..373376)
                     /locus_tag="LDBPK_050990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858286.1"
                     /db_xref="GeneID:13391329"
                     /db_xref="UniProtKB/TrEMBL:E9B8I9"
                     /translation="MVVIKGGGQTYAVGNGRQMEWDEVPESFKKKVAEQKEMEKCMDL
                     RAKAQRCISDQGFWAPDCVHLTEAFHLCQSHELTRTELTQRKEAE"
     gene            complement(<375183..>375494)
                     /locus_tag="LDBPK_051000"
                     /db_xref="GeneID:13391330"
     mRNA            complement(<375183..>375494)
                     /locus_tag="LDBPK_051000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858239.1"
                     /db_xref="GeneID:13391330"
     CDS             complement(375183..375494)
                     /locus_tag="LDBPK_051000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858287.1"
                     /db_xref="GeneID:13391330"
                     /db_xref="UniProtKB/TrEMBL:E9B8J0"
                     /translation="METEVASGRLGARDGLLGAALLSDPAANAEDEQNEETCQVLIPP
                     NMSMGADDEEVCGVCLEPPPAGCFVELWCCGNILCVADAQQLGKCPFCREEPLVWNIT
                     K"
     gene            complement(<376365..>378209)
                     /locus_tag="LDBPK_051010"
                     /db_xref="GeneID:13391331"
     mRNA            complement(<376365..>378209)
                     /locus_tag="LDBPK_051010"
                     /product="methyltransferase-like protein"
                     /transcript_id="XM_003858240.1"
                     /db_xref="GeneID:13391331"
     CDS             complement(376365..378209)
                     /locus_tag="LDBPK_051010"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003858288.1"
                     /db_xref="GeneID:13391331"
                     /db_xref="GOA:E9B8J1"
                     /db_xref="InterPro:IPR000241"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B8J1"
                     /translation="MKYVAVFASSASLANFRLPEFQFVAATLRVPITFLDDKIPWVAG
                     GADTFWFSVFESPASRSELKALAERCALLRGVYTLFETAPTLEDLYACLEERHGSAAG
                     SAGPSLASFPTTAATAFVGEDETTHLTSSTYSYQVETIGKKYSADAKRAVAEAVLKRV
                     PRAGEVEWRQPGRAYYIFLQHAVENAPPGAQGWVSNGPLLRVFHCRLCVESSRSALLA
                     TYDLRKRPYIGTTSMPPEESLMMVNMSGVCRGHYVYDPFCGTGSLLIAAAHYGARTFG
                     SDADGRAMRAGTEKGKTSPQMQQQRRLALAAYTEEQLCVLTEEERVLPNMITNFKLYC
                     LPPPDRARMNFSAWPRTWHACALRLGSGGIFDSIITDPPYGLREPRKRVVTTAATIPT
                     AAAAAASTEAGSDNAAKQQAVSFSAYPTHEVLLDLVMFAATYLVVGGHLTFWHPTTDH
                     YTDDELPSHPSLRIVCNIAQRVSLKVVRRLIVLRKVAPVPIPPPSRESCAATKSPDDL
                     RVLMDATELPDNADYMHYRAKRERKRQAAHKYKASADASSPSTPATGVDVGSGSDGSN
                     RRGRKQSRPDGQDKIVANRQRNIELRAAKQAASHLANASHKTVGHSRP"
     gene            complement(<379161..>381920)
                     /locus_tag="LDBPK_051020"
                     /db_xref="GeneID:13391332"
     mRNA            complement(<379161..>381920)
                     /locus_tag="LDBPK_051020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858241.1"
                     /db_xref="GeneID:13391332"
     CDS             complement(379161..381920)
                     /locus_tag="LDBPK_051020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858289.1"
                     /db_xref="GeneID:13391332"
                     /db_xref="UniProtKB/TrEMBL:E9B8J2"
                     /translation="MASSAATASRADRLQAFLRSPDIPASFYTNTTADDNLIAVTTQF
                     DILYHKYFPDRKPLFLLLNNECQRPKMICSFVRPTSLPYDELFDLEGACQFVADYVRY
                     EPLYDPSMYDDEYDDTVEQLPQQIVSPATALDWQVGNCFEMSLVLTSFLIGAGFNAYV
                     VVGSATKAVCLSDQKSTMWEGELPKEVNSDDEVEDDMPQNNPYMALIPEKLTLRLTTD
                     PDPASVRKKESVMASAGDYPKDTDTPNVRGGAVKPIHSWVLVLPGGRRSVSKAVFVEP
                     STGQLIAFSATDSRYTSVEALFNHQDYHVNMRPEAPVSSLSPDLADRSQWESLFSYAN
                     LSDDEVESLTGTLSATRRAFTSELAATTTAATVSTVEVFDSSRSRRMYIPNLWSNELI
                     LNRHQYESRYPAGYKEITYVNAVVRRYAPYSQSDYRILEVVVPDAEYAELHETHVFYA
                     HRADKLRRATVFPSPAPQSSSKESLILSSRSSVSLEKVPGGPRKMVEWYEKGRMHNTS
                     VEGLRELIYEPGKQRTMKFYWRARSDGLYCRTELLYDASTLRKVKELYKGRSDRLWYR
                     SFSYGRPSTMRERDMHSLIVQGPGNVSALHVYPRLDPVRISQKFLRDESVPARKDVAK
                     TTFLRPASESKSGGNNSAPTVGEIWVFFHYDAGSILRPYHMFAKPSSSVEEYIAASAA
                     GKPAEPPMRVVSLPGEEPPSELDLYNERKWLNAVETACLMEQRVMSDECMDILKSIEQ
                     EHKKPQHVLSVYDTLRNRPKETEAERARKLAEAARREESRKDYLAPYIAKLEMPADFD
                     GNYLSVLLSMEQAKQVRDEALQELKDRLIQRGHIMQSRMDKEKVEFNKRQQLYRKNCD
                     ASALEGDKETEAFALYCKEATWRMKVLDERLLQHIDHASEKYNQLAQRLAEDPRLAAL
                     YHPTH"
     gene            complement(<382443..>382880)
                     /locus_tag="LDBPK_051030"
                     /db_xref="GeneID:13391622"
     mRNA            complement(<382443..>382880)
                     /locus_tag="LDBPK_051030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858242.1"
                     /db_xref="GeneID:13391622"
     CDS             complement(382443..382880)
                     /locus_tag="LDBPK_051030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858290.1"
                     /db_xref="GeneID:13391622"
                     /db_xref="UniProtKB/TrEMBL:E9B8J3"
                     /translation="MQCTFLKLSSRRGSAFATSLFLHASSQNMRAADAAQRIEVEEFA
                     KSYQMKPMADHPRSSFEYKSSAKGAEVGARNEAAFMNYETFTPQTLSGRLVMPGDINL
                     LTVSPLYCALLCIAAAAWGVFYWDMYCRKNYETVLIARPKDMQ"
     gene            complement(<383375..>384448)
                     /locus_tag="LDBPK_051040"
                     /db_xref="GeneID:13391333"
     mRNA            complement(<383375..>384448)
                     /locus_tag="LDBPK_051040"
                     /product="stomatin-like protein"
                     /transcript_id="XM_003858243.1"
                     /db_xref="GeneID:13391333"
     CDS             complement(383375..384448)
                     /locus_tag="LDBPK_051040"
                     /codon_start=1
                     /product="stomatin-like protein"
                     /protein_id="XP_003858291.1"
                     /db_xref="GeneID:13391333"
                     /db_xref="GOA:E9B8J4"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="UniProtKB/TrEMBL:E9B8J4"
                     /translation="MLRRGTVLLQYGAQGASHPINSAPQEHPSGGSASSRMMMQRSQK
                     MLLDPASFIERPPRNTFFNIVPQGHEYVVERLGRYHRTLDSGWWVVVPFIDKIRYNYN
                     VKEQGIEIPNQSAITSDNVMVEIDGVLFLKIVDSCKASYNIENPVFNLINLAQTTMRS
                     EIGRMSLDSLFRERASLNQSTVEVLRREANEWGIECKRYEIRDIVVSELVRRSMDLQA
                     EAERKKRKLILESEGESTATINRANGMKIAQQCVADAEKYTAERQSEGAAAAIRVKAA
                     AVSDNISIVSDAIEKAKHSNEAISLRVAESYIEKFGELAKESNTVVMSQPVSDPATFA
                     TQALSVFNTVATSAAKCSPPTGK"
     gene            <385904..>387235
                     /locus_tag="LDBPK_051050"
                     /db_xref="GeneID:13391334"
     mRNA            <385904..>387235
                     /locus_tag="LDBPK_051050"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858244.1"
                     /db_xref="GeneID:13391334"
     CDS             385904..387235
                     /locus_tag="LDBPK_051050"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858292.1"
                     /db_xref="GeneID:13391334"
                     /db_xref="UniProtKB/TrEMBL:E9B8J5"
                     /translation="MFHTSRLAVPRLATKTSALLTRPGKAEKSVAPPNPEARTENSTV
                     SGVTERTTAPLQPPIIDSTKEGRTHILPQKVLKELLNSVSAGQQNFLFGSDKDAGDPT
                     VGVLRATGSFFESINTAYEGRMLQEQQVEVENFVAKRRIHYMQRLNEETEEFRREQKE
                     IHDEIQRLEAEKYKNDLNNDVIQFTKARETEYEARLHADVEKYHNALLAYRARAKKSD
                     QLGANGETPLKQLNMNVIEIMQEMEMDDTLRDFGDAAGIGNDLSDQDIRSYVVQRTCF
                     YEKVVQDEVHEFTKRRKSFYEDLLEARAVRHAAKVRADTEKFHSQRQSYYDERLTADG
                     SWMAKCFQEHYNRCFLQSYARRAWIEHRRYQATLEGIKLFTENGEKVPAISNPADISI
                     STLNAEIPLSTILDMYESENMAEVTRDVFLKAARRVAADYAPYSVDERPSA"
     gene            <388176..>389612
                     /locus_tag="LDBPK_051060"
                     /db_xref="GeneID:13391335"
     mRNA            <388176..>389612
                     /locus_tag="LDBPK_051060"
                     /product="ATPase, putative"
                     /transcript_id="XM_003858245.1"
                     /db_xref="GeneID:13391335"
     CDS             388176..389612
                     /locus_tag="LDBPK_051060"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_003858293.1"
                     /db_xref="GeneID:13391335"
                     /db_xref="GOA:E9B8J6"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8J6"
                     /translation="MLRRASVLLSLRPSEAYRQLVLRGDISTDENQISALPVFDRLYD
                     DLVKYTKESKRIGVPKRQVELRPPNRLGIIPSLFLRREQEKKVEQALSDDNKAVYHPL
                     SHVKGLYVWGGVGCGKTMLMDLLYDNAPPEIRKRRLHFHQFMLDMQKTSNSIRYKSKE
                     EMQDPANRTNMVRYNISDNRRRTPDAEINLFDEVAQRMISDVELLCFDEVAVSDVAHA
                     MILKRLFHSFYKIGLVVIFTSNRPLEDLYKDGLNRGGFIPFIDLVKKQCVIHHMKSNV
                     DHRLLGHQADTYLTPMNSENNSKFEKLFLEMCKAMPATERKLEVFGRDVIVPRACGGV
                     CYFHFYELCGGEKSAADYEVIAKTFHTIFINGVPQFPYENSDVKSRFLLLIDTLYGHR
                     CKVMIHAAVEPPQLQAPKEEAAGRIEGDAQRFDQLSEFERESGNKLVDADDSAFQMDR
                     CVSRLYEMRTKEYLEIPHEPQEVDLSTR"
     gene            <390410..>391963
                     /locus_tag="LDBPK_051070"
                     /db_xref="GeneID:13391623"
     mRNA            <390410..>391963
                     /locus_tag="LDBPK_051070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858246.1"
                     /db_xref="GeneID:13391623"
     CDS             390410..391963
                     /locus_tag="LDBPK_051070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858294.1"
                     /db_xref="GeneID:13391623"
                     /db_xref="GOA:E9B8J7"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:E9B8J7"
                     /translation="MATANRVTTIPMATTRLAVSLLTLFLCGCACVSNAAAARVNDDL
                     PPGVMRGPLLHEHSFQEPLVSDWWEEGVPHYMIGGSAVANERFLRLTTNDLDDHGFAF
                     NTAPLDHDNWEARVRFSIRPPPLAADMNGSSHYQGGDGMALWYLDQPIGDDHQHVVKY
                     SKSISPELRDEMLDAENPWRVADFLLNGDDDDDEDEGVDEDDLTEQEKQERQQAKDRR
                     ATKKRKREALFKRLFKRGTSVDESDREPRIMGVKFSDFNKGFGLILDSVGDEKEHLRE
                     HQQQGDAVQHHHHTSSIYLLLNLPNHTSSSGATVVNNFDPTRENFRSSPHVLRCTYDF
                     RQKGTKPYDPKARMMDKVTKAATAAEEPLELIVRYYKQKLTVIIRREDVAKREVSWVV
                     DEMGKATDEVEVVRTYTETMCGEVYPIHLPLRYHFGLSASTGHRPAKNRKRRPLRSVF
                     HEADKKTFTHVDVHDVLKFDLRELGLDAKAMGYSKTIPLEHFDFEADRRERLHFSRQL
                     PVNPDSDTA"
     gene            <393316..>395496
                     /locus_tag="LDBPK_051080"
                     /db_xref="GeneID:13391624"
     mRNA            <393316..>395496
                     /locus_tag="LDBPK_051080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858247.1"
                     /db_xref="GeneID:13391624"
     CDS             393316..395496
                     /locus_tag="LDBPK_051080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858295.1"
                     /db_xref="GeneID:13391624"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9B8J8"
                     /translation="MSDDASEVAAELPQMWQYIHPTHNSADSSDDEADEEENADVTDN
                     DAARGGRPADYVKLKKSAPRLGQLIRFLNDMEDEDVQGLLLENDPVTRQTLLQWATLN
                     NHFMLVEYLVKRMKRAAFSFDAESVEVVVYDRWAEMSQELPTAAEVAERQKQRENEKA
                     KRLAERAMANSGDDVIEDEESEEEEEVEPMPEELVYDTLEDYHGELGDGGVGVVKRIG
                     ELGVYVGPRLPDGTKQGLGQTLFPSGDCYTGEYKENQRDGRGVYWWSKGGALYCGEWF
                     RNMRHGYGRMVYPDGSRYLGRWVHGKRSGKGRYVYADGSSYDGAWVKDEKHGSGTYHL
                     LDGSSFIGTFHHNRFVSGEWRLASGTVRYIGNFENDAPAGAGVYVHRCGLKPGTFQQE
                     GTYSAEGKSWVPSMLKCTSRMVPHIELVVPPQPSGSTRVPMEFGAECTGRTMADLIKV
                     ANYAPLLRWVASLTSAAKDLVVGEVELKGVELRGVEVQTMRYDAADPDAITEVTILPI
                     LVDNVGKRVRPPSEAVTLKPSVTRLMVLLEAPGTEPVVLLEKSLQSASPDEHHQQSRL
                     PAVRISEDSSVGGDVVDAVGPALRLQLASTNSMALLLPPMRCNPMQGNAEESVWMYAQ
                     EVHRETVAQLEHKLELLSAELPEASTTYVAVPLSDVTSISTDAMTAMAAANVQQRRAA
                     QTLPRATVAPQRPPTPPPPTLEPRPELQPLYDAKARRDEAELEE"
     gap             397196..397294
                     /estimated_length=99
     gap             398593..398691
                     /estimated_length=99
     gene            <399211..>400935
                     /locus_tag="LDBPK_051090"
                     /db_xref="GeneID:13391625"
     mRNA            <399211..>400935
                     /locus_tag="LDBPK_051090"
                     /product="double-strand-break repair protein rad21
                     homolog, putative"
                     /transcript_id="XM_003858248.1"
                     /db_xref="GeneID:13391625"
     CDS             399211..400935
                     /locus_tag="LDBPK_051090"
                     /codon_start=1
                     /product="double-strand-break repair protein rad21
                     homolog, putative"
                     /protein_id="XP_003858296.1"
                     /db_xref="GeneID:13391625"
                     /db_xref="GOA:E9B8J9"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:E9B8J9"
                     /translation="MFFSTYVLTKKGPLAKVWLAAHWDKRLTRHEVKVVDLSQTILHI
                     VRPVVPIALRTSGELLVGVVRIYALKVKHLLKEATEATLFLRVTTLATKGSKAGVAGQ
                     HRTTSIDGVVVPVKGSDVEAVTFDWNADVAAKHGAVADAAEALGEGRFNAIADLLGNS
                     HRIEVSETDKEDALLASAWYTVQPTSQAAGDELHTMQQDYDEIAKMRADLMAFGERAS
                     GSASTSKSKSSLSSMEKGRGSVAVDVDGMAFPAVGDELDIGVPLPDELPPGFPALDGQ
                     VPAGMIPTDPFLLPDMMNMNDEAAAAAQRSRPGRKMRPVNVCDLDSTTLSREAFEKCI
                     ADRSDILNSEPRRGPYDAQEEADRYTVTGSANAANAVATNPAMDAAPLSGVLNPALRL
                     AYATALRQSAEEAVAMAAQAFRESMARRSEVPAGVGGALEADDAQVAAADLDGSSTLL
                     PEEEVAQQRRKRGRDDSYGVDDSTMAAGVSASAQQTLERIRMELSLRAARDRKKPRTQ
                     SVASLVGASCALREVCRGLRRRDAARTFVDVLALASKQYVSAQQAPGSDEVQVTLNES
                     ALRLLAAA"
     gene            <403247..>403984
                     /locus_tag="LDBPK_051100"
                     /db_xref="GeneID:13391626"
     mRNA            <403247..>403984
                     /locus_tag="LDBPK_051100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858249.1"
                     /db_xref="GeneID:13391626"
     CDS             403247..403984
                     /locus_tag="LDBPK_051100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858297.1"
                     /db_xref="GeneID:13391626"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B8K0"
                     /translation="MSKYANPEYWEDRYRSNDTTFDWFVTYDNLQTILRPLLQPAEQI
                     RVLVVGCGNSRLSANLYEHLNIKKITNVDVSPTVISQMQRRYSEMNEMQWICADLLTT
                     PIEKLMLELCPNDYLYDFIVDKGLVDSILGGSNSFHNLYTFNKNMSRLLKRGGRFVVV
                     SYGSPETRMDHFRRKKLNFDVEHKLLEKPMLSSSTASPTGHYHVYIMVKVGAKQGVGV
                     AVAAGDAESEDDDDFYDRFMTHNSAAN"
     gene            <407928..>411659
                     /locus_tag="LDBPK_051110"
                     /db_xref="GeneID:13391627"
     mRNA            <407928..>411659
                     /locus_tag="LDBPK_051110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858250.1"
                     /db_xref="GeneID:13391627"
     CDS             407928..411659
                     /locus_tag="LDBPK_051110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858298.1"
                     /db_xref="GeneID:13391627"
                     /db_xref="GOA:E9B8K1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9B8K1"
                     /translation="MYSKAEDSSHDTPCSGAAETATTTKRLPSFVVTSSNDATFTKPT
                     TPAKTGSSITLNPDAQEFRVTPAFAGTLFSMPSAAAPAPPQQRWFQPAMDFSTRPTAG
                     NNGTSQSGSSPPPASPSASAASDAMDNRQLVELTEAYMHQLYDRKCDDEKLHMVSVFH
                     LHPRTTDKQLSRIFFPTGASAAEVLEPRMMPEPLAKAFLAVRQRAGVVFFTRKDFAMV
                     GVEKVHDFVPHGQHQPLVVRYCGPDHEATPLSGSPLPPRSQSSEPLRGGALSSAKATS
                     PRPSGRPTPPQSRHRDASDPSDVFPASVVAVPPLSGGLESIASAGTTTPALDAGANST
                     ATYDSIDHHFLQKYAGEQVYLVGVHNLAYGTTPKSLFKMFYPMGALNSELLPRPVSVD
                     GKLRCSGVAVFGSKGMAMEAAEKMNDFVPHGQRRPIVARFLKRTTSPAFASSAAPGNG
                     SSITGSAYTATAATASTPRGSISSPSPASGISSAAALLESVEKQLRSKSLNDSQLAAD
                     MAALVLCAESGEAEARKLAAVLRDVLLSMGDHSTILASPLSGALRTLHSTLGIRVRTA
                     PATPADASLSVRKGVLFLQQIGRTLMMLVADTEAARQTRIVAAVQCAYLYQYTYLPKT
                     PLCFAATLFRNCERELREAREFLCREPNVPSSLAEEQQHRPWITLMDALHEMVSVWRS
                     LDPRTYAQDAVREEYERFVCEFRGMDMKRSSPVTSTLSAAAVAAAGGGEHHSGACTPR
                     NDALEVPAEAANHTHSAKGYGGSSVNASAKKSQFVTPSARPTPRRVVSKSYSTTSDWK
                     VKQSTPLAGPNCAVPPQVMLTSPASDYTQGASEFSADSNSAGTAISSALRSLGLTPQH
                     PSMRFNWGSRLLSAAPQPGMPPNPTVSAAAMLPATPTLSAPASTSATASAASGAPTAA
                     ATSAERSDATMTERTVYITKLPSCLSAGQVRRLLLHFGDFRKVRLCHDDKETTRIGSA
                     EALAAHNLKFDQLCFGFVEFVESGSAKAMVEFFRNEVHTPSAFDFLRSKDVHGFDDTE
                     LNQLRNTRTSQARNPIHDQQSLDATRTQPCLFGIIQPHHTVDTYSDAITAEEVAEAVR
                     QLHRGEEEGAQQQPLPMCASPFIHPTVFTSTPYSMAVSKGVSFESPVAATASATGDNS
                     YDENDGGGSVVAALQPMDAVHFPRGFPYHEVFAAAASQTGDGDGAGHHDNGAGSSGYL
                     PSDDMDLYGSCAPVIVEEEEDEVEGLQEYQVQQILQLLS"
     gene            <414840..>415178
                     /locus_tag="LDBPK_051120"
                     /db_xref="GeneID:13391336"
     mRNA            <414840..>415178
                     /locus_tag="LDBPK_051120"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858251.1"
                     /db_xref="GeneID:13391336"
     CDS             414840..415178
                     /locus_tag="LDBPK_051120"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858299.1"
                     /db_xref="GeneID:13391336"
                     /db_xref="UniProtKB/TrEMBL:E9B8K2"
                     /translation="MRYHRGLTAHVALSVFLGAGGAQARDGSDGVMENFSIFLFLFIG
                     GIALGAVIMLPIACLRWQGLPLELQPRERCMWETAPSSKMSAANLVLMSKIKTDTLDS
                     KKNALRAGVL"
     gap             416309..417012
                     /estimated_length=704
     gap             417694..417768
                     /estimated_length=75
     gene            complement(<418260..>419786)
                     /locus_tag="LDBPK_051130"
                     /db_xref="GeneID:13391337"
     mRNA            complement(<418260..>419786)
                     /locus_tag="LDBPK_051130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858252.1"
                     /db_xref="GeneID:13391337"
     CDS             complement(418260..419786)
                     /locus_tag="LDBPK_051130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858300.1"
                     /db_xref="GeneID:13391337"
                     /db_xref="UniProtKB/TrEMBL:E9B8K3"
                     /translation="MKSFFSKITSMLKTRRTPLAPCDCSDFIEAAPAQPSLTHLRGVV
                     AARHFHGAPPPASAVEKARRDFVVRSTVFDLQYRCGAGGRCTCAGAPTCRFPQCFTMR
                     PVTKGAEVLAERQVYEVEDAPAPEIRALVALAAEEKLEEVVKGIQHTVDAHLKAGARG
                     RGLEARFIIDGSDGHEFTPATPKTGTDSIHAGANPLREDEDLREEITSLYLWRAALLV
                     NLRRDEQAVSSLLNLAFAVEQKDRTRLYGAAAAWAVLNDMEIIYYRSLVKSCKPFDQA
                     VHFATERPLLLARVFEATRGDDYHTDYCTHVVFSKEVTATVTRAQTAQMHGDFTEDPM
                     RSLCLPLTMPYYRFRVDEEFWKRFYALLCMPPVPPPTPEEAKAQAIDPAAELGLTPNY
                     ILDAVGRSMMLHHLVTFADVRDKEIDTGVVVDRVKEMKLLDLQPHPSDYAPVLTTSEM
                     HVAATRMKELLVVVRSFEAKEQERLSGAAAAQRLQRAQSSNDAPNPSAAPPAPSPIEK
                     "
     gene            complement(<420582..>421655)
                     /locus_tag="LDBPK_051140"
                     /db_xref="GeneID:13391628"
     mRNA            complement(<420582..>421655)
                     /locus_tag="LDBPK_051140"
                     /product="vacuolar ATPase subunit-like protein"
                     /transcript_id="XM_003858253.1"
                     /db_xref="GeneID:13391628"
     CDS             complement(420582..421655)
                     /locus_tag="LDBPK_051140"
                     /codon_start=1
                     /product="vacuolar ATPase subunit-like protein"
                     /protein_id="XP_003858301.1"
                     /db_xref="GeneID:13391628"
                     /db_xref="GOA:E9B8K4"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR016727"
                     /db_xref="UniProtKB/TrEMBL:E9B8K4"
                     /translation="MGRTMMDYNVHEGHLEAMVHGYRDALLRVDEYNNLCQCDNLGDM
                     KSQLQITDYGNFLQQEGTLTSRIIVDRAQEVLLKQFKELRSWAEPPLCQFLDFISYEY
                     MLSNVLKLIVAKRSGRANLELLTKCHPLGVFPEMPTLIAASDVQEMFEVVLIDSPVGR
                     FFSAEGGFERDLDELSVEYIRGILMKNYYEQFYDFCYNLGGETREVMCPLLDAEADRM
                     VLTFTLNTLGMREITPVDRRKVFPSIGSLVDIHDDIAESENEDQLRDRLRRFANYFEL
                     LDEGSRAMDSACKKSLERRFVEMSVVMYNDAMTRQFQYGVFYAYVKLKELEINNLQWI
                     ADCVVQQMRSRLHEYVSTVPYAQ"
     gene            complement(<422396..>425146)
                     /locus_tag="LDBPK_051150"
                     /db_xref="GeneID:13391338"
     mRNA            complement(<422396..>425146)
                     /locus_tag="LDBPK_051150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858254.1"
                     /db_xref="GeneID:13391338"
     CDS             complement(422396..425146)
                     /locus_tag="LDBPK_051150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858302.1"
                     /db_xref="GeneID:13391338"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9B8K5"
                     /translation="MHVSLERRNIYELGEVHSRIYGLKAAAIPTTVKLNLSHNHLRNL
                     QRPFAHSSQGDVRVAADTDTAVSSSLGTASAGASHMSLEEESSALRPFTSLTHLLVNH
                     NQLCSLVGLGGAADTLTVLIATHNALTSVDGMQACRRLAYVDLSYNSIESLQGLPLML
                     ATPSREAASLNSPTAYDVLHKVASESTAEPSHGGASALEGVALAAELIADGTAAKESE
                     EIAFEHVDGDDNEGHTPISTASIPISLQSSVGAETHQRSHAPGGAGHPNHHYRTCCSR
                     QQQQQPPSDRSLGGARSFATRPSRSAETSIQLDVGETTISLSACASAATGAHAYSQPV
                     AAPAAADASPLLPGAKSGSGTVDSDKVGVVLILSHNRLRGRSLPGIVWVESADAEIGT
                     AQGGAPSSTHPLLRPWCTALTHLDLSHNYIEDARDVRRLFTPIRWPSSPSPSSAAAVT
                     CAPALARLRCLDMSGNPCLVNGSLADELARSARRPTIEPASDRQSDEAREQQRPVRTT
                     VGDDDRSVLSSVQFRLNYASRTLSAAFRGPSPLASAAAFPSLAAAQRSMDALLTSLAD
                     RWQCTAPSSSAPATATMFSLFSPVDARVVVEKAPQPCTVHLRGGELTVLAAALQQRGA
                     RLGEMLEVPASAPGLYAKRAAVSPTPNRAGSGHSPPPSSNSRNGGDAHTAVAMAAGAD
                     ASRAIFLTPPPRWTRDTSVGVDASVLSSGGGPSPPAAQQPATRMAQSSAPPTPPRAAV
                     VEASQDALSTSSSSCRAETSTVGYRLFQGRGHQRQPGPVADQSARYSGTAVAHLDVTA
                     GSGTAAVSHAATASLSADAVELQLLRAEVVELRRRYRELQRQTHDQTCVLQRQETTIR
                     ELKKTAALAQQEAQAELSKAQLEIRRLHAQVQMLNDLAAQAAPPQPTLSVPLQLPPSN
                     GL"
     gene            complement(<427525..>428274)
                     /locus_tag="LDBPK_051160"
                     /db_xref="GeneID:13391629"
     mRNA            complement(<427525..>428274)
                     /locus_tag="LDBPK_051160"
                     /product="elongation of very long chain fatty acids
                     protein, putative"
                     /transcript_id="XM_003858255.1"
                     /db_xref="GeneID:13391629"
     CDS             complement(427525..428274)
                     /locus_tag="LDBPK_051160"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein, putative"
                     /protein_id="XP_003858303.1"
                     /db_xref="GeneID:13391629"
                     /db_xref="GOA:E9B8K6"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:E9B8K6"
                     /translation="MKFADAVQCIGKESLCFHPELNVFVNYPVLIGCHIGYLVVIILL
                     YKFMEGRTAYVLKYPMMLYNTAQVALSLAMAINLGQFLVCGVFNLNGRFTATIEYWIF
                     VHYATKFLDMFDTYFIVLRKKEEQLSFLHIYHHLTIGFIWGLLLHHGVANGTAFFGAW
                     INSAVHALMYFHYLYTSLGYTNPLKKYLTQVQMAQFAFCILHAVLAVVAHSPIPKKWA
                     VLQLCYHMTLLYLFMQFYRKNMRKLKRKAKA"
     gene            complement(<428849..>430225)
                     /locus_tag="LDBPK_051170"
                     /db_xref="GeneID:13391630"
     mRNA            complement(<428849..>430225)
                     /locus_tag="LDBPK_051170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858256.1"
                     /db_xref="GeneID:13391630"
     CDS             complement(428849..430225)
                     /locus_tag="LDBPK_051170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858304.1"
                     /db_xref="GeneID:13391630"
                     /db_xref="UniProtKB/TrEMBL:E9B8K7"
                     /translation="MHMSARHRLTNASILSNIKSMANEKDDLTSKLVYLRRRQEDAIA
                     FAVKEKEMLAEKAKRQLAVEEEKLKVEARIEALISEAAQLGGPAAAQRMRDEIAKDKS
                     RYVRSVDAFGDKTVRLQHTFAGLADNRIIHWWEYAYWNYIRYFFTQELLIAKDRFGNK
                     FTVTWQFLKGREEQRRMYRKDSNKKHQPYGALATDERLWERWMRGHRGDPPSVAEEEH
                     LRDYKKQFFGAMVLEDEEVEDALMRLMAHMNRASQTFQELDEDQVYGDAHRVAKPLRE
                     TERKPGEEMSARQKQKGATWTLGFARGDLFYNEEETQVMRTEMGHLFRNMEWQELEYK
                     RQVRMNKQQPPHGKPPEGTTDPNTPDGDPMNHYWERTDLGIPYHDAVPDLTTPELERM
                     RIESSQLEDERLAIRKELGLTDLGDIREGREPIKRDHAPFQPPPVSQRWKPKCWEESW
                     GTGSGMKY"
     gene            complement(<432115..>437994)
                     /locus_tag="LDBPK_051180"
                     /db_xref="GeneID:13391631"
     mRNA            complement(<432115..>437994)
                     /locus_tag="LDBPK_051180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858257.1"
                     /db_xref="GeneID:13391631"
     CDS             complement(432115..437994)
                     /locus_tag="LDBPK_051180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858305.1"
                     /db_xref="GeneID:13391631"
                     /db_xref="UniProtKB/TrEMBL:E9B8K8"
                     /translation="MSNKKQTWANAHSQLWTSSVARSAGSRTQSEVSSIASTNRDRSL
                     LDDADGYHQPPSNVCPQELRHQAYQPNDKTLAQVSDILESYGAIACDADIPAVLLEVV
                     KELEREKRDNNFKDLLLREYSDTVQRRFGLYGEESPPSIAEVSARLRDGAPARPVAAP
                     NPAWLEQPLNELWRTVCDGMQACFEKNADLSAPVLLPEARRTKANVSQLLHTSCGVLT
                     QLAKEYTTAKAAVMKKMESTVAASQSFRQLTLSAALSELEAQQELKGSASEDGGASAM
                     GGSHTVGSALQSLIDVVPASLQIHFNLQVPEAPVLTRCSNLTELIRFLLSEYLSMERY
                     MEMVEAERQRLAEVFYLPSSKADANGDLQLGEALSRSLRSLQETVTSVVAFPHHISEE
                     EMALRHSSAQAVEELAQLLVDARRGGSVSGSCTPHSVAAVRVEPPTRNLLEMVELVKS
                     RFATVTAQQQRRELAGAQGRVGLAHMEESMTKHGKHVVQLLRDLCVAQEDAAADSEVS
                     EQLLVEVMGNVDLERNLTPAKLDHFLSDVVERLRMVKTKYQRALNAAAAGKARAEAAS
                     QKSTGLQKRLQKVAAAVERIGRDGLGLTFPSTPAASGIGSAGEANDAGKGRDDAEDGR
                     RGNGVSALRRLNLRPALEPSTATKTSSLTTTKDGTANEANTPGAAVTEHNVLEALQLV
                     ASRIGTSGEVRDWAVVQEELAQLRAGKARWKADTSAFHEAMAMLMQRLAKNGQMVKQT
                     LFLMGTDESAEDELVEEVLQRGSEEELDSLSAEAMEYVERSLAELLQKYNRWAQRLLQ
                     TTEDHLYTQRKIVKYFAAVCRFFSSQSRAAAEAPAEDIPEDNLYDIDSCLMRAADIIL
                     PSLDAAIQAAAQEQCPAPATATPDASATLPPLAPSSEDAATSGATSRQETLVQLARDS
                     TAAATGGVLPYDHRIARLYETVARLYTAVTSLLQVHYLCIPSASRRRSSGETELMFDG
                     DANDDGFVDIDLDRLIRVSQQRSAAASAPPAAARRDGVERERFSKEGHGGHSAGKTPT
                     PSPPSTIAANNDLILRVTYQNMEVLQDTLKRFSANHKMAAIVLQKDVDTMQQLLAGML
                     ERYSEVDMDGAFGQSRETLHELYVTLRDRGQRQKGCYFFNRVGGEGSCTWVTALEHLA
                     EGFRGVVDRLVQRTTLAAEYRRLVDEVVDVCAMYMNWAERRTLPASHALPPELLALCV
                     RDGSEVTAKPTVATMVEGGQSSYPGGDVEASTKPASGGTTTINATTATVAAAAAQRPP
                     KPSRTPPLTPRASNKEQQERQQQHQAGQERGAVVPTAATAAETKISHFTNDGAVLKVM
                     AHMFHLAQLAVESPPATGNKTGDAAAFDADAKVQQLTEEMQLLREAVAIAEHHVDELT
                     DAKHVVELQRDQAQSEAAVARAELRRWKRQQQQHEQKQCGRTPAVADGAQVHSPPRSP
                     REAASTHQPGKTADGIGAVIDEATVKEVMEYMRVLSEELQMAKKRVSGSSARAHKLVR
                     SPCQTASSLRTSGAVSKDYADVVREEDGEDGSAADGDEDAPYGAPHSHRHRRSYAELA
                     EQLRHQYGSTAIAPMIVIDPKTHSYSNSQRRSGHTRDGSSEASHAQNRYSPVKYRGPE
                     YDACDRYYARELAQVLIEEGKHAAHSWRRRSIDARHPATTKPAFSGLSFAPTSQRHLS
                     GESSRGAAPPSARDLDVCHLGGSGNSAAAAPHRRYPPRSLSRDEPLLSPGAAAASASL
                     ASPHAYHAPQRAISVAAAAAPSYRLSPKSATPGACRHSSGNALFSTPMEACAHHHRGH
                     YDSGDNRPRCADTEGEEVFYDADTPRAQTGWRWSTPSWAAPQPRRRPSAARERLCSPH
                     EQSTKASILSQQRCPKVHDGRCEPPEDVGESLAAAVRQFDAVTQRTTATPTRRGSQAG
                     SRQDTLHGSPVSVPPASTAAAPASEQQMSRNANLRAAALRSLAEVVSKTAVPTTRRAR
                     F"
     gene            complement(<438393..>438800)
                     /locus_tag="LDBPK_051190"
                     /db_xref="GeneID:13391632"
     mRNA            complement(<438393..>438800)
                     /locus_tag="LDBPK_051190"
                     /product="prefoldin subunit, putative"
                     /transcript_id="XM_003858258.1"
                     /db_xref="GeneID:13391632"
     CDS             complement(438393..438800)
                     /locus_tag="LDBPK_051190"
                     /codon_start=1
                     /product="prefoldin subunit, putative"
                     /protein_id="XP_003858306.1"
                     /db_xref="GeneID:13391632"
                     /db_xref="GOA:E9B8K9"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:E9B8K9"
                     /translation="MQQVHPDIKKLNDLLRPILKELQEMGDKKGKLIEARRQLGGQKN
                     ENELVRDELNRLEPDATVYKLIGPALVPQDQSDAKTIIGNRLDYINGEIKRSDTSIAE
                     LDRKEAELQKKAQELYRKMQERQAQLIQQQQQQ"
     gene            complement(<439764..>440954)
                     /locus_tag="LDBPK_051200"
                     /db_xref="GeneID:13391633"
     mRNA            complement(<439764..>440954)
                     /locus_tag="LDBPK_051200"
                     /product="protein phosphatase type 1 regulator-like
                     protein"
                     /transcript_id="XM_003858259.1"
                     /db_xref="GeneID:13391633"
     CDS             complement(439764..440954)
                     /locus_tag="LDBPK_051200"
                     /codon_start=1
                     /product="protein phosphatase type 1 regulator-like
                     protein"
                     /protein_id="XP_003858307.1"
                     /db_xref="GeneID:13391633"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:E9B8L0"
                     /translation="MFSNLDEEKKARLRERILQAAAAPPSAATPARSNSGSDGEQEVP
                     PQHTESTKHASEQLAINAKSTDIDIANIRLFTLDELDLNQLTECKTLSLRKNLIHELS
                     AFPQHLAGRLVELDLFDNKIRKVRDFFDSAMVPDPESGSLSKKAVPHAFYSLTKLDLS
                     YNQLRKITGLDSLGSTLKELYLVENKIKVIEGLDSFVHLELLELGGNRIREIGSGLSN
                     LRSLQSLWLGKNKIHSIGDSLHNLRELRKLSLQANRLASITEEAFKEGCNPYLTELYL
                     SENGISTIENLPLHSLHLLDFSFNPISTINEAVINPTNMPELEEFWLTDGNINDWGEV
                     KKFCGFANTLRTIYVERNPIEQDKRYRDKVYMNLPFVTQIDSWPVVNKGNLEADRLIQ
                     RRAS"
     gene            <443323..>444177
                     /locus_tag="LDBPK_051210"
                     /db_xref="GeneID:13391634"
     mRNA            <443323..>444177
                     /locus_tag="LDBPK_051210"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858260.1"
                     /db_xref="GeneID:13391634"
     CDS             443323..444177
                     /locus_tag="LDBPK_051210"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858308.1"
                     /db_xref="GeneID:13391634"
                     /db_xref="UniProtKB/TrEMBL:E9B8L1"
                     /translation="MAFSLFSLIGTAAVALLLVVAAPSSADTITVNAATQAWLKMWIK
                     SIPNLQIIWLNPNICSRAGIECVSATNSINIRLDGVTSTGFNFIGTLPEVDSSIDGNE
                     LQITSISVRGKARFTGTIPASWSRITRLTRLDFSRTRMSGRIPDELGSLATLVSVDFS
                     NSYFCYGLPNWNASSMPMLSQAIFTNNNMRGPFASSWSTFPASLKLDITGNKLCGCMP
                     SSWDSKSNLVAAAKAMDAGTVSNCFRSCNSASLSYCPAPPTGNGAQMITMTTAVVGLV
                     VAVASLVF"
     gap             449041..449139
                     /estimated_length=99
     gap             450613..450711
                     /estimated_length=99
     gene            451094..451349
                     /locus_tag="LDBPK_05snoRNA1"
                     /db_xref="GeneID:13391635"
     ncRNA           451094..451349
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_05snoRNA1"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966701.1"
                     /db_xref="GeneID:13391635"
     gene            451401..451467
                     /locus_tag="LDBPK_05snoRNA2"
                     /db_xref="GeneID:13391636"
     ncRNA           451401..451467
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_05snoRNA2"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966702.1"
                     /db_xref="GeneID:13391636"
     gene            451501..451554
                     /locus_tag="LDBPK_05snoRNA3"
                     /db_xref="GeneID:13391638"
     ncRNA           451501..451554
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_05snoRNA3"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966703.1"
                     /db_xref="GeneID:13391638"
     gene            451620..451694
                     /locus_tag="LDBPK_05snoRNA4"
                     /db_xref="GeneID:13391339"
     ncRNA           451620..451694
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_05snoRNA4"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966704.1"
                     /db_xref="GeneID:13391339"
CONTIG      join(FR799592.1:1..452426)
//
DBGET integrated database retrieval system