GenomeNet

Database: RefSeq
Entry: NC_018235
LinkDB: NC_018235
Original site: NC_018235 
LOCUS       NC_018235             505720 bp    DNA     linear   CON 18-SEP-2020
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 8.
ACCESSION   NC_018235
VERSION     NC_018235.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 505720)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 505720)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799595.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..505720
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="8"
     gene            <3126..>6722
                     /locus_tag="LDBPK_080010"
                     /db_xref="GeneID:13392015"
     mRNA            <3126..>6722
                     /locus_tag="LDBPK_080010"
                     /product="adaptor complex protein (AP) 3 delta subunit 1,
                     putative"
                     /transcript_id="XM_003858518.1"
                     /db_xref="GeneID:13392015"
     CDS             3126..6722
                     /locus_tag="LDBPK_080010"
                     /codon_start=1
                     /product="adaptor complex protein (AP) 3 delta subunit 1,
                     putative"
                     /protein_id="XP_003858566.1"
                     /db_xref="GeneID:13392015"
                     /db_xref="GOA:E9B9M1"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:E9B9M1"
                     /translation="MFIKNIIISGFRSYREQSFPDGLSPKTNVIVGKNGSGKSNFFAA
                     IQFVLNEKFANLRAAERKELFHVGSGRPALSVFVEIVFDNSDGRLVIPGRAEEPEVRI
                     RRTIGLKQDEFRVNDRKFSASDVHQLLESAGFSSSNPYYVVEQGKIVSLVNMSEEERY
                     QLIKDVAGTKVYDARRAESEHILAETKGKQGQITESIGELQRRLKELESETAELKQYE
                     EADREKKCIEYCIFNSELEAANDALLKVEEEWNKQSTLFNKSQDVDEASEQKISNFSQ
                     KIMDISTDIARLEMERIAVAKDMAALTSKQAVVELDASEAAGRFARNNRELEALCRED
                     RELSATIQTVAADIEKKKSLFHSSEEAANKKAAEVEAQRKVLERLQERRNRTKLFRSK
                     VERDKWVRGEIQKNEDSIRKSQEELVSVCREMELVEKEAAALSKEISAPNLSTADVDQ
                     SLRDHDERIKAALCQRDQLNHQRRQLWQSVHRQESVVQRLDEELRNAKQLWERAVRQD
                     IRQGLQSLSEVLHDMRNPVLSAAVQGPLIDLIEVADGYKTAVEITAGNTLFNVVVDSF
                     EVSTILLAEMNKRRKPGRVSFFPLDTCSGKALDIATTPECSPLLSKIKYDTRFKGVVT
                     EVFGRTAVVASLETAATMVGKLQWDVITVEGDQLGRKGGITGGFIDKRHMKLPLRERE
                     RELAADRQTARAKLDGLCQEVATVEQSITEVLNELEALRNQNMSTEREADARLRETRL
                     MEDRRSCLATLKSNLVATKKAVESSVAAATETVRELKRELSDEFKSAWTPEEEKRLEQ
                     LTEEVAAARVASSEMQASTLQLATEVQLLEDTARHVERRKAVVADRIRELSWSRHAGS
                     IAGGEEAAVKAEFELLSQRLQSIDHDLEQEAREREKLQSQLDALTSKRLGAARSLQER
                     KDVADRTQMQRSVLVQRRDEALQKIRQLGVLPQGVAKFESASLGKLMYHLKAANEKLK
                     ALSHVNRKAVDQYATLQEAMKDLTSQQETLAKELDSIHELMEHLDAKKEEAIERTYKQ
                     VQYQFEEVFKQLVGVESCSAELQLVASAAPNKKEDPYTGARIKVSFGLGNPVSHLDQL
                     SGGQKSLVALALIFAIQRCDPAPFYLFDEIDAALDAEYRTSVANMMARQSGECQFLVA
                     TFKTELLDVADKVLGIFFHNKMSRIQAIAREEGVRLLKQAALEDRKRSREVE"
     gene            <7730..>8551
                     /locus_tag="LDBPK_080020"
                     /db_xref="GeneID:13391949"
     mRNA            <7730..>8551
                     /locus_tag="LDBPK_080020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858519.1"
                     /db_xref="GeneID:13391949"
     CDS             7730..8551
                     /locus_tag="LDBPK_080020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858567.1"
                     /db_xref="GeneID:13391949"
                     /db_xref="UniProtKB/TrEMBL:E9B9M2"
                     /translation="MSEFFWDVGREEGSLQGPLLNAPRKRCREENYAVDAYPRHLPPH
                     VRVQVAWENITTLVSLRGHVLDAHGRFNSAEFPGLAFFYNPVVACVASGTVTLHFDNS
                     TSVTERILREERPLPCPIHGPFRCPCHIMHEAAGGVAQLLREIFCQHSPFDVSIDCHR
                     PYPHICIDSQSRTWSVSLVGLPLPPKSFGPFPLGDITSPQSIKNYWFQYIEKSRADED
                     ACIMCGVVSGIHCSRCMCRLCKRCGEHCANCWSYVCRGCSTAGENGTTICYNCPC"
     gene            <9584..>10231
                     /locus_tag="LDBPK_080030"
                     /db_xref="GeneID:13391901"
     mRNA            <9584..>10231
                     /locus_tag="LDBPK_080030"
                     /product="vesicle-associated membrane protein, putative"
                     /transcript_id="XM_003858520.1"
                     /db_xref="GeneID:13391901"
     CDS             9584..10231
                     /locus_tag="LDBPK_080030"
                     /codon_start=1
                     /product="vesicle-associated membrane protein, putative"
                     /protein_id="XP_003858568.1"
                     /db_xref="GeneID:13391901"
                     /db_xref="GOA:E9B9M3"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="UniProtKB/TrEMBL:E9B9M3"
                     /translation="MPIKYSCVNDETKLLAEHPAGEQPKLAETMQKVIATVPPKEYRH
                     KTIEDKDGGVNYNYISNGEGRIVGCVTTSDMRMRTVFAFLEAVEPLVRGSVGSQGAEL
                     RNGKKLLQQKMEFYNNPQNDKITALNDDINQVVDVMIDNMDKVLARGDRIDTLHEKSS
                     TLADQAQQFQQRSTELKRNLCMKNLKLTLMIVGAVVVVLIIILMIACKPNFSRCR"
     gene            <11985..>12674
                     /locus_tag="LDBPK_080040"
                     /db_xref="GeneID:13391902"
     mRNA            <11985..>12674
                     /locus_tag="LDBPK_080040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858521.1"
                     /db_xref="GeneID:13391902"
     CDS             11985..12674
                     /locus_tag="LDBPK_080040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858569.1"
                     /db_xref="GeneID:13391902"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:E9B9M4"
                     /translation="MDLADNSMWTLVEEAVIEDRGEDEEEVLAQMVRSYLARRGLTDT
                     LAAFDEEHQCYRGSSTAPHNRDPGAPRPSVDAEVLGSTPATDRASAGSAPPRDETSAG
                     MDKRKAAQLLCLQKRYEAAAALMEPSSLARIRLLCIQAQSLEDRPTAVFYLATHVAPL
                     VPFCIDPTMGHRVYTAALSNVLSPCRERSIPDTELLAREVNDELCGREQRSSLHVLFN
                     WAYWQETSNAA"
     gene            <13751..>13978
                     /locus_tag="LDBPK_080050"
                     /db_xref="GeneID:13391903"
     mRNA            <13751..>13978
                     /locus_tag="LDBPK_080050"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858522.1"
                     /db_xref="GeneID:13391903"
     CDS             13751..13978
                     /locus_tag="LDBPK_080050"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858570.1"
                     /db_xref="GeneID:13391903"
                     /db_xref="UniProtKB/TrEMBL:E9B9M5"
                     /translation="MASIKELNDRLTKQPYVSGYTPSADDAKLFNEIFGDNVNVVQWA
                     ARMATYYPSERSKMKPIPVESEDSSEIDYDD"
     gene            <15540..>16097
                     /locus_tag="LDBPK_080060"
                     /db_xref="GeneID:13391904"
     mRNA            <15540..>16097
                     /locus_tag="LDBPK_080060"
                     /product="phosphoglycerate mutase protein, putative"
                     /transcript_id="XM_003858523.1"
                     /db_xref="GeneID:13391904"
     CDS             15540..16097
                     /locus_tag="LDBPK_080060"
                     /codon_start=1
                     /product="phosphoglycerate mutase protein, putative"
                     /protein_id="XP_003858571.1"
                     /db_xref="GeneID:13391904"
                     /db_xref="GOA:E9B9M6"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9B9M6"
                     /translation="MAHIYVCRHGQDMDNVHGILNGHRNQPLSELGRRQAAAVADKIK
                     ESGVNYAAIYSSPLQRALETASAIGAAVNVQVQVRADLIERDFGVLSGKPYADIPKYA
                     GDRVLQGDKVLYFLEVEGCETFDKCYERAQSVLADVNAAHAGEHVLLVCHGDIGKMLQ
                     AAKAKVEWQEGLRLPYFANTEVIKL"
     gene            <16706..>18595
                     /locus_tag="LDBPK_080070"
                     /db_xref="GeneID:13391905"
     mRNA            <16706..>18595
                     /locus_tag="LDBPK_080070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858524.1"
                     /db_xref="GeneID:13391905"
     CDS             16706..18595
                     /locus_tag="LDBPK_080070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858572.1"
                     /db_xref="GeneID:13391905"
                     /db_xref="GOA:E9B9M7"
                     /db_xref="InterPro:IPR007374"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="UniProtKB/TrEMBL:E9B9M7"
                     /translation="MPPKRWARPSQKGASGENAYTTAALLQFICDEVRSNNCLGLSEE
                     ELTGMAAELVHVKTRAEVSEWAKTLMLSDAFAAEVTKRREQSGPAFEAESVLNAPSSS
                     TASAGGGEGGTLNVTKRGAGGAKRGKRGANADQNPKTSASAEALKPGRFECGCFATVH
                     NLRGSCANCGRVICEQEADDVCYACGLEPSRCIAYEISVQEGKLSEAAQQRNEEDYTS
                     AVERRDRLLEYAQNRAKRTTVIDDQSATLFSPQSAWMSPEERRAAEKSAAETERQRNI
                     ELMHRQCGAYQVHMEFVSQNLALGARKENSGGAGGDGAVTEAGAEDEEPHDAGQRVVP
                     TGAEPLPSLLQKIWYSPDGTRVESAPSGKKDKRGGGRCGNAVDLNLPAQEGSSMPMTS
                     RPTQRRFEEVSRRVQQSYFEEDVEVFAEEKEEAEKTKSKLIVVSQALIEDDQDAAIEH
                     GTEAAGGSTSPPLVDPSAVALPSRFAVTSIMRNTDDGICLSMHQPWASLLVAGIKRHE
                     GRVWGTTYRGRLWIHAAASQPINVEEVEAQYSKFMPPGQVFPKHYPTKVLLGYVYVTD
                     CLDREAYEIAFKPEERQEESPYSFICVEPKALLFPLPMCGNHKLFSLEHRVHVAARKQ
                     LGEID"
     gene            <20033..>22090
                     /locus_tag="LDBPK_080080"
                     /db_xref="GeneID:13391906"
     mRNA            <20033..>22090
                     /locus_tag="LDBPK_080080"
                     /product="ATP-dependent DEAD/H RNA helicase, putative"
                     /transcript_id="XM_003858525.1"
                     /db_xref="GeneID:13391906"
     CDS             20033..22090
                     /locus_tag="LDBPK_080080"
                     /codon_start=1
                     /product="ATP-dependent DEAD/H RNA helicase, putative"
                     /protein_id="XP_003858573.1"
                     /db_xref="GeneID:13391906"
                     /db_xref="GOA:E9B9M8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9M8"
                     /translation="MNYASIRTDFYVVPPDMTNLTAQEMRELLRELDGAKVHGKDVPR
                     PIRSWHGTGLPDRVLEVLEEHEYKCPFAVQSLGVPALMSGRDLLLTAKTGSGKTLCYA
                     LPLIRHCADQPRCEKGEGPIGLVLVPTQELAMQVFTLLDELGEAAGLRCVASYGSTSL
                     SDNIRHAKAGCELMVATPGRLLDLLTVNGGKTLSLSRVSFVIVDEADRLFDSGFMEHV
                     EAFLKNIRPDRVTGMISATMPKELRGVVAQHLRNPVVISVGGKPTPASNVEQQFFFFD
                     EEVYDANNIKADMSPRLVKLLALLGDEGGDGQNLILVFTQRKEEVDELLGRLTTLGYA
                     NRVATLYSGMDPIDREFALEHFVPGKQFILVATAVAERGLDIPYLGLVINYRLPNHYE
                     AYVHRIGRTGRAGRSGRAVSFFTRGKDDDIAPELVEGLERAEQRVPEELYEVAEKVRA
                     LRKSGDARYNSGFFRGYRDAKAQRFTDRDKKEKMREAARAAGLEQFLSSSSESDSDAS
                     SDEDANITAVPVQSRARAASAEEAAASSMALTLHRGAQSGALTLSAAQEDRISKALAF
                     AQKTTTAATMAADEATMVRFQSEYPINDLPDAVRGKLQSGAFMRSIAEETETSLIRKG
                     VYFDPRYKHSRRMKEGEKPLYFLIVGKSMEAVRAARNKLDEVKAELLSKQKKTGSVTG
                     ATI"
     gene            <23333..>26734
                     /locus_tag="LDBPK_080090"
                     /db_xref="GeneID:13391951"
     mRNA            <23333..>26734
                     /locus_tag="LDBPK_080090"
                     /product="adaptor complex protein (AP) 3 delta subunit 1,
                     putative"
                     /transcript_id="XM_003858526.1"
                     /db_xref="GeneID:13391951"
     CDS             23333..26734
                     /locus_tag="LDBPK_080090"
                     /codon_start=1
                     /product="adaptor complex protein (AP) 3 delta subunit 1,
                     putative"
                     /protein_id="XP_003858574.1"
                     /db_xref="GeneID:13391951"
                     /db_xref="GOA:E9B9M9"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="UniProtKB/TrEMBL:E9B9M9"
                     /translation="MSLAAFTQYSLAAVVRNLRSAPGGTEEEAVDRYIADTKNEVNAA
                     DPRVKMVAIQKATYFHMLGYSSQYADFRVVEMMASPIFLHKRIAYLAACLTFTEDTDV
                     IPLMTASLKRDLSSSNQFEVGLALYCIASICTPDMAQDVVADVVNLLGHPRAYVRKKA
                     TLSLYRVFLSYPESLRVTYGRLKEKLEDNNEKADTDPAVRGAVVCVLCELARRNPANF
                     LGLAVPFYSLLSSVHSNWTLIKIVKVFGYFAPLEPRLGKKLVEPITNLINTSGAKSVQ
                     YECLLAVANGMSQVSSLKKLAAEKIRGFVEDADPNLKFLGLEALSLLVASSENRKLLA
                     DQREVVLRCLDDPDSTIRLKALHLLRDLTTRKTVISHINEMLDRCVRTPPDEEWSNAV
                     IRTIIETAQTDDYEWIQDFEWYLSVLLDLCVVELTVYTHGGFMEQELVCILSRVNGVR
                     RAGVEEIVPLLTNVRLLGCDRQHSTQWRILCAAAFICGEYPHWVPDIAEACRALLDEP
                     ITLLPAEVQLACVAAVGKIAAYVYQPCARHVQLCNGEEECRAAEEEEQRIVPSLAELI
                     RTVLLPEADEASGAHDNTAADDARGAAARAHRGLRRFCHSAFPSVLERAHLVQYQVME
                     HPEVGPKLYEAALPPVAAGAQDAIELPEDVDLEAPFCENVAMLMALSGSDEDDGSDGG
                     ALGGYGGLGDSGDDDLDANFNLEYRIEQQRRSEQARREEMAPYYLRDSADAGVVVSED
                     FGAPSRPLRSAQQIGCDDGLVSHAGAVSQHRQHTRTRRPQKVFSINRQLSKPADYEEK
                     KAARWHRSKSPEEDEATRKLRGIDVTRALRADERLPETLSYAQLLQQQQHKGKGSDEL
                     YADAMVASHAAEAVQVTLYNERPLGLYLTVTGCKVRRDGFHLSGAVECVNATSSSVVR
                     DVRLTATPTAAFAMGDVTLRLEAVKSDMAEDASGGTSVTVAERLKGSATVRVPIVARL
                     SHLPSSFAEAPLSLNLSWTAERKHHQVALTLPLEYVYFAKPVLPGSVLTSHEYLEDVV
                     GKALAAAPIATAFVPCSKAAIMTGVMAAMPQLRLAPIDVFKDALSMYGLLHGRKSELA
                     HTHVAVLLQEQEVDGSKGILVTVRCHYPVLSEALIVKLAELVGAH"
     gene            <28648..>30003
                     /locus_tag="LDBPK_080100"
                     /db_xref="GeneID:13391952"
     mRNA            <28648..>30003
                     /locus_tag="LDBPK_080100"
                     /product="dual-specificity protein phosphatase, putative"
                     /transcript_id="XM_003858527.1"
                     /db_xref="GeneID:13391952"
     CDS             28648..30003
                     /locus_tag="LDBPK_080100"
                     /codon_start=1
                     /product="dual-specificity protein phosphatase, putative"
                     /protein_id="XP_003858575.1"
                     /db_xref="GeneID:13391952"
                     /db_xref="GOA:E9B9N0"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9B9N0"
                     /translation="MGGGATPATAGSQVVDLRALDPSPCPSRGSRSPLRSCHVHERGS
                     RCEDVPATQILEFLYLGSVKDAQDAAFLARHQIRYIINVSQEEYWSVDKKVQIFTFKV
                     DDSATADIAALFQPTRDLINSIRGRYYRYARGESSTRPAVLVHCQKGRSRSATIVLAY
                     LIYTNGWSVAEAMKYVGARRPCAEPNIGFMEELRKLQESLSFEERTRRYSELCWFMRN
                     LNAETSQSHVRELFEKRIGMVRHVVTYVVAGGGAGNVADGGTAGNCGDGSRVTVQRDT
                     RFSASWPAAPSTGDSDAADSLVAFDLGAALGKQNDGLDDQRAAKDSDTHAYKDASAAV
                     SLLRGPSTEKTMLCFVFFTCREDVLHGIKSGQFQQLLLQLPSAAGKQIKYATGPKLKK
                     IMTEHQSMSSSFVQDMAGFSDHATTRTGGESAAADADGAVQTQGVVAPASKEADVTRP
                     V"
     gene            <31039..>32970
                     /locus_tag="LDBPK_080110"
                     /db_xref="GeneID:13391953"
     mRNA            <31039..>32970
                     /locus_tag="LDBPK_080110"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858528.1"
                     /db_xref="GeneID:13391953"
     CDS             31039..32970
                     /locus_tag="LDBPK_080110"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858576.1"
                     /db_xref="GeneID:13391953"
                     /db_xref="UniProtKB/TrEMBL:E9B9N1"
                     /translation="MESGLRGGVSPSVPAAQPYYNDIASIRDLPTVPLTHQLPSPSRA
                     HALVVDGTEVEVQSDVVSVSQAAPNLCAFQQECQSLLALLNASSRPRRVTPPPSSAVA
                     PSQTPPSPTSKADSTGALEPAVHKERQPVTIPLAHEPVSTLSSAEESPPSPSVVSERV
                     GVGVATAAPAHSTTYAQLMQEMDDLAGLLNKEEEGFRGQHSAASRQHSETGATPAHGA
                     RGDYAAPIAPLPCVRVTSSLADTPEKQRRQAVSMHRRDRSQNPSLSPLLAPRAAELVH
                     APTSPLWAAQLLKWIIYLVEQRQSALQRIQAFEDARAPGRRGACAGTVAGESAATAPP
                     SAIRVTEGLLQLLRSLNTETGDVDKWTVSEKRHMCTRIANLLAEMTATEEDAMADLLN
                     DAAAGATLEREITAKEPSATVSAAPPPSSAVSEAYRQDMMDTLTLLDQISQENKTLKL
                     RVEEAQGQATRLGDEVERERSANMELGKYFDQLAADNSRLTAELSGMESKLRQAEAVV
                     KSVSQEELLRNQLDRQTLHLRDVRAELDDVKDESNTLRKTILQLRDALVRHRAVIDLL
                     TRRRRERERAAAAASRRSGSRHALSPRFQSPSMQLIEDILSGACDPPSSSSSSPPSAV
                     KYSCDDDAGGDFSAPSPPR"
     gap             33624..33752
                     /estimated_length=129
     gap             34900..35027
                     /estimated_length=128
     gene            <35982..>36794
                     /locus_tag="LDBPK_080120"
                     /db_xref="GeneID:13391954"
     mRNA            <35982..>36794
                     /locus_tag="LDBPK_080120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858529.1"
                     /db_xref="GeneID:13391954"
     CDS             35982..36794
                     /locus_tag="LDBPK_080120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858577.1"
                     /db_xref="GeneID:13391954"
                     /db_xref="UniProtKB/TrEMBL:E9B9N2"
                     /translation="MMLRGTSCALARSFRANLKYPSLVSYNKLPWEVVSHDSTKLHMH
                     LAPNYEQLLTLAAVTDVPHLALASHLIVPEAERLRVMPGVVYLLGGQAAHENPSTFTA
                     YRIADPTSLQYYGRIHHNLAPIRRVDMCTSADLRLLCLAMHFDGVLTTTSAGSTLDGV
                     TTASQEGHFSLFYFFRPNRPANELTQPFEKFYQHRPSLASLDAFNAASPGKAESWTPV
                     LQAPRRTAEKARLTPAEPYRPPQNYLMGLAERLGVRPGNAFGRRSLMWGTWF"
     gene            <38195..>41647
                     /locus_tag="LDBPK_080130"
                     /db_xref="GeneID:13391955"
     mRNA            <38195..>41647
                     /locus_tag="LDBPK_080130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858530.1"
                     /db_xref="GeneID:13391955"
     CDS             38195..41647
                     /locus_tag="LDBPK_080130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858578.1"
                     /db_xref="GeneID:13391955"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="UniProtKB/TrEMBL:E9B9N3"
                     /translation="MLSMFKNKKGFSVLFHGEVEARLSNRVTESSVLPRPSAQLCDTA
                     ARSKGSGVAQYQCQRCLKRFSALESDDETEAAYQCHRCQYPTCPQCRELAAGSPPWVC
                     CVCSGFKSMMWLLERTRAGPMLVTRIVEYCDPRGQRLMRSMFRFTLQQYQSPTPRPSI
                     TLMGRASDGRAGSGPPSSSRPASQTPPACPTSRTGTSSRLSGERSSARLSQVPASFGN
                     VRRPSPCTHPKRASLLRSVRRSHSDAALAFDAGAGAGTEDAAKENSPAAERGVRGSEA
                     LRRIEEAVGVVEYSPESKWRTPGDAGTEVENRDEPLSLLPDDGARFSLLEDRCTAVAD
                     IYSAGAPNVSSGGSTLRVVVVESEAPSPHARPSGHAAFQREALQPQLASTNGATTPTE
                     GEGVVLPATAALAPEASWRRLTPPQELCRLCHSVSPNSSGSGRSASPAPRFPTFGQFL
                     DEHVGIGAGDTHLPRESNVLVTVSPETENSDEDSGGVIELGGGRCDDRLATTHGKVNE
                     GLHTPRGVQPQTPLSTGGGSSGFRGGRRTSGLSEFTPTRVLDMSSARVTLHHRSSSRR
                     RTTRGSLQEIHAPHLYGNRSAKTSAAGNARRSGQMRDSRCMYDLPTQFGPHGKPASPV
                     SGQLRRQNAPLATRTAGRALGSDGRQRLVRQHSRTVAPLQRTASRNNELQRMPSRNGA
                     LARTNSSVAHLTRTASSHGCDPSFARVNSCTAHALASTPAERVLLTGGVGGRGRLQRT
                     DSAKLTGTGAGYGAAARTAPQRTAVLERAHFGYGTPAATSASSLYSSPLKRTLSSLSP
                     LKRTASHLCLRNDGSAPFGRRPYVARLTRSATTNIGFVRTSSATAARGGAPSRHGPGT
                     FTRTATGTNLFQCSRGRIYEGPRCRPVPTPLPSSAVVCGSGRSAPSIYYRAMDTSPLR
                     RVPTAARTATPTMGRRRFPTSTALSRTGTGTRNFERQQSNVLREPANRSLGVVRRTVD
                     PAPTLVGATRRKAVGSWLHRTPSATGAANAVAATPRTPRRYIIASVSTAATPAAVNGG
                     GSHSVSRPVLSSVASSPKARSSHGSNASGGTAGYSSYTGSAHAAAEKAGAVETGMGRA
                     SGQQCRPLVGATTVKGNAPSHVATLNRRATAVSASAVATAHRRTGRAAQASPFAGQNS
                     RLAF"
     gap             44120..44218
                     /estimated_length=99
     gap             45108..45206
                     /estimated_length=99
     gene            <45307..>47064
                     /locus_tag="LDBPK_080140"
                     /db_xref="GeneID:13391956"
     mRNA            <45307..>47064
                     /locus_tag="LDBPK_080140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858531.1"
                     /db_xref="GeneID:13391956"
     CDS             45307..47064
                     /locus_tag="LDBPK_080140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858579.1"
                     /db_xref="GeneID:13391956"
                     /db_xref="UniProtKB/TrEMBL:E9B9N4"
                     /translation="MLASAVSDAGVVVDVVVHRRASSSSLQGNVVADAAAVEAYECGD
                     AEAILLGDVAGPHLNMARASSASARTLPRNAGQQAEREPPIIDACFFYLCTPVNPRVT
                     QRVFHYLNIIPFGLHRPSEVFGVVGRHTNLGLVSGVTKDGQYRLVPYPPQQPQPLYLE
                     RVRHSPHFLYPHDYPATGTIDPSCLRRIRHESRSDRVQQATKNFFCRAAARQGWDVHR
                     PSNPCSTSVVQSANALAVSGGLTSPQLGVSRPRSRTRRRGSHAVPLGAAPSFPELLTV
                     IAPAAKGPYAAPRPPLEETPTPSSPLAAEFVPLSGHPDADDGPLPIMVAGTEESRELL
                     CTLAELQLPPTLALHEPVPPLRVGTRVIARRLGCAEALHMGTVLAVSFDVTYTVRYDA
                     DGGIDKGVLHSDVHVLNAEDEGDAQGRQRPWHRRARERSAEPCTVRDQVIVEVAQPPQ
                     RAVVMAALGGGRYQVAVAAAPVPLIEVEACNVLSVAPVLAGAVFAPPHHLTLFRQLDT
                     TGTGHISWKDMRHFILSWEGFGQPLSFRRLGEIQRDMCICKRSAGPKLLSKIPVQEEG
                     HQLSFQDFEYVLLRAANLL"
     gene            <47966..>51748
                     /locus_tag="LDBPK_080150"
                     /db_xref="GeneID:13391957"
     mRNA            <47966..>51748
                     /locus_tag="LDBPK_080150"
                     /product="DNA repair protein, putative"
                     /transcript_id="XM_003858532.1"
                     /db_xref="GeneID:13391957"
     CDS             47966..51748
                     /locus_tag="LDBPK_080150"
                     /codon_start=1
                     /product="DNA repair protein, putative"
                     /protein_id="XP_003858580.1"
                     /db_xref="GeneID:13391957"
                     /db_xref="GOA:E9B9N5"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:E9B9N5"
                     /translation="MSVEENVTPALADTFRTCSEFIGAVSAREMPDNPSVQLCILSIG
                     FDVEGAIAQLLHQRMARNKPHRRVYCVVVPGRLLPGAMTRFASAIEHHLALRHAGETL
                     TRQADASAAAASCLAPPIPVVAVEEGTGTKERCAVFQRGAVVVLTSHSLCADLLHRRL
                     AVELVGMAVLALPHSLLGSGRQEDALAPQTAFCAELLLRSGSGAAGGQRPPPIVLVSD
                     APVLMRSLVQRHHLGAERFVQQMHVGDVQLFPRFRLDFVRHFEELSRSPRRSLAVDRV
                     VAPVSASVLALDDLLAKIVLETLQELQRLEKQLHMQKSASGGDRAAWASDAGGSHPHT
                     RSFAARCAAAAAEADEDTGALRFLPRARLTASTAKDHLDYSGYPRSNTAKGTSAASYI
                     RHGWRAATQCDDKGILFSGISETAALSVDFSDLDGDLRAVVRCHESHWPYRLLTESLI
                     DVRRLRRAARGTAYTFLLELESVLERRLPRRSVYGTGTTPPAALWTLSSHFHDVVTVA
                     THRIGTVVYKRSAASVALSTPTKGEATRPASSAEDVVVVVDSSSDSEEKREGLQDVVS
                     TSATAAPPGQVATSAGRTMVPQLIPNVEEHETDVEVVVRLVVSWCRTVLRRAERKGNA
                     ATDASAAQPTLLLLTLGPNAVVRYTERLTNSLEAYQQLQLRRFMRVYQSKYGVELTEF
                     VEAQSAEVAAPQLATELFTSAEDVDDASSDAEGDVTTDEDNGTDGRRDLRAAASLRRR
                     MSSQGGRATAVTRRDASPSYANGSSSSQRVMMDIGAGAFHQALLSQLPPLLTRSGERA
                     DVRCDSEPQPAPPASLATPLLMLERVREGVVTLCPGCRGASGDGSATVPSPFERMPRV
                     LVFDASAMSATEMTMLLDGSHAALQLDVPSTAAPRMSGAPTNGPKGTDSVRTSLRVER
                     VVLARQELALLRQLEMAQDELPAERLSTIKVQLITTSLAELDFKKAVQAEQQAFESLA
                     HTKATLTGTLLVDQTSLRQTEEALESGMQVARSRLGPRKGTAVGRLAGTFLYAPALPP
                     PALPRVVFDEREFRSSLPYHLYRRGMELIPLTLTTADYVLSPEYAVERKSAQDYFQSV
                     MSGRIQRQLAALARKYAHPLCLIEFHRGIPFRLMQSGIYAKTAALMAAYPRVRFVWAR
                     SPAHAAGMLVLLKKSVAVANVDPADPLLTGTSIDPGSAADVGGVAVTAAERETAHYAA
                     RVLSKFPGITHQNAPRVMQLCGSLIGLATISKSSLVAVMGEEDAARLYNFLHSPFH"
     gene            <52815..>54314
                     /locus_tag="LDBPK_080160"
                     /db_xref="GeneID:13391958"
     mRNA            <52815..>54314
                     /locus_tag="LDBPK_080160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858533.1"
                     /db_xref="GeneID:13391958"
     CDS             52815..54314
                     /locus_tag="LDBPK_080160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858581.1"
                     /db_xref="GeneID:13391958"
                     /db_xref="GOA:E9B9N6"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:E9B9N6"
                     /translation="MVAAKRWPSPPAASGSTSAPATKPSASSEAPTASTAAMGQRRSG
                     AQRALVLSVAAAPVLPPGATATGGAMEVLSPSLNVYRAGSSGVTLTIAPRTTVLVADH
                     VTNTGAVVRLEQVDYSKAMRAYRVCRQEGGAVAEEPSKGWHASSATPATPLPPPLTSP
                     HGICSSYTTSLNTFSGTASPNGRASYAARDDDTALGHDPAPWRVVFLRLFGATDMVLL
                     TVAVACFLVVVSRVSMIKYGRTDGQSAMSWSSLPWLEVALAALTSGRSVVEEAVAPSG
                     LSPASGEGLAQGVTRGPPGTSSSTAATVISVPGTKGVLFASYTQATSTPALDTSVTLV
                     LLLFSTFLLVKRLSGALSRVYVEEVLVMRGVGLQFSAYGIFNTLRYRHFVDLLMLRSL
                     VIHDAFFRYQPMFFLSSSVENKAERIVYFPDTLPRLAVLRPVLNGIRGVLYGEPEEGP
                     SLGELEERWKKSASEISDGDFFTEDSFAEDTVTTPDDACFSDATDRDED"
     gene            <55514..>56215
                     /locus_tag="LDBPK_080170"
                     /db_xref="GeneID:13391907"
     mRNA            <55514..>56215
                     /locus_tag="LDBPK_080170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858534.1"
                     /db_xref="GeneID:13391907"
     CDS             55514..56215
                     /locus_tag="LDBPK_080170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858582.1"
                     /db_xref="GeneID:13391907"
                     /db_xref="UniProtKB/TrEMBL:E9B9C2"
                     /translation="MLRPRFRHCFAGRAPKLLSVTAWAERRHVSTRQAERLGRASSLP
                     TVSGTATSHASPSGIRGDSRVARGFAQRATKLSSPSAGASATSATAQSAASSGRAKPL
                     PGRFNRLLVQLGVLVTVYHYILGESINLFLTYLLHSHRLGIGDTGSWLGAVGVPVDRF
                     LNIGPTVCGLQLSPRLVLNYLVVNACMYPSIPLQMRLCIATAPILRVPFQVMGRLLGV
                     SKRATVPKAPSGTPS"
     gene            <62242..>64176
                     /locus_tag="LDBPK_080180"
                     /db_xref="GeneID:13391908"
     mRNA            <62242..>64176
                     /locus_tag="LDBPK_080180"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858535.1"
                     /db_xref="GeneID:13391908"
     CDS             62242..64176
                     /locus_tag="LDBPK_080180"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858583.1"
                     /db_xref="GeneID:13391908"
                     /db_xref="UniProtKB/TrEMBL:E9B9C3"
                     /translation="MFELLLSFSPQPPRAMLAAGPGARCATERRCCVGSSSTLSFTVE
                     RVPARYARERGVCLAPAAGVREVMVVTCCAAGRKDGAQAALEVGMWWVDRCLSTAVQQ
                     AAGGTAVLFCCMKIVDVAVERLTLYSSEDSPLPASSAIGRMRMPRHFFGLQLFRLGEL
                     RHVQLSPSVRRLVVEVDVRSCLRWPQSEVNNFLASLQSPLRAVHVATCSVSPVKLLNK
                     FHASLRVLYLFRRTTTVRDPTDTRVPVNIEDEEYEEEESNTSPSLTPAMDAPATAQHA
                     SQLPAAVHGVAQLSPIARTVTPQSTSTTSTTATGARSRRTRRLRLSSAAAAAPVLEEL
                     HVTSSARRSLPRWVETCTRLKHITLRNCAYNRVDSLRFALKLTSILLDGCASFVGFDC
                     LCGFPELRSVTVKNCGLLRDLSWVPRLRGSLSYLCIHHLSPASITAFASASCLGMGLS
                     GLEELNLSIPSLHALRSFVAHSSATLRELTLFTCMSLSGFSDLPALPALEKVVITGNC
                     HMQNFLWLSRSPRVVEVRATQCSQLMSLTGLDALHQLRLLDVNGCQRVRTIAPLAECV
                     SLTYLDVSHCGLLTRVSVLEKLPCLQCVLMRNCTSLVKDFGWIEACPKLVELMVPGPS
                     WVEAARGVLRRLGRRNVVLR"
     gene            <70166..>71050
                     /locus_tag="LDBPK_080190"
                     /db_xref="GeneID:13391909"
     mRNA            <70166..>71050
                     /locus_tag="LDBPK_080190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858536.1"
                     /db_xref="GeneID:13391909"
     CDS             70166..71050
                     /locus_tag="LDBPK_080190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858584.1"
                     /db_xref="GeneID:13391909"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:E9B9C4"
                     /translation="MPRNATTVPGFFPYFGFMLKDVGSRLSIISHYMQTKRHPYPMMR
                     HQNVRAYRGMLPWTQDACFIAPNAFVVGNVVLGHDTAIFYHSVLRNYHTKSATILGDH
                     TVVMDRTTLMGQIRVGQSTYIGAGATLDCCEVHDNVYVGPGASIALGAVVENGAIVAA
                     GSAVPKDARVYAGELWAGNPAQKIADVSPAQSSEVQHMVHDQIQVGKAHLQAIRDHVE
                     QTKELDVNWLNEAVTMMEAQQQQMSIKLPMEIPLEARRFLQPRVHMRRPEMHMRMSYP
                     VNRTAPWMPKSGDQTANV"
     gene            <72884..>74947
                     /locus_tag="LDBPK_080200"
                     /db_xref="GeneID:13391910"
     mRNA            <72884..>74947
                     /locus_tag="LDBPK_080200"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858537.1"
                     /db_xref="GeneID:13391910"
     CDS             72884..74947
                     /locus_tag="LDBPK_080200"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858585.1"
                     /db_xref="GeneID:13391910"
                     /db_xref="UniProtKB/TrEMBL:E9B9C5"
                     /translation="MAAREARDVAAFLGSLITVLMGILPLLVVEVCTMQPWCLCGSLL
                     VWALFFALQNELQLHAGEAQTADASFDMTTPIVVGNGVEVFALKQEPGVCPLIGLSVT
                     VTVISLAMPSCLFATLLLVLWSLSACWQRGYRRVLVKVKLPRGRSSPSVGKDGYVRMG
                     YSCYRDTLWMNRCFCYATLFAVCLVLAVTTPWWLHQQPVLTFMDLFASPPKPSSSAAT
                     KGEAAERAIDPANLSFTGGHEMHARCLAGPYSYYNCAQPTPNMWRLTEWLGFPWTSTA
                     KALTGIFTVNQSYINKESPLWLNYIVLVLLTLANAGSILVLTFYRVRKPPLSFETPVV
                     YAAQLAAQRAEHQAYWASKRAGRCDGARTPAPLAPQPKVETASAAQGSAGGGRQRVKV
                     VTCLSREEYVVKQVVLLCWMLSASTISGTVLFLRNAPSSCVLVFPSVSLLAAVSVVIS
                     VLRCERPLAFHPAPQQAAKTVSGAWKMKKDTSAPMQQDGDDSRPPAASRWCTTTVAPS
                     LAHAADVPCLYLVFTASVLSTGALTWTIVPMLLRHGILLLLCWRTSLSLVLLRTWAPA
                     DTTCNIFARLGAVSCVALGLLLAAQAVPQSSASAVACRLARFTDKVGDVYAHTGDNVL
                     RALIYQCIASCFMYACGAVHATLRVARLALEPEEVHLVPIEEELRICKSSCDAAAAGH
                     ATRQQ"
     gene            <76369..>78330
                     /locus_tag="LDBPK_080210"
                     /db_xref="GeneID:13391959"
     mRNA            <76369..>78330
                     /locus_tag="LDBPK_080210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858538.1"
                     /db_xref="GeneID:13391959"
     CDS             76369..78330
                     /locus_tag="LDBPK_080210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858586.1"
                     /db_xref="GeneID:13391959"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:E9B9C6"
                     /translation="MSHASTFAAGELPIRVLTFNLWGIFNSRMREARMKVFATKIEHY
                     DVILLQEQFSVEDFDLIFQHASPAVQRTYTFRRFCSSFYGSGCAVISRYPISQAFFHT
                     FPLQGYPEMVLHGDFFANKGAAMVRVMVPVTMEDGSAANAQEVTLYTTHLVAVYEKVS
                     QLSSWKRERYLPFRISQAISFADFIVSTSRPTDRIIIGGDFNCSQRSLEVQMMLILLK
                     RYGYDMHSVLPPPRALRDAATAEQEREGGQRFFTYSDSNTFNSMKTSYFKLLKLEADI
                     PSQIDHIFFSRPAFALRQFADCPDVADGYPCALQDAPNGLVVFTKNEVHVPPHSAWCR
                     SLWHQLLTGKRVPRGANATGQLAKPGRKTASSTEGQSADDAAHYYPMSDHFGVAALLG
                     MRVEKAGSTTAMICSSPETGGTAALALTPDEARAVQTVVDFLEDYVCKLRSQAKTTRY
                     MAVFSLLLVAANIWVLRRLSAKEEARSAAVLERIYDMAAATTRDTAKVVQPGNGLESI
                     KHGFNVAKDWASNQAQLTLHIVSKFTGATPAPGINAGDTPEGSKQPAANVADPSEPVP
                     RTVPASTAATTAKRATSTPEGDAAARPDFRAIAEALTVRPLYASAWVSSAFNMTAAVV
                     GTVSFAIGVFQRAGNANILEEQVHQLKKL"
     gene            <80129..>81634
                     /locus_tag="LDBPK_080220"
                     /db_xref="GeneID:13391960"
     mRNA            <80129..>81634
                     /locus_tag="LDBPK_080220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858539.1"
                     /db_xref="GeneID:13391960"
     CDS             80129..81634
                     /locus_tag="LDBPK_080220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858587.1"
                     /db_xref="GeneID:13391960"
                     /db_xref="UniProtKB/TrEMBL:E9B9C7"
                     /translation="MPPRRRQLHACAGLALRSDRGQHPRAMATRTIYHLPNIPHASCA
                     AASRNHGGPASASEEPLHAKDVHTGAGEGRGGCGSGEGAEEEVVVCAAPPTAPQLASA
                     VTRGRGDGGAVHTLKRYLRPYEEEGSGAVLLEREPDGTVAPPPRHNCPKPAKLDTDVW
                     HWSGDIEEVRQHTSVDGRRAGHDRTATAEHRRGDRTSECACGTRSRHCLPAQKKFRCD
                     ATPTPASCAAATDNFDERCDAAFAERGCVAVAVFSRPPDSRALEDARPSSPLLLPSSP
                     ASTNSSETSAPRSSTWATTRCRRRDSGGEDDTLFRCSTTATSASEIDSDGCPEDGHGS
                     LVQGVFVECEARSAGSGSGPQLAIPRHLAAQQSSACDVLRDRPLIAAPPSSEQITAAP
                     TNRASGKIARLTNFYLEPRYRRHAQHMALHDLPLATSATVPSRSSTSSSIFLQLFTAS
                     PPSCPAGCEVKRDAASRTNDDEMGVRPPIWSIIMKYYAAHHERQLPPHAPL"
     gene            <82197..>85484
                     /locus_tag="LDBPK_080230"
                     /db_xref="GeneID:13391961"
     mRNA            <82197..>85484
                     /locus_tag="LDBPK_080230"
                     /product="ubiquitin-activating enzyme-like protein"
                     /transcript_id="XM_003858540.1"
                     /db_xref="GeneID:13391961"
     CDS             82197..85484
                     /locus_tag="LDBPK_080230"
                     /codon_start=1
                     /product="ubiquitin-activating enzyme-like protein"
                     /protein_id="XP_003858588.1"
                     /db_xref="GeneID:13391961"
                     /db_xref="GOA:E9B9C8"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="InterPro:IPR028077"
                     /db_xref="UniProtKB/TrEMBL:E9B9C8"
                     /translation="MSDGCMGSVVDVHIGHVVIPHASAAAAAEAAEAAVVFPSAGPAH
                     KKARIEAVATRSSASAPADVVIATAWSEERITDALRRYAVAALEAASCEAAAGSASSP
                     STAAAAAAVLKAVNDAASSWVAVWPAVRLSPTPADMTGSGGEATTSTMASWSTVSFSF
                     VPGALESTASATAKGAHAGISKATVPDAAPAVDAVTLRVLAAISLPRGLCVPYRGIAT
                     AVTAGGCAGCVSAVLTESIQIRAATATPPAASSSVPHSPASRSAASPCTYGMLPAELR
                     ARPIFVVGAGGIGCEVLKVLVLSGFTQVHLIDLDTIDATNLNRQFLFRVADVGNSKAD
                     TARRAVLDWFAAADDPAPEHVSDLRGRRTPPSIVAYHDNVKADRYDDAFYRQFAVVLS
                     ALDNVSARQHVNRMCMRNNIPLIESGTMGYNGQAQPILKNVFECYDCRPKPPETRTFA
                     VCTIHARPTTMVHCVHYAKELYEVLFGSDSSDMDGKGASALSDVGATAEAGSGSATPL
                     QVDKQQHGATRPTDGGELSYLRAMVSDWRRRQLPAASPGCTGAPTCALAEASSTLGHN
                     DVGDRSGREGSRASSAAALALELLRLLFVTKVEELLSLKTSWPTEPPEPLSRRDVDRV
                     AAAHISANATGASPAPLSGDHVLSVQDCMELFVRAVTQCLARPTGLTFRKEDDAATSF
                     VSATANMRAHVFHIAEQSLEDVRSIAGSIIPAIATTNATIAGAVVHELISLLRSSSSS
                     FSQPASTSAAQMAPLSQAEVTGVSAPVSMQTSPRAHVVYTRKVPQVRRRRVPLPPGQR
                     YTTPALFMEYAGDDAPSANESASKLAAPCAPLQAALALVGAEDSTAYLPRMSGAAEGG
                     GKARRSVAVMDHYLVHSTAPNPPNRLHCGVCQDVHPEVCVTLDLRSATLGQLAHLVLE
                     SALGLEAPSVSYGSTMLYEDEDYEELADHILADVLQLPPAEAGGVAHQRQSYTLTADA
                     LNKDVPWSVVLTHDDKGAATSAPSPSTVFFQISGLEEAKAAEERALARLAAQQAQQEP
                     PAEEDEEEALGAPPGTTGLASSAAATTAPVAVEFIVSDDDEVLDVTPATNAPSNVAAK
                     KDIVLLD"
     gene            <86511..>88079
                     /locus_tag="LDBPK_080240"
                     /db_xref="GeneID:13391962"
     mRNA            <86511..>88079
                     /locus_tag="LDBPK_080240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858541.1"
                     /db_xref="GeneID:13391962"
     CDS             86511..88079
                     /locus_tag="LDBPK_080240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858589.1"
                     /db_xref="GeneID:13391962"
                     /db_xref="GOA:E9B9C9"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B9C9"
                     /translation="MTFRFSRAARYGAAAAGFMGASTVAILLPPRETIPPVLLPSRVL
                     FEGIGRVGRCVYAGGQIYCDYAFNVTQEDGQEQWNEVHRRCAERLVDLAERNGGLYVK
                     AGQIFANMSHILPYQYCQVMAVLQDAVVKRPYAEVVAVLEKDLGRPLGEVFSYIDPTP
                     LAAASLAQVHRGRLRDEDVEVAVKVQYIDIAQRFNGDMRTISLMFAAASYFFPGYDFG
                     QIIAKLNDTVAAELDFRIEGRNSDRAAADLRSCGWGERVVCPRIFWNYASRRVLVSQF
                     IPDAVKVSDRAGIAAMGLNVKEVATTFFEVIAFQIFRTGFFHGDPHAGNVLVHKLPDG
                     KPQVVLLDFGLCAELNAAQRREISDIWTASTTHDTPKITEIARRYDCDDYELFASCFL
                     QHPYEYFANSTSGRLNSPYALEKMRETVKHRMTDLNGIVAALPKEYALVLRSIMATKA
                     INRELGEAANRPMCMLRYSLKTSHEDLPKIQFLVLMSKAWVSELYAWLLLRFTLWRHP
                     ELSEVLESSLQLSG"
     gene            <89436..>90224
                     /locus_tag="LDBPK_080250"
                     /db_xref="GeneID:13391963"
     mRNA            <89436..>90224
                     /locus_tag="LDBPK_080250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858542.1"
                     /db_xref="GeneID:13391963"
     CDS             89436..90224
                     /locus_tag="LDBPK_080250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858590.1"
                     /db_xref="GeneID:13391963"
                     /db_xref="GOA:E9B9D0"
                     /db_xref="InterPro:IPR000244"
                     /db_xref="InterPro:IPR009027"
                     /db_xref="InterPro:IPR020070"
                     /db_xref="UniProtKB/TrEMBL:E9B9D0"
                     /translation="MRRSAWVFVAPWVPPPRHDVKVTMPPPPGGEVGGSYGVSTGYSD
                     RLARTPYWKRMALSTYALRMKENATRYPMSPHREGEYDLRYTVTAYPDHIKHRPLLEI
                     GEAHQIPTIEIPVIFLVNLWDEERLTWFGRQYETVYVSGNFAREELLPQRYAIYATEE
                     AYRLLGLPVVNHSIHEEIPKTPHAYKKLLEKQSYTEERWKYTIEYLFRKYEAGPPELQ
                     DKSEDGWDGVEELATSATAGGAGDSLAKRKGPVKQRKARKIKLF"
     gene            <91098..>91214
                     /locus_tag="LDBPK_080260"
                     /db_xref="GeneID:13391911"
     mRNA            <91098..>91214
                     /locus_tag="LDBPK_080260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858543.1"
                     /db_xref="GeneID:13391911"
     CDS             91098..91214
                     /locus_tag="LDBPK_080260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858591.1"
                     /db_xref="GeneID:13391911"
                     /db_xref="UniProtKB/TrEMBL:E9B9D1"
                     /translation="MDRQAVNTAQRGPNPHHVKRRLPPPTTPPHPRFDRRYS"
     gene            <93231..>94547
                     /locus_tag="LDBPK_080270"
                     /db_xref="GeneID:13391964"
     mRNA            <93231..>94547
                     /locus_tag="LDBPK_080270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858544.1"
                     /db_xref="GeneID:13391964"
     CDS             93231..94547
                     /locus_tag="LDBPK_080270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858592.1"
                     /db_xref="GeneID:13391964"
                     /db_xref="UniProtKB/TrEMBL:E9B9D2"
                     /translation="MRLTPMQSPSKASAASLTALTVSTSSERAELLSVPQSEHPIEPL
                     GYRERPAPTASAASAASSGHPQHAGPMKVPSPQATRHHSDRCRHSRSLATATAAAGSN
                     KSATYKPYSLSSYKTLMADVAARKSGGLGPSDTDEQRAAREKRERAKTYARHAVKVAR
                     AALAGVGSCADEGEVNPGTINISPVSSSARAARARGSSSARSSSSDASTTATTITTTS
                     TSASRSASAEFPEHRRQPPRGTPCAAPPPHATPPQHAMLEPSSSATSPRQLSAAGVNG
                     GEVAPSCSGAESTNAKSPKSVLPPLSAPPRTSPAVAAFAVAAAPRRQIMQARRRRERA
                     LTYAREVSQKRRRPTPADFEGDNSACAASGGAKSRTGPVVKSGDTDEDDMWLGRTAVI
                     SAPGAFRGADMPDPDRAQRLQRLLELEALHATKREAVEGIRRQLRA"
     gene            <95897..>98398
                     /locus_tag="LDBPK_080280"
                     /db_xref="GeneID:13391912"
     mRNA            <95897..>98398
                     /locus_tag="LDBPK_080280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858545.1"
                     /db_xref="GeneID:13391912"
     CDS             95897..98398
                     /locus_tag="LDBPK_080280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858593.1"
                     /db_xref="GeneID:13391912"
                     /db_xref="UniProtKB/TrEMBL:E9B9D3"
                     /translation="MSARSKDPDERHHGSRDSVKAAAMREALCSRIRTLGASILAITQ
                     SAMKEVEELEMEYAEQQQRLAKRQSQRKSSPRPGKAAAKPSQPQSRVRRTCGHEPRCS
                     APTGAAAASAADKNEKRAESSTEEDSSRYTRSHLWRADAAVMELCAAAEANFQRALAN
                     RVSQGQRSLRPVVTGETADDACAVWGDDDCDKGGQPRVPRHWRRGAPLYDLSNAAITS
                     QYGRCVDRAEVAKDVHDNGAQPSNTSSGARQRDDGSFVSPAITAGGAIPLAARAPAAA
                     SQLSQQAEQEALAALYIVPDQRIDIVAAETSINGEVHVEADGRTSQQRQAWSSPCLAP
                     ERSYYNVVYIHELAHPRKLCGSGGSGDDASLGSVRGQDKGRTCAPQRRPTSRVLRRGA
                     TTSSTAANKAGEAPLTITSYVQAMYAVNRTDAAVRKPPANPDMEATPLMTAAPALMSG
                     DTALVQLELCVPAQRSGRNGSPRLEGAPLMATGTKPTDVKFSSSTADRVPDSKAGTAV
                     ASTVSAAAQHDEGTETQRRSDRKVAAPSTVADAQIVARIESIEDWRRDRHADVEERIR
                     RRRRSSVVPAGWQGEYYYYANPGGAATRADEVGMPTSFPASSPAHTDATATTGSSGTA
                     DMAATIEKNDAHRGTPHQQQTQGHPSPRPLSRPCAVTSPSLRGKTTTCTVLLRTRPQL
                     SKPLSSWSERKTGAVTDVSWKSNSSGAQAHQPAQPLHRTTARGAMMATPTSAAAAAAT
                     STLSSKAALYPPLEVVVTNTYNSIEWAFGGAARRACTAAPDSAHGESPLASASLLWAA
                     HQKREQDNEEQRRWNARTRQPYGVDIHAPIDLRIS"
     gene            <101578..>102720
                     /locus_tag="LDBPK_080290"
                     /db_xref="GeneID:13391913"
     mRNA            <101578..>102720
                     /locus_tag="LDBPK_080290"
                     /product="ribosomal protein L2, putative"
                     /transcript_id="XM_003858546.1"
                     /db_xref="GeneID:13391913"
     CDS             101578..102720
                     /locus_tag="LDBPK_080290"
                     /codon_start=1
                     /product="ribosomal protein L2, putative"
                     /protein_id="XP_003858594.1"
                     /db_xref="GeneID:13391913"
                     /db_xref="GOA:E9B9D4"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="UniProtKB/TrEMBL:E9B9D4"
                     /translation="MASVSPLLMPCRGVKLVNPIGKQGSQHYGLEPKLEAGRDTQLKH
                     TEMYDGYTDDFGVFKEGPPVTLRLEYVRSPDHGYSQHILQKDIWSPFQVGANMMSYTP
                     LYYDWKGFSSRDYFGHRSGTNPGSKVLLGHYRRDEVRSWGYRIMVNHKPQKRIPKWLA
                     CVVHIPRKKTFLGFFLYANGAYVAELLTYKQLPRIIYNKAFQGCLPTIGQTVSLTEVT
                     YGKEIHSVEMYPGHGGVICRASGTAAVVLRGSEPNLVPLLLPSKEVRLFDSTCHAVFG
                     RRAGVMYNKQRNFSKRSIEENMPHRPKVHSKTKRVSSHPAGGGNGGSPNLLTPLDWRI
                     HPRNCVKTKYWLSGYILRGRQYNRNQTVADLKSKTYSWANRDPVYR"
     gene            <103456..>104148
                     /locus_tag="LDBPK_080300"
                     /db_xref="GeneID:13391914"
     mRNA            <103456..>104148
                     /locus_tag="LDBPK_080300"
                     /product="iron superoxide dismutase"
                     /transcript_id="XM_003858547.1"
                     /db_xref="GeneID:13391914"
     CDS             103456..104148
                     /locus_tag="LDBPK_080300"
                     /codon_start=1
                     /product="iron superoxide dismutase"
                     /protein_id="XP_003858595.1"
                     /db_xref="GeneID:13391914"
                     /db_xref="GOA:E9B9D5"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:E9B9D5"
                     /translation="MFRRVSMKAATATAPVGFSFLCYHTLPHLRYPAELPTLGFNYKD
                     GIQPVMSSRQLELHYKKHHSAYVDKLNTLGKGCEGKTIEEIILATSGSTESKVMFNQA
                     AQHFNHSFFWKCLSPGGKPMPKTLENAIAKQFGSVDDFTVSFQQAGVNNFGSGWTWLC
                     VDPRTKELRIDNTSNAGCPLTSGLRPIFTADVWEHAYYKDFENRRADYLKELWQIVDW
                     EFVCQMYEKATK"
     gap             105649..105680
                     /estimated_length=32
     gene            <106050..>106808
                     /locus_tag="LDBPK_080310"
                     /db_xref="GeneID:13391915"
     mRNA            <106050..>106808
                     /locus_tag="LDBPK_080310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858548.1"
                     /db_xref="GeneID:13391915"
     CDS             106050..106808
                     /locus_tag="LDBPK_080310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858596.1"
                     /db_xref="GeneID:13391915"
                     /db_xref="GOA:E9B9D6"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:E9B9D6"
                     /translation="MAHTGGAGTLCEKAPATAERPTSDVTVPQRRRHATQLLRKFTEC
                     RTLFMCCDIQEKLAEKIPGFNETIRITNDLTLFCEMLGPTYCNVLATVQYPAGVGPLY
                     HEIQLPPSAPVIPKMEPSMLLPEALPYLYGDADHGILPVQQVVLWGHETHICIMQTAD
                     ELLRRGFRVAIATDGCAAQRRLDHEVAIMEMSKWEGLLLTNSIGVYTMIVRADDSVWK
                     PVMQLIRDGAHAFKRPYERSEDPTVPPQERERQS"
     gene            <107889..>108818
                     /locus_tag="LDBPK_080320"
                     /db_xref="GeneID:13391965"
     mRNA            <107889..>108818
                     /locus_tag="LDBPK_080320"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858549.1"
                     /db_xref="GeneID:13391965"
     CDS             107889..108818
                     /locus_tag="LDBPK_080320"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858597.1"
                     /db_xref="GeneID:13391965"
                     /db_xref="GOA:E9B9D7"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:E9B9D7"
                     /translation="MRTCITHRLHSCSPPLAAASALLLGVVCAATPTQTHVRYTPERT
                     QRPPSPMTTLSAHSRLIQKFDTCRMAFMLCRAQVQADSHIPSLHNVVHATNAMAAVHQ
                     LLGPERSVFVATEVHPQGVGHTCHGIQLPEDVIIAKNVRVSMLVPKVRSHILGDAERG
                     IPPVQQVVIWGYETCGCILQTADDLLTHGVHVAVLVDGCASQTMEMHNTAVLQLSHWD
                     GLMVTTVPSAVMQLTRSDARFVKPIIQVMKKFAADWSTTQPRPELRDWRGGGDGGEAT
                     AANDARAAPSALATTTAADAVLTADSACCRMDH"
     gene            <109683..>110360
                     /locus_tag="LDBPK_080330"
                     /db_xref="GeneID:13391966"
     mRNA            <109683..>110360
                     /locus_tag="LDBPK_080330"
                     /product="mitochondrial associated ribonuclease, putative"
                     /transcript_id="XM_003858550.1"
                     /db_xref="GeneID:13391966"
     CDS             109683..110360
                     /locus_tag="LDBPK_080330"
                     /codon_start=1
                     /product="mitochondrial associated ribonuclease, putative"
                     /protein_id="XP_003858598.1"
                     /db_xref="GeneID:13391966"
                     /db_xref="GOA:E9B9D8"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:E9B9D8"
                     /translation="MVAMASRALMSSRSHLLQKFDSCRTIFMCCDIQEKLRNRIPNFQ
                     AAVEVSNSMATIHNTLTPKHSTFVVTEQYPKGVGHVAKDITLPEGAPVIEKLQPSMLV
                     PEMMPYIDGDAARGILPVQQAVLWGHETHVCVLQTADELLSRNIRVAVLVDGCASQQQ
                     LDHDVAIQEMAGWENLTLTTTISVLLQLARGDRLMRGSLMKIVKPKWADPSRFPSLPA
                     DGEKPKT"
     gene            <111509..>111796
                     /locus_tag="LDBPK_080340"
                     /db_xref="GeneID:13391967"
     mRNA            <111509..>111796
                     /locus_tag="LDBPK_080340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858551.1"
                     /db_xref="GeneID:13391967"
     CDS             111509..111796
                     /locus_tag="LDBPK_080340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858599.1"
                     /db_xref="GeneID:13391967"
                     /db_xref="GOA:E9B9D9"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:E9B9D9"
                     /translation="MQAQMMLGQALEHYSMMDFANLVLEQCWDICYDSQLTRPELAGG
                     ELPDVKVQKMDACARKCVARHFEVLTLLSATRELREKERMQGLPPGTLTSM"
     gene            <113142..>127472
                     /locus_tag="LDBPK_080350"
                     /db_xref="GeneID:13391968"
     mRNA            <113142..>127472
                     /locus_tag="LDBPK_080350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858552.1"
                     /db_xref="GeneID:13391968"
     CDS             113142..127472
                     /locus_tag="LDBPK_080350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858600.1"
                     /db_xref="GeneID:13391968"
                     /db_xref="UniProtKB/TrEMBL:E9B9E0"
                     /translation="MHAGTRGPLAGHALRVYRTGSRTPTWSHRTTCATHAGSTRAAAS
                     TFLSSFVGWEEQRTSRGRESLSSLGPSSWPQQPRVTRRLAAAWQRACAESYRHALVGR
                     PTNTARRSSRCTWTFAAEEELRAHFQRALRWRSDTAAPAAGDEELMTEVELRSMAAFV
                     VDTYVSLHKKPESGCRPGAALMLATRDLWGSSELQWQVLVLRVLADEVCAALGDSAAC
                     SMRASHWVSGATEFSVVYECIIVVAAAHLCVLRHGRYPRDVAGVAGADTRHGVADAWE
                     ATAVAPHSAHVVRATRRLVEGVLALCTRQDEGAILSPTRTDASDVCSLDSWLGGQLCC
                     LAETSFRSLYSVRGHRDHRAALPEPSLLLLRLLVQSASWHGHCAAADVNGAQHLRHVC
                     AAVLLIERVLERASEDRLAPCVDEVRAALWLPRRFACDDEGVDDAVRQRTPTPRQRAW
                     AHSRSSYKDARLDGGTAALAAATGRFVCQVLDGSPPSISRLLLLPGNAPQLLRSTTGG
                     PATPLDREMLAEDVVLLAPGMALGAAWRLRHACAEGPLLCTSPTASAPALEHTNATDA
                     AGARRGAASKCSGVGDPDSAEHGPLLQRRDTLEQVWSRLCPSSTCTAAALLPAWWQVL
                     SSRFFSSILSQLDPPEIARMAEAMVGTLSRLPPLLSAVHHEDRARARRSAGAARLKAK
                     TEMREGAGEGAGVAQPRSAVLALQCTLASAPTDAARAEASQALLSRLCTALAASARSG
                     EEDNADLTMERVHGAGVCLAVLLACASTSLRDQAAATHDFLAAVASLVDSRCHPQHRR
                     RESNDVYSALRSWCSGAMGSIMLARHAQLAREAPRCEVSASTEHGSGEAPRRNPLVSL
                     SPAAQLALWWEEQSSLQADPAAPLSRLRDSCYWTGMRIMRLCNTVAHLAATSTTASSA
                     LSSPQPPFLPAPSTRDAEAARVACTAVYDMLSLEHVCHLAIASAALPGPGEAREAWNA
                     VAGPFAAAVPPTHAAHSSCACALATADAGVALFEGDLSSGDRVTNIFTHAMTAAREAG
                     DSAMNVLQHRQGRLLNDRQHESLVEAMRDFSKRRCVKEAVALFYAHERQSRRLRLAEV
                     ELFAETAKRAPLPFLVRLLLYLPPPCESAVLARAIIAGAWKAYQRALHLHSRRLAAAA
                     AERRRGSQRENAPLASSIHRQSCRRVEQAWYESLAVARRALALLPSAGGTDGCDEEAQ
                     RHALAVLQRFLCARPHSMQTGASPGRMPSSSTGVTVFADEWDSDAVQSAQLLAALMPS
                     PSSSSSSRSRQRLHVRRGAPARESAEALCRLIQFCDATNDPATAVRAYLRFANAHAAS
                     APPSRLSCAPAQDARKRSRPTVEANDGRVVPLLPLDTCVTLLRLASMHVVAACDEDAA
                     TYGVPGTTSSSTRVPLTALVTYVEARHVPSEVSSPETPTGSEEPRGGAMLMPDSLERN
                     AAAEDAEMTMLLSMRTALKESAAAPSDIVVEAATAGAGSTSKPVGDAMLGDSGYHAHA
                     KGAPGSAVSAAAAATSRAMTYATNCIAAVQRLSPTLPASLRCVLHSDSAAIPLTAVLH
                     DALRWCRLRPQSVLAREGAATAVDGLDAAALHSLADRADSDDPATADVVARLLAAVFQ
                     LDSAEMAEMVDAAHPRPVHALVGAAAAAVTAAGVAPAMVDVAEGDATSSMVVTRHTFA
                     CRAARANQDFWRLVRHSDALLGYVWDYVWELYRLEATVLWVSPAQQQRAYLAVAECAQ
                     VILAALQALDVWAAEMRAHEARERGSSDSDGDYQAHEQAPLTGGRSRVSMAASSEWRL
                     GSSVDEWRVQLRSGILQRLHARLFDEGDLPDATSGHRGETASAMLPCSLTSFGMTDTT
                     AAAIAYMTTVMQHSSTAFETCAPTNALMQLAADPIAATSPAPSDESLSGSVMRTEGAT
                     SAQEVRELLSRTTQQYYDALSRLVSPSLPVSGGAGPLRPVYLSRLATDSLSYVLRCVT
                     ATAAAAPPRRPHTIGTLATSEAGGTAALLLRVAAAEGMLRHVASLVQHASVLMEATDA
                     APRTANVELPRTLWCLSGALHYAAALLDECMAWWTLLDLEAAAAAAPTSELRGASDAS
                     SCDIGSVFPSVNGSLVARSALTHVRAQLQRLVASFADLYVSGWYGSVHARLPEVTRAR
                     LWGRGESRAQHLRVCLVLQHLASVSGDAAVPARLARAAEALQQALARYPSSSAACTES
                     KDARALQQSGFMDLDELVDGEHHDVTESVDCTAAATVRMLERTLLAYLTRSTQPDGVL
                     VIAPGHMTAVSITALEASFQRAVMACLSPSHAALLWRLFTALLDDGCYPSVAVEDTPH
                     EGSHDVPRPMRCERDAAAEGSLGVMCAVPTTLWRQLRRLGEESESEAASDVLRSSGAR
                     TEAPALHSERLALYAALLSRHPLVIMGVVRHPLVRHHQLAEARREQWPPVQVGASSGR
                     VAGTSQAPSCEWLKKLLLYGAEDDSVAEARAAASDDAGESALSSAWTAADRTLSGGGG
                     GGLLRTSSAGALALLPAQPLRERFVSALILAVLRDASLMCDGPSCAPIAFVSSSVAAA
                     MAAQKRECMLLELVQHLGYVAPHAVRTAFRWVTCTPYPLTACAPASSFPADASPPARL
                     KCSALSCTDVTTLRRLRVALLSCGPWPTTVARTLLEYATRVQRAATQETAPQAHAGDG
                     QTPTMPFPEALELYQRQQQQPESKRHDMAEAPQALMATAQHRVDAMRGVRHPLLLRVL
                     QHYADQEKDSARRERHCNGSGSAAPCGRGASSSSPVLSSTSDTVPTVHARGGRFAVGL
                     SRRLPPAPAAPCSSVGSTRYGHSTGAGAPLSAIQLACEEGARLVNALRTSTAPAVGDA
                     AARIALRMRDLAMAPSHPACVDLLSDATFATDVMALPTKRVAATVMLAWRTLLVRAAE
                     LDCREQHWDSAGGDDGAVAAEVHNRTRNLSLREAGSRDRSCMTVLDVYAMFFLVASRT
                     CDRLTAITPPLPQAKGRQWLVSGQRQLGSLKRELAAYWVAVLADEVVASQPVFRCSAT
                     SEAEAIRVRIDAYCRSSGDGGATHSPALGLVTLEEHLRRAQARLQAVAQEPSTFSSFP
                     RTSYSPIAADDKAAAELSLLQKEAGAQLRDAGARLTSFPRSVTAEVSLRLAKEDARAS
                     PELAWSLWPPAALETYRLRACMRKSSDENTLVTVTVRNPVSVVTYLCAWRREQVSAPQ
                     KRRPGARAARHQESARTTTVRPYAARGAACVLLPAVCLPSSSAVHGSRQPGTSRRRAR
                     WASQSTAVSLADVWRAADAFVRRGRLVLACIPRDGHGGASGCGPARGSAGDAVETDSL
                     EDEVDSTAAGTSPAGAGVVMQALLDLVSLEDARLQQEQQQSRRQHAGFPSQTAISSDT
                     LQLLSVLRQLRQRLLSLAPAAAATASGAHGTEGAVTTVAAEDKGGPTPAASPWAAFMP
                     LSCVCGPSTPPARRGGELGADGIAWHSYLHVLHLCGDGLLCRVAQRRGRRASSSAVAL
                     TRVTHQLQRLASLSALEEQVTHSSVSSALRSRLLNGQDAQRIICFQLRGLQRIRDHVS
                     VLGWTVEQHRELQLAQQSIVSTVAAICALQRRWHHGQQCPQREDAWDVATARIRLSTR
                     VRRQVTAEMHEGHVHPVEQATAVCFYPALAHLLRQLSVTYPPSAVPAASAQEPSSSRQ
                     RSPVEDRVPRADDAATGVVTAFAGVVAASARRRHRPLHARAPQTTAATTTAESDNAAA
                     ALLTTVYGALCEAHEQQRSGSTDRRQNTGGGHTSTTPALAPVDSCGELHALLSAVVAA
                     VQRRSRDADPWLLLEFLSGNEREALLPLAAAAEASYLETLMRAVALGASAPSHDEDSH
                     RVVEAGLTLYALLHPWLPLSGAAWETCAMEAALSLVTLALPQRDRLDDKRGAGATVRS
                     SATSLWYLVQVVLVSILHRQQSARLSVRSIVLLGVIYSQLRNLEGVRGGVLGTERSRR
                     SSRTAPQADANVLLWRILSALSGLSEKDAAEVRDAWMSMREVDAVALGPSIAEHAPAR
                     TTDGAALASAEENIQLRTETGGAKAEVCSGAHVIEVLYHGSLQALGEGGSGGGATEQV
                     SGRWKSPLLLAATRLRTWLACEDVAVASPIRTTASSRDSAAGATLHACTASRLVLPQL
                     CVLEEALCGMLKGVDEEAGGAGNRSRTGRGATSRGVPGPLAVRRDRLACLRAYTLYAE
                     LKRTCSAPLWRRQHCCLQNHAQNGDCNSTQHDDDRSRRDCVGDVASLVLELAVVATLS
                     AADASPHSRHSGAVSDAHQLALLSTFVRCCDALGTPLPSLPCPQRLLRWGRERSSATP
                     AVARVAPPRATGLGRVGVDAHAAVRHLATTLLFRLAEDVPLSAPSARAILHDWRAVLT
                     PLQALRRVTSAFPTPGARLPEVDAGADVGSGHGSVWLLSTSSAGLQWAPVCQADPSSP
                     KLTGRLDVSSSDADTGGGDADTGGGDAAQPTVQQPQPQSRRRHCHHDQSLQGIYYTTL
                     RLLWSRGHLAKLPLPVLLKELLRPLAELERAAAETSTLFPTATEAAQRAVQPAVRGRD
                     DGAAGVNRKTANRLAALVDVAQQLSMHPVLSASAAAAAARGGDGSSGAGWTSACLVFK
                     LLAQIEAALCTRCGKPQSHTSGGARAAFAKVACISPSRVFAARYADLLAQRGTCAPDY
                     LAFMLVVSRHCQELLPTHGGGAPGESETHEERRRLLRHAQLRHAVALAAPPPAVGAVM
                     GLFQLHTAHCHRAMAAEQHSGAPPATGSAAALETNTTNQRQRVDGEEGIGGEADILLG
                     ALTPDEQTLLQRLHHLLQTSRGKPAPPLKGRGTK"
     gene            <128741..>132979
                     /locus_tag="LDBPK_080360"
                     /db_xref="GeneID:13391969"
     mRNA            <128741..>132979
                     /locus_tag="LDBPK_080360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858553.1"
                     /db_xref="GeneID:13391969"
     CDS             128741..132979
                     /locus_tag="LDBPK_080360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858601.1"
                     /db_xref="GeneID:13391969"
                     /db_xref="UniProtKB/TrEMBL:E9B9E1"
                     /translation="MPREVYAASASWSGATTFPRTSARPRRSRSHNEVLLADHDGAPL
                     FHPHGSAAEVRAGAASQQLRAVSFASALSSSAASSQAGLLLADVMPTGSHTVPPPRQV
                     KDVNVAAPASATLSANALQVLSASALSVPAATPRATSATTPTTVKGLTSGSWPFCSVV
                     DGCGISPKLAELLRAAATREDEDAPFMNIPAELLWLGGRRDAPSALLGRRGEPGTTTP
                     LNGVTRASPSSRVFTSAAEALMVDPDAPRPARRRLSYKITPAPRECRSAAFASAALGP
                     LTPLSGSTTPFISLFTKDDTATTASPLAVACMTAAPPSPGGAMLCFSTPKSPLSGAEP
                     AVTAALLRGSSLAAPRCLRSSDAPSTLMAAIVTASSHAGPGALPPLSPFTPTDPHGGG
                     SQHIELPLGFQGFSAHSHHVLEQRMPVNSRGCSSRAASAAATTSLLKLARQAASVASA
                     QSVSDCTDAPYHFEDLLDDATASSLVEDDDVLRDTPCGGDFSCDVFEDGKVCEAVDDN
                     GCDEDSSCRGLLQIRGRRVVATGAMPCAAGPASRLSPRQQLTCLQGQCDVRSCATAAL
                     NADGPATRSLTAAHAPSLGTASRVHMSLMHTTAGSDSASSYGSVGGGSTGLSTFARST
                     MTAPQQVLALQWGLPRPLSTQTRSGATGSGHLLDGSRSATTESSISAPDLPVFVPTSC
                     PACLLGAAAFDSDAGGRPLHPRLGKHATPSRERELGTAADTIAKPAQRPRSSHRHAGS
                     DGRSGCSGGGGLHRPLKHSHGAPAGTQDRIEQTHSSSVAEGRTRSAESSSDVSGWGRV
                     SDVGEDSDGQNATSGGGENGRCRPCSAPWVRRITRPPPLHLRSLSGRPWKLARSPPEA
                     GEEGHVADAHAGDGGETGSREIETFAALLPPTPRQTSPSLSLATPSTTVAAVAEGPQR
                     GWPPVHARHATAVTLATSPSKATKHAQKWSAVPRGGAHGSAVPSPSSRRHREERRSYH
                     HHHHELQQNWHLRLLWVCAPYGVFVVLLALTTFVATHVVSEGVVSISPAERHTYGLPD
                     LLACTENVTLLSALPNEIFTCWRIEDPGRPPCAAVKFADLAESLAALSCVSLSVSESC
                     DEARCIPLRRSDKLGNLSTVAAATRHAVPITDNGRRDDREDGHKALDSKPARISVENS
                     RIVSRANRNTAKAARTRRSTTGARLPPFAGERTLLRHTRPSATTASKLDESAHEYLPR
                     RREESAAGAAKTGAAAPFADLKVPLGYAFGCFGYATEFFAAAYLDSEHTSERKGPNTS
                     ACVYAIEPNLRDTRSPPFPPTKTPSAMSGDGAPHIAHALPIFHSWRKVITRADGSNSR
                     VSRWQILSDPCEHSSAMCVHPFYGCGCAEPSFLSCRLDADPLLLGYLESDVACATPQA
                     RSHVALLVPHHPAKSPRPDAGTPQQQRGGGGGEQ"
     gene            <136249..>137979
                     /locus_tag="LDBPK_080370"
                     /db_xref="GeneID:13391970"
     mRNA            <136249..>137979
                     /locus_tag="LDBPK_080370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858554.1"
                     /db_xref="GeneID:13391970"
     CDS             136249..137979
                     /locus_tag="LDBPK_080370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858602.1"
                     /db_xref="GeneID:13391970"
                     /db_xref="UniProtKB/TrEMBL:E9B9E2"
                     /translation="MSTTTTTQYTRSGILAWANDVLETSYATFQNIPSYEVGLLLYGI
                     FHDCPSRGETTANGLGDTTAAAAATTTSSASVPLLSAAELHRHHQRHHETCMRYLQLL
                     QFPPTPPSTAPANPAAAAPSGAAEASAPRPGGSAPASPLPPLPDGHGGAASAVAQQRN
                     AEHVLAMVRTLSAEEAELSRAEASDTLTSGGGHAASVVLLLGPSMTPAAWLGGSAFVE
                     ELKLWRWVRLMAERHRSSARAIRRAIRAYLQHEVGVAAVARAPTKDSQTSSASCAQSR
                     GASPAPHSPVVMMEMSDVAEVELGDARGGLLPGKSTRTFAEDASGDTLSQEMKRMRPE
                     TLPSTSPVPVHAAAAVATTRPATSSVTPLVGSVSPVHALLSPIKEVAAAGSARTDDCS
                     ATGLSWTTSSSSVHAASVATITPYVAQATELQAALRTAQAALQKELALHRAQQQQRPL
                     TLPTTTSGSTSERSSGGDVPDGAGAMHKVAPLLAPATNVCDALEASCRQRMVNTVCAK
                     TLGDRGGSSLLSPVPDTLTCNVCPSIMAHAIQCNLAAIDDLEDVRARAIAACLRRDSV
                     ALLAALQNIV"
     gene            <139430..>140092
                     /locus_tag="LDBPK_080380"
                     /db_xref="GeneID:13391916"
     mRNA            <139430..>140092
                     /locus_tag="LDBPK_080380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858555.1"
                     /db_xref="GeneID:13391916"
     CDS             139430..140092
                     /locus_tag="LDBPK_080380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858603.1"
                     /db_xref="GeneID:13391916"
                     /db_xref="UniProtKB/TrEMBL:E9B9E3"
                     /translation="MMLRRGCGTAISTAAATASTSLRCSARCIASEFKDIRPRSGGAA
                     PPPSISNNGPILPMDFNPHIEWFEYPKEIFDPKFPYTREESIRMTEESWESTMDEMAS
                     KYGMRLNMSSKPTFWMAWFIMFFYSWYTLWGCYRAMGTEPGWSHFKNVVLNQPTVPVL
                     EEDDIYLDQWMRPEMREKFSRYDRFWNWKPLVKREGAKTTWQIPMQYADESEWRHMTS
                     RF"
     gene            <141198..>146930
                     /locus_tag="LDBPK_080390"
                     /db_xref="GeneID:13391917"
     mRNA            <141198..>146930
                     /locus_tag="LDBPK_080390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858556.1"
                     /db_xref="GeneID:13391917"
     CDS             141198..146930
                     /locus_tag="LDBPK_080390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858604.1"
                     /db_xref="GeneID:13391917"
                     /db_xref="UniProtKB/TrEMBL:E9B9E4"
                     /translation="MAFTDSSVPPAAGHTGFPALCKAANDDGNEVGTQDPFMVAYPSS
                     SLPPSYSSMIQCVLGRPLPFLPSPLSRKANSRSRSGLGVGGRLRYGTDPISCSGSLQL
                     SYDASAASGPSSLSRTVPQGSSDEASTLGKDYILKEEDAFESPRGTPSVPTALRRSLS
                     PTGAAAVARTMMPAAPVLLRHSHGGKTRLLYADGHVETVVAGGATKPPSKRTHAPSAA
                     SHRRMCADDKRNHLRSLPLDAAPLPSPSASGRWLLESFSAVAQVHQQQLPPLVEPIVT
                     PQAAGAASSASPPSHAAERSAVRPMEAESSRQATKFPSWSFVTVEPQQQQVAASITLP
                     HPSGKTPPRLPANFSEGTGKTDHARESTEAGGDEGGHGRMEGFRAMVPAGSPPITAAG
                     AASRYDANEKSIRTSVVSTVGVRPSRSTSNVGEATLSKAADDAKTAVAALQSGVRAEL
                     AAEQRAGAQAFASRYARDVSASPSLFSLRFPVRPLSELHAFADRPHHEDAAAAASRGA
                     LSTDEPSASFLEHREAASSTRRVEDAPAISPTRAPPPQQQAPDVLLPYAQVTTPSGFT
                     VPELLQDRLLPRETPSLQQKLSKLYAVRGLIDARDSTACRFTVSFMWFVLLRCRKARR
                     EQSLVNGYRLLSTAFSNAFPHVALDEALPPLDVLEQLLVELLTCLRYSAGVQSATNTA
                     TSAAAASSAASAASSSRRAVELPTSDGFATLTRTSGRTASTSGLLANAAPTSPPASTT
                     HTTSDTPNAASVAAAPSKVPLRLRLHEHAAYFPLLLSPTWSKLVSTGAVDAGSGNGYQ
                     ESKWAQQQEQPHSSCRQEVQRMLPSEDALAILCKMYQDLWLHHSEYVQLCLYEELLQK
                     QLALQFGTVVMHLQQGAMSAEASTAASTTASFSAGVSQGLRPSATWRPSALASATPIA
                     RSEGWGDLRASRSGAPTSGGDLRARKSRNTTAMMTNTAVAAAAAVAPAVMDGILESLL
                     LLVAHATYYNCVFCFPNDVCAGMFDEEFRADVVRWLFVCYHGVYLTHVQVRHWPMPAK
                     GDYADAQLKRRAATELEISALGLLPTCEQQTAGIVRAAVVSGVQGKSSLTAIAEAARS
                     ASLFTAAEDGIFDVGGVEANSEARVVYQLDRYGRSAVLHVAELERSMALLQRRHMTGD
                     LCGSYNSQFGPRGVSGSSRTPGNSRGSSAGSATPAPLPSNVHPNLIEMVDTEAGSHRS
                     TARRQTGTKTSRQQKHSSAGFSRRTTGGSPTTAAEPLSQCATLDARSSSSRGAVKQGA
                     SIQSGCGMQSPRQRRTPALATAASPHCHQEEEARAQYRTSAAVAVGKSLVTLAAELRR
                     GSQKGRVARATWKATSARSICQENEHRASASARAPHSAGANVSGNAAAAVCAAASKKR
                     NSECPATGVRAHRRELSAGSLLSSNPLCVSPAPIRDYWLSMLLRAPFWWTTRTAIATA
                     AAVAGGEAATSPATLQQHSAQLLLWSSVPIGADGEVVPLQDLCRLQLEPWRALLAVAA
                     VPPISKEAQQAAHQMRVYGKTVPQQQAHLHRMVERQKLHHQCNRQRRSQEDSRELPVF
                     APPRLALAINAAKTAATPSGPAPSAAGTAELEEPAVSVVPPRFSARWRTASSVGGVAD
                     LLFMCSAMLPLTPLNIPADAAELEASTTTATVVTASPPAVAQPRRRGTGEAYESCTPP
                     FYEVCSPSMTPASSHTSYMPAHGKGGERIRWRAQQHRAHRSTAGSSNGCPDSTDVTTL
                     TTAATPITSTFWSMMPSGALAPPALASMHRRTLTNQGLTAHNTAIVTALSRCPGGAGA
                     SSNGATSDTRGTTNWPGDSFAAMPAPHTEPKPRSRRLAPLRKEALRRRVQLLADLDTI
                     SKRDQVVRQHYTVQHLQLSSAMTYTQSEAMMRRYCAQSRLALERLICGEVGDATAARA
                     VTERTKEFNF"
     gene            <148729..>154386
                     /locus_tag="LDBPK_080400"
                     /db_xref="GeneID:13391918"
     mRNA            <148729..>154386
                     /locus_tag="LDBPK_080400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858557.1"
                     /db_xref="GeneID:13391918"
     CDS             148729..154386
                     /locus_tag="LDBPK_080400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858605.1"
                     /db_xref="GeneID:13391918"
                     /db_xref="UniProtKB/TrEMBL:E9B9E5"
                     /translation="MERCDGVEVQPHIRADTGPTAGVDSIGLVSSIFASRSAATAASR
                     TSPQESEVPPAAAVRRARSAPLQALASAAVSAAWGPVAAPQSAAVGTGVGGTLWQQAF
                     AAHAETLLRETQQQVDELRRYQQKAAREAQRADAVAAANRALEVQLAEADAKRAEDRA
                     AHESAVNALSQQVLRLEEAVGVLRRTKLELQRQIKGAQTAAAQQEAVHRRELREVRSA
                     FESELKRMRAEQHLQADEWRHERHRLEEKLVEWDVTEVAVSTQQMQLLTRRAELERKH
                     EAVAAASLGAAPTPAYEAEAERAAAVPRVDAATSTDVVALPAAQAIPQESDASPYTRV
                     HRDVLAQQQLREQTMLSELSIADARIQQESKQRRLAEERVAELLEQSEQLREALTNAE
                     AAAANTERVSEVARQETAVAVTAKAAGGRDNAGHQMGRRDAVAHGTEHDLRTQQRLLQ
                     EIQYEYTALRRESSALFERHREQQRCETERWAAVRSAVGAVLHVAGLHDVRSTLEHAA
                     AAAADTSNLSCLGEVLADSSEASLNATLAALDTLASTLRSQQQAAAADEAALQQQRRL
                     STLEEALRVAEAQNEARIASLSATEAQLHESQRELSAWQRRHNDLAARQDVYDAAWRA
                     AEVQLKQIIGILRRALREYAQPLSASLARLSSPGDDADSAGRRVTRRRSARAVKRRSQ
                     SSPASAASLDGIEDSEGHAAMLPTTADAAPVWASDGDAIADADLDDLLQDAFVLPKVA
                     GEGDKMDRPEAVADGEGESLSRRRTTRTANLPQSSAATLVVVESTDGGSDASHSEVRR
                     DMAVVVWGLLKLLTAWRDRQHALVEARKALQRQLADMTAKNTALVEERREAATRCQRQ
                     LRLSRAAEQRRAHQLEQAHKELEDVKRKHMLGSAQAHQKAAEWEGEREALRRRLRVAE
                     EQLNRAEQALVEADVDHNAQHASQEMLQHALSDVTAARDRLERRQADLCVHIEDLETR
                     LSVTERTQTDLHALITTSVAFIVRLLADHEQLQEHYRVLRTLAWTDAQTARMVERVLE
                     NCCPERSEQATALAGERGLPWSTGAASGVSASPAGAAPHSATSSTLLRIAGHAVRAVL
                     RLSRLLTARQRLRSHAGTRRSDGSILSPSAAAAEPASLQPLLLALSSAFAWGAATPAL
                     NNAAASLHDSRLRRYATRPDSCVLPVVHLPAPLELAAVAHNEAAEVEAGGHAGLSKVR
                     FDLRSRACEDEETYIGADHHQQRQLVQLLTVAQIDMQAPTTRHLCDGVLAASSASARA
                     TVELLQLAQVREALSATLLRRRGRNRLSIAKPQPVLPVPDLRPLLPDRLAALLQSHLQ
                     RAVTQTCQVAESHMLVQRLMHHNETLVSALKMRTNEHAAASAEVRSLTSQLQLQQAER
                     AERTAVQERLVEVRASLLRERELRRAAEARLAELQQARLQWLSDREQYKREVYSLNME
                     LASTSVGGASPAGGGTRPLPPFAHGGGAGPALATSALSIQVDNTTMSDAARRPAAPPS
                     HLDALADSVMDGSALCEQDFAHGSHPQVWRAAAFAAEVDYQRNSENVYYHELLRNGHE
                     RDSHARAGHRHGGNIGAHADAPKWSSAHGETPPLRTPHYRPRTNLPTPQDLAESGSPD
                     DTRSAGAAPGAGGGGGGVRPTSDTDASLWNEQRQPHGPSCAIGLSPTAASMDTLKTTT
                     PAERPPAPQPLLTSANALELYVPSVARQREKPRSHNAVNCEERRLDTTAKTTRAKRKT
                     INNEGFGIVSHAAATASPSSSFLADAPAPESDVCAATPPPLSPPPPLRSTADTETPAE
                     ERRGSTHQQLRRSAANVVEPPSAVAANHGSTASTAASFSAPRPPPPHSPSKGVSASAS
                     ADMRTEAPTLSREEFDSTGQPTAAAGVTRHVSGPLYFRARPAR"
     gene            <155351..>158917
                     /locus_tag="LDBPK_080410"
                     /db_xref="GeneID:13391919"
     mRNA            <155351..>158917
                     /locus_tag="LDBPK_080410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858558.1"
                     /db_xref="GeneID:13391919"
     CDS             155351..158917
                     /locus_tag="LDBPK_080410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858606.1"
                     /db_xref="GeneID:13391919"
                     /db_xref="UniProtKB/TrEMBL:E9B9E6"
                     /translation="MQSSAAPILPPSHGLASLSSGSAVSVEGAQPHVFCLSSEASTVE
                     SAVRGSHATCGAGRTFRPLVPPATALGNEEFTARCKGTCDAIAGVPATVTSTGIFEEC
                     DQLACSTTAHFTDEALLDALPSHFFSSAELLTSSHLADLLSHAQESCAAAAPMSMCAE
                     RTATSTRALTSSPPPHSPSSAAPSFAPAVPSDAAVLNVSQLASLGVPVRSATSRDADE
                     AEDKEARDTLGSGAMLRLPVHSMQETSSSSAVHQDSQPHFTPAAEHDGERTDTRARTP
                     PPRDPSTAIRPPQLPAEEEARTTLVTPSSVDSAAPCTLATHPLVADNVCADLPASSSR
                     TSFSSPPPPEPAPTSRLGPGMNAATPEGDPAVPVPFDELCRRWMRLLARTAVPHEQPL
                     CIDCWRGACLAPLQQRTRLSLEGMKTLATIISSTPAEKLRFFTMCYTEPAAAPLRGAF
                     ANSAGLRRGFDEVENGQAVDSMAAAENLSRALPLISLDAVAANLFGANEEGLLSSLEA
                     LSTPHGRCFPPTRGAARALKPLPCSSDAPLELREASHAEYGDDAEQMMAELERLRAQQ
                     ANLERQLAVLRDVLHSLEFTTHPHSNRGEQFRDTVAAPPSAVTPPGWKELAVAHNIRE
                     VQRAFTVSDEAAERQHAMEDLMKSFAYVSSTPIDALCFPIDVSGPIGLIAGLRLGLVP
                     PYSGSSSGRTGSGDGDVRGGGASVACTMSALPPLAHAAVSVSEESMHLDGFVQRQLGY
                     AQLLLSGNTSADGDGHSDAVKKRSSERSTGVNGSASCGDAAPTAAAASSAPASTAAAK
                     ASTRVSPLEVNAACGYMLLLLNYLAHVNGFSFSTAVLRPAGDRSTVALLKRVPVSASG
                     AKDCGGAAAATKSSVFSPFTLSYFTRKGAAFTQARGDAKSARATARSSVAHVVDHEVD
                     FYLTDRLLAWRTFGAACVAVATCVKELADALHESLRCWRVRESMVCRPAPSAAPAAPS
                     GTVKGTEDASDFGTAPAAPADAGSLEGAQARRDGAAACKQPRAPVPLPQLLQNLAGTN
                     DHLISAANALSSSAPHVSAAVLDTAGSLGTTPAVRGNDLRKSASTSSRPQPPQEAQSA
                     QRRSSPAVGGRFPLQPPFRTRGDTVDGFSVRHGSVSEAIWTLGMKKLLANVQWCREAT
                     VELERLYAITGEAANDGADEQVSEDDGEVAGQVDTIAGMRRE"
     gene            <160258..>164469
                     /locus_tag="LDBPK_080420"
                     /db_xref="GeneID:13391971"
     mRNA            <160258..>164469
                     /locus_tag="LDBPK_080420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858559.1"
                     /db_xref="GeneID:13391971"
     CDS             160258..164469
                     /locus_tag="LDBPK_080420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858607.1"
                     /db_xref="GeneID:13391971"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9B9E7"
                     /translation="MALSPTAYVSPGCSAQCRQCVSAKPDSFAFASVQSISLYRVSTA
                     NVTIPTSASSTPAQAQQQHQSLETIAITDYPLVTLFGHGANAAIAAFSYNDDYMACLT
                     PQNKQVLLWRLKDAETLTAKKITSTALSDAFKREGNPSTMCLAGRHHVLCGTNTGRLI
                     SLNTNLDNAEPRSVAIPPSQQRGNAQQPRSPLSPGNAYSVPAVAGPLSSLNPSGTSSA
                     AAAAVESVECIVAATARPEAVACGTSDGTLCLLTLNASTGLLVTASLCPFPAKEKSDT
                     VLDVNPLPVTSLAFEPTSAQYLAVGSQDGALALCDMNKNSIVQIFEVSKLPEKHISSI
                     AWIPGEAGAFYTASTDSPVLRKWSVSSKSVVGSVSIMVMQQMPQQRSSGARGAADASD
                     SADAEHSSSRIGIRSVACIDQTRVVVGLTNGSVKVYDVTQQRLECDIVTGHTDATLSC
                     KLSKHDRDQAATGGVDGMIRVWNLRTLSQQYSIPVGPVMVHSVDWSPNGKHLIAALGS
                     GEVVMYSTSTNRESWRTPVFSELVYRVCWAAGDSSLIAATSRSGVAVLSSKDGKVVRR
                     YPATRGAFYGVDIEPAKSKMIAAGSHDHRIYVYNLSSSSEHPVHVLAGHTDAVCDVAY
                     NPTALNYLLSGSYDGTLRVWDLSSNDAHTISVSSRALKGHADRVRSVAWCSLAPYLVI
                     SGSADASIRLWDIRNGVAITTVRGHNADVVAISSHVDRPLTFLSAARDSTLVAWSVAL
                     LRQVYLDAALGTLENCIVADPSSLMGVAASSVTVSQVAGAAVQRLAKELAECASRPAE
                     RLQKLVSFFESPNGAAEVAEMALCAVDPAAYQVAVAEGKTAATGLVVPARSLAEAARA
                     HATYTNERAHSKSVNAAGPSYRKQRLLEAADELLRVGQLEAHCNVLMEAEEWDRAIAA
                     SPAISRAYWRSVCQKAAEAMEAAGDARAVAYYIIGEHAHKAAQLLTRLSQRHYDAATV
                     VCQTCPQVADDPQQQQQQQANEPPHNTTVDVNSMTAATQQLQRQRAAVLKRYANPQLF
                     AAVLLAYGHHDEAVNVLQHCGDVVLAHLLVHTVPLREQASIDTAFRLSMLQSARQQRW
                     DTALACATRQSNPYDALATVLALFQTAQGKQLAGKSTAPSLTSGNLSTLQGVSERLKT
                     FYEQVRGECGKLQLPLDAAAIQQRHAHDGLASQNQLAAMVLMADPSSGPMTDGAILQS
                     LSGFMESLLTVALKEIDGATTPFYLRQAYNVSAYVSLPFETPSKAGGNASVSLSASAV
                     ISSMTPEHKRFLALVFIVAALMAVKVYRFPKLLQSAFTKARELAAASGSASLSTILTN
                     TQGALGTYSPHSKEVDCSSVGCALPALSSEGRQIVSVLTGDPVCGAVHVLEDSSSFIS
                     KSEALAWMLCSHFSPLGSGARLTAV"
     gene            <167170..>173124
                     /locus_tag="LDBPK_080430"
                     /db_xref="GeneID:13391972"
     mRNA            <167170..>173124
                     /locus_tag="LDBPK_080430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858560.1"
                     /db_xref="GeneID:13391972"
     CDS             167170..173124
                     /locus_tag="LDBPK_080430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858608.1"
                     /db_xref="GeneID:13391972"
                     /db_xref="UniProtKB/TrEMBL:E9B9E8"
                     /translation="MYNFHKRADAPTRVEGDAGAHGANDGHDDERSSAGPQAMAEDDG
                     HDAQRQGRAYGHSAESRVGDYADGLGAPVAGSGEGYGDYGQEDPGGYDMTSYPAQGSD
                     NQQQQQQQQAYMQPQVYGQGAEARGEGEDDAPMFADYRGPIDGERAERYNRRLQQQKQ
                     YDDIPMPPDDADPQEVFTYYRKLIGLVHFVPPRHWREIRFDLPANVAELRLYPQRRER
                     VQDREPIRPTSCIAISLKGMLPENTTPSEYAAQMVQYMFDLLNYQNASTAITELRFVK
                     KGTELLQMVVTLGKDVRLAGRVLTELQAAGLRAYYGKPVFEFPPNATFQVVDYRRTLH
                     DGKGISAEDVTFLLEPIRQYNTVDINVIEGYEPGVFYAPVKRPETVYSFLWNYFCSYK
                     FQSDLFRRYGVLVTMAQCPHEFLQKGIPYHIQKQQLEEKIRAELQRKGMEKREYDGSG
                     GGVGAGGVDDDDDSDDGMNGGADEATGEGPPPAWAANAADEIDIFGSSTPASRVQKKQ
                     QQQQPTSAAASDPFGYGSGSSRAAATAAAAATANTVATAITFVDEDGLEDVDALLQQY
                     NAVTEPPPSAGKKKEAAAKGRKGKETTSAASAATVDGGAVGEDGVALSDTGPQGGACI
                     LPPPSVEGAGWGGGHGSYGGDPYGSLPGYAPEQGAHGYPPPPQYYPSSGPYGGAGRGA
                     PPESYYDGYQGVAPLPRAAPYPSVAQRSSSSYAAPPYAYRDRSAISTAADALPVTAAG
                     GSGAPSAYPLLVDEADDEQDVIQHPLPQEQQQQQQSSALWSGDGSGGGYGNLDGQQPQ
                     QLPSSSQAIAPAPHEKDMLLSWSMDEGLAHSSGPGYAATGVFSPLPPHRTQQGHVNAF
                     LPEGEEVGGMQGYGSNWSAFSDSQQQQQQLNAYEAGAAVGGVLGDYDPTLPSYYAGGD
                     GSSYPPPPPQAAAPWSHADSNSGAPLRYGEPMPMPVPMPMPMPPHVREAAEIAADLEE
                     RIQAAFPATWATASAASAQPFLLDGEVLEGQDLQSTSEESNCVLEHIPDAAAAAVADL
                     PAPTTEIEELLSFLQRNVSLVGRLLHKTTTTTVEQAAEVAVFRARVARALLIGATMTV
                     EESGSPATPEAIRAAWERRAADGGEVPASPAAANDGEAGEPAEGEAAPAETQLPALLP
                     YLLRTSAGVDLAMLLAFHYPRAFSRRFLPYAPAYLFDENVVRVVVATALRRDAQAANV
                     LVRHVLAHWCPLAQWLLRVAHHKAAEKRNGGEASAAVVAAGESGSTTAAMKHLVSSIG
                     SSMDTVLAALSPAQREFCRASNDACNYVDAFAEAMHATGVHDPAEDSGALPLLWGPDG
                     ALYRSLVRLYVNADVCDGAKVALRMLCCGRFSSSATSTSLASAEVCLTRDHYYYCIVL
                     LSRSHTAPVLSREMAAFCGAFLKLLELQHTRWQQQQQHPATEGGGSATRAPSVGEKEA
                     EQLLDTAFKAMQTIDVYTTLRDAYLAVEVPITRFESVLARLSPAEPSAKLQLQVPTLA
                     EWYDGSNSNSGKGKTNAGQPPRKRGTEAPAIPSIFYYRAPSRRNARWNQPQQQQPQVS
                     HATLNASGAGGGSGPTSIASRWRQEWTAAMRTYPPSGVPFTALPEGWTSQPSREHGHY
                     CFTPPAPASSTDGAAAPVTAPTYKHPMDGKEYPVTPQALLLQGAAAGGSTSSVTLDQV
                     RTRANAMHAEEAAAIGLPPPAELTAAAAEAWASDQRRRNVFLDIATMELLGIKYRPSG
                     RAHTVAADAASTSGVKRGRDAGATAPTPEQLQQLLAKAIARSYPAVGAPYPVVSRGWA
                     VYLNSARGQYGFKGPNSGPSQPPLFVHPKTRKHYFVSPQAFAQQRKVNLDVVARDAGV
                     EKKDVESWMADQRIRHAAIDAAVVKLIPITYSDVDKAMEENAAVEVAGDSAAAPPVSS
                     SRDRDHQNQHTSSSRHRSEREGHGSNSGRKRRRYEGGGSDASHSDDDKRENGDGSRGR
                     RRRRDRSPRRRGGNGGGGGGGNRCRR"
     gene            <174516..>177293
                     /locus_tag="LDBPK_080440"
                     /db_xref="GeneID:13391973"
     mRNA            <174516..>177293
                     /locus_tag="LDBPK_080440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858561.1"
                     /db_xref="GeneID:13391973"
     CDS             174516..177293
                     /locus_tag="LDBPK_080440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858609.1"
                     /db_xref="GeneID:13391973"
                     /db_xref="UniProtKB/TrEMBL:E9B9E9"
                     /translation="MSGTSKLRWAHYDGVYQPALHIPAEEITETVLPAGYSAVYLLGL
                     DSTVVVPDADLSPYDPHDTAKASHPAAALGVATAQQILEGFQAIEDGSAAGTQHAQQW
                     PHNDEAEGPSDTLLLDDDDDGGRAHGRSSASRSRHEEKQQRKREKKAAKEAKKAARAA
                     AKREREEVTSAPTVQHRDDGDSDDELLAAMTIENKYRQARDRGSAGEGDNAGASSGKK
                     SKSKKERDDGAWAALEADLFSDEEAEDEEIEGDGAGRCDAGGTWRQQRGVRAGNRMGQ
                     ALSALNVARAAPDIPGLSTSCPYAYPYLMEIDYEYRQLAQEVASEGLLLTKQEGEVVR
                     EIDAELRRRAAERVYLQSVLEQRLQQQEKGSERGEASTAASNEVDALSEAIGKLDAPL
                     SVADLVRRLVSKQVSASTAAFDRYAAARARRAVQRRTRTFQDTSVITLLEQLRAVAAT
                     PREDATEVMRKYVQQRRQHEEMKSNMRGLTKTGFYAVPKPMEKWKRGRDMMLLVNAGA
                     EAQKVRPTSYISQAYSTMRERMRDHAEKHFDRMAVAARDGASFLDPSSFAGTSTAFLP
                     STSTPAALPLSAQQHLIQQQQQQQGRLNAAKAVHRREAFFQFHSLRCDTEAPVTLESV
                     PLNAGFAAASTLAPELLESVGETIAPGSRAVSLGRGGEDASIHTEDGTSLSYSTHSAA
                     PSSYPYLFDHEPRSRRPRQRRSSRGSVSGLSPDVEGASVNTSRATSVASAYSGNGEDD
                     KAKEHRRGGRSAGKRGATAAATQNGGAATAPADWRSNAKRSIMEQLTLYRRGKHGKPA
                     VLNDEQCREMCRLLLDRAMRAEAERQGMSLAVQSNNIAARFTKVTEKRLKKSVDHYLE
                     RQMQQGSLFSKAATSAGGALGASAVGVLGAGAVLHPGILPIDDNGAVLPHDTAAEARQ
                     RAVADTPIYED"
     gene            <178579..>185769
                     /locus_tag="LDBPK_080450"
                     /db_xref="GeneID:13391974"
     mRNA            <178579..>185769
                     /locus_tag="LDBPK_080450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858562.1"
                     /db_xref="GeneID:13391974"
     CDS             178579..185769
                     /locus_tag="LDBPK_080450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858610.1"
                     /db_xref="GeneID:13391974"
                     /db_xref="UniProtKB/TrEMBL:E9B9F0"
                     /translation="MIACAALQRLERYGSLGLKRHSTEDFVSASLKDARRANIYALTL
                     LSTWKEALQAVRGGDANGVADVSKAPARYTDALVYAVSFAVVLTTQHLFEVSTATAAC
                     LIFTDAYAQALELLTLLKEMTVAMGSGGALRSNASSDDFTKAVAHLLTSCTDLALLLL
                     GGIPTSSGAATQERQESQPGSSSAEQQQQQRESILAQALVLVAATAQMLRRVQASYPI
                     NDLYHTRPCAALLKAVANKHKQLQQRLTHVSDSSDAATEQTRRAAPNACSETAKGATG
                     HQTTATRVPALLDVLHRYIQLCARRSIAGSQQQSAAAPSASASAASLFSIFSLFQRLG
                     MLHGALGAATALPKGLTAQLCSACEDVQYWLSQLLSSTACNRATRYVVYFREDELRLM
                     QHNIRQASEYALYTFATTPPVDPGLVEPLLKDGVTADSNDEATRARAALVLAQWCVSA
                     PFFFESFCQGESWSSFAQEQRRLVLLQQSRARRGLERASRRQQRKEGAKKTAMHLNEE
                     HGSRSSSVSSDSSDAASAHSSGSDSASSAGGRQQRQRGSGSGDAETTSLLSLQTASHA
                     NHAGGSTCGSVTSLASRVSLLSTLSKHSAASYLSFISVLRPSITAGSAAGGAGAGGSA
                     DGDDEAGADRQMHESEDGNTNLPLILLEQLALGLHRFMEAYPAELLDRYGLRSVSWSS
                     IARMFATVEKSLVNTTKMTAGAAAQRQANRFPNDHELPQPLFNLAQDIRYNKGMGYEC
                     LGLLFAKVVAPLLDPTSSRAIESTSWSPPQQHRLPRSTGEATGTEDDDGSETGSGSGA
                     HSDGDRTEEGVFVNAAAAAATVGRAVLTIDDDPTTRASVEAALSRCLTAYETVAPQVV
                     DMNLPTILRLAARTAATSAGSATSLRSSASPSSLSIVLVDFVRDITARLGRGNDLPHL
                     VDALLLRGDFAANASAAAAASSVVDDSGDPASAIRSLRAVFSLPPVRQAVMEAAGASL
                     DPESLLQRLSGVAAELEEGNKGSNSSSAHDEEQVKPSSAARPCRKKHDDARLQRMLLA
                     LELMEALLAGVTPTCVSAGAMLEHTTQLELLLNSSFMAAVEELKGVCGDALDDRRALM
                     IQHMYTIRQCRAVTILCLQDLGTQQVHDYLRMLEDALWQLTSHVGSLVGSLTLADLQP
                     LLRSHSARYGGSEVLAPSPSALEQLRVQLLPSSLILQRLSLARAVTVALGTHAGPAEE
                     LRDMVSHLWDCLGQDGHDADEAAAPQQRRSGGVSLWLANQMTAEEWTSLVALGKEKHA
                     RSSMMALLLRSAALTSAATTETPAWLSRCLQCIPGTVLRALVDAFVSLSVEDFCDASL
                     ANASSSSARRRLELAQRQWMALTTSLVAAYAVVGHNPYWPSVVAHTVRSVTHVARVWR
                     NHAKGRLGWAVETPAQAPHDSTAAHMFALLTRQLISLLLCTLRSEPRAVEVLRRVLST
                     LARESAVAPSSAAGPSVPVLSRSGMSVAYLKALTVPAASLGDLSAPTMLTTSDPTTAA
                     DGGGTVEVVAALKELTFEDEVRDVCTELFAASFVKRIFTVTDLCSDSAAAAMSVPLAT
                     VTVALRASMMTLALLYQVCVAAVQASWRAKATNGSLEALVQTPAVVFLHTVVSSFHAR
                     GAARVSSSGASSDTAVDVVLAAFLEQFRAHDEEHSEQHLFVHIASAASSGEKRRRTRD
                     RTDAGAGDTDCAAGDPSPLRTAIIAPSSALETVEELWRDQLRWTACTVMRLSHAADSE
                     PSSCATALQRACLTFRQLFACMWSSAHFRKHQVPKGVGGRTGGGGGDARRARSNGDSE
                     PKARQSRLAGDVDAFLAAVLGRPRAPGDGSSDRVRRVTGNELRYQLADFFGVPATATD
                     GAARGVERSRHPCDRIWMRLSSVGGEAGVCALWLLWKLQCVSAALTDRPATADGVKDD
                     SQTRMRTFLCAYYDLNASVEGDAATAATTSTAYTRLVASLRASPVALRILPAEEAPPL
                     LHEHVQALLTRTIPGASPRASAAASSFALVAPAAAEVIAHLFSVRPRLPGGQLLPHAQ
                     RLLVWLTHASSAAASLAAAGVHGVAGPSLPSLCIRVCAAVAAHPAVSSASDSSALIAT
                     WASPLPPHQKQLGACRSGWQLRNGSSAAQELLDNVWLLLLSLLEGSRAPQSATAAASS
                     APLLREREVVQMILLLTKTWLGHSARQQMLWSRPAMLPPLMCALFTCVMRGMESQQFS
                     PRVLNVLASGLAAMAAHVDAATANEGEGVGERKAEGSASSAPATTSEERRRPQKRRLE
                     AGTEAWAAGTAIPAHVKRAALAAVTSALFEVAHHYIHIFTAFSSDMDFLFTDFLKVLS
                     QHFLPTVTRPPIAHRVGVRIGGTVRSDMSFADLAYMCVGNAESKSLLKQAALRMEEEG
                     VMDSGSAGGGMASEGERGPALTDGSRSIFRVA"
     gene            <186579..>187121
                     /locus_tag="LDBPK_080460"
                     /db_xref="GeneID:13391975"
     mRNA            <186579..>187121
                     /locus_tag="LDBPK_080460"
                     /product="signal peptidase type I, putative"
                     /transcript_id="XM_003858563.1"
                     /db_xref="GeneID:13391975"
     CDS             186579..187121
                     /locus_tag="LDBPK_080460"
                     /codon_start=1
                     /product="signal peptidase type I, putative"
                     /protein_id="XP_003858611.1"
                     /db_xref="GeneID:13391975"
                     /db_xref="GOA:E9B9F1"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:E9B9F1"
                     /translation="MREHIDTLLSLRIRDVVQQVVTISLFLSVVLVGWRGAAVITNCE
                     ASIVVVLSGSMEPGYHRGDVLLLHHRPEYPVEVGDIIVYTLPGQDIPIVHRVHRIHER
                     AEDHKKLYLTKGDNNMNDDRFLFHSGREWVEQDMIIGKTFAYVPRIGYLTIVFNESKV
                     IKYVALALLGFFMLTSTQEL"
     gene            <188157..>189044
                     /locus_tag="LDBPK_080470"
                     /db_xref="GeneID:13391976"
     mRNA            <188157..>189044
                     /locus_tag="LDBPK_080470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858564.1"
                     /db_xref="GeneID:13391976"
     CDS             188157..189044
                     /locus_tag="LDBPK_080470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858612.1"
                     /db_xref="GeneID:13391976"
                     /db_xref="UniProtKB/TrEMBL:E9B9F2"
                     /translation="MRPVTRSPLLVATVVVAATLCLSGDNVILSLPSGVRLARADGPI
                     TKEQCFILNPKPTVTSCNAYLPPIVDLYGMLPYDKTPAYTNCVKERCLCTGAATSTAI
                     KTSGFFCNSSGWMESGYTTCNVLVDCFSKFWRCINKALYTRYLEDRGNLDPTEVDLMA
                     DMISHGNRPGETFDITDIFRSCRLMMCAAANSRQNCGLVTCLPNYTQCDEYIRPPPLP
                     YTHQLCTQGCRAALLMMALTIAAVSFSVCCFCCCPAQVRISKPVMKEAPAHRLESNSM
                     WSEVEAQDRRHRMGDSCTP"
     gene            <191988..>192341
                     /locus_tag="LDBPK_080480"
                     /db_xref="GeneID:13391977"
     mRNA            <191988..>192341
                     /locus_tag="LDBPK_080480"
                     /product="small ubiquitin protein, putative"
                     /transcript_id="XM_003858565.1"
                     /db_xref="GeneID:13391977"
     CDS             191988..192341
                     /locus_tag="LDBPK_080480"
                     /codon_start=1
                     /product="small ubiquitin protein, putative"
                     /protein_id="XP_003858613.1"
                     /db_xref="GeneID:13391977"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9B9F3"
                     /translation="MEHPEHTNQHPEGNNNTEAPAPVKAEAAAAVSAQQISLKVVNAD
                     GAEMFFKIKRGTQLKKLIDAYCKKQGISRGSVRFLFDGAPIDEMKTPEDLGMEDDDVI
                     DAMVEQTGGCVVRQL"
     gene            <194942..>195790
                     /locus_tag="LDBPK_080490"
                     /db_xref="GeneID:13391978"
     mRNA            <194942..>195790
                     /locus_tag="LDBPK_080490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858566.1"
                     /db_xref="GeneID:13391978"
     CDS             194942..195790
                     /locus_tag="LDBPK_080490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858614.1"
                     /db_xref="GeneID:13391978"
                     /db_xref="UniProtKB/TrEMBL:E9B9F4"
                     /translation="MAQLTRDEVHTYAEAMIAAIKTPAFQERVRAAMSREPTPTDAEA
                     VMKRYEEVQADYFTNHYNAEAGGICSSVSAGAVGRGTGDACGRAKSSQDASGVLAQQV
                     DNMSLEKASDAPKLDGVEIVEQLKNAVRMYKEKETVRLITELCLLIESQVTALPAAVP
                     ALKHLYSNSVYGSSAMEQAQAASARAGGGENVLPVAHPSPQVMQMMDMAMRTLSPKQR
                     ETLERVQRATMNGSPPLPEDMQDMLLIQRQLGAFMQTMQRFGQMPSGRGRGSGGRGGC
                     GGRGAP"
     gene            <196967..>198217
                     /locus_tag="LDBPK_080500"
                     /db_xref="GeneID:13391920"
     mRNA            <196967..>198217
                     /locus_tag="LDBPK_080500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858567.1"
                     /db_xref="GeneID:13391920"
     CDS             196967..198217
                     /locus_tag="LDBPK_080500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858615.1"
                     /db_xref="GeneID:13391920"
                     /db_xref="UniProtKB/TrEMBL:E9B9F5"
                     /translation="MPTTAAVRASRVPNTHDRETDEDEADMLQRFSNVSERQSARGMS
                     PPPSPSRAFDGTGDAECAMHMPPAQHGGRAAVSLERVPVSVLPVCALDKTAGASSPAQ
                     ASPPSQSVRSFSSTLLSQLLLAEAARAEAAAVTVAQQQCHNSVDDGSYASAAPFCAST
                     PSQDSQLPPRMTAMETTRLYRHHRGSGAASLHEQLPESPSSVAASPARLPMDYLAVSI
                     GVVPLPGSETPHGSAAPRKRSRWWPWSLTAPTVTPNAATGVVGEAACDTASRITRVDG
                     NAAEASWLTVHGDPTVSVHQLRPLRFYTSGQQHTAGAAAGRSSTSPTLKQPTGVTATA
                     VADNVVSIEPSSRTMDVLGWSGVFADVPLALPGAQPTNLPGATGSVVKGSKGVHARGG
                     DRDGSSQSEALFCSGVASISVILA"
     gene            <199017..>200117
                     /locus_tag="LDBPK_080510"
                     /db_xref="GeneID:13391921"
     mRNA            <199017..>200117
                     /locus_tag="LDBPK_080510"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858568.1"
                     /db_xref="GeneID:13391921"
     CDS             199017..200117
                     /locus_tag="LDBPK_080510"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858616.1"
                     /db_xref="GeneID:13391921"
                     /db_xref="UniProtKB/TrEMBL:E9B9F6"
                     /translation="MPPSRKVRHAAAVQEPRIPAKQQRQQQQQQQQRSPSPDHAVGKG
                     SSASTSTSTGATARAAPRLRKGSLSRTSVTSSPVGASNPRRHASAATSWRAQLLHLAT
                     QEAYTAATLLRLLPSTAPADARDGVQPNQLLLGTAAPPPAPCGAGAAGGARVQTAQTA
                     RMARRSAYDASAPTAPAATTEAASPPTHTIKWTSYGELWEGLLARLPLVNGANDAAKP
                     TPATGGNSDGNGITGGGKRCGGESAGHRGDKKAAVAAALAHGGAKAGDMNSPATDVSS
                     MLSNDWRSFFLHRRLSGTATAGGRTCTAAPPQGHQAAARPQRRRLDNLTCSPYMTHAE
                     QRAIRRYTAAAIASVPSGVRRGLSTICVLDFL"
     gene            <200804..>203326
                     /locus_tag="LDBPK_080520"
                     /db_xref="GeneID:13391922"
     mRNA            <200804..>203326
                     /locus_tag="LDBPK_080520"
                     /product="ribose-phosphate pyrophosphokinase, putative"
                     /transcript_id="XM_003858569.1"
                     /db_xref="GeneID:13391922"
     CDS             200804..203326
                     /locus_tag="LDBPK_080520"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase, putative"
                     /protein_id="XP_003858617.1"
                     /db_xref="GeneID:13391922"
                     /db_xref="GOA:E9B9F7"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:E9B9F7"
                     /translation="MLKTGKDLSQGQAFHRQLLSEYNTEITLDNYVSYFELKPIAKKI
                     EHIRQALESTYRDRYAHRSVVEPSLTSTLTITEPLQVEPVQPCLCETSAAVTPTGRRD
                     DKEFPASPVFVTPRGRQQHITTTMFTDPLSPLFFETPGFRALKETDKELAALIQRRIQ
                     LQERFFEKLHESYMRVKRYLIKLERDFVNAVAELRTFNEDHIRNELPRNYIPSLYLKL
                     EVIVKYRALNLKAFRKILKKFQERCACDSLELLQRVVNIDRLIYASNISQPSIDFRSA
                     ALDLIVVYGTVFRLTYEQAVRHMKQYENRTGVNAQRILPNSQTFFVADAFPHHERPGT
                     FAVRVLSGTCSLFCEKMITEVLQCPRYPGNSCGRFANGEVSVNLQAPVRGDDVFVVQS
                     MVALESENLSNAGALMELALLVHSAQLAAAARITAVIPYLAYTSNVASISAVAEMIEL
                     VGCHHVITVDMHSDQVEGMFSIPIESASAMYEFVRYVSNLLESEGNTFENITVVAPSG
                     EFLGRAKEYADALMRYNNLDSATQFVSVCTAVRRVETQPLACTTRTNRHDYEIPRVIA
                     ESHRCTGLSSSGEVAHECKLQQQQHGPVTRSTEWGTPNSSTAASVATSHINVNTPIDA
                     QGKQYLHSPATPPAADAVTSELVAIVGSESQAVSFSTHSYYASTNATAHGGTHNLLLQ
                     RHGEPDMQRSSSTLGIEKALRQQEEGPQALIMRKETASNEYKNYVLVGDVKDRLCIII
                     ETVIDEAINMAHVARCLQEQGAERIILVATHAVMSGNAINLLVESPIELVVVTDSVNQ
                     DELMKNPALARKLRVVPIAPLLARAIEKIHTENTLATLFDKS"
     gene            <205489..>212475
                     /locus_tag="LDBPK_080530"
                     /db_xref="GeneID:13391923"
     mRNA            <205489..>212475
                     /locus_tag="LDBPK_080530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858570.1"
                     /db_xref="GeneID:13391923"
     CDS             205489..212475
                     /locus_tag="LDBPK_080530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858618.1"
                     /db_xref="GeneID:13391923"
                     /db_xref="GOA:E9B9F8"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B9F8"
                     /translation="MGTSRVHSTSGTAGARWNSISLGPRSIAGSTRGPHGLQCRRGFR
                     VLHFLLACAIALHAVTAPLSTCYAYIRHAAAPPSITAETPAAPSLIRPNGLPPAAPAA
                     PWRTLNESLLPYPVFYPAIALLNSSILLLGGCATATCATPVGASGTRVAASRHRASAA
                     TSVTSPYHERLLSLNVDKGNITTLPQLTLPSGLGFAGRYAAVTLTDSVYVARSCTMST
                     QSPAEVASMTAEELQAMQAAYAPVVAFYPEGTAHASTRVGGPDPPPAVNLTYFKVPAD
                     RVRVNASCTALATENKLLIIGGFLLSGKRVTASVDSFNVVTRKYDADVAFLTAPVLQP
                     SVATSTGFAAVAGGWTYEADTTASATREARALQEESRVRRSSRVAVSGEPLHLVQELA
                     TPPGKSSASPRSDTPSSPPSRSVPSPAPLQPVARYLFDLLFFEPDRVRGCSRAAPRGA
                     LQIGGSICVSPVDSSTLPRTAVEDILLSPNGCHVAVFGGQVVLVDHNLGHIAALDIRA
                     RLAQAFAARAPLVLRPPPAVTLLRTAKPNAAARAFAGTESAASRDAQASSRHNDHAGS
                     TAVFDSSGSSSAAPMTSSTSSSSSATASSSSSSAPLPEYRYSWMQPTLISLPYARRPA
                     PAAAPDPPVMADTILLYYALGGEDVWSQVVTAAGDSAAADLLDPSGRQHVVPQLHGDP
                     STLRATGKGTEAVVRREPTLRWAQRELPDVRYDRDRPELLAVTMPTPLWPDALTLQTN
                     SEGIIHLAFRDLNYTRYCRWNRLVDNDDDNVVCAVRLSSRRDCVGNTAGTLDSAYDGS
                     PNATILFSASGSTTPVYVCFSYVVRPTLWPTCRIRQSFSILNPMMPLRILDNSHTTSA
                     PTPTPRPSPTRDPADKTTSSPLFMLAVGVSIVTLLVAVLLAARLQHVPEDGLLVMSLL
                     DRGDGAGDQHASPGIRGRSCGGAARHNGQGRRKRLLRGSGEPNKAADVEDDDEPGLYP
                     ISTYAEFLQVVGSAQEDSEARMLATAVDVLRLHQHRYRVLSRIGQGPHSLCFLALRKA
                     PPPPPLRVQQQRVRGAGAGMNRRVRMLDGDASPVVRSSLFTRPPSSFPAASATLSPGV
                     PTTATSSLWAARHDQSTAVVVKYTQCPDDATRALITRLCERLRDLQADAVTEALGATG
                     VYRQHRNSAPSRRPHRRYRPSDTSSTVSSAAALRPLDVSTQLTCGIAREVASGGRSSR
                     GGAAAQAPQTDAEDATAPPTSRRDSSAIIVTTASRAGCQPLPPLSSAANEARVIDGDD
                     DDNSCAWLDAHEVNVVLSLFLLLPEDLFVSYEVSVLQQQNSNSSSQHAHVDRSGRLTP
                     LSVSQAAVEWNRRHVWPGANAEPAKASHHRQRHRCTPMLSAGQSLPEQSTPRVCWAAC
                     VNPLQPSTLRPWSLCLVMPYERSGDLADFILRCQQVQLLPADVTGAKDTKRTGLSSRT
                     SASPACVPPVHHCWTESLLCSILFQVCTGLQLLHAQSPPILHGNIKQTNVLLREPASF
                     SVARRRVVVAGTPAALAGMKMGVSSGRGGLEDANGDLDMAAATMRVPGAQQAREGEGG
                     WRDRRLEAGIAAAARPLSAHASFWRASSLVAAATAVWQAGSPVLRSSLSIGSPPSLFR
                     AGATASSSTAAFSHDAPQEGQPQLQPHEDEQLWPPERARHLLSTHTYLPISLTDGGMS
                     WWLTVQLPLRLRGCFGRTTRSTLRQAPAGLCWLRRLDPPPSSPPPITTKSSVLPSEDC
                     IAALADFLFTFIDVPTHVAPELLWGRLCTLSQSGHGDEGGAAAGLAVPGSSLTQSSSS
                     LHSIRNRREQHVASSRRDGRRRGDGDSLTHRRCGDVAREPAASPAVGSANLLRATASD
                     ELGANVTGDKQALGVLPQQQQPQLQRHDDPYADEDMDDRDVELDIDEDGIFTCEEVNA
                     LTSAMWKAEGLTRVPRGSRHYRQAPPQQRTSAAAVDPLLPGALAASTTTPGGGSVADV
                     TLQPLRNTTGEDGGRRGLGGDMRGLPSSFSNAPLFASTTTAATGLPSTSSTQPTSQAL
                     HRHHNDVDRQLCGNSNNGGRRMAEGGGGSVGGEGSRSSSSVYEVLIQRVLAMDTASDI
                     WSLGVLLYGMCADTVDAQQQQQHHRHHQTSASTPTSTLSPPHATEAGSSRVRAHEGVA
                     DTLPPAIPTCTCASRLAQRAFAALLGDLYDLAVTGVPSGGPGNNGWSCDGGAGLRSVG
                     GDEGDGVDVEPPDEAADDRLRWPRSCALEDEVMQVIGEAGYTHALASVLASMLSPVAA
                     RRPSAGDIVNQLRLVTTGAPATLASDIMRGGGGGLADADREYSVARQGPPPRTRHSGG
                     ASDATSSVMLHEQTARMALRQR"
     gene            <213000..>219338
                     /locus_tag="LDBPK_080540"
                     /db_xref="GeneID:13391924"
     mRNA            <213000..>219338
                     /locus_tag="LDBPK_080540"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858571.1"
                     /db_xref="GeneID:13391924"
     CDS             213000..219338
                     /locus_tag="LDBPK_080540"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858619.1"
                     /db_xref="GeneID:13391924"
                     /db_xref="GOA:E9B9F9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B9F9"
                     /translation="MRAAAHHHHLPPLLCASTFHITRIRSPAAQHTPLRNAVRRGTRT
                     NSTAAAVNVSAYSFAAPPLTNPYAYAASPSPSSAPSMRTVGVAAAAAAMSTVHAASVT
                     NSGAAAHTWTNGGRGGHGAAHALTNSGRDVSLVLLTVACTLLVVTIVLLIVGVRLLKR
                     FAAAVAAAEGARGQDILSNNLSAGEAAAYISVGIVDDDDEAALHTDNGDSRTQLVEYA
                     DEREPLLHHVRGRGGGAGRHRRSASRQHQQPGRRTTLAVFEALSILLGVSSTPPTADA
                     SSHGAAAAPRRRSRSCQAGSSAVPTPENQPALRSSPQQQRHAGRRAVPDALAADENSR
                     GAFRSGPQLTWHSNGSLSRSGAARKCDEAAVAPASASPAPASHPAAAPGSSAAPATAD
                     HGATPPSGNAQLPVFTTTTEKDMVVYNTTHNSRYRLLQRIGIGAFSSVYLVQHKTTGK
                     QYALKYILCKGDRERLAALRECEVIYSLQGHPQVIRIVDMFMSYQFQRASPSPTVAGS
                     PTAAATNSACKEQASGQQGLRSFPGVPPSAPAAPAAALAPSAIATPALAPASAAPAST
                     YTTSVAGRLKGLNDAALTKAAMESSTESRAAAHSEADDGHVDFSCVDRDRYSEGRWRG
                     SRPRVRPSVEGVACGACMVNVDHASDVENEESAYSEHQQPQQPGKLSMRASSVCCPRP
                     LPHSVQHTSQSSSSVHPTLSAAASASTAPATASSSSALAGSSYVPAQLCAAAGGGAQG
                     CGHVPSQSAHHSSTTASAARAAATGSLSPPRDEAHADQPHLCCHAIDVPDAVVHDESD
                     ATAPVHASARCCAAHSTTTTATSMHPCFPSTARNATVSRSSEAGHEPGTLEDCDGGDG
                     VHSGSDSRRRAEQGQSATRERAKPALQSRRASSEDRGSDGADDGHADIEAGREERRTE
                     LRGDADADEMHSCKGSDARSGATSSSGADEEPIQPIHRIFVPPPYMYPPLNGMAAAPR
                     SCSICSNNSVSYAGTGNGAASVLRPQSRTCATGGESPTSHHLYSAFPTAAAGGALAVV
                     GPETANGSTAPAPVRRIPERPDVGSLSATASPPPFAAASASLTSSSPSPSAAVNLRHT
                     AGSLVSTSTLPHQQQQQHPQPIPSSVTSYAPARAAVSSADVKSAATGAPAVQAPIRYK
                     DFVLSPTTVTAHAAASWTPVPATQANALVDGQTHRQPVDRGGSPAPPPCAASARVGSG
                     AAGAGATGLTVARPTDECVNPYLERARGREPVPPPRTSYAPGGGVRYNSLTVPYVAAP
                     TTLQAAAKGFPAQSSSPSSSLTLSASGTGVSAFDERKAGAGQGRRFEVTGADSSSQDS
                     DASMPASQAARLTASRSLPSTAPAAATVVRNTYAPLRYGNVVQSNAASPATSSMASSS
                     LMPPPSPSLQKQLPQPPSAACPAAAAPTVGSGRLSVCGVLRTARAGQQGEREDWDDGK
                     PRVSASWPAKDAGLVSTQAPPLLPLPGLANQTSGAYFLRSVGRVNGAGAVPRAATPRA
                     PYGEGRPPAAAAAQDEAPSPTRPLYTNLGVLIAGPSMTADPATATTTHVLRTGVQPPS
                     PRHPRSNSYAGDDADRKRQRGYSNVGLTGAAPSEVRYTNAGSPNLWNAYNAGASPASA
                     ASAAAVAALTGLSPRIGAKTPTAACAGESNINDGKSSKTTHTNSSSSHLQDVCDTGYL
                     CLVMEHHPMGDLCRYALRAQHELEMRRHRQKQSQSQALARSSLMSVGILQPITSPATA
                     TTQSRTCTSERSSAQQPQAPTKNATERDGGGTGAEAGESTSPLSLRPLSLTHGGAAGS
                     AAAALSLLAAAADATWTVKVAMSRTDLHPALSAGVGGRGNTSGSHTAGGTDGDERATD
                     FDTQRAASVAVDPTSENPLTEAQLLSIAYQLASVLDHMHQQNPPIVHRDLKPENILIK
                     GELIDYLDLPLSAVLASTNNTVHCGGKDDALGKSSVSPMTPPFTTPAAVIDAAASSLT
                     SLPPIRITRAVVPIVLIDFGLAILQDTHGRSHCSRGGGTRPYIAPESWKGDTCTASDV
                     WSLGCVLYALATCRLVAEDVRIMSQEAKRDGFASRMLKDIIAHKYSLAFASFVVSLLV
                     VDPAKRPTAAQAARCFCVADGDICFDLSSPFFSNVLDL"
     gene            <219916..>220974
                     /locus_tag="LDBPK_080550"
                     /db_xref="GeneID:13391979"
     mRNA            <219916..>220974
                     /locus_tag="LDBPK_080550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858572.1"
                     /db_xref="GeneID:13391979"
     CDS             219916..220974
                     /locus_tag="LDBPK_080550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858620.1"
                     /db_xref="GeneID:13391979"
                     /db_xref="UniProtKB/TrEMBL:E9B9G0"
                     /translation="MLRISPPRCAPLQASRPLFFFSWLRQSSGHRGSAAATWRTKAKN
                     TFISEGAMGLGGGDVGQPMANEASEALDGKGTSTASYRQAALNGTVRRGFGNGQAFQA
                     GGGAAPGSTVPKQPIDDILIERGAHLSGPSRRPLSYDLEIHRAARAREAAQKQASQEY
                     LLHFDEQNMPRNPHDPNRKRASWEFTPTPEHKSLVLLLYRNVLKGLMNYKSVRRRSMI
                     AYARMCFRRRAMATEKLLIDECIEECRRSIYVLEKHHNFTKTGTYEFDSMTLPKDTGQ
                     DVKTYMEEVYDPEQSRMQFQNFTDVQPGREHLHRQGLGPTSGSHHWKDQKTSEGFKVE
                     IRDEDRALRPPPPPGVAS"
     gene            <223483..>224949
                     /locus_tag="LDBPK_080560"
                     /db_xref="GeneID:13391980"
     mRNA            <223483..>224949
                     /locus_tag="LDBPK_080560"
                     /product="cyclopropane-fatty-acyl-phospholipid syntahse"
                     /transcript_id="XM_003858573.1"
                     /db_xref="GeneID:13391980"
     CDS             223483..224949
                     /locus_tag="LDBPK_080560"
                     /codon_start=1
                     /product="cyclopropane-fatty-acyl-phospholipid syntahse"
                     /protein_id="XP_003858621.1"
                     /db_xref="GeneID:13391980"
                     /db_xref="GOA:E9B9G1"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B9G1"
                     /translation="MENRPHEDSESKEAAAAALLSRESYESVQRLSKCPSDLPSSENR
                     YEVIAAAMKGDDHGMGGSTSRVVNYGGPHGNGSLFSMSKAEYAKLEKREAKYLRIAQK
                     ILSACGITIGGDKPYDMVVHNPMLFRRVIRKGSLGLGEAYMEGWWDTRDFYALDNFFK
                     RILQSGIEYYFPDNAKDMLNIIRAKVHNPQTKSKSRRVGMQHYDIGNEFFRNMLGPRM
                     QYSCAYWEKHVGSAEDHMIKPVETLDEAQELKLHMIGEKLRLRPGMEVLDCGCGWGAL
                     AAFLSEKYSVKVTGITISEEQREGAARLVKDDPNVTILNRDYRDATFDRKFDRIVSVG
                     MFEHVGPKNYKTFFKHMRRLLRDDDPEAVLLLHTIGSKTTMSSADQWYLKYIFPGGCL
                     PSISSIGKGIEAYFVMEDLHNFGFFYGLTLLAWRSNFLVHWNKSTESTKPGADAFFRM
                     FYYYLSSSAGAFEARDLQLWQVVLSPKGTPGYVSVYRP"
     gene            <226751..>227788
                     /locus_tag="LDBPK_080570"
                     /db_xref="GeneID:13391981"
     mRNA            <226751..>227788
                     /locus_tag="LDBPK_080570"
                     /product="translation initiation factor-like protein"
                     /transcript_id="XM_003858574.1"
                     /db_xref="GeneID:13391981"
     CDS             226751..227788
                     /locus_tag="LDBPK_080570"
                     /codon_start=1
                     /product="translation initiation factor-like protein"
                     /protein_id="XP_003858622.1"
                     /db_xref="GeneID:13391981"
                     /db_xref="GOA:E9B9G2"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:E9B9G2"
                     /translation="MIREAGRQRRRNADSDESSSEDEQQQTTTTVQETTAAAPPARVR
                     AKAPAAAVVSAPSMTLHADPTATQVTAPSAVSAETTNSEGGSNEDAPSSAAAAAPSNE
                     FSEEMEAIDYDALTYAALLDIMNRASRPAIEELMAQKEQQVESTMQQQQNQRVERFLD
                     VATTSSAAAAEANGSGAEEEAAEGYRYNTMLTRLFEALNRNNEGSAMTERNQLPVPIL
                     ERMGKKKTVIANFGRICDAFHRPMEDVKDFIEKELSIRGNLDSNNALILKFEIRKQTD
                     FDRVLIKYLDEYVKCNSCHRIDTTLTKDGRRLELRCNVCTATRTVTAAGTATFSAQIE
                     KRSRQRAAMIL"
     gene            <229800..>230513
                     /locus_tag="LDBPK_080580"
                     /db_xref="GeneID:13391982"
     mRNA            <229800..>230513
                     /locus_tag="LDBPK_080580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858575.1"
                     /db_xref="GeneID:13391982"
     CDS             229800..230513
                     /locus_tag="LDBPK_080580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858623.1"
                     /db_xref="GeneID:13391982"
                     /db_xref="UniProtKB/TrEMBL:E9B9G3"
                     /translation="MQPRRMAGHFNPTPQANSLAATHYAHAPELRHMADGAAMSLSGQ
                     RIPLLKPTLSKWSRKLRSDIYDELLKLPLRYALHDFRALQAHIHAVPDTAPNASGTAA
                     AGERLPPGVYHASSGLSSASPDAPAYYAVAGRDSAVGYAPPLGPADPVDVIPFFVHRS
                     SNGHLPGKVYSMNAKTLMPAFYMRIQNIEGDMFRFEEELMKIFPTKKIFVRSHSVYVY
                     NVNLDGRAVLHHWLLGLGF"
     gene            <231752..>232291
                     /locus_tag="LDBPK_080590"
                     /db_xref="GeneID:13391983"
     mRNA            <231752..>232291
                     /locus_tag="LDBPK_080590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858576.1"
                     /db_xref="GeneID:13391983"
     CDS             231752..232291
                     /locus_tag="LDBPK_080590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858624.1"
                     /db_xref="GeneID:13391983"
                     /db_xref="UniProtKB/TrEMBL:E9B9G4"
                     /translation="MTTPWATMVVAQGSASAVTGICSYAVWTTTLPPSGDAHIVYPPG
                     AVAYQPQNHTIQPVNFFLHHWYVAIALILCAVCGFYTSLALSFIHHFDFYAQHQAMKV
                     VGESYATKGYFNLDGEDAHGAPRPTAALAGAHAARSRRLSLSSVQSSSYSDDSYDGES
                     LPSPSEADDGIIEMNPLQL"
     gene            <235098..>235601
                     /locus_tag="LDBPK_080600"
                     /db_xref="GeneID:13391984"
     mRNA            <235098..>235601
                     /locus_tag="LDBPK_080600"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858577.1"
                     /db_xref="GeneID:13391984"
     CDS             235098..235601
                     /locus_tag="LDBPK_080600"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858625.1"
                     /db_xref="GeneID:13391984"
                     /db_xref="UniProtKB/TrEMBL:E9B9G5"
                     /translation="MTTPAPMDGTEVEFPSNSVVYQRVKHRLPPKSFFDAHWYTGIII
                     IVLVVLAAYIVLALWVCHHFEYAEQRKAKKVVKHAYVTNGFFDLDRGKTGLRTQRDRR
                     SSSSSSERRTTVFSVHPSASRDEHEETHNWHSGSDSTTTSESDEYVFVDVNPLQPQGM
                     VLRKRAT"
     gene            <237689..>239239
                     /locus_tag="LDBPK_080610"
                     /db_xref="GeneID:13391985"
     mRNA            <237689..>239239
                     /locus_tag="LDBPK_080610"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858578.1"
                     /db_xref="GeneID:13391985"
     CDS             237689..239239
                     /locus_tag="LDBPK_080610"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858626.1"
                     /db_xref="GeneID:13391985"
                     /db_xref="UniProtKB/TrEMBL:E9B9G6"
                     /translation="MVDAHRAGNAARARRQRIVERQRAPPLTVSATSPLTESLTILSY
                     VIVFSLYFAGFAVMVLAVVHRRRAVRRVRTQRKQLSPPPAFLIAANSEEACAMTSMMS
                     NASPARAEETSKATPTAARGSLQMSDLTVYRLRKLQNCVESDQDDGEQNAQGVRGETA
                     TAEAVSVLGRTPLRLCAHRCGETSSGGSSSADTKRRLSDSVDSTALAALKMSAVAKLL
                     PLGDQELTAAADEKSDMSLTRKMKADPVRAMRSLSLSPAASWRPCAASDACATVQAPR
                     RHRGGHRRRERCSDGRGSCGDVTAITAAAHVADTATWFAPSSGSSTSLSSESSSASTT
                     GNGAAANTATAAVAAKTRPSTSPVLVTYVPLRQVRSSPTPVLPGYPSILDTGLEYETD
                     AEVDAADVFVAVKAAPMPLDPRSPMTMNAADTAAAAPVNSHGSSVLLALADAERGVSR
                     ASQQTPADDASGMHYHDMRHRNSSDDTYNHPQRQKSRLVPLLPSFFPGSSAPPSPAAP
                     PLRCEYTG"
     gene            <245252..>245683
                     /locus_tag="LDBPK_080620"
                     /db_xref="GeneID:13391925"
     mRNA            <245252..>245683
                     /locus_tag="LDBPK_080620"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858579.1"
                     /db_xref="GeneID:13391925"
     CDS             245252..245683
                     /locus_tag="LDBPK_080620"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858627.1"
                     /db_xref="GeneID:13391925"
                     /db_xref="UniProtKB/TrEMBL:E9B9G7"
                     /translation="MEAGHGCRAARQPKRLLTALFVAAALLAAFGGALLVAQAEVETP
                     EPTPYVRRTYEVKVPFFTQYWWVGFIIMILVLLLVVMVLYAAVQHHFKHSEQLRRRKE
                     IEMSRMHIESGSGDDDARSQGAGQYSRSGRSSYSNPLRTPL"
     gene            <252006..>260657
                     /locus_tag="LDBPK_080630"
                     /db_xref="GeneID:13391926"
     mRNA            <252006..>260657
                     /locus_tag="LDBPK_080630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858580.1"
                     /db_xref="GeneID:13391926"
     CDS             252006..260657
                     /locus_tag="LDBPK_080630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858628.1"
                     /db_xref="GeneID:13391926"
                     /db_xref="UniProtKB/TrEMBL:E9B9G8"
                     /translation="MGILPSRESHEYPGAFHFALSGSHAMAILPLTEHFFPSVDSLAF
                     RQLYAGRDMQSAKYNFSLISPELLRKYRHRSMEQRRGKGGVGDEAMAPPAGRSKPQPY
                     LRHGQPPGDDSDADEKWVGVDTIDASNYGQFFKDDTQCVSPNDPTSLSPDGDEEVCEE
                     LQWPNPVAHWRTHDTAKQLIQDKDNELGFTDELNYVSLDGKGGGLRCLPSSLSLPCSS
                     GQCPRYGQTHNASMEAGTDSTAATAHLTAEERDLVNRFFARSPEALYNALVVEPNKGF
                     LVDTNKEMCHLYAAEQRWKEARNVVRAYRRQCKQDAAAEGAPQPVAGESPNSPKGQPQ
                     RRITKEEAERAATVPPPPVFLRPVPQVIMVRMSREEEEATRAAYLAEQQRLRSRSGQP
                     QQSQSGGGDDAAASMSSSPAAAGAAEGSNVLRPPLIKPVSHLHVPTTRYHRFEDDPKY
                     KDGRIHLVEEDGVLYMFAYNTAYVDPRLRMRQQREELLKQQRQGKERKQHESQEESLE
                     RGEACRSPSSAGAVVAGTTAEGTASGTAAGSPGSCSTERNAAATPMPDSGSGSGDGDG
                     DGALFHGNRQTSSFYHTVSAFGNEEDEAGLEEHGAQSKKVKDASPRRASSTEGSPVAA
                     GTIPAVAAKQTEGTAEEADAEEDATLSSACNGPGGHQRRQSAILVDDSALLQRSDGKP
                     STSSDDEDDDDGDEQRKGASVSACSAGVTATTVNGATSAAMKEKRARVVQQLQLVTAA
                     PFILPICPVRIVGCNGYAESSCRGTPWLRGYEDEPEEDAYVESLPVKPPIMSGGGFID
                     ANIGDKILSRAYLLGFQVYRNVCLDAGLPKTLTRPFWTLGLLSNIPLLQISREMRFRM
                     RAAAAEVELGYRGLCDMIKGTENDLQSYIYGFSDILPYLQRAARARVELAEAEAKAAA
                     AAEGGGGGGASDGAASSSLLPVGHGASKTPEEEAQESQSLQVPPAIPTRSSQAALQHS
                     LLFPLNEMEFYTQFTIRGNQSLSRVRCEAQESFFHLIAEATAPVSTSLFMKPLELPTY
                     DYGGAIRLHLLCNRVTCADELQVLPPPRNLDQLLSDHRRRLQLRRQPPASADGNAAPP
                     YLVYAVVHPSGKARGPSLEHYKRNLQAPEDGADANTLDEAEAAAASTDGTDGDGRYAA
                     HQYTYPPGSFVDSDMVIYNVHKGRWEHFEYFHHQQLAQRRARKLQAQAEKAAGEPDGN
                     KTPAQSNKGTASAAAATQAAESGEACRGALVPTRGGGFDANDDDDEQDIHLEDILLCW
                     IKRRLQSATMRNRTDPGWLRDSEGHIVQEGRYYIWGFEQDGQQYFYGLIPKFAKEKKN
                     KRHSTAGGNAHNQHNQDSHTRRITAHGSVCGSSSALNSHSRPQIGGGGSSSVSARDRH
                     GTLPETLTPASQQGPVSGSINGQPTDGRGGGRMEKTEVRAGPASADESAKKHAAMAAA
                     PSVSLSDVKGDAGSGLRTRTDAPLSAACPDSHSRRQHQQQHPRSPGAVGGGAGRGTAS
                     SGSAAASSSTAGANRLSNPSNATSGARLPAQASGAPRTGASEKSSPPTSSSPAAASAS
                     SSTSSPAATSAVPPAFAYNTPGVASRRAAGSRGAASPPPSAPTALVTPRESEAALAGR
                     SGAAAVGRGGASRAGTSLAESPPSSVVVGGAAAEAAASSSNPRKLPQRQDGVSRISGR
                     GNVSREQQFSSSATTTAQFSRQSATAPAAASYTSAEEVGYRQGRGERRGNGAESAYAS
                     PQSQQREPRSANASPPPPPPPPPPPAARPYPPHIPQQHPEVHSARHPLSGGSSLASAN
                     PVSQQQQQQQGCRISDPGAVVLGCKGAPQNRYHAPPHQPPPPPLQHEYMQAPSSAAYD
                     NSTNATNYGGGSGVNRYAATSHASGHGYSDMPPPPPPPQSPPPPPLLPAGAESAAYEQ
                     SHQGYPAPVEQQHHQHPQQQQQPSDSPPPPLHLHPPTAYMNTGAAQANQRPTLVLAGP
                     RVPSPRHAQQQQQQQQYVSYNTRPHQPQQHVSHQPSYKTQPAMANVVSGARMQPPEMV
                     PGPYHHHTQQMMMAMSAPNAGPAAPPPAQANAAMNTSSSRYAPHPRMVASGAGAAPMQ
                     EQQQLASVTAVSVAPPSALTGGNSMYSDVSAASVAPSGSRPTSYYPTSPSQVSYGTSS
                     QTATSAMHPAGPQGSAASPHTGSGPPVLPPLKQQQQRQPEYPPSAMMDASTAGGQGSV
                     ASQCYLQHKKPQSPPSGPASAPPGGAHYCQMTSPTSQQHAYQQQMGTRNASYDGGSSG
                     HNYGTYAASTANPNANSSFSRVGLSLSASAATVKAVTGVSGTSTLMSNASASLPSTGS
                     GIGRGAQGYAPQPSGYPTSGGTSFTAAPVVAMAAGATAPTSSMMPGAEGGAVKAFPPY
                     QASPHPQQQQHQQPSPQQHQQQQQQQQTSVGGRAAGAPSPAPHQYRTTPTAEQQQQQR
                     DSRYPLQVLAQSYSNDYNGNGGVPAMAAGGRASRGVAVASDGLDSSSYDDAVMHGSRG
                     TQAAAGEYQLSYQQQYQQPYPQWQQQHSTSASSQPSSCTPTPLPVQQQYQQQYGAQAG
                     NGSDNNGSRGHTHTQASRAGATGNVNAPSAYAHEQRASPYPQHAGAPPASPAAAAGVS
                     SDRGAAAVVTSPAAVAHLSTPMQSANSFNSNVAAMTSAGSCESTQASSAAAQLQRNSD
                     SYGYRSSQSGPTSPYLQASPQQQQEQQEPQRYLQQNQYPQQQHQLQQRQRSATRATAA
                     AGPFPCGTGGGLQPKTMMSAGGAPSASVNHAYTLHHHHHQQQQQQQRITHSSPAPGGY
                     YQNQVLAHPQQQQQPSVALQRLAATPNASGTLLRASPGSQQRHNQQYQRQQQQKPASP
                     YASTKEEAERQMRRSGNYNNHSVHNSNVGVAETSYDSNSNNTAAQRFAHNPYAMQ"
     gap             261738..261836
                     /estimated_length=99
     gene            <263876..>270697
                     /locus_tag="LDBPK_080640"
                     /db_xref="GeneID:13391927"
     mRNA            <263876..>270697
                     /locus_tag="LDBPK_080640"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858581.1"
                     /db_xref="GeneID:13391927"
     CDS             263876..270697
                     /locus_tag="LDBPK_080640"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858629.1"
                     /db_xref="GeneID:13391927"
                     /db_xref="UniProtKB/TrEMBL:E9B9G9"
                     /translation="MGALPSRESNEDPSSVFFANCGSHVVFHIPMTDHYFPSPHSLAF
                     RQLFHARNNQSALYCFDMKDVSSVMPKDVAAAFREAQEEDWGAEVDEVDPSLHYYDDE
                     IREKVLECGRNADSICEDAGAGAAVPRVPRIGRHLRPSIEDREELYRVLVTEPMEGTL
                     VDTDSEMCALFEQEQRWRAALPHLSNGQQQHGSHTGKRCNANGGHGVDEKDADHAQPV
                     AGASATRQQSHDKVVKKGHSAAAANGAGVGEAATHSPSVTRPAMSSAPPPPAKFLHPI
                     PRAIALRLTTEEEEEMRAEYCRQHGIPYVAPAFHSVGTATGNRADACAGGFSAQQQHM
                     APPTPLPVVERRHYHFEDDPQYRDGRVHLVEEHGVLYHFAYFAKRPSPTVAAVAVADS
                     SRSSQKGVTTDGTAPSGVLTAGKTPISQTPIVRGRCLHDVVYCAKPSTSPASSSKHAA
                     ASSSGFAGSEPEVAPPVRYTWCARCGERVTQRMDYTQLRRLKSTRAHRRAVRKQLPDG
                     DQDSPREKDSVDEVASNTERVDEEGEEEFIINIMPVRVVGMDGLLPSRSRGTPWLRGY
                     AQESEAAEDTYIEQLEQKPPVMRVCRFIEGSVGDKIVNRAALVTLLSYRPMCRQAGLS
                     DALTRPIWSMCVLSNIPYLQMVRETFFRAKAAVAEVDNDDLLLRDWLDVVDRENNFYN
                     FINANLHMTRNFTPPERTVRQREQADDVASAGTASSRRTTTGGGCGVREGGNVGVGPA
                     GSSSVTSPSLLKTAVYSAVEDNGSPTESHAAHSATSASGATTSPSRRRAAPAAAVAAR
                     ESAETAEHTTDAAAQGVCCKRKDKDGDLKPAEGDGAGLRGRHLTRALEEATIGRPEGY
                     DPRDQVEEDEDDEDDAGDEGGERGASDGVGESDVATKAAARREKGKKKLQHKDLGLPS
                     LCWDTASPPASSTDRSAAASAAASASPFTEDTKQKRSDGQGNPVAASAIGGLPAAVDS
                     SYVAHRHRSGGNKDGEDASGKPPATVTTTSRLLPNAASARAATGQGSSGEGDGMRPSV
                     NNFDDDDDPDLRTEEEERRCARVSVAKTAETSGSSLQKPTPPSAVAVEARGAEKQPHQ
                     QRPEVPPRPNFQLFSSRLEPHAPLSLCTLFDYDASADQAAKKTVTQLAAAVAAGVAAD
                     VAAGVAADHTNNAGSREEDGVGQATAASAAAKAATTVWPSYVQRDILRENERQQAEPK
                     ATRRPSHALYECGMLATTRGRNFLFLLREDCVRALLFYCAAAAAPIFIGAYIEPVDTT
                     SLSYGGAVRLRRPSTVDIPLDGGDEDGGSRTAPGRNYDGQRVVIGQVEGMEVMAEYFK
                     SKGLITCFSVSDVDKAAPGPSAAHRLRKLILPTTSLSTTYAQHRSSSSGGLAGEAGSL
                     AAQQARELAQYGHVFTYAADDFCDGDLVVFNFEERQWEHYEHVQLRRRFAARAATAAA
                     DAVATAASAMPVKTAEPMSTGNVAVAADGSRSCARSVVDPSMSARLLCVGLDELLLSW
                     TKWIVDNRFYEDRTDLGWLSLPDGSPIQLGGRYFLWSFRHNHQRYFYGVIPKFAKGRL
                     RRQKMVERNRSKKKDVEAPRQQAQPLAGILTLSSVGVQRSSDVSVAPSAPSSPALVTA
                     VAATLSSPPRPSGKSPWGANDTLEAQQEGEPPRRGSVTGTGSLHAGPALGDQASSSPP
                     HPSLGVSPPAHAGTAQQPPLPQEQLSTSAAAQAVSTAAASSTHPAAMRQRQRHSSPHL
                     QTQQPIAATSAPLPLPHRMNPLYTDSISYSAPHASITLPQQPMPQWASTSATASHVSA
                     APATAGEQAKQGNFASTLSSAGGFSVHAGRNAARPALCSPKIAAGSLTAAAAATTTTK
                     TTTAARRAPFPNPPPQHPVSGSRNRLSAPSSPAMYRSGQQIGFGGGPNYYYQYGGNTF
                     IQDGKQHENEYYPPLPTGTPFHPATAITKLVPLPHPKTGRGGIPAIFRFWGPIGSPAP
                     RTPVAAPSLPTAGGAAATASLAAIPIALVPQQMHSLSPRHPATGGSPAASSSVGGGES
                     MGVSPVEAHHHSTGSSLDAGSPTAPAIAPASATAAAGASAVNLTVRMRRRTGGGNTAA
                     IRVGGGASPAPLQLPSQGTSSLGASLTTLATAGPAMGPGTPFKHSPLTPSNLPPASLF
                     AQSAPAQLLVDDSGSQRLSPTSMLPTNLINEGSKTKGESVLRVDEDTYMQREAFRWNP
                     YASTKWAQNRSSSTGGSASDARGGLPARAAAEAVRTTAMGARRGHTRTHECVRASLPP
                     LSTFQCFFSLPVLGISKQCKEADER"
     gene            <272922..>273824
                     /locus_tag="LDBPK_080650"
                     /db_xref="GeneID:13391986"
     mRNA            <272922..>273824
                     /locus_tag="LDBPK_080650"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858582.1"
                     /db_xref="GeneID:13391986"
     CDS             272922..273824
                     /locus_tag="LDBPK_080650"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858630.1"
                     /db_xref="GeneID:13391986"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9B9H0"
                     /translation="MVSGNTHLTLLRSSVVVGAVAAALCLGATAMLPIFRLNIDALNS
                     SITQSLWTTDIYTPAGEKHIPVKKFVKDCSDLALAFQVAQVCTLVGIGALALAFLCSV
                     LHMSSTFTRSSYRVRAVCGAPICLLLTVAIAAAGLNCYIMRAMYENNWCEKNTTECME
                     ATQSAMGVIGRPSILLNRGLPLRKMSKIQHSFLTPAVNMKFAVSREADIFATPLTKAA
                     ATGSTGGLFGDCNPFDGCISSFHNMGFTGAEGWQTTWAALAATVTGFFAETLVVIIGG
                     RRSSEAGLGESAVALLQGEDERLL"
     gene            <279483..>280373
                     /locus_tag="LDBPK_080660"
                     /db_xref="GeneID:13391928"
     mRNA            <279483..>280373
                     /locus_tag="LDBPK_080660"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858583.1"
                     /db_xref="GeneID:13391928"
     CDS             279483..280373
                     /locus_tag="LDBPK_080660"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858631.1"
                     /db_xref="GeneID:13391928"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9B9H1"
                     /translation="MQTFYDVLSVPMSASQDEIWHAYRRLLVRCHPDRCYHDNDSVAY
                     NTTRELDEVRTNLLSKAYKVLSNPQRRSEYDAYLTRQLRNNSSVYHQPPQQVRRSQGT
                     AQPQVFAFGGGANRSVSRMAGLVKAMMTTAVDGNAAPATAGAAPASGQPISTEEGARR
                     GAVHPQYANPMTRALGTSFGVAGEATATVPEGGANFAKSPSSSTPSSVSIVYTDSVSV
                     RAIKAGPRTVGLVVVTDGGVAPGTPASTETPEAPPQQQQQQQQEQAQPSAAAAAAMPS
                     AVSDVHLPLRIRVIEEHLVL"
     gene            <282948..>287027
                     /locus_tag="LDBPK_080670"
                     /db_xref="GeneID:13391987"
     mRNA            <282948..>287027
                     /locus_tag="LDBPK_080670"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858584.1"
                     /db_xref="GeneID:13391987"
     CDS             282948..287027
                     /locus_tag="LDBPK_080670"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858632.1"
                     /db_xref="GeneID:13391987"
                     /db_xref="GOA:E9B9H2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B9H2"
                     /translation="MPRHSRHSMGLTLLAAPRATPPMKAAAGVSPMKTPAAHEQEVPM
                     HPPEGRHQPLSSRCSSSPAWLRKVKHVGTAARNVLCRLDICWAVFYFVFLVCVGSVSS
                     SISYRLVSRSLIEAGRSLHENRITTVNKLIDQSMDRVDDMAGGLLTLYMKTQFLMQSE
                     KTLSVLCALLERYDEARNYRAFSVISLEQLEMISCWRGSAEADAGGPLIGAISLNHTV
                     NATYYVNRSNYMLNRPLQVSAVIPEGNGTVAALVSNYAASELIEYTQAYYKGSIDSVD
                     IRLRWLQPSSHPHLIYYNYPAGLIYRSLKLPTNVSITDCTQVHIDGARLALNTIGEAK
                     SGFLLAVFVNQSLADADPLIMSNNWGQQTVHDNIIFPFSEHAPTAYLKSSNVSHPLMR
                     EALKHVDLSRMRDPGYKHSVDFRYNDARAVITVWAYTSCHGLTLPLVYVNSQNTVTGP
                     YLRLHDTLNGVLAAVMVLVSLVFWLFVQLYFAAPLREITRLLNCSVQRGARALYRAGK
                     HGIGALAEVRALGNAHNAAMRQLREVDAFVPAAVRKELPRGTLPAPLTVPIETTLAGL
                     NVVMGSSENRAAHLARHLSTVVYITVRPPQPPPVASHSSSRTPAPLSTQPAGHDAAAI
                     TPRCKQRLSVMVQRAVHAVNATSSGPFATPAALEAFASVVHELAHTHRGTVLRLRPDT
                     CILHFHAAVRAHLLPRQEVQLVNAADVDVVTEELAQQDARDAAAFALALLSWVDEQQT
                     AEGQLELPRMPDVRALLDTSLFTCGQYRPADSEQTMTVALGRDVLRDAGSMVERIGVR
                     VAMTEETAARVLRGGSGDSGAAAVSAIPVEALCTGRAEHDADELVLYEALCSRVASGT
                     ALQLYARCCFDGFARMRQGDYAGALTAFCGVAAIADLDPGLLPPCLRREVAASGATVG
                     AVSVQVARLMRECERCVRAGVADGFQRVPRRPPGMDAVLPDDITPLGTAPPVSTARSG
                     VPAASAKPRRMASSFTAPPWYPEVGDRHVMLLSNGAVTTRVVVPTPPAWVRDNHGMYW
                     QLACRKSDCTPPELWACRILALGSAGAIASVNYIMYREVHPVVAKAIRDAPPGPISDA
                     LRRATPVCGPTAQQDAAIKRLITRHQELRHPNILAPLAYSQSVEGGVVLIWEFCPGGT
                     LRQLLARYPRVKSVTFACFGLQMLSALSHLHERGVAHGRLNLDNVMVDSNGHCRLIGQ
                     FADHALEREIFHFKPSCYRSPAMAAGALPTPPCDMFCYGLLAMEAVTQQPCWRWATAA
                     EYGGHRDSKPPSAKELADLMATGGQRFADAVVQGRVVLNLEQLDVGPITEHHNDTMIS
                     VCRRLLSLDPASRPTAAELREENKSVLNLLGITMEEDTR"
     gap             288996..289094
                     /estimated_length=99
     STS             289732..290134
                     /standard_name="ha1258"
                     /db_xref="UniSTS:515421"
     gap             290861..290959
                     /estimated_length=99
     gap             293505..298781
                     /estimated_length=5277
     gap             299954..304194
                     /estimated_length=4241
     gap             304813..306893
                     /estimated_length=2081
     gap             308462..309113
                     /estimated_length=652
     gene            <309435..>310046
                     /locus_tag="LDBPK_080710"
                     /old_locus_tag="LDBPK_081330"
                     /db_xref="GeneID:13391988"
     mRNA            <309435..>310046
                     /locus_tag="LDBPK_080710"
                     /old_locus_tag="LDBPK_081330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_024473499.1"
                     /db_xref="GeneID:13391988"
     mRNA            <309435..>310046
                     /locus_tag="LDBPK_080710"
                     /old_locus_tag="LDBPK_081330"
                     /product="amastin-like protein"
                     /transcript_id="XM_003858585.1"
                     /db_xref="GeneID:13391988"
     CDS             309435..310046
                     /locus_tag="LDBPK_080710"
                     /old_locus_tag="LDBPK_081330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_024329221.1"
                     /db_xref="GeneID:13391988"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9B9H3"
                     /translation="MAYPVGIILYAILQFIAFLFVLVGTPIDMFRGTTKDLFNISLCI
                     TLWGSKFECNTIMYAMPTDDQWKFCPTRLQHFRIAEILSIISVFVYALAALLGFIMLC
                     CCSLLRWLCLVFNIAGIVTLGITWGFMVVEYGRNESRFCPPLRKDYKFGVGFALFMVA
                     WVLNLINIIFLMLPWQIGESGKGDEPNGQEEEEEVGSKKATEE"
     CDS             309435..310046
                     /locus_tag="LDBPK_080710"
                     /old_locus_tag="LDBPK_081330"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003858633.1"
                     /db_xref="GeneID:13391988"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9B9H3"
                     /translation="MAYPVGIILYAILQFIAFLFVLVGTPIDMFRGTTKDLFNISLCI
                     TLWGSKFECNTIMYAMPTDDQWKFCPTRLQHFRIAEILSIISVFVYALAALLGFIMLC
                     CCSLLRWLCLVFNIAGIVTLGITWGFMVVEYGRNESRFCPPLRKDYKFGVGFALFMVA
                     WVLNLINIIFLMLPWQIGESGKGDEPNGQEEEEEVGSKKATEE"
     gap             310279..313585
                     /estimated_length=3307
     gene            <313953..>314561
                     /locus_tag="LDBPK_080720"
                     /db_xref="GeneID:13391950"
     mRNA            <313953..>314561
                     /locus_tag="LDBPK_080720"
                     /product="amastin-like protein"
                     /transcript_id="XM_003858587.1"
                     /db_xref="GeneID:13391950"
     CDS             313953..314561
                     /locus_tag="LDBPK_080720"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003858635.1"
                     /db_xref="GeneID:13391950"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9B9H5"
                     /translation="MACKLGVIIYVVLQFIAFFSVLIGTGVDMFYIKPEHSFGARVCI
                     TLWGGKTDCRKANVTISSDVRWKFCPIRRNNFRIGQAFAIISIFVYGAAFLFGFLLLY
                     CCAGFRWLCLALNIVGAVTACVVWAVMVVTYRLPEPKCLELSDGYDFGTGFGLFVLAW
                     ILDIIDIIFLMLPWQIGEFGEGDEPNGQEEEEEVGSKKATEE"
     gap             314748..317813
                     /estimated_length=3066
     gene            <319409..>320938
                     /locus_tag="LDBPK_080730"
                     /db_xref="GeneID:13391990"
     mRNA            <319409..>320938
                     /locus_tag="LDBPK_080730"
                     /product="tuzin, putative"
                     /transcript_id="XM_003858588.1"
                     /db_xref="GeneID:13391990"
     CDS             319409..320938
                     /locus_tag="LDBPK_080730"
                     /codon_start=1
                     /product="tuzin, putative"
                     /protein_id="XP_003858636.1"
                     /db_xref="GeneID:13391990"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9H6"
                     /translation="MEEVHLSPIADVSTRVYVRVGRTATNEDRIAGGIVGRVNSNGTL
                     GVLMDNNSFEAQVSQDDVILVEGRSRFTREKGYKDMMEWFRSAGVHRRADRERLCFLL
                     YQRGWRVDKLYLLEPSDVHCMQYLRKSVRQMVLEKAEWQRDHHAEMRALLRERVKERA
                     RRYFIQKYSGFVSANWAGLGVLSVFLWNYKRFRRQQRSFQVKHAVNTLTHTDHRRSSS
                     PAVPQQFVERAAEERWTRQMLRRLNNTHPRIAVVTGFRGCGKSSLLRSAVRKEHKPAL
                     FVEVRGVEDTLTCIVKAMKVPNLESCGDYLEFITDTFTKAAKINGEPPILVVTLREGS
                     ELSRVYNESVALACDRRLCHLVYEVALESLSIPNVLLPRLDFYSVPNFNVRQALQYTE
                     HTVDAVAMQHFIETMGTNSNDIDELLAAILHRKVSIAEYTEQKLRRAMRQVETAWAGS
                     EKLRAALKKLAEADCYVGQENGTDALRDPALKEMVLYDPVSDRWVFTHKVYHTAARCC
                     L"
     gene            <322219..>324126
                     /locus_tag="LDBPK_080740"
                     /db_xref="GeneID:13391991"
     mRNA            <322219..>324126
                     /locus_tag="LDBPK_080740"
                     /product="tuzin, putative"
                     /transcript_id="XM_003858589.1"
                     /db_xref="GeneID:13391991"
     CDS             322219..324126
                     /locus_tag="LDBPK_080740"
                     /codon_start=1
                     /product="tuzin, putative"
                     /protein_id="XP_003858637.1"
                     /db_xref="GeneID:13391991"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9H7"
                     /translation="MLSQPTRRCLFTAVSSVSSTTAASSSGGVSRELDASAVRRSAFA
                     QPGLEGLRIAAYAPTEPGVPSSQRRLPVAIGHVVAQLSSLVFAVDFDDRLPPPAVSLG
                     SRVYVAYEREDVDPISQQGDGGVGGAPSRVFLVGGLVVRVNPNGTLGVLLDHNKVDLA
                     VPPEKIAVTEGVCKFLNHPKYLRVVEWVRSAGLSETDDVESTACILYHRGWRAERLYL
                     LEASDIRSMTHLSQSARMSLMEKAEWQRDHHRQMRNIHRERVKERDRRYMSAKYAGIL
                     SASVAFCGAFSLFGWNYRNYLTHQRSYQMRFAVKTLCKKVPPGSAATIGAPPAATGVE
                     TSMSSSAAHRMSKHVSRVVQERWIRQVFHRLDTAHPRIVVITGYFGCGKSSLCCTAIH
                     DEGMAGVFVDVRNKEDTLRSVIKALGVPHVEACGDPLDFISEACYKAKSITNGKAPVI
                     VLKLREGNSLTRVYNEALTLACDRRACHIVVELPLESLTTTNTLLPRLDFYTVPNFSR
                     SQAYEYIQHRLDALGMEVFLDTVGTNSNDLDELLAAAHQHRVSATEYTNQKLLKAMRR
                     LQTAWGDDAQLKAAVKRLAQLPYDEGQHEGLDDSSLSHPSLRDVIFYNSVQDVWLFKN
                     QVLHTAASCLL"
     gene            <325360..>326352
                     /locus_tag="LDBPK_080750"
                     /db_xref="GeneID:13391992"
     mRNA            <325360..>326352
                     /locus_tag="LDBPK_080750"
                     /product="tuzin, putative"
                     /transcript_id="XM_003858590.1"
                     /db_xref="GeneID:13391992"
     CDS             325360..>326352
                     /locus_tag="LDBPK_080750"
                     /codon_start=1
                     /product="tuzin, putative"
                     /protein_id="XP_003858638.1"
                     /db_xref="GeneID:13391992"
                     /db_xref="UniProtKB/TrEMBL:E9B9H8"
                     /translation="MIPGVVYAVHLQHLFLPLIIEIGFGVHIEHDKSEEYLSGLVGGV
                     FVRVNGNGAYRTLLLDSSGFNVAGPAETIIPPEGRPKILSTAEHREVVERFHTACLAH
                     IPQEGPLRVLDESRRHRDHHRWVLQLLKKRVAERGLRCDSINCSGVVSAVMALSRIAF
                     ALEHHLMTHRREQRTLQLASATNSLTHTSNRIRSVLLWPHRCRSTLLRNKEKRIQFSS
                     WCRSVPAAPCARRLRGGSSSRRVYKGAVALACDGRLCDLAREVAMEPLTVAGAGLPRR
                     DACTSPVLDRERRHSPTRSTLCGPRQPQPHHRHHRNEQQRFGRAVCRRAPRPRRA"
     gap             326353..326743
                     /estimated_length=391
     gene            <326771..>327502
                     /locus_tag="LDBPK_080760"
                     /db_xref="GeneID:13391929"
     mRNA            <326771..>327502
                     /locus_tag="LDBPK_080760"
                     /product="amastin-like protein"
                     /transcript_id="XM_003858591.1"
                     /db_xref="GeneID:13391929"
     CDS             326771..>327502
                     /locus_tag="LDBPK_080760"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003858639.1"
                     /db_xref="GeneID:13391929"
                     /db_xref="UniProtKB/TrEMBL:E9B9H9"
                     /translation="MCVRVCVAVFPRAVVVDASSALWCCEGWRTGDGVGGWWRGGAGW
                     RVLEPCRTGTPRPLRPPLHAPRTTGLTQARLGQRKGERKQQATAGDNLCHGGPLRSLF
                     LPSLAPAVRRGGVSDTHRPPLPMLVCMPAGGPPAPAVHDSQSSLPVPSPLPPRTLLAL
                     PLSPPRPQNKRARASAQQQEARAHAAATKTSLCQDSTPLRSPTRSPSPPSSPAPLRHL
                     DPLAISPPPPSTSALHPFSGVSVRRW"
     gap             327503..327601
                     /estimated_length=99
     gap             328485..328583
                     /estimated_length=99
     gap             332293..333195
                     /estimated_length=903
     gap             334055..334153
                     /estimated_length=99
     gap             334370..338682
                     /estimated_length=4313
     gene            <338970..>339551
                     /locus_tag="LDBPK_080780"
                     /db_xref="GeneID:13391930"
     mRNA            <338970..>339551
                     /locus_tag="LDBPK_080780"
                     /product="amastin-like protein"
                     /transcript_id="XM_003858592.1"
                     /db_xref="GeneID:13391930"
     CDS             338970..339551
                     /locus_tag="LDBPK_080780"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003858640.1"
                     /db_xref="GeneID:13391930"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9B9I0"
                     /translation="MTYRIGMLLYALLQFFAFLLVLVGTPIDMFRPHGTSRFCSTPCL
                     TLWGYKNECFNTAYDSWADDLWANCSNRRLQFRVAQALAVISIVVYGLAFILGFIMLF
                     CCFCLRWVCLTLNILGFGTLGVVWALMVVAYYKDDGRDCPRLSDRYHFGAGFALFVST
                     WCRDIFSIISLLLCCHSADSGKRKVANQNQKEQ"
     gap             339854..339952
                     /estimated_length=99
     gene            <340014..>340298
                     /locus_tag="LDBPK_080790"
                     /db_xref="GeneID:13391931"
     mRNA            <340014..>340298
                     /locus_tag="LDBPK_080790"
                     /product="amastin-like protein"
                     /transcript_id="XM_003858593.1"
                     /db_xref="GeneID:13391931"
     CDS             340014..340298
                     /locus_tag="LDBPK_080790"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003858641.1"
                     /db_xref="GeneID:13391931"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9B9I1"
                     /translation="MLFCCFCLRWVCLTLNILGFGTLGVVWALMVVAYYKDDGRDCPR
                     LSDRYHFGAGFALFVSTWCRDIFSIISLLLCCHSADSGKRKVANQNQKEQ"
     gap             340601..343322
                     /estimated_length=2722
     gap             344397..344495
                     /estimated_length=99
     gene            <345600..>346472
                     /locus_tag="LDBPK_080800"
                     /db_xref="GeneID:13391932"
     mRNA            <345600..>346472
                     /locus_tag="LDBPK_080800"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858594.1"
                     /db_xref="GeneID:13391932"
     CDS             345600..346472
                     /locus_tag="LDBPK_080800"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858642.1"
                     /db_xref="GeneID:13391932"
                     /db_xref="UniProtKB/TrEMBL:E9B9I2"
                     /translation="MPDDRRRSSRTDGALVAHRPDDSASPVERRMRVDPRTHTKSLYQ
                     RGPDGSEMYASYYNSNDDPTFQERFNRHNNGNAFVQSAQFTYVSHGCGGGRNPGVVKE
                     RQRPVVVEEPVGADKHEASTDSGNNANVYANHRDKEKRRTSKQDPIVEEPDGENDYND
                     ADSRAHRRSGKKGERSSHPDALEFWRDPWGMESMMAEMMQPPLGFGDAFPFTSRRAPA
                     QGRQKSPSASDESKWQLSPYSRGGVMGGPFTGDFFGTGGPESPFRMMEAMQYHMHKQR
                     AAMFGGVDPFARFM"
     gene            complement(<350077..>351336)
                     /locus_tag="LDBPK_080810"
                     /db_xref="GeneID:13391933"
     mRNA            complement(<350077..>351336)
                     /locus_tag="LDBPK_080810"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858595.1"
                     /db_xref="GeneID:13391933"
     CDS             complement(350077..351336)
                     /locus_tag="LDBPK_080810"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858643.1"
                     /db_xref="GeneID:13391933"
                     /db_xref="UniProtKB/TrEMBL:E9B9I3"
                     /translation="MQKLRADLTKHFDSENTNMTAYRDYDFERRVNDMRRLQHAVDHF
                     DHAVRQGMMAMKEIASAYEAVGQAFTELTLTNNNPVPGPGEAEEPNPYPTEADVQYMS
                     QPNAGAATADYAASVASTRMPDEANSQVRRLAKTFAEEARRINEGAPYQSYNAGIHRD
                     VHNRLLPVLEHLKSINEYRHKRIEALERYNKYKAEVEKVEKHYTKKGKPFCDSKDHKK
                     YTEKRDEAWKEYIKRRDKFNKTFGMLMEVNDHAAAQIIHRYLVLNHEYLQQLVASMDR
                     VLPAMAEVYPLNNEYNSLQNTLILEAVANAKMPFADHSKTRSKQADHAKRDGAGDETH
                     EDAQEAIDAHYEAQQSTLTSMSSDGGSNIASGSRLEDSVSYDAHAKPSTALESMEPPH
                     DPVQGRAQHAGRTRVDRGLTMSEPQHI"
     gene            complement(<353026..>354558)
                     /locus_tag="LDBPK_080820"
                     /db_xref="GeneID:13391993"
     mRNA            complement(<353026..>354558)
                     /locus_tag="LDBPK_080820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858596.1"
                     /db_xref="GeneID:13391993"
     CDS             complement(353026..354558)
                     /locus_tag="LDBPK_080820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858644.1"
                     /db_xref="GeneID:13391993"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9B9I4"
                     /translation="MSSYVHPTQVSIGAAPRMAVQETHPDAKRKGRRVVATMELKPGN
                     AIFAAPPDIAVLYSPFARHICARCLVADVRACAEPLKAHHHQHQHPHQQPHATLSRSP
                     VGASSSPPSSSSSTTAPAAAAVRPYCCPNCDQFVLCAPCVAQLLLDSGVDVTSSAGTD
                     AAQTAGLLLQRRGESKRGGSVVDERLHLHPLLRAHAISCAWYTSLPASIRAPGNDTDF
                     LRFCLDYGARAYLGDTAMMRALATLDTNASVQSKESMQLCEVFARDRVVATFGKEPKA
                     TTTTTTTLATAASAKYMGSDPLSNQAGAHDSGGIRRGGNSDGVRCRGSAAVAPFPPRY
                     PISWTDLRDTLLRTRCNSIGFPYNTEETTGWSLHQTVCMLNHSCVPNAAVIMLYDSAD
                     AMAAAAALGARTGASHTALPKERTQEAARRKASERIAAFRAVATSSESPYSTSYSPSL
                     AGWIGIEATRPIAAGEEITISYVDLGSLGDDLQTRSRHLLEQYRFLCTCELCMRQRSQ
                     KR"
     gene            complement(<355982..>357112)
                     /locus_tag="LDBPK_080830"
                     /db_xref="GeneID:13391994"
     mRNA            complement(<355982..>357112)
                     /locus_tag="LDBPK_080830"
                     /product="mitochondrial DNA polymerase beta"
                     /transcript_id="XM_003858597.1"
                     /db_xref="GeneID:13391994"
     CDS             complement(355982..357112)
                     /locus_tag="LDBPK_080830"
                     /codon_start=1
                     /product="mitochondrial DNA polymerase beta"
                     /protein_id="XP_003858645.1"
                     /db_xref="GeneID:13391994"
                     /db_xref="GOA:E9B9I5"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR018944"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027420"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:E9B9I5"
                     /translation="MLRRTFLRRDHRENIIRIFQEMADLNNALGEKYKVSSYHRSIES
                     LKTNLDKPLNTPQDLKAFSGFGAKLLKKAEEIMATGKLEELESKTKPKLKAIQELTQV
                     HGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQRVGIKYFYDINEKIPMQESVL
                     HENYLREKCMEVLGKDFSILICGSYRRRHPFSGDVDAILSRTLDAPPLSEPVAATGVL
                     GHFVEFLESLKYLEATMAQGPLKYMGMGRLPPRIVRDKAGRENTKVYKARRVDIRLIE
                     TKSVPTAMLTFTGSKNFNVIMRQAAISKGYLLNEYGLFKLGTPEEARALYERIGIRGK
                     NAGEELGVPKDELEDKRVEVRSEQDVFDVLGMPYAKPENRDP"
     gene            complement(<358620..>363062)
                     /locus_tag="LDBPK_080840"
                     /db_xref="GeneID:13391995"
     mRNA            complement(<358620..>363062)
                     /locus_tag="LDBPK_080840"
                     /product="mitochondrial DNA polymerase beta-PAK, putative"
                     /transcript_id="XM_003858598.1"
                     /db_xref="GeneID:13391995"
     CDS             complement(358620..363062)
                     /locus_tag="LDBPK_080840"
                     /codon_start=1
                     /product="mitochondrial DNA polymerase beta-PAK, putative"
                     /protein_id="XP_003858646.1"
                     /db_xref="GeneID:13391995"
                     /db_xref="GOA:E9B9I6"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:E9B9I6"
                     /translation="MRIFLSSAVPRTGWSLRRRRADPLCVVAAALVAASLSCADGQRL
                     IHGPPRLSSTWRRGARRLPGPSAFLPASSAVAASLTAQCRGVSSTTSTSADATAAAAS
                     AAAAVAALSTGTKLRHRRGAHRKRGRVSATAAAATTPPLNAPLGDGANGSFSVVDPVV
                     PASVLVNPSNTSSEPLRRRAVKSSDAAVTDARLRALGDTEAEAEPPAVTAAAHLNGFG
                     KSANKPSTTPQPAGEADAAESVPAPSVTAVVAAEMPSPCRKRKSGTAKRGIRGRRAAV
                     ETTVELVAVAAAPAAASSPAAATLLAKAPAEAIKMAAAVSRERLSRGLNKRRSRRSGA
                     GTVTAASAGDAEADEVVTAGVTVVPSVAVNPNLASSLTAGAVEGEGGTPSVDPVRAAA
                     LPPAPQHLDATGRVVASDADAVEGRVSSGSRKRIARQARQKYVEEPANARSSGVVLDN
                     DKDGSAADVDKDPDEISEDGGARPSGRPRRASSRTRSGKRLRAKAPTAAASTLVEDAI
                     AASVAKAVAEGVIGAAGQAPATGAATAGGATLASFSLLTAATSHKPASKTTTTTTTIT
                     TADTKVPCSPTAEVESLEPKTDADGEGPAEAISSTAASRAPRNRERAGGKRMKKRLLA
                     PAAVAAASAAVVAAPPPPMAAAADDGKTATTPRPADSFKRLFDTVDAAKGISSLALKK
                     RLAAQIVRRRWQLQRGLTLSPQALLSTATPAADEAGVMATSAAAKADEGAAAVTAPKS
                     SAPSPTSPRRRLLQGKKSASLEASASSPIAAAPLPEKPAQSDEAAVAGGAKSKSRITK
                     KGGKRGGSAARRNSGHTVAMAAAASVAPVAEPTKAAEVEDPASDADREADVAAAMAAA
                     VELVSKPEVIDDEFSLAPQACDDAAAHATPKSHSPSALAAGRASQQQELLQSAGVSKV
                     AYGASGGSSANGSGNHAGSSGSSNGGKGGKGANSKDTLFFPDYRERVVQIFEQLTQIN
                     SALGERFKSQLYGRTVERFKRGDKVFQLLPPNLLPLPEEDPKKKAIIEALYKDDPAAQ
                     KKRVEEVERNRAKRSLVLSSDNLIPGLGTKLREKVIEILVTGGLEELHRQEAKPIIRA
                     IRELTQVHGVGPRTAIDYFKKYGISTVAQLRDYAIKAGELDMSNKDSGKPSNLVVCAD
                     KSKFHLNDAQRLGLVYYEDMCHRIPHEEGRLHEAFMKLRMRKYLGKDYELVVCGSYRR
                     QVESAGDIDVLITHKRSATEGGDRPLLPPSEVLGSFLAGLKADKYIEATLAQGPTKFM
                     GLCRLRAMGTESVSAATGKGKTAKTSGKAPTKFRARRLDVRYVDSDSFPAAMLYFTGS
                     KNFNVIMRSEAIKKHCVLNEYGLFRKPTRKQMQHYGVVQKNPDMSFHDMITRLARFDL
                     SAIKDEENELASGSSAEAGGGASGATAAGSGASGDADGAASKKVTAAFKKIKKKGKEK
                     TKQELAELREMAKIVERQRVKASTEREIFEALGMDYVPPKDRSV"
     gene            complement(<365150..>371515)
                     /locus_tag="LDBPK_080850"
                     /db_xref="GeneID:13391996"
     mRNA            complement(<365150..>371515)
                     /locus_tag="LDBPK_080850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858599.1"
                     /db_xref="GeneID:13391996"
     CDS             complement(365150..371515)
                     /locus_tag="LDBPK_080850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858647.1"
                     /db_xref="GeneID:13391996"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:E9B9I7"
                     /translation="MLHYIQLLGSDTPNGYGGCCYYGPLDHPALHASTLSSATGSGPP
                     TGGVPPASRHSYVVDAEATVPAPTLVPSVNASAHATLHQFSPTGEVAEPAVPSSWNWS
                     SYLTAKRPTWPRAGPFHTAKLLHPQPPSPSVSPSAVATASTPHVTADTGFSGSEGYIF
                     FNCPEGTQRFSSEANIKLKKVRGFFFTRWSSSKTAVYPLPSGNVASSVEDEQHGSASA
                     DAVDAPADTTALEMPVGAASAVMGLPGMLFTINDAGARHATFFGPSAALDDPPQPAHM
                     EGVARAGTRNGDGGSEPHNSNSEQAYAHACGSPCAGDSAATSSTGGSAVAAPGAQLPS
                     PLSSAGLRGFLTALRFHYFQYRPMVFRQLHGLVRHAMDQAAVSDHSVDATSAAAIAGN
                     NQLHFVETVGEPTASRGAQPGRPLTGLSPFVHATLPLSPQSLLVTFRVSGGRRGGESE
                     SAATAAAAAGDARMSLLQPTSPSAMPEDEQQRHQLRHAYFAGHIERADQRADTDTAGS
                     TMSFTAPTSHDVVFGYAIIVAPGPSFDAAKARALGVRSGPKYGQLKLGMSVQADTDAG
                     VADTSAASMPPSQNATVAFGHTNDQLPTPTQRWVHPHQVMRPTAATRHAYISLVLDGD
                     RPEDVREAVARLLGSSVGGDGESPSRSSAAACRESEEDDNTCCNAAVGEHSDGVLQRL
                     LREYFPHLAYYYEEDDKVGEGTAAAPPHSQEPRLRRRPRQLAVRHVVHVQPTSYFAQF
                     ERRCRHNALLHSPFVREDRAPARPKTLPPSLHREAGAPGVYAAYNAYIFADVAGQHDP
                     LHHQRVCAAADHGEEEAVAARVEAGGDAVVVKNVSSPPRQDSSKSLSAVQLSLAPSLS
                     FTLDDMADTADGDAEMGERGECESDSAWIGEAHRCRPPPPLPHGTPPEAELPRHKTWQ
                     LFTSYVQRHFTAFPTALVHRYHLHHLAPSLFPIVGATALTQRAGGAGNATEDRAARSG
                     TAAGAAISTEASSSGSAVRAQRAKPSVSNSSSSSAEDVVEYWPYSLKLRCIPEATLQL
                     PYKQHATAKKATQAQQGAEMAGPVRQAPSTVNASLGHDAATAAAVPSPHLPAPRKRER
                     QVSSSRDSASAPACTVHASASSSTANAATPRVLPPAAAARTRPPSAPPRRAAVVDGVA
                     SLLPYPTPASALALLSTAFLRSLRTSSVVAAAAAVAAAGEVPATPSTPTESRVDRHGG
                     FAASQQRVDVPSTGMGGMGGGALGFLGTGSAVPSKYRNVSGTFLELHLPAYCFPGGDC
                     PVKPLLHDDDSAHASGAAAVVAEDTPSATFARPPAGEATCARREGDAVLGFGSSDSST
                     CSRGPATASIDGSQKIVPRRCSSAPLTMGSQQLRRGVVILDFGEGSAGQLASLCGRVR
                     GGSACSQRPPSCSLTASPMHATLDGHRVNGRDRREGAGDHAEDAETYTSSPHAASAED
                     ATEFEDDADVRLRQFVLDIVLVFISHAHADHHLGLMSLLTLRHEYLQRGPSALPPAPK
                     LLIVCPTEVYAFMMDAWGSTPPYTTWLHEECVFDLMPPSFSGLRREGRWPDALAAEEG
                     DAAPHGRQEKLQAATAVADNNVPDSADGTERDQDAVGDGGVDSRRAASFTHRFRHDRH
                     ALHASNNQPEQQHVVPMPLLQAHLTMWNQAIAVGIRHHQRQPPSDSPLPSSSEPLAGT
                     SMKAAAASVKGNIWWDAEVITVDHPANAHALLLRFPFCSLMKEQGMHGVCGEAAEDGG
                     PRTANPDAAEAATGRQRSQEPLSRVPDSSRVLLFSGDTRPSSFLVERSWAFATSAPSR
                     LPRCADYTELTIQDGVVPDEADSGSALEGGRAALVAKANASGSMDRIREAALPRLPTS
                     TPPSSLSSPVFILLHEATFGPGFEGEAVRKKHSTLPEALRIGVAVRAEFIVLNHFSQR
                     YPKLPGLSEEQLGGRSADLVCQRRTRASAAVAATSAVTAAETQNPADHVSGGLASASA
                     PRSSSPGEQQGLAGKALSKALRQESGRSKWERDAEQTADASRPLPPPHIATDDAAASP
                     YVNMSFAFDLMFVSFSDMQRGLVPRLTPTLVRLLEEYDSWGSGTTQRMRSGGGGGDGS
                     GGRPQKQQQQQRKSPATPSTTASSAPAGIDSNTSGAAAQRAAYDESA"
     gene            complement(<372810..>373424)
                     /locus_tag="LDBPK_080860"
                     /db_xref="GeneID:13391997"
     mRNA            complement(<372810..>373424)
                     /locus_tag="LDBPK_080860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858600.1"
                     /db_xref="GeneID:13391997"
     CDS             complement(372810..373424)
                     /locus_tag="LDBPK_080860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858648.1"
                     /db_xref="GeneID:13391997"
                     /db_xref="UniProtKB/TrEMBL:E9B9I8"
                     /translation="MSSRGAAATAMAKVSRLVSPRLRIIHRDYLTRRGGRTHQRRSAV
                     AVDYTPTYFATYKSDPGQCPRLIDAEAVHGDEQAFWSARRDFYRGGASRSYYPAWDRQ
                     AQALIMLTREVPRIPQEAAFRLFTLGLKMMLLPRLVAGVELMLPSWVTMNAESLLSEG
                     LAGKVAEADGDGKATGAVADAAAPPSASSAGASEDSGSANAEKK"
     gene            complement(<377762..>379621)
                     /locus_tag="LDBPK_080870"
                     /db_xref="GeneID:13391998"
     mRNA            complement(<377762..>379621)
                     /locus_tag="LDBPK_080870"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858601.1"
                     /db_xref="GeneID:13391998"
     CDS             complement(377762..379621)
                     /locus_tag="LDBPK_080870"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858649.1"
                     /db_xref="GeneID:13391998"
                     /db_xref="GOA:E9B9I9"
                     /db_xref="UniProtKB/TrEMBL:E9B9I9"
                     /translation="MPPPLPAALRDAGAVDQRRPVELPTNPSPLSRQRDSAAAEQAPN
                     SGNADAARQARGDHLSAPGVRGQPYQAPPQRRHIGGQIDENSAPPSSARGAAPALDEL
                     SAVLSELSSWRERSVLRQQRQGGHRAHRYDTSCKTGVVPKPQHVGAKADAHVPSPQPP
                     TSPSAPATPRHQLSKYAEQAGAHRPGVAEGAPTHEPNGNAASQGKPLRDGGRGTKAGE
                     ARAAEVEVQRMRVAFASPAANRRGSDGDDTDGDESVTQSFVDALGTALDVDAVQAASA
                     AAQQQQQQRLSPPPSPAEAGSASCLSGRVPFLQQSMKKTFHVTSEKIDALQPTLMAGT
                     VFRHLPSTALLAGTMRGTDAAACVGEAEGVADVHFTTSCLCGRAATSRGCLSMIYGSF
                     VCSCDACVRFTGSMHGVEWLHLPEVADGLPALLPSPTPSNAPGEWSTKERPSAGAGAA
                     AAVALRAKAEEAPLHHNKGAEAKWKGSMNACCAPPPPAQSPGVWPPSPRAGSGAHAGD
                     EATAALGEANVRAYRHCFQAEAPLQLEEAALRQPAPHTRGSTLTGGAAATRQSALHVL
                     YTCLTCGSLIGMQHDGVEGLLLPKVTLDAQSLEILSWCAQTVDVEAAELIKVG"
     gene            complement(<382154..>382957)
                     /locus_tag="LDBPK_080880"
                     /db_xref="GeneID:13391999"
     mRNA            complement(<382154..>382957)
                     /locus_tag="LDBPK_080880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858602.1"
                     /db_xref="GeneID:13391999"
     CDS             complement(382154..382957)
                     /locus_tag="LDBPK_080880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858650.1"
                     /db_xref="GeneID:13391999"
                     /db_xref="UniProtKB/TrEMBL:E9B9J0"
                     /translation="MPQRIAFVPPLAASLSVNKRFVSTMSDRADARGTCNSGKFDFFG
                     AYRAFRRERSANRSRQYTTLSMYLDMLPPGFRELLLWSPLLALLHFMCRQARVYYLDE
                     EEPWYYVALPRRWRCRVDGEGSSATAHVSSLLKRAPPSSMPTTSVVVEAHNPSATHSL
                     PNTGRGANSQGGGSTTTIVTTTCAFRAASVQDDAAAVAGAPLAGSPPVASFHEVRARR
                     VHADQGAPPVTTASTPPLEETYRYGVWGAPLVVIRNPATQRVIGYTTAG"
     gene            complement(<383757..>384197)
                     /locus_tag="LDBPK_080890"
                     /db_xref="GeneID:13392000"
     mRNA            complement(<383757..>384197)
                     /locus_tag="LDBPK_080890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858603.1"
                     /db_xref="GeneID:13392000"
     CDS             complement(383757..384197)
                     /locus_tag="LDBPK_080890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858651.1"
                     /db_xref="GeneID:13392000"
                     /db_xref="UniProtKB/TrEMBL:E9B9J1"
                     /translation="MLSFTFALCLSAKQLSHGPLATHTRKQSFRQSRKALQMSRLRSQ
                     TQRANFNLQQELNQDFGARQHAFAQGRLSMQRAAEDLMYDRAYRAQRHGGRAGQVYRT
                     TKDRAAEMATARQLLQMQESTRRLMKKGRTQRTESFRAQKQWNR"
     gene            complement(<385675..>387372)
                     /locus_tag="LDBPK_080900"
                     /db_xref="GeneID:13391934"
     mRNA            complement(<385675..>387372)
                     /locus_tag="LDBPK_080900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858604.1"
                     /db_xref="GeneID:13391934"
     CDS             complement(385675..387372)
                     /locus_tag="LDBPK_080900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858652.1"
                     /db_xref="GeneID:13391934"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:E9B9J2"
                     /translation="MDSAYLKNHVGMLLAKGVAETVTAQPSNPQEYLALFLLHQLQEE
                     ERKVDAATRRRKVDDLRQEWCQQRALHEKAAVDVIQRCFHRFQDRLRKKRAAEEELRE
                     VYEAAEAEAEELLDEEEAIKAEKGGEDAGEDGAGATSERDSASRAVAAQEKEAVMAEA
                     RREFFKAQRFLLTLPKSAVGQLKHELEEEAERVRIAQDATLGAYHRAAAQEAALVEAT
                     TAPSMASAAPALSPAAAELAERLTEHRDHRCICVPYVKYLVFRCLCYLLLNATPKATS
                     SAEKVAALLKPSVLVQHLRAFNPVASYDRGVALKLERIVPELADSTGGDEGNDEGDVV
                     GRPKQNGTSAEEEGASVPFMQPTTRQVRRAARVLRTCWLDGEYHCEVDPEEFYTEEMI
                     EEDAARAEADREEGEPRQKLIPTLADEVEAAAKVRERVEELRNVVETQVKQRGGTVMY
                     ALLRFVSAAVAYRQARDAVVQQRQEMGLPVDTFDELPEDEAEDPMNDEALIDEETGEL
                     DAAGVQVLQERIGVDTEEALAKIWEARDRRQREAYSMKAISLQRQLDASGEEEEDED"
     gene            complement(<389147..>391648)
                     /locus_tag="LDBPK_080910"
                     /db_xref="GeneID:13391935"
     mRNA            complement(<389147..>391648)
                     /locus_tag="LDBPK_080910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858605.1"
                     /db_xref="GeneID:13391935"
     CDS             complement(389147..391648)
                     /locus_tag="LDBPK_080910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858653.1"
                     /db_xref="GeneID:13391935"
                     /db_xref="GOA:E9B9J3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR019537"
                     /db_xref="UniProtKB/TrEMBL:E9B9J3"
                     /translation="MRRCGRAPMRQVSSCGLLLSSWAIITPAPTYSRRQVATTASAAV
                     GSGVASSTANAPSSPNPSAAATSTAAAAADTAAATYAPYSSSTGAPASLVASPSAPSY
                     TAASSASLAEMTNRLREALRALSEVEKAKAELAKKSAAATATSGQNLSTSVGEGRVAP
                     RTAPKADHPSAAGPPTAFSATSRLEEPTPSDGGSSGSSRSGNDASAAGTVNATSTQSA
                     STTTSSSWIRNKKPKFWALVNEAGTDDVEADGSGERLATAATASTAADSAAAASPSTE
                     TSPSTSTAVSAPFTAMRPTLAGEASPSAKEPSQVRAAAEPMKAASYVATGSSPPSSAA
                     ASAVSTAAVGARRDADSSSSPKATDRAVTAHSVRISTSVSPFRNRYKRDVAHVLSELL
                     NSDPSLGPQLLGQLSAESRRLLLIMGAASEYFGVDYEEVAEQVKVADTDRDNSISSKE
                     YDAWVRRMADSTPAKRRHAKEGQASADTLDPVLPSASAPAQGAAAVVTAVPPSMPSTA
                     SQSSSRGPGGTSSSAKAAPAASKSAHPPAAASATLSRQRTDMAVGTAKAASTCIIGAM
                     QKSPPSAAAAAAPESRDAGDGAAVAGGPAASVAMSSPTRASLESSAANRSRGCVSDAA
                     GGGAGASPFLPVTSAATATSAASASIKQDPGYIPWPTYLRIVAAAAPPFLAFGMLDNS
                     TLVLAGGAIDNALSGSLGLSQMAAASLGGVVSGVAGIQVHGLAERYTRAAPPRLTMEQ
                     QRSDAYSRATQAGNTLGMVFGLILGMIPLLFMSGSTQLAEQEERDRHHFQREAARSHQ
                     RHCKTMEKEEATLRQRLWEEEGAAREALLRGNDKM"
     gene            complement(<397994..>400309)
                     /locus_tag="LDBPK_080920"
                     /db_xref="GeneID:13391936"
     mRNA            complement(<397994..>400309)
                     /locus_tag="LDBPK_080920"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858606.1"
                     /db_xref="GeneID:13391936"
     CDS             complement(397994..400309)
                     /locus_tag="LDBPK_080920"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858654.1"
                     /db_xref="GeneID:13391936"
                     /db_xref="UniProtKB/TrEMBL:E9B9J4"
                     /translation="MEPIRPAQRLERPPLPPLSPQRHDDIDDEDEEDESDVSTELESE
                     MLSQHFKSLPWPFPAVNVPLGISPSASMRRGVSPLASDQQTCMSGSSLTAWSGAQVVC
                     GGGAGTAWASGLGLNKFDKLRVSPRSGVSGASPRAGSGAASKGLATPTAVARPVTTTT
                     AETTAPIATVTSSKCELTSENLDRLRETRAMSDALPVAHWKASTQTTRVSPPAVIAVS
                     RARSDCAAGAGGTRMTRAAALLKQQPVLARQPRQRSANNSGARALADVPARASSTATA
                     AKCDNGFNTSGDGPREGQGATVGATPTTSSTSPLAVAQGCEPSPLDEPTTLRAEEKDD
                     SNGCRGTASGAGAAVTTAIQLPSAASPLARASSPRISHSRRKRDNVPSPLKRQRLASA
                     KNRYQGQILLLEDCTETSGDATSPFSVRERAPRSATPAGAINAGLHTCATSSVVPATR
                     ATLSTPSDTKKSVPGAISPCMTSGRGVQASRRISVTAPAAHSGTLSPPSIPPFEKEAG
                     QGSSEAVRGTNQLPSFGLSKEENDQAAADIDDSRASCSTHTMPPENARQHIVHLPRSP
                     QTRPAVPTPVSEKAGRDEHGADLRSVDQRDDEAEEPEERGEGALPTPVHTHQATSLLT
                     STSTTTFSRPPLLSLTAIGVTSITSGVLRSVTQTSPRLSAVLQRITLPHQPQQQVRPA
                     VIISSAGMTELPPSRTPLTAVTTASPGNTGDSHISVSQASRLDSSRRSTVRTGTMRHS
                     TSCDTRMPSSADCLPSVGSTQPPLSVRTPRR"
     gene            complement(<401462..>402442)
                     /locus_tag="LDBPK_080930"
                     /db_xref="GeneID:13391937"
     mRNA            complement(<401462..>402442)
                     /locus_tag="LDBPK_080930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858607.1"
                     /db_xref="GeneID:13391937"
     CDS             complement(401462..402442)
                     /locus_tag="LDBPK_080930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858655.1"
                     /db_xref="GeneID:13391937"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9B9J5"
                     /translation="MSEAQQAAEIARLMACEARKASPFEFLQLDIATCELTDVNRQYR
                     KIALLLHPDKCQLANAADAFHVAEKVHKSLSQESIFYHLKRAYRKQQDRLAEEGTSGT
                     GAGSRTIPAAGAAAGQKRAREAETALPPIAFGSLTQLAASGLSSDAQKAAEIRRVLQC
                     KATDYFIILDVDPSNCTVADVDRRYRKMAQALHPDKCQLPHVQDAFTVFETAHKELAD
                     EKKLVRFKVAFEQQRKKEAALKAAAAQRGVSGSGGDADRFGSEESMTAEERLQKRRME
                     ALRDQQLEAARLGEEAARRRKLKEEKEKEETALAAELERQRKEWNDLQLF"
     gene            complement(403161..410534)
                     /locus_tag="LDBPK_080940"
                     /pseudo
                     /db_xref="GeneID:13391938"
     misc_feature    complement(403161..410534)
                     /locus_tag="LDBPK_080940"
                     /pseudo
                     /db_xref="GeneID:13391938"
                     /db_xref="PSEUDO:CBZ31935.1"
     gap             413763..414541
                     /estimated_length=779
     gene            complement(<414544..>414705)
                     /locus_tag="LDBPK_080950"
                     /db_xref="GeneID:13392001"
     mRNA            complement(<414544..>414705)
                     /locus_tag="LDBPK_080950"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_003858608.1"
                     /db_xref="GeneID:13392001"
     CDS             complement(<414544..414705)
                     /locus_tag="LDBPK_080950"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_003858656.1"
                     /db_xref="GeneID:13392001"
                     /db_xref="GOA:E9B9J7"
                     /db_xref="UniProtKB/TrEMBL:E9B9J7"
                     /translation="MMHRCCVRLSAPALPVMTPPPSLALSPSPPALRRDRLLPTPSTD
                     SHHHHHHHHH"
     gap             416210..416308
                     /estimated_length=99
     gene            complement(<416310..>417344)
                     /locus_tag="LDBPK_080960"
                     /db_xref="GeneID:13392002"
     mRNA            complement(<416310..>417344)
                     /locus_tag="LDBPK_080960"
                     /product="cathepsin L-like protease"
                     /transcript_id="XM_003858609.1"
                     /db_xref="GeneID:13392002"
     CDS             complement(<416310..417344)
                     /locus_tag="LDBPK_080960"
                     /codon_start=1
                     /product="cathepsin L-like protease"
                     /protein_id="XP_003858657.1"
                     /db_xref="GeneID:13392002"
                     /db_xref="GOA:E9B9J8"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:E9B9J8"
                     /translation="MATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRT
                     YRRAYGTLAEEQQRLANFERNLELMREHQARNPHARFGITKFFDLSEAEFAARYLNGA
                     AYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKNQGACGSCWAFSAVGNIE
                     SQWARAGHGLVSLSEQQLVSCDDKDNGCNGGLMLQAFEWLLRHMYGIVFTEKSYPYTS
                     GNGDVAECLNSSKLVPGAQIDGYVMIPSNETVMAAWLAENGPIAIAVDASSFMSYQSG
                     VLTSCAGDALNHGVLLVGYNKTGGVPYWVIKNSWGEDWGEKGYVRVAMGRNACLLSEY
                     PVSAHVPRSLT"
     gap             417603..417701
                     /estimated_length=99
     gene            complement(<418465..>420294)
                     /locus_tag="LDBPK_081000"
                     /db_xref="GeneID:13391939"
     mRNA            complement(<418465..>420294)
                     /locus_tag="LDBPK_081000"
                     /product="histone deacetylase, putative"
                     /transcript_id="XM_003858610.1"
                     /db_xref="GeneID:13391939"
     CDS             complement(418465..420294)
                     /locus_tag="LDBPK_081000"
                     /codon_start=1
                     /product="histone deacetylase, putative"
                     /protein_id="XP_003858658.1"
                     /db_xref="GeneID:13391939"
                     /db_xref="GOA:E9B9J9"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:E9B9J9"
                     /translation="MPPPRFARPELNGIITVRRFQRPQLETEAPIRKGDLKEPLEAVA
                     GRVGLRARCSTSAPSADLCLVDDQELVLMGKLVDKGVYYITGGVCIDAEGSDTSSQSP
                     TAALVSSTACGAAPQPPDITVGWCFDARMLLHRSDMNRSPETPHRLQRAIETLQGCER
                     ALDVLPVELLAPFTMHRDSSSGSDLGRAVPPISAANRSQWIPARLATYDEVCSFQDPQ
                     VYEHFLKSGAALVNLKSDVYCNDETSSVAVRLSAGAVIDASVAALRGVAASRSDTASS
                     AAGRVHPLVSFCLVRPPGHHCTASQPSGFCLVNNVAIAVQQLRIRHASALPSGPPRIA
                     ILDLDVHFGEGTASFVEGACDPASLLYLSLHRYDKRQFYPFDGRGDTAYVGGSRHAAS
                     KGSICNVAVHTNGQQPARCEQVISDHLMNSVLEEIFLPRLAEFGPDLVMVSLGFDAAY
                     GDPLGKMAVEGGFASVLSRLKWWCLHDGRTAGLVVVLEGGYNPEAVAQGVLSVALALS
                     LPRTDPLLQRFLEEKSPKVWSDLRQRQERRHREWQQLREERAEEDVGAAPSGRGSELK
                     PAASDEPEQVQEDALLLDRHKRWCAALVAKVQQIHREAMTREH"
     gap             427037..427135
                     /estimated_length=99
     gene            <432032..>433123
                     /locus_tag="LDBPK_081001"
                     /db_xref="GeneID:13391940"
     mRNA            <432032..>433123
                     /locus_tag="LDBPK_081001"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858611.1"
                     /db_xref="GeneID:13391940"
     CDS             432032..433123
                     /locus_tag="LDBPK_081001"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858659.1"
                     /db_xref="GeneID:13391940"
                     /db_xref="GOA:E9B9K0"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B9K0"
                     /translation="MWVGECPDRIRRRISAATKSRMVIKKLNDPTRFAVCDIQGKNHN
                     CTIGNPHMCSCGATQPCAHTLSVLLLFFKVSEENPIVWQRYINEVELSDLIDKRADEG
                     KCVFCHESTGSVGSCEKCGAHFHQLCLELASKSGKGNCNTCPKCRGMVSRSESKSDTC
                     CRNCRVPCKTENYTCLLCPDYFLCRRCYTLCKTHPSHPFSCSKLGGPARSTCSVSSQS
                     MGDLQYREINPEDYEALIALDNDKRRPLGEEELSNLPVEYFSACARRNDSCPVCLRRF
                     VASNRCIALPCGHIMHHKCGFKWLSEFSDVCPIDNRKVCKWSNTQDARTAGEVKPSLQ
                     ASTRDGTTLRFPSKITSVKLPAIKPREWK"
     gene            <434645..>435742
                     /locus_tag="LDBPK_081010"
                     /db_xref="GeneID:13392003"
     mRNA            <434645..>435742
                     /locus_tag="LDBPK_081010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858612.1"
                     /db_xref="GeneID:13392003"
     CDS             434645..435742
                     /locus_tag="LDBPK_081010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858660.1"
                     /db_xref="GeneID:13392003"
                     /db_xref="UniProtKB/TrEMBL:E9B9K1"
                     /translation="MRRLTAPALSTPCVRSICGAAPVMYFPPLPFASVSKEEQIKKNT
                     KIAIEMIRRYKGEAPASYTRKHTATIEQLEKEIEALLGGAQKMRKATTDDQPMDKLAL
                     MERCLRHALWSYHKDDGKYDFDEIARWVVYTPEDEVKLAQMKRQVEAKSKLAAYRAKR
                     AEQGLPEAPVPQINWGEEYNNVTDRELVNEKRIRYDTIAANTMERDEAQIEAVLQQYR
                     KPVQDKRLDDLVDLLERFKPVLAREAIMQRLTIKHLEGQLGVWRYMDWCPEVRDRAEL
                     EVDVSGFQWWSPLEERRLLPVRLRSVNEVREIMAQTQSSKAAEASAHSPQASQSAGDG
                     DRERLLKEVLALQARIHQRDDAPVEENKAAH"
     gene            <436749..>438389
                     /locus_tag="LDBPK_081020"
                     /db_xref="GeneID:13391941"
     mRNA            <436749..>438389
                     /locus_tag="LDBPK_081020"
                     /product="stress-induced protein sti1"
                     /transcript_id="XM_003858613.1"
                     /db_xref="GeneID:13391941"
     CDS             436749..438389
                     /locus_tag="LDBPK_081020"
                     /codon_start=1
                     /product="stress-induced protein sti1"
                     /protein_id="XP_003858661.1"
                     /db_xref="GeneID:13391941"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B9K2"
                     /translation="MDATELKNKGNEEFSAGRYVEAVNYFSKAIQLDEQNSVLYSNRS
                     ACFAAMQKYKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDP
                     SNSSCAQGVKDVQVAKAREARDPIARVFTPEAFRKIQENPKLSLLMLQPDYVKMVDTV
                     IRDPSQARLYMEDQRFALTLMYLSGMKIPNDGDDEEEERPSAKAAETAKPKEEKLLTD
                     NEKEALALKEEGNKLYLSKKFEEALTKYQEAQVKDPKNTLYILNVSAVYFEQGDYDKC
                     IAECEHGIEHARENHCDYTIIAKLMTRNALCLQKQRKYEAAIDLYKRALVEWRNPDTL
                     KKLTECEKEHQKAVEEAYIDPEIAKQKKDEGNQYFKEDKFPEAVTAYTEAIKRNPAEH
                     TSYSNRAAAYIKLGAFNDALKDAEKCIELKPDFVKGYARKGHAYFWTKQYNRALQAYD
                     EGLKVDPSNADCKDGRYRTIMKIQEMASGQSADGDEAARRAMDDPEIAAIMQDSYMQL
                     VLKEMQNDPTRIQEYMKDSGISAKINKLISAGIIRFGQ"
     gene            <440085..>442694
                     /locus_tag="LDBPK_081030"
                     /db_xref="GeneID:13391942"
     mRNA            <440085..>442694
                     /locus_tag="LDBPK_081030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858614.1"
                     /db_xref="GeneID:13391942"
     CDS             440085..442694
                     /locus_tag="LDBPK_081030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858662.1"
                     /db_xref="GeneID:13391942"
                     /db_xref="GOA:E9B9K3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="InterPro:IPR010554"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9B9K3"
                     /translation="MSSDPQLRLSMANQSNVPKEYVRALDPQLLPPRVGHNWNDQAFR
                     FKQGKPQQLEAEFRGTRVFPATRNSTFPAPAPDMCRTAQQLVDALMSSSLNRNAATRK
                     ARAAADWRHVTLDDKVLRFYAFFSEPAPEAGAASFWHRRVVISFFPVDDTILIEEPRI
                     INSGLDGGVFLKRQKVVADPRQREQFPGEEYVSLNFFNVGNSVRLNATDFFLYDCDDF
                     TRDFLTALGIEVGAPVECPDDLFMSEYGRYQERLKSGKFGLLSQDSSADEVEHSVRFI
                     RDGGKMLRFYAILDERDSVPAGMVRRLEVMLFVEDNSIAIVQRQSSPESCQGLYLSRC
                     WLPKSGSVAKANELTFAHRVNGQREPDMGIPDAYYRDVDLDVGVTLNVFGRSVLLYDC
                     DDYTREFFMERYGVSLRPPVDVSSYFQGDGRRTVLGTEAPTKSLLGDGVKSVVGKPAT
                     AADAGDADGGVAVSSANAAAAAKGTPTDTLRFRAVLARPANHDDEQRRFTVTYYTNSE
                     EFMVYESAYPKAGINGGCMWKRRKVMKIPPKPGPRNAPKPPAVPGEVPHYTLSDLGEG
                     KEVVINGLPLRLYRMDAHTATFYARCAGTLPEDTADGPAMVTDATGAMVTVDHLVSEL
                     RSYLHSRYGTGVASFMALDRDRDGIVSLPEFTMAMKAFQITEDRGAAAAIFAHIAPTR
                     DTAYFTSVDLMKWIDAVGDEHRTAGSVRIASMPSGGREAELKEIERRALRSKVLRELK
                     SRLDARCWKGADMFRLASTMPRAYRGRRADLYSFTNPDRDTVITPVQLRRCIEEILTG
                     APTAAEMACLLEFFFPTLPAEAYTQTRDNGTTYAVDLNEFQKRYYVMTKETMLPDDDA
                     AAASSSSRRGTRE"
     gene            <444461..>445576
                     /locus_tag="LDBPK_081040"
                     /db_xref="GeneID:13392004"
     mRNA            <444461..>445576
                     /locus_tag="LDBPK_081040"
                     /product="phosphoribosylpyrophosphate synthetase"
                     /transcript_id="XM_003858615.1"
                     /db_xref="GeneID:13392004"
     CDS             444461..445576
                     /locus_tag="LDBPK_081040"
                     /codon_start=1
                     /product="phosphoribosylpyrophosphate synthetase"
                     /protein_id="XP_003858663.1"
                     /db_xref="GeneID:13392004"
                     /db_xref="GOA:E9B9K4"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:E9B9K4"
                     /translation="MSVSPLCDQLKRIEKAYFYQPGKMTEVHAMSGTVSPHTEKRDYS
                     RPFCLVSGNGNRPLAEAVALLMGTHTHHTSVTQYSNGEVNVRINECVLGADVYIIQST
                     TGNEIIDINTALMELLLLIRKMRLSNAKSVTVIAPFFGYARQDRKTNLRGPISASVVA
                     RMIVKMGVNRLASLDLHSNQIQGFFDNIPVDNLLMAHEFARYLHDQPWFNVDQMVVVS
                     PDAGGVERAKQLADILQVGRIVTIVKRRIAAGKVDTMQSVGEVAGFTCIIVDDMIDTG
                     GTLVKACELLKELGAVRVMACCTHGILTNPCPDRINNCSALEQLVVSDSIPQEEHQKV
                     IPKLKVLTIAPLIAAVIHQYLNEKSVSSLFPPSLRDS"
     gene            <447123..>449963
                     /locus_tag="LDBPK_081050"
                     /db_xref="GeneID:13392005"
     mRNA            <447123..>449963
                     /locus_tag="LDBPK_081050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858616.1"
                     /db_xref="GeneID:13392005"
     CDS             447123..449963
                     /locus_tag="LDBPK_081050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858664.1"
                     /db_xref="GeneID:13392005"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:E9B9K5"
                     /translation="MTSLTLREIGATNNVAEDHDVLELFAACRESVVHVAASHLLPYH
                     VAVTTRNGFVELIDTATGEFRLFLTYLDRIPLDASLRCFSLVPSLYAASQQHHHRRPQ
                     HHLLYSLSYSNELLLGNVETGAVRVFATCESRPSVVQCDGDYIICGEGTGKVTVWRTS
                     VEGEWDARYASSSAASTSLLPPLWKACLFDSTVVCANLHRDQLVCCSADYRCVVACVE
                     DGVVRATLPLDLNQAVAVFALTMPSMASLLHKSLVVCLTSRISIFTSRPARDTAASAQ
                     LSPSSVPTAEHLECWTRQGDCAVEREEVACASCLGGYLATGTISGLVLLYSCDAAEPL
                     VKELVRFNVGYGVTGIQLFPNDTLLVVTSVGDVWRWPLCDLLRNAGASGAEGEKDEAT
                     EAEPTAASHQPPLPLAAPRVPAAPSPQDKTLHTEPRVPAPPHEVSYTQEGDTEDRSFS
                     AHDTSTLGHTPQREREATARVEEIVTAVCVDADAPLVGARSDAEEQGTPSVHLSTASA
                     SLRALSASSENDGDEDHPNERGNSSTDMDARRAEPATVSCLPPPPPLASPTVSDKFDE
                     KRGAGGVARCATEFQRRTLYDPEQSTEELGVVDMGVPFSAAENSADLSHDDLRIAVSP
                     PSTADTTAHHDAALDGSGADVPEVTARGPAAGAAALAAKEGTISDKDIQPFQSNHGDL
                     RDTAGVAQGTVHSSPGIASRQGTSMKAAVDDLELEFAHAMKRLLGPTVGVEGLRKDRR
                     MNPRKVAGVLANLTNQQAAAAGAKGLSHEAPSQPRALEGSNSTKLLEEKRATLEAAAF
                     DFEAYRQAHRLEVDALQYHHPVRAPTYTLQDRVFDAVESAGRLCDKEAGRATGASGNA
                     AATLPAAPEDELRDVTYGKVKWTLDPQIAEERRRGGPEIAQHHCDHLIFSTPYPTKTT
                     VLFAEEAPLMPSTAWEEVLLLPLPLPPAPSVF"
     gene            <450898..>454332
                     /locus_tag="LDBPK_081060"
                     /db_xref="GeneID:13392006"
     mRNA            <450898..>454332
                     /locus_tag="LDBPK_081060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858617.1"
                     /db_xref="GeneID:13392006"
     CDS             450898..454332
                     /locus_tag="LDBPK_081060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858665.1"
                     /db_xref="GeneID:13392006"
                     /db_xref="InterPro:IPR019160"
                     /db_xref="UniProtKB/TrEMBL:E9B9K6"
                     /translation="MSRYKELQPAIDGVFHQRGEEVVAHEMVSEISSKKKASTPRLLI
                     LSHFLGRSGGATLSIVTVDPSGQRVKIKSAFAVDRLVNISNEGSFDATFNFGASGVLS
                     VSFESHIQREMFVAAARRIRATPSSSSGARESYVDNRLSTIRGVLTEAVGAQVEADAA
                     ARVRKLRQDKRRIFSTEEEKHLLRHIGNNGAGFDDIKQFQEILLRQQKSSELRSLNLL
                     TTSEAVWQEAQQQVQDLVQDVEEVGQRIEEYSTHLLSKKSVLQQVEHDNNTLQRRQQN
                     LEALYIMMSDLRDQLRLAPATMALLSRLRTVPEDGLVAFFSEGSNAVTLSVAMKHMQG
                     VLHNPKLDSDFPITAVAERKAFFLEQRKMITQRSKSYIMAIIGSFEATYLADKSRYSR
                     DASLVWRLHVELAHKLLNISDVIRALDRIDVEGFNNALRKYRTSMQRVYALEITHFFK
                     CLKKQVKKVNTWRGPFLLGTSESRKEAMSMRMETAQSGETPRMYSRGSQSTPALTPRM
                     MRFGDDSDYGAGAGGRAASGLGGSEDRTHLSLQFPSVADLSMEGSVPASAIELYQSAN
                     TLRRLDARAETSSVMSGMKSLNPASTSGGGYVRPDLAFAIALESSVLAVIHEEVILSR
                     CFNLFSDPAEKSGNDEDAAAPANAGANPQADDSKRTGAATPRGAAGADRAQMKQESLL
                     ELFGGADADHLVRTLQGTSRSASVQNSRSSSQDIGLPPRPPPAGYGGDRRGHGGSSFP
                     HRRTWSGASLSGYGRESNSSDGDDVDGGGPVDECSRASRIALHRNFLIRTMRDLALFF
                     VEKCDRIYCVPILCMIRAYRSTAADKAMLPSKSAFCQAMLAEVETVMVGGMMRFVAEQ
                     TDSIHRCRKRYVVRPTALLHCFSKMPALFMRFEAVHNALARNVCDRTEYASIALSLVD
                     QSFDALDQITSVKATGEDQNAEQLKLNKLIAQKVHSVLDGVEADAHSLKWVFIQQYRH
                     QSFFCAFYSTMPSDSFAVELLQDHYTSAKEKRDRYEELYLTRVLLVRSFPVFGAFALS
                     AEDLSMIYSKEELRHHKALSADAVKKVVGGLEKEMRSGVRASAARMKKHFLCDVDLNG
                     NEASFHTTLLQRTWQHFSTLLLHKFDFLAEMLTWPAYHGISMPVARSDVVEMLAAY"
     gene            <455236..>456516
                     /locus_tag="LDBPK_081070"
                     /db_xref="GeneID:13391943"
     mRNA            <455236..>456516
                     /locus_tag="LDBPK_081070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858618.1"
                     /db_xref="GeneID:13391943"
     CDS             455236..456516
                     /locus_tag="LDBPK_081070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858666.1"
                     /db_xref="GeneID:13391943"
                     /db_xref="GOA:E9B9K7"
                     /db_xref="InterPro:IPR008854"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B9K7"
                     /translation="MLRTTRLRRIGVHIPSAKELDDQVLINRLRKSRPKSVFSLKALT
                     TGRVQGFVAAGGIVLGTAMFLGPWLWEEVQELMGSRYVPLAPSQMPHTSPEWWENEWR
                     KMNPLWRAGESMSDFFVGPYRFVKEQTGRDMSSAADFVRTSPSSSLSSFGAAGEQQRS
                     FLHRLKQVFHRSASLTTSTCVTTASSGVGAASKGGHSRRATASAVMLPNPPQMLVPLC
                     GDSPIMRTAALQGFEVDAVDSSQTAIQTAVGRTEEGLPQEFYSKIHLHWKNFFSPELW
                     EGPLKGKKYDVIYERQGMTSLNREQRPDYAYLLKRAMKDDGLIYVEGVFRTGRVKGNK
                     LMGPPYSLSKRELQQLFPLSEGYYVRCEEKTDAMQQLSRENRILKRVPKELYVTPFSC
                     VVFRESTVNLRTRTEPLQHPEPPTLTPPQEGFVW"
     gene            <457918..>459246
                     /locus_tag="LDBPK_081080"
                     /db_xref="GeneID:13391944"
     mRNA            <457918..>459246
                     /locus_tag="LDBPK_081080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858619.1"
                     /db_xref="GeneID:13391944"
     CDS             457918..459246
                     /locus_tag="LDBPK_081080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858667.1"
                     /db_xref="GeneID:13391944"
                     /db_xref="UniProtKB/TrEMBL:E9B9K8"
                     /translation="MKKLHQERGGNPMLAQQARRVLFATSITGQNIDARSVALLLNTA
                     VYFGMESDARVVRECIDFCLKNDKFISLDIMPIVVTACATLKSRDAREVIELQAIKAT
                     KNARFLDAKGVTNIISAFSKTGINHEKLFGLLSMRVQTLARVGEFEAAHLVILANAFA
                     RLRFREQHVFGAIARRAMSLRERVTVNELVPLINAFSKAGLKDPKLSKRFAGKAMEYV
                     DQMNAEQVAMMFQAFAYFGIRYDQLFGVLTNRAVELIDEFNAQYISTTLASFQRIGIN
                     NPELFDNLAERALAVVQDHDAKDIALTVTALAHFGLKDEELFKRLASHAASIADQFDP
                     VGLVNTIHAFARTFFLQEDMVVALSERCVYVCRHLDANQVRRLLWSLAKFQVKDPRIL
                     TPVFNRCLTLHQDFFSDPMGGEEIEEIFDVFGPSFCPPLYQLYMSRGNSV"
     gene            <460433..>461686
                     /locus_tag="LDBPK_081090"
                     /db_xref="GeneID:13392007"
     mRNA            <460433..>461686
                     /locus_tag="LDBPK_081090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858620.1"
                     /db_xref="GeneID:13392007"
     CDS             460433..461686
                     /locus_tag="LDBPK_081090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858668.1"
                     /db_xref="GeneID:13392007"
                     /db_xref="GOA:E9B9K9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9B9K9"
                     /translation="MEPNADEPKKSSVRQLLRQQRELQEMRKFGLAPLAVDTETHQEI
                     SPNIPEFISRAPWYYGATGPTLVHQRKQGDSATGVSDEVLDEKVDRIVVKGQASCFTA
                     GACKNCGSRTHKTSECFQAKKKVGSVYTNRVTGSDIETHQEAKTYSQKRDRFVGEVGI
                     DLMRAVRQGQEDDSVDVAAPATARHRPEDVFGSRTAQHGGVEVKELPKYLHNLDQQDG
                     LFFDPKTGSMRANPNAGDSTKAFRGDLERYRTGDYYNYVESQYRFLTGQSRSFVDFEF
                     DDAMRRAREQQQEPQQQEQDSTRGPVTKVLTETPQDVLLRSLYGTSQPKFDSDVPPSS
                     TTESKTSAPSSSPAPPIDALVTTATATVAAHSSVQAASLSWVTTRNGHAAVYGSYFDP
                     IHFRWGYACCKRMGKDAAGCSATHA"
     gene            <462459..>466202
                     /locus_tag="LDBPK_081100"
                     /db_xref="GeneID:13392008"
     mRNA            <462459..>466202
                     /locus_tag="LDBPK_081100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858621.1"
                     /db_xref="GeneID:13392008"
     CDS             462459..466202
                     /locus_tag="LDBPK_081100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858669.1"
                     /db_xref="GeneID:13392008"
                     /db_xref="GOA:E9B9L0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR011041"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017233"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9B9L0"
                     /translation="MFVYLSKRIAMPNGVKVTSIAWSEGQGWLACGGEKGLLKVLKVD
                     GGPQGQRSGGLSSSQTLEGHDTTVDLVTWNQQYCKLTSSDVSGRIIVWMLHKGMWFEE
                     MVNNRNTSRVVDFAWSPSGTKICIAYEDGAVIVGGVEGNRYWGRELPYKLAKVCWSAD
                     GHSILFGTATGDVYVHDASSGAQLSQVEVQCNDGKALSPLAGLSWHPAWVERPEPLAT
                     LAICYQSGKMQLMTSIGDETPRLMDSDFPVHFVSWNSSGTVLAAAALTPATAEDAPTV
                     VTQFFSNEGVHLRTLRVAGKQCGGITWEGGGLRVAIAVDSSVYFANVRPSYKYCYFKK
                     TVVFAFTMPDKVEESVMFWNVNTNERRTKSVRGLQYLSACKDACVLVSRPDAAQQQRM
                     IQLVNAIGSPLETRFIDMELYTYDMNASVVVCCGDESIYIWQFRDPGTAVDALDPVSM
                     QASRAESQERVIHIGDIVRSDTAPTMKVRSALTNDLICAMCVSETHMFVALESGTLHV
                     YQLSPLQLVSKYILPTRAQSMAVNCNSTQLAVIDLGCITSVYSIEREKFSLVPCKAEP
                     IDGVELKDVWNLRWAVDDPHRFAVMEKTRMLVYNHGVAEEPVQSCANLCKFKSLKIRT
                     LQLDELLLDPERPRKDYVVDFEAQLLREMRAVLRDGTAKEAYEFAESHNIKKLWELLA
                     EHTLFQLDFTYAEVAFIHCKDYPAIQFVKRVRSLDDPKKQLAEVNAYYRRFDEAERLY
                     KDVDRKDLALDLRYRLGDWFGVVRLVQEGGGDEALLLQAWENIGDHYASRQKWSKAAQ
                     YYTQCRHYRKLAHVFYIIEDYEMLTQLISMAEHDKELMVTLGNMLLTVGLAEEAAKAF
                     VAASEPRMAVNGCVQVNMWDRAIALAEEHRLEDVGQLLEKYAKYLIHRERLTEAIELY
                     RKAGKHDEAATLLAQLGKRAALSDPLKAKKFYVLSALEVQKYRSTAIALNRDGVEVVR
                     EMLNKDRSTVSERTLDAAWRGAEAYHFLLMCQQQIADKNFKAALVLAMRLMEYDDLVA
                     PVDSYSLIALTAYLVKNYGLCSKAFARLEQAERNDEAGGAAAAATTQLENFSLDLDVT
                     QRTMAGTCGGSTGGGTGMLSGGGGSALSGTTTSLQLTNPGKGVTRMAPMTYPTVSLRD
                     PPRPFADLARQIFMTYSPVDTSVDSVPCPTCGSFNKEWAQRCIKCQQPFNTCMVSGCA
                     IASEDGAWQCPVCHRKALEAVVDKYRNCPLCHTPKKGRARRGI"
     gene            <467412..>467999
                     /locus_tag="LDBPK_081110"
                     /db_xref="GeneID:13392009"
     mRNA            <467412..>467999
                     /locus_tag="LDBPK_081110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858622.1"
                     /db_xref="GeneID:13392009"
     CDS             467412..467999
                     /locus_tag="LDBPK_081110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858670.1"
                     /db_xref="GeneID:13392009"
                     /db_xref="UniProtKB/TrEMBL:E9B9L1"
                     /translation="MFRHTARRMSSLSSFTGIEVDPYTAKSMFLFGFIASVGFLSVYS
                     VKETKKAGPIELPEELEAQRQRHNDPRRPPWPLLHQRVVLLREGKGAPEDIALMWEQT
                     KHYYPADWLIPLELTQVLKYSSGKCLQTYVADPDEMRKEVLMQLLNVKYGRVSDLKGG
                     RVNKDVEEIISMAVDDLENMDLNPSADAVLIPTHT"
     gap             468536..468858
                     /estimated_length=323
     gap             469347..469445
                     /estimated_length=99
     gene            <470755..>471939
                     /locus_tag="LDBPK_081120"
                     /db_xref="GeneID:13391945"
     mRNA            <470755..>471939
                     /locus_tag="LDBPK_081120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858623.1"
                     /db_xref="GeneID:13391945"
     CDS             470755..471939
                     /locus_tag="LDBPK_081120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858671.1"
                     /db_xref="GeneID:13391945"
                     /db_xref="UniProtKB/TrEMBL:E9B9L2"
                     /translation="MEPHMTSLVLRRDLSLEVPKLLIGAVQPYQTLAGPALTTSFLHQ
                     PDLLPFQRTAFSHAAIAPLYFHTLLHTLAEFAETPRAVQYSAVKLRHAPKADFWDSVG
                     TLNCFYYSAHAPYGAPAEASVLDQHPAMGAVELMRPGHRMESDVKLTLFNNSHQPIAS
                     MLMTGPKGATREADDNAIESSQDTSSTSPHARTAFPYVAPPTKETASASDCLSAVMIG
                     GTRVHGGLYGDLMPMEGGGGFGQRACYRVEDAAASSPSPNDRSRVSGTEAAAEERTAS
                     SSAPTVMPPWVLYDCVQRFFLRLHRSGVFGGDAAIAPTEGWRVSAHHVVQTEDAVFGV
                     PVEVVCAVPRVYPSYRLPPWRHRLGLPAIPNGAAPCVSLRCETRQGGRLISTGVYFFT
                     RW"
     gene            <473750..>475270
                     /locus_tag="LDBPK_081130"
                     /db_xref="GeneID:13391946"
     mRNA            <473750..>475270
                     /locus_tag="LDBPK_081130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858624.1"
                     /db_xref="GeneID:13391946"
     CDS             473750..475270
                     /locus_tag="LDBPK_081130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858672.1"
                     /db_xref="GeneID:13391946"
                     /db_xref="GOA:E9B9L3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9B9L3"
                     /translation="MLQNFQFILRAELLTITSTQGLPQGQRRLMECIQLSDSLVPWEV
                     VHSVVMRATPEEFQCPICMEMPTAPRITECGHVYCLPCILQYMSRQKAAGAQRKCPMC
                     HDLLTPYTLRPCVLQSVQPRRVGAQARFDLFKRHRNSCVLRRSDDPFLAAPPPPSSAK
                     AVAIHLPAYMEPMSCQSRYVMTTPQYEAGQRYADCAGISERMRELEQLTQPLSESDAE
                     VERFLLEALNEVTKEPKGLPPSMLRNSPPMAPRPVTTPEGEGDHLELYADGEGQPYYL
                     HMLTVKMLKHDAKLRNAALPDTVTGMIEEVVTMEQTEETRRIYKVFSHVPLHGMIKLC
                     VVNVDHLVLPETRAAFAAALQRMASDRAQRRHRDDRAASEDASWKQYLMRYSNRSGDC
                     LGFSPDTAPSDFSIDTESLPYLKLPSTGSAGSDHGLPPNTLDTRQRATKRQDMQSLLV
                     DSAVEPPSRGDTATAKTSSTMAAGCWAQGSATKLFAKAERKEATKSTWGGHVFSPK"
     gene            <476697..>478118
                     /locus_tag="LDBPK_081160"
                     /db_xref="GeneID:13391947"
     mRNA            <476697..>478118
                     /locus_tag="LDBPK_081160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858625.1"
                     /db_xref="GeneID:13391947"
     CDS             476697..478118
                     /locus_tag="LDBPK_081160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858673.1"
                     /db_xref="GeneID:13391947"
                     /db_xref="UniProtKB/TrEMBL:E9B9L4"
                     /translation="MPPRWFHVPGSGARDAQGPPEGLVTSTHLSSSLLLQRSSLLDHG
                     GTADASAHALGCGGRDADGSCWGIAGPSPAMQPQQPFAPHGGAGTRDTRSLGSLLCHP
                     DLRPTRDTSADNTSPTEVSRLLRQYRDENARLREQLKAKELHEAHIMARLEETSHRCA
                     HLQLAWQRASGDTPSSLLQSAGDKADAAQSVGSHGGEAEETVQSRLAQKEAEVRELQG
                     RVEAYREALQRSRAHAALSEEERRAAAAPATCAAGSVSPTSLHVLLLQSLNAADYLVK
                     VFNALQHCHCTRHGDAHGSASDCCRRSLHDCKVRCLQAAVKGAPISSELLELEDGPEN
                     DTAAANMETAVAVREELLYCEAVAVRLAASLLSRERTTDEDAAPPATTTAAAAPPEKA
                     ASPPPLSALGPLTALGVAEPVALAKAAAAETHDDGDDEGAGEGEKSTEENGQATVSYV
                     AAAREPRRRPSRCRPDVGDCEVQ"
     gene            <479389..>479688
                     /locus_tag="LDBPK_081190"
                     /db_xref="GeneID:13391948"
     mRNA            <479389..>479688
                     /locus_tag="LDBPK_081190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858626.1"
                     /db_xref="GeneID:13391948"
     CDS             479389..479688
                     /locus_tag="LDBPK_081190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858674.1"
                     /db_xref="GeneID:13391948"
                     /db_xref="UniProtKB/TrEMBL:E9B9L5"
                     /translation="MSQQLAFHDVSNDAIQHMQASEALQKHLENAQLAHRVCVAKALK
                     ANEPPVEKCALTWGEVVMRYNQWSEYRPAFHDSDAQKRYSKYWTKKRQAADDSHP"
     gene            <481240..>482538
                     /locus_tag="LDBPK_081191"
                     /db_xref="GeneID:13392010"
     mRNA            <481240..>482538
                     /locus_tag="LDBPK_081191"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858627.1"
                     /db_xref="GeneID:13392010"
     CDS             481240..482538
                     /locus_tag="LDBPK_081191"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858675.1"
                     /db_xref="GeneID:13392010"
                     /db_xref="UniProtKB/TrEMBL:E9B9L6"
                     /translation="MPLPLTSLARAMASPCAVAGSTTTGTAVAAGNSSGTDCYVIVWV
                     EGRERPVYACTAPLPSSGSSASLPSAASAGAAAVPAVNVVTLRRFFGALVLLSSPPPA
                     ARARAGGHCAALSCAASFTRETAPVLCATLPLGLVGAFGASPPYYYVAVLAPGTAAVV
                     GNQLLAWLASSVLAALHPDSWATAALPTGQACGTALLSLAADAPDLCSQLALYGAAEV
                     GRARAGAAAMEDYGAREVLADSAGQSTLAAVLQEFEPCRDSPVAVAISTLLRRCWVPF
                     TVSPATTAASLHISLAGYFTLPFPSCLRASSSAASPPAPTLYACSAGCWEALRLLASF
                     CSRRTPDLQQTSSADAAPLAVLPLGGSSSGGAVALIAASVGYVHPDTALYQAVLVHGE
                     RPSRGGAVNCAAPYVRYLTTSEVAACGTPWHPDALRSVWA"
     gene            <482948..>483808
                     /locus_tag="LDBPK_081220"
                     /db_xref="GeneID:13392011"
     mRNA            <482948..>483808
                     /locus_tag="LDBPK_081220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858628.1"
                     /db_xref="GeneID:13392011"
     CDS             482948..483808
                     /locus_tag="LDBPK_081220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858676.1"
                     /db_xref="GeneID:13392011"
                     /db_xref="GOA:E9B9L7"
                     /db_xref="InterPro:IPR003198"
                     /db_xref="UniProtKB/TrEMBL:E9B9L7"
                     /translation="MTKLTVVCRAVSSALEKQTCELTCIERQTISLEAVRKQHKAYVQ
                     VFKEMIEDGYDIELIELPALNELPDSMFVEDVSMIYNTCAVITRPGAPSRRPEVDPIL
                     DTVTALRQENYRICEPGTVDGGDVLYVANSKYVFVGKSTRSNDSGYEQMKEYLGKHGL
                     ECVQCVVKNCLHLKCAVTFLSESTLLLSPKWVDPEIFTSRGFKVVEVDSNEPAGANVL
                     SFSAEKNGKPLRTIVTAAEFPGTASRIEAFAAEETAQGRPTRQVVLEADEIAKAEGSL
                     TCCSLLSYSA"
     gap             484684..484782
                     /estimated_length=99
     gap             485490..485588
                     /estimated_length=99
     gene            <487852..>490416
                     /locus_tag="LDBPK_081250"
                     /db_xref="GeneID:13392012"
     mRNA            <487852..>490416
                     /locus_tag="LDBPK_081250"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858629.1"
                     /db_xref="GeneID:13392012"
     CDS             487852..490416
                     /locus_tag="LDBPK_081250"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858677.1"
                     /db_xref="GeneID:13392012"
                     /db_xref="GOA:E9B9L8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B9L8"
                     /translation="MRDAAATERERLPTPADGDVDSLYEDGTEAETAKQRSTVSTTTL
                     FLALPWLGCTLFLVAVLLYVNVHTFSIWSRLVSMPGGVVADVSVQHRDMARYTVLFVS
                     LALLAVHLAISFCLFRRAYHVLWDVQMSLVELSFMVDVIRTHQHSTFFFVDCVERAQR
                     VRESMRYWVKEFSGFKEICAAEMAVNQVTLRLMTRPRESAQRLESPGDTQLPCTGSGT
                     SSPVQLARGGRLPPDTTAAAFRLPQDAAWSPHVQSVRTDSAHADPGPGRQLAGHHSGS
                     RRSLSFTTEIGIAQVPFEVTLKRRHVALLLLSFLTYRELVRAEAEEARQISRDFIAAV
                     NMCAQRYKGCIVELYSDRAILSWNAFFESAGNYAQTCAQCGECFHDRFVRRFSPESGA
                     YFSTAGYTGHIVCGTTTEKSLLLHGQHVSMLRGLPTLLEMRYCAYVWLGTPPPACTSS
                     PLSWTRIGAVQAGADFSVDLHAMRRTSAEPLPAAMVWHMPQWTTFGDERAVRAEVLTN
                     DDAARLQQDGDTAPVTPASTAASAAATGVATAFPSSPFLSSPLCLRGVGTPYETFYDR
                     SHNRYQLSNTVLGESKSCVVRLAISETGNFVAVKEIKIERGDVKPIRRRRYQRENRII
                     VTRGEKPQWMNEVEIMERHRHTCIVAYISFVEAEDKLRIVMEYVGGGNLLKFASSSRG
                     AEGEGPPMAVLLRNVVEGLKFLHQKGIVHGDIKPQNVLVPDSGPCKIADFGISRRATT
                     AVTSAIEGTPFYMSPEATRGEVTAACDIWSFGIMMAQVLTGRLPYDASVRDYYLVSQF
                     MCNKDVKRELHTPLKKPALDVFLACTEYDPGKRKTAKDLLKMPYFTAHAASSTEDA"
     gap             492195..492293
                     /estimated_length=99
     gap             493847..493945
                     /estimated_length=99
     gap             496380..496478
                     /estimated_length=99
     gene            <496854..>497294
                     /locus_tag="LDBPK_081290"
                     /db_xref="GeneID:13392013"
     mRNA            <496854..>497294
                     /locus_tag="LDBPK_081290"
                     /product="beta tubulin"
                     /transcript_id="XM_003858630.1"
                     /db_xref="GeneID:13392013"
     CDS             496854..>497294
                     /locus_tag="LDBPK_081290"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_003858678.1"
                     /db_xref="GeneID:13392013"
                     /db_xref="GOA:E9B9L9"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="UniProtKB/TrEMBL:E9B9L9"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVISDEHGVDPTGTYQGDSDLQL
                     ERINVYFDESTGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGM"
     gap             497296..497846
                     /estimated_length=551
     gene            <500099..>501991
                     /locus_tag="LDBPK_081300"
                     /db_xref="GeneID:13392014"
     mRNA            <500099..>501991
                     /locus_tag="LDBPK_081300"
                     /product="histone deacetylase, putative"
                     /transcript_id="XM_003858631.1"
                     /db_xref="GeneID:13392014"
     CDS             500099..501991
                     /locus_tag="LDBPK_081300"
                     /codon_start=1
                     /product="histone deacetylase, putative"
                     /protein_id="XP_003858679.1"
                     /db_xref="GeneID:13392014"
                     /db_xref="GOA:E9B9M0"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:E9B9M0"
                     /translation="MTMPKRQRSDEKAAHHVQLSVESGSRFDAYIRGWMQGTVEQPLL
                     RPSLLPPLTPLPTLAAPSKSGAAQTPATASAATTVGDLSRLCEWTPPSAVIPASRTAV
                     VYDTSMLDHVSPDAGDYERPARLQSTLDHLTAIGLLPCCQRIPARTAKKHELRRVHCR
                     ELIDTVDQLDFFMGIQEGRGSVIGQDLFASEHTSRAARMAAGCVIEAVKAVLSGAATN
                     AFAIVRPPGHHAGPANAAGYCLYNNVAVAARAAQADLAAAQAEHNPAGDAQQPRILIL
                     DWDVHHCDGTENIFYDDPSVLVISLHQYGNGHGHVLRKVSSAAAKNPAEISTPSKEEI
                     TADDLAALLSGGAIEPPPVSAPEASRPEAASDPPQGSTEGRRVRAAVDYNSLAAQIEE
                     EGDAEIAALFGVDLNAASTSSSNSSSASTSSSVSAHSTSVARNGTRPVHYAGDTVGLS
                     FDETPRQRATGAEEEELFYPGTGHLNRVGGDATPAAQGRNINIPWPTHGMGDLEYLQL
                     LHEVVLPAAREFRPELVLISCGFDSASGDLLGSMCLTPSGYYIMTRLMAQNFPKLVVA
                     LEGGYNVRNVALCSEAVMRALLESSGCPGDRLPKSRMLWCQASSLVADIKRIHAPYWS
                     CFSPNM"
     gap             502934..504995
                     /estimated_length=2062
CONTIG      join(FR799595.2:1..505720)
//
DBGET integrated database retrieval system