GenomeNet

Database: RefSeq
Entry: NC_018236
LinkDB: NC_018236
Original site: NC_018236 
LOCUS       NC_018236             588727 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 9.
ACCESSION   NC_018236
VERSION     NC_018236.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 588727)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 588727)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799596.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..588727
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="9"
     gap             2406..5615
                     /estimated_length=3210
     gene            <7491..>7925
                     /locus_tag="LDBPK_090010"
                     /db_xref="GeneID:13392190"
     mRNA            <7491..>7925
                     /locus_tag="LDBPK_090010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858632.1"
                     /db_xref="GeneID:13392190"
     CDS             7491..7925
                     /locus_tag="LDBPK_090010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858680.1"
                     /db_xref="GeneID:13392190"
                     /db_xref="UniProtKB/TrEMBL:E9B9N7"
                     /translation="MEKDSSGSTGSGAVNREGVLEKMLEEEVVKRHDAERAAEGLRRR
                     MQLLEAEVLDLRQASDWKKGSVLCTAAGDDGTAVSTVGDAECADSSDSALKIENHRLR
                     EFVKRQNALIDVLRRQKVLLEASAAVNISVRDFDKQLEIHKV"
     gene            <8490..>9611
                     /locus_tag="LDBPK_090020"
                     /db_xref="GeneID:13392145"
     mRNA            <8490..>9611
                     /locus_tag="LDBPK_090020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858633.1"
                     /db_xref="GeneID:13392145"
     CDS             8490..9611
                     /locus_tag="LDBPK_090020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858681.1"
                     /db_xref="GeneID:13392145"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9B9N8"
                     /translation="MACVTGDDTGVVKIWDISKSSGATLKFSFGEQSRKRAIMGMCWE
                     DNSTSSVAFSSNDGFLSVLDISDYIISSSVKANTVAGLPNAMSFVKGKLVLVSKDGET
                     SVFSSDLTPSSSFSGNGPIDAVHIHRKFGMVAMGGRENDLCVYDLASEAVEEPVFKAR
                     NVRDHILDVPFPVFVTGACIVNPYVFAACTAYHQVRFYDRRSNDRPVQEFEISREIER
                     RPTTMLQWNANKFLIGEASGDIHLYDTRRGFCSRAKLRGGVGSVRCMCKHPAGHQILG
                     VTGLDRKARLYHVPTGKLLMSVYVKQKANCLLLDKQLPLRDKVTAFSGVVNTKQPEKA
                     NTLGDALWDDMDPVLDDLDEKEIVADTATQSRRKVQRKE"
     gene            <10252..>10575
                     /locus_tag="LDBPK_090030"
                     /db_xref="GeneID:13392063"
     mRNA            <10252..>10575
                     /locus_tag="LDBPK_090030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858634.1"
                     /db_xref="GeneID:13392063"
     CDS             10252..10575
                     /locus_tag="LDBPK_090030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858682.1"
                     /db_xref="GeneID:13392063"
                     /db_xref="UniProtKB/TrEMBL:E9B9N9"
                     /translation="MASCRTGRLPMPDDPLFNSTHMHGLRHSSRLAGLGMIAVIWIMY
                     EKLRHSHHYITYKGPENPFARIRHRRFPGGAFMFGWGNNGLNRDCGIKEFECWAGYTG
                     KEYTY"
     gene            <11797..>13656
                     /locus_tag="LDBPK_090040"
                     /db_xref="GeneID:13392064"
     mRNA            <11797..>13656
                     /locus_tag="LDBPK_090040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858635.1"
                     /db_xref="GeneID:13392064"
     CDS             11797..13656
                     /locus_tag="LDBPK_090040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858683.1"
                     /db_xref="GeneID:13392064"
                     /db_xref="UniProtKB/TrEMBL:E9B9P0"
                     /translation="MDAKEFVQRFPKSALSAKLVLSLESTEQRDFVVSLIDDAVYCDS
                     WEAYFDFAERNNVAITEDVALAAVQAVGLDPLSAPLWVRAAACCESVESQKSLYEFGL
                     SVPLHGWQRLFEEYRRCTDGHEDDHVLSETECWCVSNVLTAEKWPDRYAKLDTDAEAE
                     EVRQAWLDLFSCMLTSLAATVIARDLQLRRIELAMRQMCTQLPGDDSCWYQLALFQLR
                     ILEDAEAARKTVASGIAAAGPSFALENIASVVDGVVGVSDISDTSSADVLTATKTLMQ
                     QRRAAEELALDGVTKDRLRALRSVGKAAAQQGLSDWKIFSQWRCAEDMAAHDTKMAAK
                     VLENGMICCSHSPTDALLLGSEAAQYHLLQRHEREALGYAEQQIEQQAGLHHRGKIMA
                     SWNSLVRIESLLGLSFSKAAKRRAELFPQNRISMFMENCRVGDYLPCDKSTFQWARFV
                     EDYQVDKASVEETPFHGIAPPRNKAVAVKRLQQVECETPDDSQWEPFVPPLSCLPSRE
                     EENPDDVTGVRELRGKLVYRVKVDARTAARCQREKATRQRSKTGEKAVERGGALGSLM
                     RRVCPVNLTVGQTKRLQSISADWVVHVLTVSELDLERTLKERAERQESHGMSV"
     gene            <14101..>15063
                     /locus_tag="LDBPK_090050"
                     /db_xref="GeneID:13392016"
     mRNA            <14101..>15063
                     /locus_tag="LDBPK_090050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858636.1"
                     /db_xref="GeneID:13392016"
     CDS             14101..15063
                     /locus_tag="LDBPK_090050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858684.1"
                     /db_xref="GeneID:13392016"
                     /db_xref="GOA:E9B9P1"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:E9B9P1"
                     /translation="MMVQEVVTGEALRVLGRNPFEGITTKTRLRQLLQTHQGRDKLFK
                     VAQYLLRIRLWWNSVDFNVNYVPGENFSRMEKNLMTIVNSRRMFRLGRFFGEFVRMRV
                     TLIKASELVYIPVNGGQWVALFIQCQMLLDMLARGLLFVKSLLEDVAFLVQKGFFHSN
                     VAGRLIYVATRCGLPVLTIDLFLNTLRLYQGILDASATESSNEIMFSKDSFSLLSKYD
                     RVDKLRRKLASTTDEEKLKEVIKDQQRTANGTNENVVYVESYAQLLWTDFELHWICVT
                     EAKLLLDIFVALSGLRGWKLQGSVSTAGLLSGLCSIYRVWTYGR"
     gene            <15768..>16517
                     /locus_tag="LDBPK_090060"
                     /db_xref="GeneID:13392017"
     mRNA            <15768..>16517
                     /locus_tag="LDBPK_090060"
                     /product="N-acetyl-D-glucosaminylphosphatidylinositol
                     de-N-acetylase"
                     /transcript_id="XM_003858637.1"
                     /db_xref="GeneID:13392017"
     CDS             15768..16517
                     /locus_tag="LDBPK_090060"
                     /codon_start=1
                     /product="N-acetyl-D-glucosaminylphosphatidylinositol
                     de-N-acetylase"
                     /protein_id="XP_003858685.1"
                     /db_xref="GeneID:13392017"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:E9B9P2"
                     /translation="MHSITVVCINVVLALLLLLWMKIANLAGTSVRSDVLFVFAHPDD
                     EAMFFTPLLHSLRAQRVTVHFLCLSNGNYAGMGKEREKELYASGAFFGVQRRNIRVVD
                     HADLQDGMCNIWSPLLIRREIESYMQKAGSISTIVTFDKYGVSGHPNHIAVHNGVREL
                     KENMPPGLLHLQLRTRSLLWKYVGLLAVLPYVLWSSTCVSRTSFVAVIPPASVWESMA
                     AMRKHAGQLVWFRYLFVIFSSYTYVNEIEEL"
     gene            <18283..>19059
                     /locus_tag="LDBPK_090070"
                     /db_xref="GeneID:13392018"
     mRNA            <18283..>19059
                     /locus_tag="LDBPK_090070"
                     /product="endonuclease III, putative"
                     /transcript_id="XM_003858638.1"
                     /db_xref="GeneID:13392018"
     CDS             18283..19059
                     /locus_tag="LDBPK_090070"
                     /codon_start=1
                     /product="endonuclease III, putative"
                     /protein_id="XP_003858686.1"
                     /db_xref="GeneID:13392018"
                     /db_xref="GOA:E9B9P3"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004035"
                     /db_xref="InterPro:IPR005759"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:E9B9P3"
                     /translation="MNKCSFTPPSNWAQLFARLEDYRKHLKAPVDTMGCHRLRDEYAP
                     KEVQRFHTLVALMLSAQTKDVVTAAAMDTLIKHGLTAQSVHAMTETELDKHICKVGFH
                     NKKAKNIKEVAAILMKNYDGEVPREYAELIALPGVGPKMANLFFQDADHRVIGIGVDT
                     HVHRISQRYRWVPSTVKTPEDTRKALESWLPREHWGTINSLMVGLGQTVCTPLRPKCG
                     ICELSDICPNAFKETQQKRLRAKAPLVEKEEPVSNKKRRK"
     gene            <19717..>20112
                     /locus_tag="LDBPK_090080"
                     /db_xref="GeneID:13392019"
     mRNA            <19717..>20112
                     /locus_tag="LDBPK_090080"
                     /product="RNA-binding protein 5, putative"
                     /transcript_id="XM_003858639.1"
                     /db_xref="GeneID:13392019"
     CDS             19717..20112
                     /locus_tag="LDBPK_090080"
                     /codon_start=1
                     /product="RNA-binding protein 5, putative"
                     /protein_id="XP_003858687.1"
                     /db_xref="GeneID:13392019"
                     /db_xref="GOA:E9B9P4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9B9P4"
                     /translation="MSYPSPFTRNVYIASLPEDYSEKDLLDLFSPFGRVISCTVKYDK
                     ETGMCKGYGFVLFESEQDALNAVIALQGHSIRNTRVQVRLARPEASAKKMYPVMMQQQ
                     LMSACMPYQPVYVMYVPSPVYSPMPLVQG"
     gene            <22187..>25891
                     /locus_tag="LDBPK_090090"
                     /db_xref="GeneID:13392020"
     mRNA            <22187..>25891
                     /locus_tag="LDBPK_090090"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_003858640.1"
                     /db_xref="GeneID:13392020"
     CDS             22187..25891
                     /locus_tag="LDBPK_090090"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_003858688.1"
                     /db_xref="GeneID:13392020"
                     /db_xref="GOA:E9B9P5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9P5"
                     /translation="MPSEILQRLYEGLGFPRDLVTQYLTDLAQAAEVPTFSDVTELLD
                     EAGPFQSFLVCSCFELFNCMTWFSREKSDDKVSPEEGDAILENEIATIESLFSDSFLG
                     RKHFDDEDTNERELYFGFCTSYEKQLLVVVRFPDYYPTEPPAIYVQPLRRSSPESLPS
                     LVVAPSCTKDISAVDRRAIMDAAVQAINGFVGGGCLMVLISAIHGAVSSMKEVRPASS
                     TPPLDRDAAAKERSAVQQQRKAFLGALTGNRVANREDIEEAAEDEEDRFIQVSMPEKV
                     ELATVDAASASRETQRRDFLVSDAALDVTLKSSWEKLKTEGSLRKARDSLPAHSVRET
                     LRAALQKHNAVVIGGETGSGKTTQIPQFLYEFMCEEGHGSSANIVCTQPRRLAATSVA
                     LRVAEERDEAVGGTVGYSIRLENCVSKKTQITYCTTGIVLRRLQTDKYLGRVSHVVVD
                     EIHERGVDTDFLLILLRDLVRRRQDLKVVLMSATMDSELFARYFDGAPVISIAGRTFP
                     VKVMHLEQIIPEVNYTLEEGSPFEKISGDKETRRRNTRKNVLNLDLEDVEEDVEREKA
                     QHRLAQVVRASPKTLDTLARMNYDVVNYELIEYIVEYIDTKLRAPGAVLVFLPGMAEI
                     QRCLEQLKLNPRLAKSCLFYNLHSSLGSSEQQGVFRRPPAGKRKVILGTNIMETSITI
                     DDAVYVIDTGKAKENRYNARKSLSELVTVNISKANCRQRQGRAGRVQEGFCFRLFTEA
                     QFEAFDDHQLCEMHRVPLESLILQIYALHLGDEVEYLQKALTPPEERAIHSSVKVLTT
                     LGALTVEKRLTSLGQHLANLPLDVRVGKMIIHGALLQCIDPVLTMAACLATRSPFIAS
                     VDFRTEVENMRRAFAGETLSDQLSSWFAYNKWVSVLQQKGTAAARKVCEDYFLSPATL
                     KQIQSTKRQYERYLYEAGFLDSAPSSHMSPSKFIFPPFTTLDDRIFEAGGQHFNENST
                     STRCILACLVAGLYPNVAQMRMSRGSRSVGGGNCSRRHTVKFTTFDGSECLVHPSSVA
                     SKETSFASPLLVYVDKVKTSATFLREVSVVAPLHVILFGSGNLEYLAKYEELCVDEMT
                     AFKCRQEDATLLTHLKTQLDSALTQKINDPSKTWESISSVVVRAIVKLLKEDGGRAGG
                     LTIIDRRQPREPLTEPLVPEAAAVQPVVPENQPFKTSKSCFLCGETGHVSRYCPHNST
                     HHKGGPPARCFICGQWHFPQDCTLVKALKR"
     gene            <27282..>28019
                     /locus_tag="LDBPK_090100"
                     /db_xref="GeneID:13392021"
     mRNA            <27282..>28019
                     /locus_tag="LDBPK_090100"
                     /product="RNA-binding protein 5-like protein"
                     /transcript_id="XM_003858641.1"
                     /db_xref="GeneID:13392021"
     CDS             27282..28019
                     /locus_tag="LDBPK_090100"
                     /codon_start=1
                     /product="RNA-binding protein 5-like protein"
                     /protein_id="XP_003858689.1"
                     /db_xref="GeneID:13392021"
                     /db_xref="GOA:E9B9P6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9B9P6"
                     /translation="MMHPQPAAQFVNDDTLKQSRNVYVASLPLSFDDQQLQDLFSPYG
                     RIVSARIMRAKKSHASKGYGFVMFREVSSAEKAIEGLHGRVVDGSRIQVRRANADASM
                     TFSKVLHTPVCPRSTPSTQSNSTTSVLQYTIPDAPAQHVMYSAALPQAATGLYAAQPS
                     TSPYAIVAPRAYQSHNPTPVSINPSYGAVMNPHVLQEQNGGIGATYFSHVQSHQVPVQ
                     AVQQQQPVYVVLLPNGQHIVQPNQFSI"
     gene            <39073..>39972
                     /locus_tag="LDBPK_090110"
                     /db_xref="GeneID:13392022"
     mRNA            <39073..>39972
                     /locus_tag="LDBPK_090110"
                     /product="RNA-binding protein 5-like protein"
                     /transcript_id="XM_003858642.1"
                     /db_xref="GeneID:13392022"
     CDS             39073..39972
                     /locus_tag="LDBPK_090110"
                     /codon_start=1
                     /product="RNA-binding protein 5-like protein"
                     /protein_id="XP_003858690.1"
                     /db_xref="GeneID:13392022"
                     /db_xref="GOA:E9B9P7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9B9P7"
                     /translation="MTLNFDILAGNNVDWGFECLPTAPERSPAPALFTPFGVTAGTES
                     DLMMASALQAPAPRVMSGSLQAMTQSVPLSDYGENVSPMKNDSLNMSVQASDPAARAY
                     DSNLYVASLPEWFTDADLHELFKRFGPIVSAKVMCHKGTHHCKGYGFVLFQRTDDAAV
                     ARSEMIGHVVGGNKIQVRRARSAASAPLTEAASAVSGTFTESPGSTRASSSNVTPINY
                     AAHVVPAQQPSFNPLYPSTTALTPTYVLTNPSAPMQNATHTQPAMLVAIPNGRTMVQG
                     AGDVMYMVLASSAQQMQSTSAIY"
     gene            <52272..>54020
                     /locus_tag="LDBPK_090120"
                     /db_xref="GeneID:13392023"
     mRNA            <52272..>54020
                     /locus_tag="LDBPK_090120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858643.1"
                     /db_xref="GeneID:13392023"
     CDS             52272..54020
                     /locus_tag="LDBPK_090120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858691.1"
                     /db_xref="GeneID:13392023"
                     /db_xref="GOA:E9B9P8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9B9P8"
                     /translation="MFIVQVAADIFGNKLNFELGFPSRPSLQEITRVSESAFSTEIAN
                     TRPDNVPQHTFHISKIKVYDEDKSKWVDLLGEGQLTDYCQLYAFQPENPWHKETQKPI
                     PPATKPPTATTALSRSAAVSNTPSGSRAVASTSNALAPYTGGRSEPATLRRSYAAGAS
                     STALVPRSNADASPEEKLRVVFSEFDNKGTRMIDVDDFKQGFHNMGLDFSSATVEDLF
                     ERADLNHDHRISYTEFERFARLYPIMTDCLYFRSKAFWEEDQMRKEIQSEVEAAHKSE
                     ATLDHAQRSLENAEADVADAQSAVKAADDDLRDRTDRMRDLAKDMEEARKGKERVMRE
                     KKEREQDLGAIREREKDARKDLQDLARDSDKLDRRAAALVSDADAADDKVRQLQKALE
                     DAKRTADRAHQAAEQAALEADQAKERERDAAMEADAIAREIPKAEDAVRLADRNVVAA
                     DQVLRELDSAGKDIGRQADEAASRRDAGEKAVAEAREKVMQKVRELDAARNAVAEKDR
                     AIKQKEAELDEHRRQRELITQHERTLIEQELRLREQRDSLEQRETKLMSEASNYLGNM
                     RINLATRSYSRDPGGY"
     gene            <56463..>57128
                     /locus_tag="LDBPK_090130"
                     /db_xref="GeneID:13392024"
     mRNA            <56463..>57128
                     /locus_tag="LDBPK_090130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858644.1"
                     /db_xref="GeneID:13392024"
     CDS             56463..57128
                     /locus_tag="LDBPK_090130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858692.1"
                     /db_xref="GeneID:13392024"
                     /db_xref="UniProtKB/TrEMBL:E9B9P9"
                     /translation="MSALLSFPSRSSAAPLAMHRCRRTFTAAAAAATSLSASSSTSAD
                     GRPLVADAEAMERSGAAAMHSLYRRLLKAGEEGRMMQHCLTVNSLSDSLTYGLRLLRL
                     HRELTTVDATAQQTPWWRVAKRARQGLARRYYAWSLLSLRLQLRSRNAIADVLVYLLF
                     VTMCFLLYEIYRACRIGVNRAEERYRTLSIPIIQTLDALEAAQARKRELRKEMEKDIV
                     QGR"
     gene            <58193..>60328
                     /locus_tag="LDBPK_090140"
                     /db_xref="GeneID:13392025"
     mRNA            <58193..>60328
                     /locus_tag="LDBPK_090140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858645.1"
                     /db_xref="GeneID:13392025"
     CDS             58193..60328
                     /locus_tag="LDBPK_090140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858693.1"
                     /db_xref="GeneID:13392025"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q0"
                     /translation="MAEVRQQQSSRAVSNVVEYLQLAGRRYREHVELLRQEQAVRDAQ
                     HAPFKPNVSLYAERVGKSSLARQSSSIGARLHELHQKKLALLEEEAQEEAKRRAAAEA
                     QDCPFSPTVTPHAARSRRTGSDVAAALMQWGEQRRARQARAQVEAARDELSKVSAAPR
                     ITAYADEKARAERGGVSVEVSLTAEAEARRQRRHAAFEKAYPAASSSSGATSARRFSP
                     SISAYASRIEFEEDVVSRLYERHGSRGHLAPRDRLYDEEVALYCTFHPKLSARSTELS
                     RRYYEEEGEADTDPHERLFRNTHHASKYRKPAQLSVFTGQPEISDASRRIVEERRRQL
                     ALDGQPGALGLSPGSRLCPGTASFAAAQATKTSKKKVLSARDTEAQETVTFTPSVSPA
                     SEALWRQRVSALKASGVARNTEEARQLLWRKAEKRKEEEVLKLQDQRRRKEAAECTFR
                     PKAGRPPQRSSGYVAMPVEARAALWAQQRDRHLADLRTELSEITVEECTFRPHVDPVF
                     PLPRGDAKPAWGVEAFLERQAEARRQREEAEQWWRPKYARAPVARTSRVSRWRSPSSR
                     GASQPSTQRTVSASRRSAASSTASEAEDNKRKEEGVFEQHWARPPASTSLTASSFSRV
                     SQQEVPSAESSPAYVAPQQPNTLFPYTVDISPSGPYPWRPTTAAGASEAAAGEGGSRA
                     SAAFSWRKPLRYRPISATATASRGRSSAL"
     gene            <61264..>64518
                     /locus_tag="LDBPK_090150"
                     /db_xref="GeneID:13392065"
     mRNA            <61264..>64518
                     /locus_tag="LDBPK_090150"
                     /product="kinesin, putative"
                     /transcript_id="XM_003858646.1"
                     /db_xref="GeneID:13392065"
     CDS             61264..64518
                     /locus_tag="LDBPK_090150"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003858694.1"
                     /db_xref="GeneID:13392065"
                     /db_xref="GOA:E9B9Q1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q1"
                     /translation="MTERIMVAVRVRPFLPHENEASCLEVSENQVAVGAGRPFVFDCV
                     FDEKASSDDVYVALGQPLADSFLNGFHASTIAYGQTGSGKTFTMATLLHDTVQEVFCR
                     LTEDSEATQSNGRSSSALTSLSTTLRTSTAFTMSLSVLEVYNESIGDLLAALVPQPPR
                     QHTATVLNGTVLQALDTPRRLLAQGCGPLPNRRSLQRRAYGPTSSFPRNSLALREDPH
                     GGVYVAGLTEAPVRSEAEMLALIDSAIENRKTASTLKNPKSSRSHCVITLTLQRRGLC
                     SRCCFVDLAGIERLKSRGVAGPSGRPGGPASLVGASLPSCRTLSERMREGININSGLL
                     ALGNVIVALCERKPYVPYRSSKLTRLLQPMLSGNARTAIVACISQLASSMEETLNTLK
                     YADRAKRIHIHPHLAVAEVTTSVDARQTILLLREQLEDAQRRLVIATAAGAGTRNPAR
                     SPSASLMREVKHLRELLCQERQLTKRLENDVLSAKCIAMAEVEKRKALEVRVAQLEAA
                     SAADPKAKEAGCTEANADGDTGKSASPLLNLRSCLATDMTCLQQLEEEREALAAMPAQ
                     KVGDTVRLEATVVENGNCGADNLAATLTASADDDSNVVTLAEDIAAQKGRVAQLQMEN
                     GDASAQLVQREKLWCTLSSQAHPCGELSKAEAQLEKSEVALKRGKQEKEKLRAASGDH
                     LRRAREKSVDYRGRVKESARHVRARQADLESTRQLQEKLVELQAEVFRQRLCARKTRK
                     ASWKLNGAHQQEVEQFQKQLQLISTQTTSPSQRTKLRGAAIVKERSQLAGQQVQRSQQ
                     EVPSPVRLCHLPPEKTLSPMLSSSSAKVSPRSPALGKTSPHIVKARKNFHMSSSWSGF
                     HAHGLHSSIDGALQSSCAGDATQTTIKCELQGLEQIQKELAKLLVYRRALLTAQAVDT
                     SKWHRAKEGFARRLSQVRAALQSTEPGQRERTALLKEQSSMEEQLRQLQALHHMLADP
                     AQQLAELDSRIEDLNRAHRLYTQRFRQLQRSVPKPRGGGGVVSAREKHQPSVRHMRAA
                     SARYAAAGTSAPHTPVASTRGNNGNMRAYVTGSKQQVMHRAEESRSLRAQERHA"
     gene            <66591..>68165
                     /locus_tag="LDBPK_090160"
                     /db_xref="GeneID:13392066"
     mRNA            <66591..>68165
                     /locus_tag="LDBPK_090160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858647.1"
                     /db_xref="GeneID:13392066"
     CDS             66591..68165
                     /locus_tag="LDBPK_090160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858695.1"
                     /db_xref="GeneID:13392066"
                     /db_xref="GOA:E9B9Q2"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q2"
                     /translation="MSSHASPRHSKEDTPVQRSFADEAAAAADLFDLAAPPLQQPLVA
                     RLVPLYAGLPTLDLHQDSGNVVVGRGKDISEDYRIDVSDKLSARHCELAVHPVTLRVE
                     LRDLSTNGTFLNGRRVAKGERVVLQNGDRVALTRPAESDAGAGQAPSSAVDGIAANGR
                     VDYMFQRLKQETTRARMSAELTCSVCKSIFHRPCSVLPCMHVFCAGCISGWMAQGEQH
                     ACPKCRVSITDVRPTHRLQSCAENYLLANPASRRPAEELAQLDAADKIHPLGMRTGKR
                     SRSDNSDCDGDGKCGSHSDGGSDTVRAVRHAALVFGHAVPLAGPKCAECDTPSSIDGF
                     QCPAGGPHLRCSACRSCFAERPLCGRPQRCHVCHLAFCHLYRAGGCACTDGTSFQPFK
                     EHEPFSVLPPQTFSGNTIEQNILSHYLASHSILVKDVWSAALAKFEGGEWVPDMVLIN
                     GAIRADSPVCRRCAATVFAGLLFAYRRHLASDELPESVNKRPNCWYGKECRAQFHNEQ
                     HAQNYNHVCYQEKRKE"
     gap             69087..69185
                     /estimated_length=99
     gene            <69465..>69839
                     /locus_tag="LDBPK_090170"
                     /db_xref="GeneID:13392026"
     mRNA            <69465..>69839
                     /locus_tag="LDBPK_090170"
                     /product="microtubule associated protein-like protein"
                     /transcript_id="XM_003858648.1"
                     /db_xref="GeneID:13392026"
     CDS             69465..69839
                     /locus_tag="LDBPK_090170"
                     /codon_start=1
                     /product="microtubule associated protein-like protein"
                     /protein_id="XP_003858696.1"
                     /db_xref="GeneID:13392026"
                     /db_xref="GOA:E9B9Q3"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q3"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAHFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRRADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWN"
     gap             69865..70780
                     /estimated_length=916
     gene            <71060..>71464
                     /locus_tag="LDBPK_090180"
                     /db_xref="GeneID:13392067"
     mRNA            <71060..>71464
                     /locus_tag="LDBPK_090180"
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /transcript_id="XM_003858649.1"
                     /db_xref="GeneID:13392067"
     CDS             71060..71464
                     /locus_tag="LDBPK_090180"
                     /codon_start=1
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /protein_id="XP_003858697.1"
                     /db_xref="GeneID:13392067"
                     /db_xref="GOA:E9B9Q4"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q4"
                     /translation="MSAYVLSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAHFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRRADDGMLYV
                     AYTAERCMGAAVCTPCGSCAWDGSTADDDVII"
     gene            <72520..>72552
                     /locus_tag="LDBPK_090190"
                     /db_xref="GeneID:13392027"
     mRNA            <72520..>72552
                     /locus_tag="LDBPK_090190"
                     /product="microtubule associated protein-like protein"
                     /transcript_id="XM_003858650.1"
                     /db_xref="GeneID:13392027"
     CDS             72520..>72552
                     /locus_tag="LDBPK_090190"
                     /codon_start=1
                     /product="microtubule associated protein-like protein"
                     /protein_id="XP_003858698.1"
                     /db_xref="GeneID:13392027"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q5"
                     /translation="MSAYVLSTPLE"
     gap             72554..72572
                     /estimated_length=19
     gene            <74109..>74477
                     /locus_tag="LDBPK_090200"
                     /db_xref="GeneID:13392028"
     mRNA            <74109..>74477
                     /locus_tag="LDBPK_090200"
                     /product="microtubule associated protein-like protein"
                     /transcript_id="XM_003858651.1"
                     /db_xref="GeneID:13392028"
     CDS             74109..74477
                     /locus_tag="LDBPK_090200"
                     /codon_start=1
                     /product="microtubule associated protein-like protein"
                     /protein_id="XP_003858699.1"
                     /db_xref="GeneID:13392028"
                     /db_xref="GOA:E9B9Q6"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q6"
                     /translation="MSAYVFSTPLEARVAKCASLRAANAVPVVVEEAQARGGKAHFSA
                     LARETTVAQLVAAVRGFRGVDAKKPVALTVAGCSVSPSATLGELHDACRRADDGMLYV
                     AYTAERCMGAAVCTPCGSCA"
     gene            <75510..>75872
                     /locus_tag="LDBPK_090210"
                     /db_xref="GeneID:13392029"
     mRNA            <75510..>75872
                     /locus_tag="LDBPK_090210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858652.1"
                     /db_xref="GeneID:13392029"
     CDS             75510..75872
                     /locus_tag="LDBPK_090210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858700.1"
                     /db_xref="GeneID:13392029"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q7"
                     /translation="MSKHFAGRKDAERTTGLAYLLSPSRVQSPGELRFRRHGYVRCGF
                     VIGMLLYFVYCNPEYSYTYTALRQRCGWDMKESMFPQYLTLQPSRIPRPSTAGEQQPS
                     PQSSSPLRSSAAGTEENG"
     gene            <77072..>78583
                     /locus_tag="LDBPK_090220"
                     /db_xref="GeneID:13392030"
     mRNA            <77072..>78583
                     /locus_tag="LDBPK_090220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858653.1"
                     /db_xref="GeneID:13392030"
     CDS             77072..78583
                     /locus_tag="LDBPK_090220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858701.1"
                     /db_xref="GeneID:13392030"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q8"
                     /translation="MCILAFITRHCERFPFILIGNRDEELARVTGGLTLDTSTGLVWA
                     LDRRAGGSWMGIEPRSGRFAILTNCRRSPAAPLTCSAKARDAGQCGGSERGEPAQRAG
                     LFTAAAVWRGAAPLSHICAHTTVVPVTALPTVLATAKTAAEDSRCPQHSKQLRTVTLA
                     YDPPTSRGLVIKNFLQTGILPGDTAQTPMGCTRSEDADASLGKDDALVAALPAVLRVP
                     PYYAGFNLLSCDDLRRCGVDAVASEHGRHESGNTSAAAPEILYTTNRYTAEHRCPVAP
                     GQVHCLQNSYLDNMHGEPITARLGQLFTDALHRVIDPIAAEQPPSSTSGITPAMVTEV
                     ATALADECLCDRCSFDLPKMEKTAFSAAAAAALHAQLHSNNPLLGFTEKELHEYFGNS
                     AAGDEDDVSVRFCDGGAATREAYLQSSIFKLPFRGYGTQMQSMVLVERVAAVPSTLSN
                     VVSSASATTVIHFCQRKVSFDVATQSVVAAPWIAYRILQDGSCLRDSAEIPAP"
     gene            <79085..>80002
                     /locus_tag="LDBPK_090230"
                     /db_xref="GeneID:13392031"
     mRNA            <79085..>80002
                     /locus_tag="LDBPK_090230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858654.1"
                     /db_xref="GeneID:13392031"
     CDS             79085..80002
                     /locus_tag="LDBPK_090230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858702.1"
                     /db_xref="GeneID:13392031"
                     /db_xref="InterPro:IPR029358"
                     /db_xref="UniProtKB/TrEMBL:E9B9Q9"
                     /translation="MFSPPVYISVGDEYDKREVIAKATGQPPFVVSAKRNPHITDATF
                     DPFVSLSNGDPYTSVGFAGPFRANTSAGGKTEHGSSAAAPPPFRPVGASKKSSGKGDY
                     YGTFSEKAPIRHETEFPPIKTAADYKAETAAAKCNFIVNPPKKGTYGYTGLTIGQAGE
                     VQYVADPYEGSMRREALQRKYEATKRIGSPFRSAVRSGGCFDESKHGVSRVYGLTKPL
                     PPKRNPSSQQAIASAAAGRKPWVPGGALVPDLLKQPEYQEDPYDVKEQKVRAMRQKES
                     TYKPWIPAGNDPYRYIYTKPINYDPPAVV"
     gap             81379..81469
                     /estimated_length=91
     gene            <82337..>84685
                     /locus_tag="LDBPK_090240"
                     /db_xref="GeneID:13392032"
     mRNA            <82337..>84685
                     /locus_tag="LDBPK_090240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858655.1"
                     /db_xref="GeneID:13392032"
     CDS             82337..84685
                     /locus_tag="LDBPK_090240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858703.1"
                     /db_xref="GeneID:13392032"
                     /db_xref="UniProtKB/TrEMBL:E9B9R0"
                     /translation="MLSLLLELLVSIALCVALAYFTFLNVPVEAEEPGSTATASAGDG
                     VSAMVGAAPSGALPGTGSDGAEYGHAYDPLLLLPHELPLYTSITRYVSLAEDTTLGIA
                     YRWLLINGLHYSPREVYGERRLREWGYCYSSSVGGPSGGKDVDVALSGAGMRVSDRPS
                     SAVAASLSSAGSAMAASLDSSRCSRRRLRRGAAAAAAAPPTPLRRESAHWVNVLIRCA
                     AFLCLGGGTVKPEVWTDHLLYGAEKVLESVNVGYENRMRARAAQAHAVAAQLASAAHP
                     SPPPHRASSQSAAPLLTAPRKPLLRIQLLELGSGLLGGTLRDVRRPPLSLHHGASDAS
                     GSSATPARATPPARRAATAAAAGSPGMAPSAAGFAHHHHHSNSSVSSDHRQQISSHAA
                     LYAPSSLLSSSVAGLSTAITDAVSSVTTRGTDSAHLSDPVAGAPVADYAGSCPLFTGG
                     GGGASSAGAQLGVVLPRVEGDVISVEQAYSEGCHMRPPTPAASNSTPARALSAAASAS
                     PLPRASAAFQLRCFAVPLLYEDQRFHVRLGCCLPLGALLPVSLCVPPDVLTLNCAVAV
                     HRVTFTGHLYAAFHGARVELSFPTAPLFTAVVKVMPDTSDASSGSGSVAEVSHHGGWG
                     MRAAGGGGVHSGAAAAAATTAFTATYTQRNEATVVGGSSIDGGRDSYNAAARPPLPPR
                     SGLYSSGSNASLNHHHRSGMSGGGGTSASGSCLNEHNEKVQEVVLLAVRRLIESLTYP
                     KVLVGELVCRRPSGAGGTAEGGAEMQLQLRWTRQTASLPLCM"
     gene            <85523..>89404
                     /locus_tag="LDBPK_090250"
                     /db_xref="GeneID:13392033"
     mRNA            <85523..>89404
                     /locus_tag="LDBPK_090250"
                     /product="kinesin, putative"
                     /transcript_id="XM_003858656.1"
                     /db_xref="GeneID:13392033"
     CDS             85523..89404
                     /locus_tag="LDBPK_090250"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003858704.1"
                     /db_xref="GeneID:13392033"
                     /db_xref="GOA:E9B9R1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9B9R1"
                     /translation="MKVFCRFAPPPAAVPGVDAPAGGHCRIPREPAEAVLLMRAEGPS
                     SAATRTTAASPMATGARVYLADPTTFSKATFSCDGVFLPSTPTAATPAAMAAQQQHLY
                     DVTCKSLLVPAPRPLERQRRWCSSSPVPTAARRIYLAYGQTASGKTYSLFGETSTSSG
                     VEGLSPAAGVVPRYLHDVFSRRNGAVQRRRLCGTGRGSGDGAADDVFVDLSCFEVYNE
                     AATDLVALSVALSTIDFTCSTGAAGLARGSVDRRLSSKTPTDAAAGVTPSVRSSDLRR
                     QLPVWMAHELYRSEQQPDGADAYTQEDLWGTRSESSASVETGCAATAGAAAAPFALSP
                     TLSRFLKTEYKATEKQQVLRSLERARCTTFAEAQAVLQALLALRQECATRRNQSSSRG
                     HLVLCVRVYAPAARDHPAGEWIMQHETAFVDLAGSESGKLADADVADVHASKVESHQP
                     RRRGQAATGAASSSRASSLHSRVSLDTSMQSGVSSQHSGISSGTTTVSSVYHRSLLRP
                     SPEEDKRAARVRRRRETRSINASLLALRKVFRALYEATRLSHTAVAQGSAAAAAATKL
                     PRRPPLHHAPFKDSALTAILEPFLVPQPSAATPSSSTSPSEPEGAAAVQVVLLVCCSS
                     RSVDFFETVASLRLGAEAAAVKPEVVLRALPVQQRAQQHQLHLKPHYNSAGRRHREGS
                     GCAACLPPRLCRSASAPSRRLALSGDEDEQGEVDDLSECTTAPGIRAVSSERHDGCRP
                     GEVVMSAADAARLCDEARQYKKTAQQLYKQCKSLCESYDACVDELQWCRAALSERDTR
                     VAELEAALEKATRACAADSSRQPQQPLPEPVQPRTPKASRNSIAAHGSPAARTPHPLR
                     LQRSSREAAADESCEVIPAVNDGGKLEVNPDPVPSATASVTAGSMRATSTNSTAREGS
                     GRWMVSVSPFSTASLAEGTAARMATVREDVENVKDVVDDADSSGNSIRRQSCGSTVER
                     QQQHARCIIDTLLARQIFPSDEPGEPTQSLSPPCASSPYPVLPTLSARGIAASASSPA
                     QEQRRARSHSSCQDSDSDACVAQGCESDSDGSPLTAEADAAAGEPARAKEVAEASVAV
                     AATSASMSAPRQSYNTARSSSAGATASSLLEGRGSVSVGRSSCDSVAEGPEAELMAFL
                     SSAATAVQGVILPVASASAVLATATWSKDLGVSVSHTVPYDSPLRATTRRMIAMSMDR
                     NREVPHAVSAVGGDEEDAVEEVVIRLKKQGHSGALHIPAATCQSTETVGHVEVNGRAA
                     SKPPCHSPSLGAVSSVPATPSALPLGQVCQL"
     gene            <90297..>91007
                     /locus_tag="LDBPK_090260"
                     /db_xref="GeneID:13392068"
     mRNA            <90297..>91007
                     /locus_tag="LDBPK_090260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858657.1"
                     /db_xref="GeneID:13392068"
     CDS             90297..91007
                     /locus_tag="LDBPK_090260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858705.1"
                     /db_xref="GeneID:13392068"
                     /db_xref="UniProtKB/TrEMBL:E9B9R2"
                     /translation="MTLVFEARRLPFGSISEAYAAPIQPIVALHALDELPLWDRCMLV
                     AVLPVVQQRHSAGAAAAPPSTVAQPPLTGSSGDNADAAAAASWSSATIRAANHEERVN
                     ASPELAGAPSLEDVTLALTIVRALDELEVVYDSSISTRAELEQQQQQPSLHAASLAEA
                     PRRAFKQPKKTSEELLMEQLLQERLADTAPYLLESSDEDGEKSAEAAVDVAMCFTVKG
                     ESLGIGTANIFGGHGYHP"
     gene            <93061..>94497
                     /locus_tag="LDBPK_090270"
                     /db_xref="GeneID:13392069"
     mRNA            <93061..>94497
                     /locus_tag="LDBPK_090270"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858658.1"
                     /db_xref="GeneID:13392069"
     CDS             93061..94497
                     /locus_tag="LDBPK_090270"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858706.1"
                     /db_xref="GeneID:13392069"
                     /db_xref="GOA:E9B9R3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9B9R3"
                     /translation="MGTSGFSRLRSLTPTPYPGTQGSPYRRHRFVGVNLPGAPPPSID
                     FSSIQRTVKEVYEVHEKLSEGTYGEVFKGVDKRTGAAVALKRIKMLSTHQGFPQTSLR
                     EVIALRHIQNQRERLEERLRNDAHHRGAVAITDPLAEVSQLCDVLLYDRQQRDIVLVF
                     AYATASLAGLCRRQFAFTPSEMALLMKKLLIAVRKLHEMRIIHRDIKSDNVLVTSEGE
                     VQLTDFGLCSIAAPGSSRCGTHVWRTPSVITLAYRPPEMLLGSTAYDEKVDVWSLGCL
                     LAQMFLLEPPFYRHRAQAQQQQQRAPERSAATELEQLSRITEILGPLPPVSVYHPDSC
                     QHMRVLEQLEVQGRLAEAGRAAQPANWGRLQTIFEPSFLYQQFHGFRGWFEAELGRSR
                     HQPHRRPTQACMDVLCAALQLDPQQRPTAAELLRMPYFTTLDDAPLLGSYQRVLPVTP
                     EREAEVRRGFMTKVQRCGDSHTQRRPHQ"
     gene            <95989..>98748
                     /locus_tag="LDBPK_090280"
                     /db_xref="GeneID:13392070"
     mRNA            <95989..>98748
                     /locus_tag="LDBPK_090280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858659.1"
                     /db_xref="GeneID:13392070"
     CDS             95989..98748
                     /locus_tag="LDBPK_090280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858707.1"
                     /db_xref="GeneID:13392070"
                     /db_xref="InterPro:IPR006189"
                     /db_xref="UniProtKB/TrEMBL:E9B9R4"
                     /translation="MVVTRHHAPTQQEPRASMLTGAGAYGGGGGALSGNHEGHGASAQ
                     EMVVVSPNSQEVAELPSECASRQGHCSVVLPYRQPSPETQRFIATWQGALPKNFYIIT
                     ACVLGCALTIFIGILVPMLVIRRSANIHNAVVRAKEYDAVSAWASVLRDVMIEGFAAT
                     RALAGYSISTFPPLQTPTNASDSIPSDKITAYLKRFPRFASLIASKKPAVAIQAICPG
                     GVIAMTHPHDPDTVGRDLMSPSDPTNRYKPSTRETAQSGRYAIVGPRRTTIASLKQIW
                     VIFTRAPLYRNTSKGVIPSQETFWGFVLLVVNVTGALDVMDLDKLAKDHNLDYVLYDT
                     STESGDTHVIASSLPSGAMQPDYEEFVAESTVTDVLAPHSSLYIAVRSRETYVSLTPT
                     NIILIVVWTLFGSLLLLGISIAAVLWCTATYDAAAHAPKMAPFAMLTIGPCRGEELWD
                     LATDQMAEVTEKLDQVLVRQMERHRAYQIQQVHPLTTSYVTRSVAAAVQMAFSTIEEL
                     QRHPIDGPLRAVLGDEVRLLLCYAVHWCTDAAVRVESLEGTYRYEGCDVVFGGRMWAF
                     AAPSVVTASEAVVQTLPCFGLSGVVTRAYQTVDVMRTTRASYTDGSEAGSSDASSTIG
                     GGGSATLYLLVHAAKQDLVAGAEATAAAAAAGAMVPQLMVGNAPAPSLYCGLITRGNS
                     PSLEAGRASVPSLQDVSARSPEIESSASSAWSSAASTKGSSRATNASQRRGRAAAERS
                     ARTRNPLSRGYLDTEQQALVRKQALAKHNAASTPEQHRLVLIEADAVTRALLQPLIPR
                     ALDVALRVAFDYQSITLDVRYAEVRVLVYYFYSSYKILFRPLAAPERHNIFRRLVTAF
                     GVPQQGILEHLAARGAVQWLSQVRKINGFMHRQGSLECSSQTESSSVTPSPCNSLPGA
                     QRLRL"
     gene            <101296..>103848
                     /locus_tag="LDBPK_090290"
                     /db_xref="GeneID:13392071"
     mRNA            <101296..>103848
                     /locus_tag="LDBPK_090290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858660.1"
                     /db_xref="GeneID:13392071"
     CDS             101296..103848
                     /locus_tag="LDBPK_090290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858708.1"
                     /db_xref="GeneID:13392071"
                     /db_xref="InterPro:IPR006189"
                     /db_xref="UniProtKB/TrEMBL:E9B9R5"
                     /translation="MMIDDAVHQRVVRPRLPPLRVQTRRYIGIVAFVACLLLIFVGIF
                     SPLIVLRNMDKSYEAEMRYIEYTLANKAVAPYRVVMVEAFAISQALEGYVMSRMLVMP
                     NLSAPPLERIQGQNFTNFDDIGATLRRNTTMIAMTALQPGGVYAFFSPRNATKYGRDT
                     LDPNDNAQNFKPTPFETILSGRAVYVGPFRSTSDVLRGHWGLAIRRPIYNRTSYESAD
                     IRTFWGFAFTLVNISGLIDKNPFAFTSLSKKRDVDYLLSVHNETSGVITVLATSLKQP
                     TATQLADFVRLGTSVGITPNHPFLLTIRGRDYGSNLSPANIIIVVSTVLSGLLAIFAA
                     VIAAVLWCTATYDAAAHAPKMAPFAMLTIGPCRGEELWDLATDQMAEVTEKLDQVLVR
                     QMERHRAYQIQQVHPLTTSYVTRSVAAAVQMAFSTIEELQRHPIDGPLRAVLGDEVRL
                     LLCYAVHWCTDAAVRVESLEGTYRYEGCDVVFGGRMWAFAAPSVVTASEAVVQTLPCF
                     GLRSIDTRPRCVVNVVRSRTLCGATGGKELGGKSATIYVPHSPPTTVQATAGVRRGRA
                     VSSTAAPLESSSDTEDTQSLPPQQLFTLLDTRRPALMAAEAAATHDADSVSSASCPSD
                     SAAIPAMDLPAGERAVLPVSPSSAADGSSANNAEMATAAHTSARSDAPTENEGNELLS
                     ASSPSVAPPLSHASSSFDIGVSNGATTAVQLSSLAFQGDAVTRALLQPLIPRALDVAL
                     RVAFDYQSITLDVRYAEVRVLVYYFYSSYKILFRPLAAPERHNIFRRLVTAFGVPQQG
                     ILEHLAARCVIRHVQQRLKSLQFAPQHPHLRAAPRETPLTLNAYAKLGRATR"
     gene            <106157..>109138
                     /locus_tag="LDBPK_090300"
                     /db_xref="GeneID:13392072"
     mRNA            <106157..>109138
                     /locus_tag="LDBPK_090300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858661.1"
                     /db_xref="GeneID:13392072"
     CDS             106157..109138
                     /locus_tag="LDBPK_090300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858709.1"
                     /db_xref="GeneID:13392072"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9B9R6"
                     /translation="MAYATTFRDAILGAISAVYGVEGYIMGLMKSLPNLNETPAQRVA
                     GQYFPKFYGYAELVSSSSPHISLFATAPGGVVLQVYPSEDEKFMENWDLLNSSCENHT
                     DPAAAYREDPFTTIKNGLLALTGPYKSPGLPIRGWDSSSGEAHNMWWVDLRQPIYNAT
                     STALITNSTFWGFAIVFFSVDGLIRKKGLPEKMNSLEMAYIIYTASINGSDGCTVILA
                     SSMFKGETDCSKPFMKKFLDDATTRDVLKEKLSWKIALKSMKRVNRFTPRVRNAIVIT
                     SVIGVSLLFALFMYVIVRCTRVYDGAKHAPKMAPFAMLTIGPCRGEELWDLASDQMVE
                     VTERLGHVLARQMVRYHAYQIQQVHPLTTSYVTRSVAAAVQMAFSTIEELYSFPIDEP
                     LRRLLGDEGSLLLCYAVHWCTDAAVRMEAIGGGLRYEGPDVVYGGRMWVFAGPNVVTV
                     SQAALPSTTCMPHVKSKLFDSVFLRGVTTRQDLYVVTDTSNHSLKEAEAFAADQLRRS
                     RQAQLRYVADKEADLGSTGYTRCDRLLTSYPRTGYDSSDLDSSFFAREASAYSEGATS
                     GSGNDSNPISVVNSSGGGQVASGAARRGARKDGVAGVSGVPTAIVVPASTPDNALVVA
                     GADVSESASTLSRAVPQRRMGCRPPRDLAAANVVSGSSRSSSSAASVGSEKEETSPGE
                     PPTPLLQPVSPEVSVTAATGTVRPRRGQDNAHTAPGATASGSNSIGFRDSCSGIPATS
                     SVRHHDLLLTNPLVVVPPAVTVDATAHGLCGGGGSASTTPISGESTGGRHSNFPTCGD
                     NPLAHGTTAAAAAKVDALSGGITGLASNGGRGAVGGTPAACRPGNSEGNAALQGSGPA
                     LDNFSDLLLRPAISTQSDLLLRAVFDRQAVALDLSYDSVRVLVYYFYSSYKILFRPLA
                     APELHNIYRRLMTAFGVPQQGILEHLAARCATRFLQRHEETQTLLWDQQHRLQMHIRS
                     ASATAATATSVSDDGVTSTSG"
     gene            <110430..>111185
                     /locus_tag="LDBPK_090310"
                     /db_xref="GeneID:13392073"
     mRNA            <110430..>111185
                     /locus_tag="LDBPK_090310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858662.1"
                     /db_xref="GeneID:13392073"
     CDS             110430..111185
                     /locus_tag="LDBPK_090310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858710.1"
                     /db_xref="GeneID:13392073"
                     /db_xref="UniProtKB/TrEMBL:E9B9R7"
                     /translation="MVRVGAKRERPCILVLHVALRAAQQPAREGPQRGREGGTSLSTS
                     PRERFIWKTSATAEVYAKAVLRSIRAYWQLLGGVRYAGSDALTLISAVWQDIDDAALG
                     ATAAAQAGGIVEGDSPSASPLASTITTGVKRSKQQQQRRRQRMRATRRRSGVLRCAVH
                     LSRSVYGDAGAAHVLRASCACVTEATVEVPVSQLVADDGSATVAADASNDDRRKRRRR
                     RTEEDVEDVMPQTCHAAVHVTRVENVLPSRQRR"
     gene            <111975..>114602
                     /locus_tag="LDBPK_090320"
                     /db_xref="GeneID:13392074"
     mRNA            <111975..>114602
                     /locus_tag="LDBPK_090320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858663.1"
                     /db_xref="GeneID:13392074"
     CDS             111975..114602
                     /locus_tag="LDBPK_090320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858711.1"
                     /db_xref="GeneID:13392074"
                     /db_xref="GOA:E9B9R8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B9R8"
                     /translation="MKSLAREFRELEATSQLPPSTPQQCLTPSTVLLPAAVGTVPPQL
                     SPFVASTAAALSPQASIQMRMAPLLGLSSFPRSPLHNGSTTLQTTNDGCPDARADRVG
                     SRSCSVINLFDWPSPPTPSVALRIGGGSRDSDPSGTTHAHAAPASRSADEDSALGPLT
                     SSSSTATTRLSQGTPENSFMMNTTSAHQSNAEEATSATATANRTGSGSWRRSRSDARS
                     DRDQRCSTTPPYPQVQAHHQQPLPACDASLAWVSTLACDPSGLSTLGVGGAASQPGPV
                     HHYAPPFPSFAEGVCALYPLTSVMEPTAPAPATAPSIPSRAASREQVNSGPPSMAAKH
                     ETLHQAPGQPQTPLSTTTVTASPMSPTTAPVQLSLQEKLLISAPLPPRSGRGTPSSTP
                     RVAPSPPQRRCSSATNPFISTVGVKPNAGKSRRGSSTTTAAAAAAMAAAFTSSQLAPS
                     PAAPATATPPSPPPCMRLRSTGNGTIAYSNPNSTSVCSILSTVAFVPIAVQPAIPSAS
                     PSFLATSPCQSPANAAVSASDSGTFISGVAAASAPPTFDRRLSAASAVPYTPSVPKMA
                     ALEQPGQASAGPRASATPPLQRNPAFPTAQPVQNPAHWSVPCTPAVPMKVFLAAPEMG
                     WHSLTGGVTTPPASSVGVAIPDPCSQNFFVGCGVRGTGASILDGCSSTASIAAPLATS
                     PASSAALDSQRTSGSRGATWTSAGQTYRNVLVYGGGGTSGHGSGCATAVTASGNSHSL
                     GLPLYSSQPQLLCTPVPLDDTESVCAICLEGRVSKTRTTETRETTALPSAPLQLPHAA
                     EEGASQERDSAAAVMSDTMPADEGAERGAVRGVKPGSCLLSLPCGHCYHQNCVQRWLM
                     ESQSCPTCRRDLTRDATIN"
     gene            <115835..>118633
                     /locus_tag="LDBPK_090330"
                     /db_xref="GeneID:13392075"
     mRNA            <115835..>118633
                     /locus_tag="LDBPK_090330"
                     /product="DNA photolyase, putative"
                     /transcript_id="XM_003858664.1"
                     /db_xref="GeneID:13392075"
     CDS             115835..118633
                     /locus_tag="LDBPK_090330"
                     /codon_start=1
                     /product="DNA photolyase, putative"
                     /protein_id="XP_003858712.1"
                     /db_xref="GeneID:13392075"
                     /db_xref="GOA:E9B9R9"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:E9B9R9"
                     /translation="MRQVETDSEFLAAAQGLTPPLSDSPVGEVNQSAATAEDGSHGGC
                     MLASKPPWGSPAPPLALPEDAAELATDLAQEVGALYTDAGVTSARCWEQAEQEMEADS
                     GRRDDGVEFGDDAERDEQLLASLKGRHVRLQNTPDVVMAPLIIPDRNGRVAADAQPLL
                     HCRGGESEASALEVAPRITARLLHRHSHLAEQDRLYLGPCTAPEAQLRPPDVMRAAPP
                     SAGTQRHGCCVLVVFSSTDLRVHDNQLLAFASVCARAAAAEAGSPVPVIGVCVLDYRT
                     FAQPSTVGGFFRQSPQRAQFLLDTVAALRRKLEDTLHVPLLVRCGRPEEHVPRLAVEL
                     GAMDVLMTTQYAPHERRVQALMVRRLRAGTWVSREEVSDEAVVAGAVGQGASATPVGA
                     QCGSAAEEDDPLIAVVEHASCGVGGQHPYHCGSSLPLHCRAAAAPPMVHSVWQSTLVH
                     LDDLPTPLTVMKEGERWYHDDVTVSTIRPTEPYDKATALLAELPLTWQAAALLPTEDE
                     RYGRAGPSVLRGALPRLEDLGYSAAAARGTDFAFQEVIATQSSHPDAGEDAALARLQN
                     WLAQGGVTSLLRYGRERRTNTKMYSQKLARVSPYIALGALSPRKYYEVLREFAQENQR
                     DAFVQQQFREGLLRLSRRDYWHWMGLRFGDRLFFSYGPHPEHTDDVPEWRHDRKVVQR
                     WCDGLTGIPFADAAMRELVGTGFVAQEGRQALAWLLTRGYGQDWRVGAEWMERCSLDY
                     DPFVCYGNYAYSCGLMLDDFGEPVRNVYYLAHQHDQTGIYVKKWLPQLSKVPPVYIHR
                     PHVLTERMQAMHGVYLGKNYPYPLKLWQGAQRSLSAAELTAYYPQGIVQGPGYAEALR
                     YGSAVMQPEEYNAAVSPAYLQRQEWATMLPASAFAGIEDSDEMAKHFSLLEAAAPRKS
                     APPAAVVAGGSTLKRVVA"
     gene            <119344..>119976
                     /locus_tag="LDBPK_090340"
                     /db_xref="GeneID:13392076"
     mRNA            <119344..>119976
                     /locus_tag="LDBPK_090340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858665.1"
                     /db_xref="GeneID:13392076"
     CDS             119344..119976
                     /locus_tag="LDBPK_090340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858713.1"
                     /db_xref="GeneID:13392076"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9B9S0"
                     /translation="MSTTAPATSMGPLPYPNALQSRHTTTEQRQIAAAAVRAYQSTLE
                     QEKVLLQENDALLSEEEAGRLQRRVDNQAAADATAAQFRDRACKVVASVPGEQYRSEG
                     GAIDIFHAACDGDVAALDACLRSASNIDALGQPDPARYNGFQFKQRWLFRAPPLVFAA
                     AFGREEAVRFLLEHGANPHVASTTGLRAQDYAAQRGYSAIVLMLTSGAPQ"
     gene            <121194..>121457
                     /locus_tag="LDBPK_090350"
                     /db_xref="GeneID:13392077"
     mRNA            <121194..>121457
                     /locus_tag="LDBPK_090350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858666.1"
                     /db_xref="GeneID:13392077"
     CDS             121194..121457
                     /locus_tag="LDBPK_090350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858714.1"
                     /db_xref="GeneID:13392077"
                     /db_xref="UniProtKB/TrEMBL:E9B9S1"
                     /translation="MEGNFYVSDVVIDRELKSKYGMAYRKCPNESKRYGQCVEAGQIN
                     RSLQRDSCAEERHALRACVATHLRNIAIGSRASCAANSGTQSQ"
     gene            <122891..>123418
                     /locus_tag="LDBPK_090360"
                     /db_xref="GeneID:13392078"
     mRNA            <122891..>123418
                     /locus_tag="LDBPK_090360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858667.1"
                     /db_xref="GeneID:13392078"
     CDS             122891..123418
                     /locus_tag="LDBPK_090360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858715.1"
                     /db_xref="GeneID:13392078"
                     /db_xref="UniProtKB/TrEMBL:E9B9S2"
                     /translation="MAFPKTLKSGRPAQQNTISQQLFYANPVNVADVARQQQRDREYT
                     QQMRELHAKRGSADRRFFQRMTDYRDIQDGDPYASVFGESGGTQRLRTAAWQRQFEKE
                     NEDVELPYERTNVLARLAPNRFVRYFVNLRDKGGADHLYFLWACALIVVSLLWVVGYL
                     FYTAPSRARPTSEIR"
     gene            <124087..>125475
                     /locus_tag="LDBPK_090370"
                     /db_xref="GeneID:13392034"
     mRNA            <124087..>125475
                     /locus_tag="LDBPK_090370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858668.1"
                     /db_xref="GeneID:13392034"
     CDS             124087..125475
                     /locus_tag="LDBPK_090370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858716.1"
                     /db_xref="GeneID:13392034"
                     /db_xref="UniProtKB/TrEMBL:E9B9S3"
                     /translation="MPAAYALAKECQLLRGDIEGVLSLAAQLLLHTTAAASSSANGPP
                     TAPASSSAPATSFLGPVVGSILTDAHVRSLLLNTLVRVLVPARRQKALLDDNKYVQAA
                     NMVALQQQSTNDARPANSVNRAADVSQRYRVGRVVGVVPKPGPMAAEASHGKSASATC
                     GGLAAAAADEGQRWLLAVYVGECVEPFAVSAIAEDIFTEAEHRVFVQSALSTNREDGS
                     RRASVLPSQQPALLSAETAATVQQSIKDIRVALQLMQAADKTVSVAGMEAATATLIQR
                     ASGLKRPHAASDDDGDINSHKRRTGAASIGEDSDGLGTYFGNGASSQAVRMARLSEDL
                     AARGAQLQQLRQLLQQKDQEVKAALQQQQQQEARHRSEIDVWRAKVEEQSRTRERVAK
                     ESRESLEQRDRLLEEANTKLRRLAGMATKYKQVVDAVAALLKRNGGGEASDGTVMTPE
                     DILIALQGKKCL"
     gene            <127383..>133283
                     /locus_tag="LDBPK_090440"
                     /db_xref="GeneID:13392035"
     mRNA            <127383..>133283
                     /locus_tag="LDBPK_090440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858669.1"
                     /db_xref="GeneID:13392035"
     CDS             127383..133283
                     /locus_tag="LDBPK_090440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858717.1"
                     /db_xref="GeneID:13392035"
                     /db_xref="UniProtKB/TrEMBL:E9B9S4"
                     /translation="MPASPSEAHTTLQSTMAAEGGSDAVSSSPLDHSASVAAAALAGN
                     SAHCASNASIAVFLFAKEKLLFRYPDTDPFVVNVAAQGPSSASSSSAATGGSAAAAAA
                     AAAAAAADASSKKASGESNASSAPSAAHAAPSQRDRQRGRGPYAEQTKRGGGGGNNSS
                     GGTHVDPDDVSNTQTPTSSMNGGGGSRLKKSPHVHVTMAVDVKDSHQYHGTGGAHPPG
                     GAAPDSNAPVSSSSGVAPQRGMRRPASSYSLVSDHVSSSGGSFGHGHCAVSTGGGGTA
                     AAEGRRGLTTRGQLGNSPGSMIQVQHTSTGSTRRQLSGAAAAAASSISGSSNTRKSSN
                     VSAGAAAGSGGGPASGGGRNGAPQQPQQQVATTGSATCVGIAPNVLMHLLRGALCGTT
                     TINMVNCTFLVFPLSIGAAAPNTFSGRDGTAGSSSGSFAPLDRLRLPHRSGTALLVVA
                     MKEPDTDTGAIANFTQCFVNILCREEHRCQYVSTELERMEMLTNHWEVGGAAALASAA
                     AAAAEKRRPHGEEAHQQPLMAGGAGEPSGAGGSAISTSASVSPARDRRHRAASPRGGD
                     ADMSAGSSGDYDYLFSASRPAVRHKLVPGVASGTASEKTVLTSRGDRGAASGARTSLH
                     PAYNQQHHLHRSRESSPSAASQGSMAGPLLEWADPDDDADGDDGAYREDGRDADHAFS
                     RTASPSTGKGGEHSSSRRGCLSPAATAPSALTTSASSRSLYQQLAVHVQLAYEVLRVA
                     QCIDVWNRTMRGGCSAGNGAGGGALEGGLWGSRTSCMTGCGRGAAGALREPRRRPSIA
                     AGCAQQQQQITFASAGASLDTLPEALLINHMLLLPMSHLTGAERQEETNSLRSASSRI
                     HPCSVLTVEADQFTEQLQHRYLDMMGRRYAKLIPLSTVYALLQALPSPRRAGSFYRSL
                     ELAFLEAVQRRHVRAAAAAAAAANNTSITSVSGGLDVGVAATSVSQADLRGSRDIIDE
                     DPNALHTSAAAATAATTAAGLDFLAMEIIDFLRVNGAISVASEMHVCFTHGEVTPVAF
                     LDAAVARRRRHRLKAEQRKLKAAAAAVTALKERDDGDAGKRRKRRDHRRYTARDAEMD
                     AEAGINGEADSAVAKMGFRTPLKAMGDSASVSQSWMLSQTTVDGPATTGATPEATADP
                     LDAVLDMETVPAALVLHMLECVVNTQQHRHQPHQQEQYHSLTVISGSDQRGETATPMT
                     SMAGLPKTPSTGNTATVGSVPGRTPRFWSADTISAGKHSSHVGYRANEHDTSLRPPHG
                     RSGTLAAAGASTSLTQGWQGSPHLSTRAMGTISSPSLHFATHTAVSSTLPPAATATAS
                     QPVLSLAALGPLSVYCAWGSACPLCELLMAHPQCWTTRSHRDYTLGFYTINAARPRHY
                     SSGPAIQLTFPSLDESVCTCARRACHLRDNADFTALMQNSYTGDGSSSSLLHSMQPWF
                     MRPHIFVTPVTAAYGVSPYEVFERMSYHCNRLGSGSGHSQRLPHHHPSHSPMAGESSA
                     IAAPLIGVNNTSSLIDPDPRDLLLISRAQAHPHETSVVTACRNAAVVSTKEQGHTLLQ
                     CADIPKAAVEYLRRSADVIKQRLDYARRQQSLLERYEQAWEQQSTAPARAAPLASTAS
                     PAAVAVAKPASSLAIQVSQGHTGQGAASFSSHADAARGGGSSPSSSSIPVSATVAPLG
                     RSASPQPRSLRYGCRQLPLHTASRPLANQALLFDSTTPAEMNSVTDTLAPQRQQEQQR
                     NYTSSAHIDPHTQFITSASAATPLAGVGGLLGTERSLPVEVLLQYVLHHVIALSWGTR
                     GLEVDTLVRLLERNLRRLPPLLANLPYIMQLRSAGYTSALAAAASASHTTASSAVGEA
                     TAAVSSAFTTVHTRLAAPSLSSSVPVHDAAPQGSFQGTSPDRSVTSPYSGMSHAATSA
                     PITEAEVQLLQAYEVLDQLSLMKLLSTYATWPVRTVPTRLLLHTVVNEFSDVLYVNSS
                     GRNGDAEQ"
     gene            <134421..>135011
                     /locus_tag="LDBPK_090450"
                     /db_xref="GeneID:13392036"
     mRNA            <134421..>135011
                     /locus_tag="LDBPK_090450"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858670.1"
                     /db_xref="GeneID:13392036"
     CDS             134421..>135011
                     /locus_tag="LDBPK_090450"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858718.1"
                     /db_xref="GeneID:13392036"
                     /db_xref="GOA:E9B9S5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B9S5"
                     /translation="MDSSSAAADAGGAAARSGLHVYSSAQANAAGSGTAALPNKALDH
                     MKHMSRSKSDARRSGSKRTFDEATATDNVQLRRHDGTAVPNTAPNQVVEVVAPPPKKK
                     KVTYALPHQNMEEGHFYVVLGEDIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCA
                     VKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMK"
     gap             135014..135112
                     /estimated_length=99
     gene            <135899..>138340
                     /locus_tag="LDBPK_090430"
                     /db_xref="GeneID:13392082"
     mRNA            <135899..>138340
                     /locus_tag="LDBPK_090430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858671.1"
                     /db_xref="GeneID:13392082"
     CDS             135899..138340
                     /locus_tag="LDBPK_090430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858719.1"
                     /db_xref="GeneID:13392082"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:E9B9S6"
                     /translation="MPYSKAWRSAMYPDFRDQGAYVDYKATKDILHRMKENIANPSTP
                     DELYASLLEQKMRVYEWCERKQAELLTLSLRLYECSKYLTEEEVVTNRSITLSNQPKS
                     AAKRLLPREARLIADAIMHELLRFVECRNLNTDTIEHIIGRMYRYAVLGPTGDRWKNI
                     YVEYDYDQISVEEVFCHLSRVYDRVKQTEERISAKGKLSIPTGAEGSQVFDRRSVKYW
                     VHLQDLPFVIARIVPHLPLSTFKDTYKESKEKGVPFRLFSPVSSVYYDNNKFLFYHRR
                     LERIEGSTLIRMRWYSDTYAEDWNALQEDDNVFMEIKVHHEAWSGERSNKRRFAIKEK
                     EVDAFVHAQLSLLPAVEKLKRRNASEEEQEAFKSLSAEILSKIHAYDLKPVLRTQCGR
                     AAFQRGADQRVRVSIDTDLRMSAEDFGLDHHWRYTGGDSPVSHFPYAVVEVKLQCAEN
                     ERIAPWIEELMGCRYMESVPKFSKYAHGIASLYGHTSFISMVPYWMHQLDIDIRASTK
                     PEVHLWDPTMGLAAGCLERTADRLIFGTNPAQTQTVGASEAQFLPRTDYAKIYQRVLR
                     SLQHETDGTAESSANASVAASTTNSFTAVDCIADGKADKRTKDAGQGAVQPGLFPVVQ
                     YSVDRRHMAYTTFHLYPYSENGTEPLCYDPKDSKNAAAQVFYGKIPWQTGKRIKVPQK
                     YDPKTLLTSERYMVKWMQLATSFGLLGLTSIRFGKGLFLPQDVAHHSPFWQDNFHVVT
                     GVVMVAIALLTLAYAYIGFKARSRRVYARRKIRYDDVVGPTWLTFFVTASFVAITMTH
                     IARRYGPMLTGSDSF"
     gene            <139562..>141073
                     /locus_tag="LDBPK_090380"
                     /db_xref="GeneID:13392040"
     mRNA            <139562..>141073
                     /locus_tag="LDBPK_090380"
                     /product="heat shock protein HslVU, ATPase subunit HslU,
                     putative"
                     /transcript_id="XM_003858672.1"
                     /db_xref="GeneID:13392040"
     CDS             139562..141073
                     /locus_tag="LDBPK_090380"
                     /codon_start=1
                     /product="heat shock protein HslVU, ATPase subunit HslU,
                     putative"
                     /protein_id="XP_003858720.1"
                     /db_xref="GeneID:13392040"
                     /db_xref="GOA:E9B9S7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9S7"
                     /translation="MLRFPTRLLFCVATAASTPSPDVLQVTKEKASKLDDLSPRAITK
                     ILDAYIVGQDAGKRAVAIALRNRWRRRQLSDADLRKEVVPKNMLLIGPTGVGKTEISR
                     RMARITDAPFIKVEATKYTEVGFKGKDVESIIEDLYTNAKLKARRALEAERHAEALNM
                     ALDTVYSAWSVSQRMRAMDRSLLSTGKAEEVTAAAADDSAAEAEESQPQQQQHNFEYF
                     REHYLDEPITNDMVTIDINAPQAPTKPPKEGGIDLQSVGMLLGLGGEPKRLKVSVTKR
                     VADAVPLATQEALDKLIDEASVNTLARALAEEEGVVFVDEIDKVVAEPSSANADVSST
                     GVQQDLLPLIEGSNVTMKDGSVIATDNILFICSGAFHVVKTSDMIAELQGRLPVRVEL
                     QALTEEDFRRILTEPKFNLLRQQEEMLKTEKIDVVFTEDGVNELAKVTCAVNSQGQNI
                     GARRLNTILERVMDPYSFNCEEYEGKRVEINAKMVREATEKLQKNVNLAKYLL"
     gene            <142806..>145655
                     /locus_tag="LDBPK_090390"
                     /db_xref="GeneID:13392039"
     mRNA            <142806..>145655
                     /locus_tag="LDBPK_090390"
                     /product="ubiqitin hydrolase, putative"
                     /transcript_id="XM_003858673.1"
                     /db_xref="GeneID:13392039"
     CDS             142806..145655
                     /locus_tag="LDBPK_090390"
                     /codon_start=1
                     /product="ubiqitin hydrolase, putative"
                     /protein_id="XP_003858721.1"
                     /db_xref="GeneID:13392039"
                     /db_xref="GOA:E9B9S8"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9B9S8"
                     /translation="MRLRVLPRCRRTITSYLLSIMSATAASSRRKQHHESLKEESMIS
                     FEMELDEAIELPLDVSAVAPTDAALSAPLGGKKITMPAARAASESRAAWSNGSTASLR
                     FAVCGNGKELPNTPATADGVGSPIATPDNAATTTYSAAAPSRTLTWKDTSASQRRAEA
                     QASRQDDFNPMVLCPLQNLGNTCYFNAGVQLLVNCPALVYAVRNSPFAQSTQSNGPLT
                     AHAVSMPRAEAATATTKLCLKGGAATHTLFQEFSTLLARMEMGCAAGERAISPICALD
                     SLAQAYPQFEGRSQQDAAEMMTSLLASLEEEGGQYVEVAQLLQSFEEDAAALRQGVTS
                     LASSPRASEPVARALKDATAPLLEAETAPSASPHRRDYSEPCNIEEYSQPSLLSSTSE
                     DTFLPGPRSAHFFTVLRLMERVNRENELLERRVKQRQGIAYTNSFKPPRLHFNPLLDG
                     FRGYTLSEVECHNCRAVSRVVSPFNGLLLDVPTAKQRRRYALAHPNVPRRVDFDGQLR
                     QVKKPFRLTWWNPLSLCVAAWRQLKRFFQDPFPYPLWLDECLDIHFEPEVLRGCNRYR
                     CESCDTTTDATKSETLLALPEYLLIHMKRFEAGRFFNSKKSDSVFFPTSWRPLTKMQA
                     RQSPINTDDAPPALPEYLDLRHYLHSSVAPFAEPIPPCLWSTGNEPHQQHHASRDDAS
                     SPASSIATTYTLDGIVNHHGGYDGGHYTVFLYKATEERQAWVYISDDEVEQAEEVVAT
                     DTEYVLLYRRQPLVQAAPESDEAEQLRRKACYYLSQSSPSCPAPNTAAATTAGPKSSK
                     LHNRCPFSSSSAGGAASAPPHAATAATEPWVYISRMWLQRVVFMHEPGPIVNRLCYCR
                     PEDQGRVSMYRTIFPATVKVPAEVPHVHGPPVSWFYVPITQRDYDIFYNAFGGNAAVT
                     ASEYESLRAMQGKFCAAIDLAERQRGSAARPAPRR"
     gene            <146689..>149376
                     /locus_tag="LDBPK_090400"
                     /db_xref="GeneID:13392037"
     mRNA            <146689..>149376
                     /locus_tag="LDBPK_090400"
                     /product="minchromosome maintenance (MCM) complex subunit,
                     putative"
                     /transcript_id="XM_003858674.1"
                     /db_xref="GeneID:13392037"
     CDS             146689..149376
                     /locus_tag="LDBPK_090400"
                     /codon_start=1
                     /product="minchromosome maintenance (MCM) complex subunit,
                     putative"
                     /protein_id="XP_003858722.1"
                     /db_xref="GeneID:13392037"
                     /db_xref="GOA:E9B9S9"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:E9B9S9"
                     /translation="MQQRSEEYSYIWGTGIAVEVFRDEFRRYLETFALGQVVADPSRR
                     TPQSNGGEAAAARSSVSDTPAAAATAYALQEKYYLKELLRMHMQGRSTLEVDFTWLQR
                     VAPRLYVQTVHHPTECLQMMSAVADEVYRDVLLLRHGIEVAEDVLIAVAAKKLPSMWT
                     LKQLSPQHIEQLLSIKGMVIRVSKIIPEIRVACFQCWNCQYQERSVSGDKGRIFEPTR
                     CAHCGKTYSFKLQHNLSLYEDKQLIKVQESPEHVADGETPISIGVVVYGSMVDAVVPG
                     DRVIVTGVYRSTPIRLNANTRIIKSIFATHIDAVHIELVRATRASEAGARKGCFANGN
                     ATGTGLHVSTPTLATAKNAEGDLSSAVLMDTARLDMFHSLAHRPDIYDVLLHSFARTI
                     WGHDDVKRGILAQLFGGTAKTFVFSERIGSGAAATTSSNSAVFRSELNVLLCGDPGVA
                     KSQLLTQVHEIAPRGVYTSGKGSSSVGLTAFVVQDSDTGELVLEPGALVLSDRGLCCI
                     DEFDKMNEATRSVLHEVMEQQTLSIAKAGIIAQLNARTSILAAANPKDSQWNAQLNVV
                     ENLQIEPTLLSRFDLIFLLLDCHDSAEDRRLAAHVLSLYMDTSRGARTRRAVTNGSGA
                     AGGRVPPQGGCNDDGSGEEDEATQWRSTASAGQPTAASDDAAGTASTHVDATTGLPVE
                     VHMELHGEVFLQGPPDAPYMPANILSEYIALARETIFPKLTEASHKMLARCYVELRQA
                     RGSSCTVSATLRQLESMIRLSEARAKMRYGSEVSVEDVVEAKRIISAALKKAATDPTT
                     GLINLDMFHAADPGKNTVEGNMRRLEGLLKRRYLAQGRHTVSVAELRSVFNEQQSGAA
                     RPVAPAQFVELLALLSGGDVVQSFTATTVTLAMAGAAPM"
     gene            <149740..>150558
                     /locus_tag="LDBPK_090410"
                     /db_xref="GeneID:13392079"
     mRNA            <149740..>150558
                     /locus_tag="LDBPK_090410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858675.1"
                     /db_xref="GeneID:13392079"
     CDS             149740..150558
                     /locus_tag="LDBPK_090410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858723.1"
                     /db_xref="GeneID:13392079"
                     /db_xref="GOA:E9B9T0"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:E9B9T0"
                     /translation="MPLIRPGMPKPPQGFDVVLVKLEEYDEQMKLATQEESKGVVGVT
                     TRPRHRGRSGGCGARKRTRDDDANDEDGTVSPPAEASSTVAAVESEVGTSTAGDGNAE
                     AKEEAPIPPLWRMAAINRARTRYVFLAYYKQHIISKEVYDYCVDTRLIDGGLARRWRL
                     PGYERLCCTACGVPGAASLAASITSKYALRDRQERRLTTSASQQRIHDTATCLCRVPA
                     AQRRSKYFVACAGCGCHGCCSADAMKRPTEGDGGEKTDKTREEPSVNAPGRGEA"
     gene            <152909..>154774
                     /locus_tag="LDBPK_090420"
                     /db_xref="GeneID:13392080"
     mRNA            <152909..>154774
                     /locus_tag="LDBPK_090420"
                     /product="integral membrane transport protein, putative"
                     /transcript_id="XM_003858676.1"
                     /db_xref="GeneID:13392080"
     CDS             152909..154774
                     /locus_tag="LDBPK_090420"
                     /codon_start=1
                     /product="integral membrane transport protein, putative"
                     /protein_id="XP_003858724.1"
                     /db_xref="GeneID:13392080"
                     /db_xref="GOA:E9B9T1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9B9T1"
                     /translation="MHAHEHHYGAAPLPAPEQEQPLGHYFSVTYAELLKAHVLDVHLP
                     NILIGISASIEVPLVTILGRRIGANYSSIADYISVMALCRTLLDIPFGITVEYVGVRN
                     VMFLCLFLNIVASLIGLNVSNGASLFAFCMLSGISLGGFFLARHIFVAGITSKKYRGL
                     LMAILSGLLRWAHVIGPVASGIFASYSGDVRYSFVLSAIANSIAFGTLAIATQSTRCQ
                     QVCERTCRASLASSVARTPLHSEQEEDASDIVWHHPGVTGRDGAYVATALLPPATASF
                     PTKSGVSSSLPDSANHRVIVGAERNGSTSPPHAHHLHHTHANGGVATRPRSCSAASTA
                     SASLHPDTGACQEHNFHLTTLWSTFVDYWSVIWRLGLYIVLATVLRANRKLLISFAGM
                     RAAMTDAQVSYLMGFSFIFDALLFPLGGLMMDLLGRQFAMVPTAVGLGIVFMFLPLCT
                     TELKLYVAASAFGIVDALGCGIIMTLTADRAPPRCGAPFFGIMRTVQDMGHVVGARGV
                     SSLMRYAGFDVCCWMLTVAGFFTAVWGMYGVPSDTEALPEAPRLEQAAVVAHERRLHM
                     LSSYSQSSEETAPLAVVSATATPSTTTYGTATRPQPAPCVRRQEGGEGYRSVARS"
     gap             156426..156524
                     /estimated_length=99
     gap             157476..170648
                     /estimated_length=13173
     gene            <170845..>170946
                     /locus_tag="LDBPK_090455"
                     /db_xref="GeneID:13392081"
     mRNA            <170845..>170946
                     /locus_tag="LDBPK_090455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003858677.1"
                     /db_xref="GeneID:13392081"
     CDS             170845..170946
                     /locus_tag="LDBPK_090455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003858725.1"
                     /db_xref="GeneID:13392081"
                     /db_xref="UniProtKB/TrEMBL:E9B9T2"
                     /translation="MTTHPYVLKYYPEARQAPSYPDNRAMLRPPPIM"
     gene            <173573..>174172
                     /locus_tag="LDBPK_090460"
                     /db_xref="GeneID:13392038"
     mRNA            <173573..>174172
                     /locus_tag="LDBPK_090460"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858678.1"
                     /db_xref="GeneID:13392038"
     CDS             173573..>174172
                     /locus_tag="LDBPK_090460"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858726.1"
                     /db_xref="GeneID:13392038"
                     /db_xref="GOA:E9B9T3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B9T3"
                     /translation="MASLQSRLAPITNINNNAYTTTAGAPILRKPEMTSAASAVYISR
                     KEAAVSSSHGAPTNKMMATAAVTGSSRCEEATGRRSGSKRDHETSVTTDQNPQDAAKS
                     LPPPKKKVTYTLPHQNMEEGHFYVVLGEDIDVSTQRFKILSLLGEGTFGKVVESWDRK
                     RKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFP"
     gap             174173..174271
                     /estimated_length=99
     gap             175424..175522
                     /estimated_length=99
     gene            <177830..>180844
                     /locus_tag="LDBPK_090470"
                     /db_xref="GeneID:13392041"
     mRNA            <177830..>180844
                     /locus_tag="LDBPK_090470"
                     /product="tyrosine phosphatase, putative"
                     /transcript_id="XM_003858679.1"
                     /db_xref="GeneID:13392041"
     CDS             177830..180844
                     /locus_tag="LDBPK_090470"
                     /codon_start=1
                     /product="tyrosine phosphatase, putative"
                     /protein_id="XP_003858727.1"
                     /db_xref="GeneID:13392041"
                     /db_xref="GOA:E9B9T4"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:E9B9T4"
                     /translation="MSVAMEAIHDFYFKENFFASGVAGACRKGSSTRTIPTTRAAVGQ
                     DAVFVSLRGIPPYLYRPFFADFGPLDMSCCVHFARRLCELLRAVTGFDVRASPASAAA
                     AGTFSNGTSSGAAAPAHRKRGGRGQPASAPSCSPSSASAVSTVSSSGCPLGATLPVVV
                     CASLDAQERVNTACLVGAFCVLCLGWSAVATWYRGFVDIYPGFLAYRDASQGVSNYPL
                     SLIDVWAGLEQGVALGLVNVHTFDIPAFLEGKQYDYSWVVPRRFLAMSSPQDDKSART
                     AEVFARRLRPLGVRLVVRLNDNLYNPSPLLRLGIRHVDLPYADGSVPCDAMLLRFLQA
                     VEEHFGESVAPVSLQEWWSVPSSSAATARAGSASTKASSARASHRRPALQPCSLMHSG
                     TCRGMPEAWTAVPPSAPPSHARRPDSAHANRTQCHDTCTLAPGDKGAVAVHCLAGLGR
                     TGTMLAVYMMRHYGFTARAVIGWMRLCRPGSITGIQQQYLDAMERRLRPPPHMLAALQ
                     LNSAAKLYGAVGGGRRFELPSRRTRSSSLSVISSTSALPNAAAAAQTTHGRDGAVAMG
                     RNQLDASPQPPLGKATTGCMRSTAAVTAFQTHGSVVADAQPATATATSIVGGHIRRDD
                     SGRSSAMAARAASDVARDIGTFTGLAAWTDLTGLRGAQQQRQQLLMRRFSNSSTATLS
                     LSTIQEGGEALDVVARMPVLGDNSPQNRSAATASLKRGSATAAASYHKTSIHPSPRVD
                     DYKYASTYFVAMERVGELPRVYPWSTSSAAASAARGEPGGAHGGGPRPATANTYDETA
                     PRGTRHLGRPRLSECSIGSDASRAKETRTAPASADSCLRPRKGLTSALQRRRPYTAAA
                     AVSVGPQLHAKRYPTHYERGGAADHSETGTHAPGGTPPCSDLSEKTQQSPRRRQAATR
                     TRVRWDDKGAHRANLDDARAGDTAAADPCVDVKLQTPHPPSAPMRSSLPWRDGGVTEL
                     EDGPRSPLVLSRSSLAIPATSLPMWARPMLRT"
     gene            <182935..>184338
                     /locus_tag="LDBPK_090480"
                     /db_xref="GeneID:13392083"
     mRNA            <182935..>184338
                     /locus_tag="LDBPK_090480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858680.1"
                     /db_xref="GeneID:13392083"
     CDS             182935..184338
                     /locus_tag="LDBPK_090480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858728.1"
                     /db_xref="GeneID:13392083"
                     /db_xref="GOA:E9B9T5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B9T5"
                     /translation="MISEEDSRLFEAAKRAQVSRNTAIHVIENTNSSRILAGAFVRVL
                     LEMPTRNEGYVVARIHSTTAGEPYSGFSTNPAQTTNVYLMLELPPPLAAINGVQYQLN
                     SVSNSSMGEGEFRDWLQMIRNEPTLRVPTVQGLKEVTARLHPYEVSRHRSNSHVSANG
                     SMATNGRAGVVDTSGNVPHPQLAQQQQQQRSLSAHGAARQRRQSLAASSQTMLIPPML
                     QDGAPLPDSGDALLRRSSAAMYEGDSSGVIANAESSASAAGSNSNYNVNNRLGRQGTV
                     MTRDYNRNPREDGQASHEMSNAEVPVMSFYTAATGSQQEQQQRTMFPLPHGGGGVASE
                     SDGGPVLAATTSFMTRGATDPNMESEDEEMERRLRQEIMNHLAQECVLFPKDAQGYKL
                     SRLRLLERDMIEYLQHVRDEIQGKQENCIVCMDHVPTVILLPCKHKVMCRLCAPSCPT
                     CPVCRSKIAEMFEPEEI"
     gene            <185655..>187562
                     /locus_tag="LDBPK_090490"
                     /db_xref="GeneID:13392042"
     mRNA            <185655..>187562
                     /locus_tag="LDBPK_090490"
                     /product="hypothetical tetratricopeptide repeat protein"
                     /transcript_id="XM_003858681.1"
                     /db_xref="GeneID:13392042"
     CDS             185655..187562
                     /locus_tag="LDBPK_090490"
                     /codon_start=1
                     /product="hypothetical tetratricopeptide repeat protein"
                     /protein_id="XP_003858729.1"
                     /db_xref="GeneID:13392042"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B9T6"
                     /translation="MACFAAVEAPELPPGMDPAYYALSLLRRRRLEECIKVSTHYLTL
                     ATTPKCAGSPTGATATTPPSTGFMDESMWFIQTKAMVLQSWYDDAEIEDDGVDDVLME
                     GEQAVVSTLHRPNTSLRAARQGTAGGGTAAGAVGRAGRLGTSAGGGRPVSSRYGYARP
                     GTLQNRPGSVRSGPDGTAVRPVTGRFVRIGTASLRSVTGGPHINLQALNLERYAQEKP
                     MVAKLLCDYLLYVEHKPKMALELCTAALRPVKPVTTSAIPLPSAPGVAAKLPMGVAAG
                     AGVGPSSLPPPGKTAAVSAAQEQVGIANTNDWWWKARLAKANYQLGLLREAEKYLKAA
                     LFDSPTSTSVGAGMLAKESKAWPGGDGSGGGFQKGRAFANYNTSVVMQLGKVYLKMDQ
                     PLTALETYEAALEVNPVDHHIVLCCARLRDELHEPGTAYDLYNQVLHLDSSNIEAIAC
                     IGAHLFYERNQPELALRYYRRLLQMGLHTSEVWTNMGLCAFYTFQMELSLRCLSHALA
                     LCKEDSQRADVWYNIGHVGIGMGNMAFAERAFRLAVSADVTHAEALNNLAVLAYEKRK
                     EKTGRRLLDTAVLVAPGLTEALYNTAVISFQAGELELSYQMVMRVLEAEPDHPEAVVL
                     QGKLRERFLAI"
     gene            <188776..>191580
                     /locus_tag="LDBPK_090500"
                     /db_xref="GeneID:13392043"
     mRNA            <188776..>191580
                     /locus_tag="LDBPK_090500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858682.1"
                     /db_xref="GeneID:13392043"
     CDS             188776..191580
                     /locus_tag="LDBPK_090500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858730.1"
                     /db_xref="GeneID:13392043"
                     /db_xref="UniProtKB/TrEMBL:E9B9T7"
                     /translation="MEKSTGDGARQSPLGAASAAAVATSDDILRGIYNEKLQASVRSI
                     ITTLTTELPQDHIFLQLLADPTTLQYCKVRLTEVVEGFLYSTQAEQYHTLATELARGE
                     RDCALLRQRIEELEAALAVASAPVRSPTPPRQGFSSHGGKSGTCDGHAHPAAPAGSSW
                     TSSPTMMPAPAAAAPTTSSVSPSIPANPMENEEARRELLRVLEQATHDQELLRCTQAL
                     QAVSKVVDVAQDESRCDDKYFFEGELLGELYKCVHSLLHYVDGALESQERLRCEIQEQ
                     QQHWLHGVAAESSHQDIDDGAAAGSAVSADRSASVSAGTKDSGTRGVLVSGYSTPRHP
                     QVSLGNAGTALMSSAVGSRFSSASSPAAADHTRPIQQQRKRLQRLAEQLREGQQHASQ
                     VLQTLAHMESARRREVAQLEMAVAAAREEAAVATSAAESARQVKENSERLHAEHAAFV
                     ARERTELRDQLADVHAQLAAATQDVHAARRELRSATSRAEAAEEREKDLAAELAALKA
                     AMARRDAEWQEQKADRVARQAELTALKAVHQSTVDALQDAARELLCLRVEGTMAGLSA
                     LYQEAKAAKAELLEREGYRPLSHRCSIAVATQQEVVRHAQVQSQLAESAQAEQAVAQR
                     GCMDALGMLLRSMWADEAIESALTPSSASTAALVVTGTHLTDGKDAREAPRGGRTRRG
                     SRTGSCGSTTSGNAEDPGAENPRSSHGYRLPQTLAGLCTSLEYAYNNVRARHRARQQT
                     IDSLRAALVSKDIELRAAQASDAQLRELLKAEQAKEEQWKAEMAQLSDQNPMRGLLAR
                     QERLLKAVSDERNELRRLWNQLSGDYIALEQRNGALHARCAEKEHENARLNGMLRRGG
                     TPTTPAGPRRKDAASCSAARGPPAIPAAAEAAPRLSALATAAAPLGTSADRPTSTLGS
                     DSSSPSHTNSTEALSNQVPE"
     gene            <192673..>201930
                     /locus_tag="LDBPK_090501"
                     /db_xref="GeneID:13392044"
     mRNA            <192673..>201930
                     /locus_tag="LDBPK_090501"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858683.1"
                     /db_xref="GeneID:13392044"
     CDS             192673..201930
                     /locus_tag="LDBPK_090501"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858731.1"
                     /db_xref="GeneID:13392044"
                     /db_xref="UniProtKB/TrEMBL:E9B9T8"
                     /translation="MASYWWPLGGLTVPAEPKGSAPAGAPTAAESGPPKAPSGRTSVA
                     AAHNSSVTAASAADARHLARAAFHTSLEGLLVESTKHRGLAVLRDAVLDTRQRQYDPA
                     SLFETLCIACTLLAERSSGGTAVTARRHSSNAAHPKTSSPAARGSMSRSSSGAALYTM
                     GSGNEPPHVPVIATEAATLLAAGAHASSAASPPHPLHYRHNAASRELLLQSIGDIGKL
                     IALALLPVTQQVGRRVADLVRALAFQPSPTPSVQPSSLGVQLPARAALPPPTWTTSAS
                     VAPSSAPQSHSTAPRDKDPSSGLLDANCGGGAMSSAAVTATVSAAGPVHLVHDDPVLV
                     RLLQMTASAASRCPLGSSALAELYGVLLLFYSGVAPQSMLEATCEATLTHHIHAVLAA
                     LHDSGAGDDGVVSASAHASDDGLVHRNSSSVTLTASTFAAQLQGVAFIKDVCRLMVGA
                     RTRWLHLSPYSTSTPAPGGAAGGEGATAVSGSNHSNKRGAAEHHRGSTPSSMAGITAS
                     VAAAAADASRQRDQEQQQLSLSTSLMSKSMLGSLAALSPGIQHELDAQSAAAAAAAGA
                     VSGAGGPGGAAELSSLSSLAMTMPACAAMEAVPERLRLFLMRAVTLFFKEQAKALAAP
                     AVATAAAGGGGGTDEGASRSSAVTSAAAVSMQSPLYAQCLNDCVFSVALWGLHEMGIA
                     VSMQPPPALFVEVQEQQQRDGPFSAPPCSLEVFMCTQQLVLVPISTHLHSMTNSTQVL
                     LEAHDRLLQRLCRRRKPCATSSSQWLCSSGEASGGSLMSSNDAERLSQAATVVLSLWR
                     KTLTSATLLWELLQLRSMQGGHNAEEVAAGMSVDTEAYRSSGWYSNEEWRASSDVKRN
                     GYNSDSSGTAAPSQRWSQSAHDSSLYPQRPSLALSRSRDNLTSSQSALDGRNDSEKDR
                     ASTPPVPGLGNAAAAGEEGGTGVDATTVPLLVRLVLSVLALVVSHMQLHANNIMQASA
                     DDKSTDDRRGGGDGEEAEGAAFTGPLLRPSTPPRFLSAGDSEDDIVGEPSLKLSPLHM
                     GPAAANAVGAAAAAASIPLCLCVANASIVYQCFTEVLNGLTAFGQLFSQLVDTQLMPS
                     VAAADKEQVLCRCRECFLVLHPHLLHCEQLCLRHLRYEEDVLPVVLKATSYWVQVSCV
                     LQLPEQRDAHLAALVDVLRTQDPVDGHLVALAPPTALGMSDTASPTTAMLLEALLTLN
                     SACAAAEPIVPGSVAAAALSPSGDRDAASPGSGGGVRGIRQYALSMSSWGAEWLRRRG
                     LTTSSSARGNTASPAHAGGGGSGSWTVSPSQSQMSTTPAGERSGAGARPSLAAPPRIG
                     TPTLIAAASRSKQQQQPASASWAIPLVLTSHGWRAPAVQHAVILGVCRLQHKLFIMKT
                     LHVIANTLGAQLKSGWALLARGLAVTEPLLHMLKRLLSWIEESAEEQEQQEQLLSDAL
                     HLRDALRSLCLHNACQLPYSQFEIFFTELVSATVALGAAAPSQQQDGAALAFNHWGCG
                     DLHAAACAAASDRLPRHHPQGCGGQWVLTSECLSVSLLAMLPFIELRYTDATNGVATG
                     KVGDGSGGGDQPGVQVVQLQHQRTGALARALYLWELEARVCRYVTDHQHVEEWGRALL
                     TTMKTHKRALLATTASSSVEPAATDPDTPLGTGSLSQEETRTIELVLSTVVGHVSTVA
                     VQMCRSSSRRRVAAVTSAGGEGGSPLNDTGSAAPSPSYQAVQSAALTLTSGPFAAVPL
                     TQVANALFAASAASGSSLGTSGAKDTLAGVGSGGRLPLLPFVQADAAQSIARLHAAVH
                     RSSQAIALHTPADDSRSSVATAPPVATASVHLAPLEQLLASPFALLDRVYGEWQLQCA
                     GSPSRGGGQGRRSAAANAAEQHELEGRMSSTPLDTNEARELPQRGERSASSEALEASA
                     AFSVVAGAVPQLLGNAAAAVLMDVVKIVQSYGEEIDGAAWEAILSLLQRTAMAAKEHD
                     NTLAGMSVGAAGGSGSHTQSSVSMDSIGGRSASSTGLLGKPGIKAPTSAAGATVSSSQ
                     AVESLNTAFRALESIQHNHIPRLNVDGLHRLIVCVGTFTVHRVDGGAAVERKLHTNLS
                     AVQLLWSIADYLAAFGSGADEEIERGGACNNANGGSSGTVKATAAGCAGAAAGGMRGS
                     PTRCSDDALVAQHQQQQQQQHDRLWCSLLWQLRNGCLDDRQEVRQSALQTFFALVQTY
                     GWRFSAACWRCVLQDVLLPLMEIVAVATGLCATPPPSPPELGEDGATAATGAAGERGA
                     QDATRQRLLRSFMDHPPQLEEVRAALFDAGSRLFVTHYARMQAAATALSSPSSARSRR
                     PQLPVTEEDKDDATQVLERFLRLCGDVCVVLRGTSGEQAAVAAVHALHGLLVEMPGKG
                     LHAHGIHLAWSALERLILRGGGGGDDCVEGPLAGVTEGIAPEPDTQRRAKQCTNAVVA
                     ATVAAVCDSFRLQRLAAAAPVAAVGSATATSPSAVERSRNATGFSSYFSSWGGGGGGI
                     ATTVAGSTSRAELRHSDPSSPAPYFTRLLFLLQAVTRCPAVVNSYYFPSKAQATLLEG
                     LAAVWPTLSSREARTMWGEVLLPAFPPAARLQSFVLQDSHESVSITVVDDATANAAAT
                     AAASTRIPLKSVMPPGSHPGYLGAVMETMRGLMLRHMGADAVGATAARRRGPDGLPPD
                     PASANTSAAATEAPAKTTDEDRARLAFMAPSTVQVSGTLLLLHLAPAAVLEVPPRSGS
                     VPFNPPALFLQECVNVLQYTLWEPVLARTRTPPTSAAAVQCRRDGVVALCRVFELLLT
                     TTSTVVRHLHATATSGAAAASGTTTVPTTTITPPHVTAALQSLDLLVGTLGEVVHFVM
                     ERYEDVVCATAAVTTLTIASTAEGTALARVARRSLSLLQRWACAISGTPSARLAPPSC
                     AATPHHHQRTRSGSDGSCIMSPSAQGAVARHDVCAQSQPADHATAPTAASRSKLQDVV
                     RASIESRNKAIMAQFVGNPDDASAGALLVDTLRDMLHVAQSSARADPRAGSDAATQNL
                     NTMMPDLLRLVACSSREPHRSAAAISREQEMRELLANLLTLAVDKQHKQLACQAESRG
                     WSGCRADDYRLNSDAEDQDEGTSII"
     gene            <202929..>204887
                     /locus_tag="LDBPK_090520"
                     /db_xref="GeneID:13392045"
     mRNA            <202929..>204887
                     /locus_tag="LDBPK_090520"
                     /product="serine/threonine protein phosphatase, putative"
                     /transcript_id="XM_003858684.1"
                     /db_xref="GeneID:13392045"
     CDS             202929..204887
                     /locus_tag="LDBPK_090520"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase, putative"
                     /protein_id="XP_003858732.1"
                     /db_xref="GeneID:13392045"
                     /db_xref="GOA:E9B9T9"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9B9T9"
                     /translation="MSSDLMELSREELISRVLDLQSENSALSRQLRSMANRRGGASSP
                     TQADPRSRTTSGGIGATHSDPSAFIAANPVSARRNGSLSTSSEVPMSAAADRLSGCAS
                     GPPSAPSFEISMSVIVIENGAALSVPLSSVLDKTYGRQDLRDADTPVVSSKYLRDTNS
                     LRTQRFSIGSVSATGGAAADASPSMNLDEEFSDSLSPGRPSSALGRGSALVRGSVANA
                     GGTVNDTDDEPYPKDPRAGSAGGAAAASSLAQRAGVTNLNLRRDVLFARDLSLDADAI
                     ITHQTLRLFNQQFARGANMLSPMSSYGNAVYHYIVKTFAVRNGCEHSPDDVEGFGRTL
                     MNLCEEVKHILLDEPRHGSVTSPCYVFGDLHGNFRDLFYFMDNLISFQDLRYTPHRFV
                     FLGDYVDRGEFSVEVVAYLFSMKVLAPHKVLLLRGNHEDTLVSGDISGYGNTSFRAQC
                     HSTFGAALGEELWHRASAVFAHLPLTANIDSKIYCTHGGIPRYSGGVDDRLGILNSVD
                     FPVMESFFQVPENETPQHRMYRQIGMDTCWADPAENESELDRFGFGSNPRGTGVILFG
                     SKAVDDFLDHFHFEYIFRAHQEKSDGLKLSKSARVFTIFSTSAYVGHQNGAGVVLVAE
                     GKIRLIVKTADTYEEDDYVAEVENVHRR"
     gene            <207441..>209675
                     /locus_tag="LDBPK_090530"
                     /db_xref="GeneID:13392084"
     mRNA            <207441..>209675
                     /locus_tag="LDBPK_090530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858685.1"
                     /db_xref="GeneID:13392084"
     CDS             207441..209675
                     /locus_tag="LDBPK_090530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858733.1"
                     /db_xref="GeneID:13392084"
                     /db_xref="InterPro:IPR013518"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:E9B9U0"
                     /translation="MLRSVSLAPQQRAAKDLQDLPTELKNSLLGVPLFHVPTGYGSTG
                     GSGANSAQVSSPLLSGEVLQAQNLFSRGPSPSSLMSRVFRSAKPRYSTGLTGQVPVFD
                     YNGRLTTRQVGVHTFRFRSLSLFYFLRSQPWTVLITYSVVLYLIIVLLITAAYYAWGV
                     ECGAAMNAVSAIYFTVVSLAANGGYMGEDGDTMTDATHMCYRGRTAIVMVCSYVNILF
                     VGLVAALVVSKAEYTGKLGHRVVFSDFCTLATVPGRVDQWRLVFRVANVDNHIPLARG
                     KLRLFCVTAEPLKECHIHQQQLQALRHSRSVKKLAGSTWSGTHQLLPGVEFDGGGGGR
                     QPQRTAPPPAEADENLHTAKAKKRHAKVHSRLRSAPAPPAPHDSAESGSREDRSGLTR
                     AQRHHQRRKQRDRQLHKSGSGGHTDEADSPRRHRGQRSEGSLNPQKSHGMPSTESRGH
                     RSASSGPSRSSSTASSGSDDSTLSTSAASSRFLSASSSAKATSSTRTRRKAVSRAKAP
                     SPKSQSSSAADNADVDKANSSVSSQEGSCLYAASLFTEVGNEPSVAFAGKRSPFPTGI
                     PEPAVSVPILSRSPNEDAGKTMERVHLCVHEMRWTCAGETYLDRGERGQLSLWYPADI
                     IHIIDERSPLRPFLELPHVAASLGSGGASADALSGFPSRADLVRQHFQIVAVFDATEM
                     ETGSAITTKRTYTNEDIVAHYKFSDRLVHVHPESSEVLLDFHYFNALLPVNLVEPSTT
                     ESDM"
     gene            <210593..>211828
                     /locus_tag="LDBPK_090540"
                     /db_xref="GeneID:13392085"
     mRNA            <210593..>211828
                     /locus_tag="LDBPK_090540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858686.1"
                     /db_xref="GeneID:13392085"
     CDS             210593..211828
                     /locus_tag="LDBPK_090540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858734.1"
                     /db_xref="GeneID:13392085"
                     /db_xref="GOA:E9B9U1"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9B9U1"
                     /translation="MEKFRHFGDAATGIHPFTFVMAPTAAGRIGSICMFPARLLLSAV
                     FALLLLVTDTLLWLFYVAYLGLLGRLLLAPLQRAWLRGLLFSIGNILPQQPAAMVKPQ
                     QQGREASGSSRAARAGDLVVCNLQSVWDALVLEVMLAQPYHAICFPDATMAGEDGSAS
                     SAEAAAAPGLRVFWPGPTQRWRVWAYTRRTSSLAFLRAQQPDSAEQQAIRKKTEVTEL
                     PLYRVQKAAALSGVPVWWFGEGTCSNGRGLLLMPAVTCASAVPSDASAGCVVHLATIQ
                     YDSPAMQNVLGSDNESFFAALFRTGLLLYGSTAPAWTSPLFPTAEVTYRSTRLARATP
                     STATDSKSAASRCHWTLSAPALLELRNAMCQRGQALVVSGSVAGVRRQPVSVGVKEKK
                     GFIEAYRAMLDSKKASPSA"
     gene            <213108..>217625
                     /locus_tag="LDBPK_090550"
                     /db_xref="GeneID:13392086"
     mRNA            <213108..>217625
                     /locus_tag="LDBPK_090550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858687.1"
                     /db_xref="GeneID:13392086"
     CDS             213108..217625
                     /locus_tag="LDBPK_090550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858735.1"
                     /db_xref="GeneID:13392086"
                     /db_xref="UniProtKB/TrEMBL:E9B9U2"
                     /translation="MQLSTEGYHEELRLLREKPELLSSGAEMEVRKVWRERLWMDDEL
                     EKAELRPSTSDVVHRQEAHGAAGGIAALSSPFAPYHVGTAEHAARQRQAAAPMMEEVD
                     EVVVMAQHVVFRVGHDEIASHFSAKHPNSIIDASALASVQHVELGAMPPAKHMREQQQ
                     QQQERAVKQHLASLRRFSLDTPYELKECLARDIVAGRVDVPMQTAITDAVMDEQQCSL
                     PTTRRPLSPDLCVFPSPRTEKSSAAARRRRQHDDDLPAPAALIMWQLPLRKPKMPTTP
                     LWQRPWLPPGAWAVEMAHCDVTRAEALIRASAVRDPLAVEKRTAAIKDSIEVPRHHQG
                     RPRSTGVTTAATDGEQHRHNVRVRRQEAAVACTDGTENLYGLQYVWRSPLPPGGFIRV
                     SPDPRIAMWPDSEDEDSDDGALDKMEKYDNSQARGVHAGDGGGIREGVRRSISKVSTG
                     TSQHHGRQAQMRRLARCVNRRTHKLRWLHSIGRRHVCYKDLALSDSDNSTGAASASSS
                     SSSQCTSPTVSALRDIHVAVEVKKASKRAARLPLLHGNGKARRRQRRRQEGVDDTSRG
                     PRPVYDGVLNINIYAEIVDSQCRNASVVGTSPLRAKSQQHGQQASNAATTTRRFLGCY
                     RQSRLLIHFKLYCRALYEEQRVRRGGAGTHVIGRAGGSAPEYTPATEGLLAGVPAIPH
                     PVLKLQEHAPSLRKSYAHRIPVASTMSGCRCWEGLYPALGTNLATPVQRAWRQLQRSS
                     LVRQALRDIYDELPHDKEGLLDKRTFVLFVLQLLELFFPTRLPAAAHIAIAEEEWVYR
                     GTTEHVGPQTFHEKFFVFPFIFYRDIAAVTEAQLVEFWTLVRVCFDAQKRTREKAAAM
                     SAAVRGRSSSLAGNSGDAPRPPLLSLLTPLTLFTAEQLDVLLSRPPPAFDVDVYDRYC
                     LLRQAFREDPKVRAAPRGHQYVVARSVVEAQQQKRPRASNWAAQKGNAAHKMSAPLTA
                     CRTQLCSADVKRRAEVAAAAQRERESRQRSLEAQEHKALLEQSDYYQARIGRIQSRAA
                     TVISGIESTCSTWELHRTEAYAPPQKDENADARLQVKEDVEELLLEYLDDVPLDVFDG
                     PVSLRERYLLHAGLRQERLNRTFSPLQPPPAPTPSVAPADDGCSAALPPVNPVARATP
                     SCRPVKADDVAPQYMAVMTGGLGATQRRIAVSEEMRPLLDGTSDVSGGAVITPPTTSY
                     VAGMYPLRAVRRTVSSVLCPSRVPSRRRSILNKSSEASLSGACTTFCSVLGVEDDGRI
                     GAASTFSSFYTAASAPHARLTRGVQRKGVAASASTCGVSGRYPGKDEDAVMEAMASSA
                     SLTGVRNKSCYRKPAAVQLRQLSRPATPAVSATPFVPVSPLLRPRDGGVSILCGLNSV
                     ATMPASTQRGTSPLPQHQQLLTSAKASSTAALETAWTSSVMLVDLGEEVTNASPGSAP
                     RVSQQGSTVVHHVGARPPHPPALSTVHAPAPSASLHYAQRLRAQKRRQEQYKRQFNNA
                     AKTAAGVACRH"
     gene            <218433..>219680
                     /locus_tag="LDBPK_090560"
                     /db_xref="GeneID:13392087"
     mRNA            <218433..>219680
                     /locus_tag="LDBPK_090560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858688.1"
                     /db_xref="GeneID:13392087"
     CDS             218433..219680
                     /locus_tag="LDBPK_090560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858736.1"
                     /db_xref="GeneID:13392087"
                     /db_xref="UniProtKB/TrEMBL:E9B9U3"
                     /translation="MSSAIVSVGSRQVIPLASRLTVGIRLQGTIGFVDPASPYVVKPR
                     PYVSYLATTLRRLQCAVALFVPTNTEHDREMMNMFYRRDFTVPFRYVNDHSKFIGAGS
                     GRGNRKRGMAPNNYTEYLRIMANEANGTGQDTNRILFIDSEVNYRFTPVQTIVLDAYE
                     PLTRRQQRRLVQQQYSNPFGDVSSRHARRYGAAAARARKTTVRHRAVMSAQHLQDAMD
                     MQQKYTDFLIAEQEGVQLPPEMRDGVQDRHGDDLSHFSKRRTQRSASSSPPHPQQGGG
                     TRGRILGPLSTPGPSSSADTESDKTPPDGNKGIKEVQQQRPSMSCALAVSLEDYSLVA
                     LAEMIAEMSASETSVADYIKTEPLIEKVEVPFHGKANYLAPENCDNIDLLNWDEIQVM
                     EKAHSTGVPETVEETEDHKDFFR"
     gene            <220579..>222891
                     /locus_tag="LDBPK_090570"
                     /db_xref="GeneID:13392088"
     mRNA            <220579..>222891
                     /locus_tag="LDBPK_090570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858689.1"
                     /db_xref="GeneID:13392088"
     CDS             220579..222891
                     /locus_tag="LDBPK_090570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858737.1"
                     /db_xref="GeneID:13392088"
                     /db_xref="UniProtKB/TrEMBL:E9B9U4"
                     /translation="MSAAVQTLATVMATDMNYYAGDPTVLAADVASSRVEQILQSSRS
                     DQLTARVAIHAQLREAFKNADVQQRLKPFLNNGEDMQMYVQDAKARARFFSQKQQELQ
                     HDILQSEEQRQLKEAHGELAAWERENAVLLRHQMFMTYMPSQALLLESAATVALYRQY
                     ATLEEGQYTSDSSDGEVPMMLKKMGGKTYFTQSEQPFEVDTHNKMFSQQVLQNKRVEY
                     EQMREKAAQLRQALEECPTVKRLEAFVELRNDIFIEYGIDRLASLCSRKDKEMGNPNE
                     GGVDVSLHGLPADHEYVSSSRVAQYSLPKIVDAAYKNYLNILSMDDWDAMMKHTGSNA
                     RAVMEKIKPMKDKETFRYWFLSCITADVPQMGPNKIVGQKVTTLEDYKKFWAPQKSNY
                     VPSLTSNRSIFGSKVADRRGLPHFLILSPVTYRYRENNDPNAVKTGKIDLMVYDATNE
                     KVLLMLTNSSDERRPRAAFLNAQEERYRFAAVVRSAITYENQYHGFECEGTVAEYFFD
                     AQEGPEENYYCIMAPHRVYSKQPNKVQVPMKALRPFTSCPPRYFVLGSNWGVSAGTSR
                     NPYPASYAHVELNENAVGLSNVIPDGFISSKVLPQLLSRAEGVQKLEETKRQQRAESE
                     RPQSSPRALTRTSRGGAATPRPSTASPSPENNAADILADENMRGPGEEEDPLSPIVPN
                     EVLHPVRDQLLKQRRSWQNPAYIAFRARDSDLRRLPAVKDGHLRTPLNVFNDLMREKH
                     GEDAPPASAPSSARRSNGPPSSRTASVACT"
     gap             224066..224193
                     /estimated_length=128
     gap             225411..225509
                     /estimated_length=99
     gene            <227334..>230327
                     /locus_tag="LDBPK_090580"
                     /db_xref="GeneID:13392089"
     mRNA            <227334..>230327
                     /locus_tag="LDBPK_090580"
                     /product="leucine-rich repeat protein, putative"
                     /transcript_id="XM_003858690.1"
                     /db_xref="GeneID:13392089"
     CDS             227334..230327
                     /locus_tag="LDBPK_090580"
                     /codon_start=1
                     /product="leucine-rich repeat protein, putative"
                     /protein_id="XP_003858738.1"
                     /db_xref="GeneID:13392089"
                     /db_xref="UniProtKB/TrEMBL:E9B9U5"
                     /translation="MASMNGSLYRSSCSISSLADAPLAKATALSEQNLARTPTPPPAR
                     VLPAIAAAATVTAATLPSIPLDRYRAKLEECAELHRQLEELAHTKEAVEQRLSSCQAE
                     AVQLRQTVHRLECVLQLRNEELVLLRDCRRQRGVGGGDGAPASMRMILPTAEAVAQSL
                     GRARGGASQQFTHAAEGAATADQAVILEYIRASCYVGCPTHPQLIQFFFAASSGEALV
                     ATEPPLTYAQGSVLHRLLTQTPIGWGAAAAAAAVAELSAFRTWACEHLRTFSVRFEDA
                     YAGVSTLSDALLHSLPSLAQLEVWGVDSDAALTKLTDALVGATQVRELSLPELVVGDE
                     GLQGLWRLLQMRGSMHAPCTAAVPAETSCAADSLALALCTLDLSACHIKDPLTLAQLH
                     CPSVEVLLLPPTDRMTDSLLAEVLQRCPRLHTLDLSGCARLTDACVEFFNSAAPQLRV
                     LALEHCPHVHRLQLDHVEVLLSSLVHVHALTSRSLRVLPLPVQQRAVLSSLVAPRLSQ
                     ISLHGLPVDEEVLRRLNGRSGEVDGCEEGVRLTSVTFSECTFVSDDVFAGFLQSQTDL
                     QKLSLFHCKGLSSACWMAKRGLPIFAALHTLELVNLRTLTDEALRELTQACPALQQLD
                     LHGAGWSHLTDISIRQLDRLSELRVLNLLALNPDLVTAPVVTALVQRLPQLQRLYHET
                     AITLAGHSESVENGDRGALHPVGAVDIPSASVSSSVTVERSDAEARWRAALRDYPLRM
                     LRLQHHSALVLWTDRARTAGPRASREDVPQATSDSLLTATTVDGGHDGSGIQVAEAAA
                     VEPSKLFPAMATRTMAAAIAASAASTLTLPSLKTPAPPQHGPPGEVRLGDAEGAPHAS
                     SCFVASPHHEAALLPPVRRSTPGEPAHMDADECGQASPVHEQQQQLNSPSSCSSSGSS
                     TYTQQSTQEGSHEGAGHSLKRSLVQCANAAASAAFQSYQHRPVRMSTGSSRPSVATAV
                     AATAAAPQAGSVEDRAEAFMGPWEE"
     gene            <232491..>235817
                     /locus_tag="LDBPK_090590"
                     /db_xref="GeneID:13392090"
     mRNA            <232491..>235817
                     /locus_tag="LDBPK_090590"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858691.1"
                     /db_xref="GeneID:13392090"
     CDS             232491..235817
                     /locus_tag="LDBPK_090590"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858739.1"
                     /db_xref="GeneID:13392090"
                     /db_xref="UniProtKB/TrEMBL:E9B9U6"
                     /translation="MASPTHSHASNAGSRRHHTPLLQERSNSLTRRQEMLKLQNGQSS
                     TLHYSASPQQEGAAADAAMPGTVVVCGVRSAFPLIPLAGEALIASCSAVLETPSPQCS
                     PSSLRGVPCLRRPSSPTAATLFQRQDSGTGIGGDGPCIGNGTSAAGLPPALRTRNRAA
                     HDATGRPPRVRPYDGQEQLAEFDAEAGVEEDRLSWGLEEDDGCEAEDARSASTNAASP
                     HESNGRSSGESAERPDVAVEVIQPLVASSEEASPPSCTKRAPPPSQVVTACVDAHPIT
                     ETAKAHTPQARHLTYNSDSSLDWLGDDQTASEEVRPRDSRYPTQESLENHSDDCEGRR
                     ASQSAGQPPARSCHAQLEQATVSPPCAPTTPTTHRQSVQTTDASASVKTNAASSTLAA
                     QLLAKTEGRRSSPGAGKETLVVQGEVMPGVLQTVGPRVMSASSDDRSRNQRAGKGSIH
                     VRAAEVEAAHSASWQTQGPQVISASETCRASRQAVESVDPWYTDADQQPSLLQTVSSC
                     NLLGSATDLSGVNSRRKIYGSMVEYHSSTPVQAEETTTVSQASPTTAAEDSADQLQSR
                     CAGAALPPRSPVDESTSKRPSLLASRPSSRTGTSDVEEDYDGHPSQARRADPKGATES
                     MVAGAGDCRWGEVDEVPPMHQPHTRKGELHDEGGKDDINAMNGRKNESEEHRQQQRPA
                     EEEHAVGAAAARGSDGEHGLVLQYRPQVQVSALEAHQIRSSRAIARESNSEIHQDESI
                     DVHEENEDSTEYISCYDVACQTSQHLLMSVREEWQGRAQSRQGASGEGDVSKIGPLDP
                     HYVGSNRWMCAAGVCPQCHPKRRVRGSSSGFGGLSKLTWPLAPRSTLGYSAPPRSVPL
                     QRPQGPARAATAGRDARLPPLGSSLSASTRAHPQLPPASLCQQRAQRAPSARQHSSTY
                     ASSSSSAGRHYRRDRYSPTVTSYQGGYCFTREWDAQQQQRQCRLRELQMEQRARRGGT
                     GAAYTSLLLLTSHDMRSRERAAGKEPRTYRYCNLESQQMMVHTGVGRADLELESYNDT
                     LHGAPLIEAQEEDNDGAVKAIEAWKDREVSEQTQLRYPAAAVVSAAGSSNAATNPSPR
                     SHARPAASGSAKASRLCVLC"
     gene            <237646..>239421
                     /locus_tag="LDBPK_090600"
                     /db_xref="GeneID:13392091"
     mRNA            <237646..>239421
                     /locus_tag="LDBPK_090600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858692.1"
                     /db_xref="GeneID:13392091"
     CDS             237646..239421
                     /locus_tag="LDBPK_090600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858740.1"
                     /db_xref="GeneID:13392091"
                     /db_xref="GOA:E9B9U7"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9B9U7"
                     /translation="MKPTDAGTDNNTHAASVFDWAEREMHLVVSLEAFLHAWAEGDRE
                     CGRAKAASSAATEAAVSREDERHHQAGAHPNPILCASGLDAASLATARIESAPSTSTL
                     ANEYLAALPPRLPAPPPRSFRPNEMMPGVYLGSWSDIGTDILELARRLRSVSTGTHES
                     SSCTASRSSQRLVLLVRACPVKGVVAPRLELRVTRRHEGARRLRLSTEKVAPVPSTKA
                     AAAGGLQQPSQRPPAMHSRKLPGAATTAAPADEDVVVAQMSLSEVYKRVCAAVPTTKA
                     DPVSDASVICAEATASSKGENYYTSGSIAGASSSTTTSGVSTVARWLCPDSPLISPSR
                     SASPASSTAADVPSGCTSADWHVFVRAMQGVLTEEASAHTPAGAALNNEEIAETAEAE
                     RHPCSAATTELRYWRLTLPILDSPGTRLLHYTPMTSLIMRAALTLEEHPQGRAWLQGQ
                     QQRREVVNNNTPADGSHAMVDFASEGGACGEVGACATEARVFPCVAVHCQAGKSRSVT
                     FVAAFLMQEWMWCYRGCYPPNTAGAGTRTAEQQKEQRGRQGSIARRLVDTVLSYLRRR
                     RLCIGINLGFDTQLWEMMCGFVRSL"
     gene            <240430..>241218
                     /locus_tag="LDBPK_090610"
                     /db_xref="GeneID:13392046"
     mRNA            <240430..>241218
                     /locus_tag="LDBPK_090610"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858693.1"
                     /db_xref="GeneID:13392046"
     CDS             240430..241218
                     /locus_tag="LDBPK_090610"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858741.1"
                     /db_xref="GeneID:13392046"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9B9U8"
                     /translation="MPPAHIFIARHSERVDHMNREFAKTYSRPHDSPITENGVVLAEK
                     LGEYLVRHYRVDPADVVVITSPLLRCVQTSNAIVTGALRAAAASAKVDTIPVYLEPAI
                     MEGPYWMFVDMCNNPSVVEPNGGPFHCPEPVYNDAAFHRASTSPHVQLQNPFPLHPPP
                     VFTVKDNKLVDSSFPERCAQASKRLLAVPELDGKTVVLVAHGETVLRALHAMKNTEMD
                     AEFHSPPYTGLVHVTCECSGAETRVSVEYEPFATPHLPAEPMES"
     gene            <242144..>243613
                     /locus_tag="LDBPK_090620"
                     /db_xref="GeneID:13392047"
     mRNA            <242144..>243613
                     /locus_tag="LDBPK_090620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858694.1"
                     /db_xref="GeneID:13392047"
     CDS             242144..243613
                     /locus_tag="LDBPK_090620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858742.1"
                     /db_xref="GeneID:13392047"
                     /db_xref="UniProtKB/TrEMBL:E9B9U9"
                     /translation="MSASPSSSSTAAASASPQGTVEVLLCDGCRCPIGSLWDVLPAEE
                     AVPVWREQVYSYELDLFANGSPPIQAYSATNPSARRFDLLRLAPHVTLRLASTPSGEA
                     PPPGADAFRSCNADTSTTAASVLDAQKCEGPVQVEEVSTTHAQPADATGTRGAASTTL
                     HAPSFVECNTTVYSTEHSFFAGYAWCFCNCSNCGAFLGWGFAAVDRLRAARRLHRGSK
                     SGGVSENGDVGRARKKGARQEEEVRKAETDTATAAAAGDSQPAESSSPPVAPSAPRDQ
                     RQQRPRGEGDGCRSGARASDLAPPDDSDDSSDEGTSMTTTTDSNDGDDSSAIGGAQGG
                     GQEHTNTGVTPDFIGIIITHCTGDPDYPIASLMRDVEWRAARQRRRKRVEALTRRLSL
                     LLPQMRDSYRAHEIYHDYHAMEQLLYAAPLLPLQEASDGFATAVTALLSDVDEDGVPI
                     CMHDTVEAARIAVARQMDSENCSGVSGHSSSGHEGNNPS"
     gene            <246951..>247808
                     /locus_tag="LDBPK_090630"
                     /db_xref="GeneID:13392048"
     mRNA            <246951..>247808
                     /locus_tag="LDBPK_090630"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003858695.1"
                     /db_xref="GeneID:13392048"
     CDS             246951..247808
                     /locus_tag="LDBPK_090630"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003858743.1"
                     /db_xref="GeneID:13392048"
                     /db_xref="UniProtKB/TrEMBL:E9B9V0"
                     /translation="MAQQARRLSMAALMAFVVYVLLLAGGVTRAALTAAQNSITAEFL
                     RSFAVSIPGLASVWTGDDWCTWPYVSCNADTNITVIIDNAGFTGSLPELNVAGDSANI
                     AVTEISLTNVDIGGGFKNSWGGLKKVRVLNFTNTNLFGTIPASWNAMRSLQTVILKNS
                     SACGSLPRWTLPSLKNIDVSNNLLRGSMPDTLGYIAGLQNVSLVGNNFCGCSPPSWVS
                     RVLTSALFQAMGSAPYKPNCRAPINCGSEGAKCSRDPPQYRDAAAAPLRVVVAVLTLV
                     LALVCNFSV"
     gene            <250281..>253271
                     /locus_tag="LDBPK_090640"
                     /db_xref="GeneID:13392092"
     mRNA            <250281..>253271
                     /locus_tag="LDBPK_090640"
                     /product="ATP-dependent DNA helicase, putative"
                     /transcript_id="XM_003858696.1"
                     /db_xref="GeneID:13392092"
     CDS             250281..253271
                     /locus_tag="LDBPK_090640"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase, putative"
                     /protein_id="XP_003858744.1"
                     /db_xref="GeneID:13392092"
                     /db_xref="GOA:E9B9V1"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9V1"
                     /translation="MDESQIRAATYPAGAALILQAGAGSGKTQTMAARIAYLLQSGVP
                     GHSILGICFTRQAAETLRERVRSTLPPTLTREAHALKLKTFHAFGLECLRRFGALQSD
                     THVLDARQQYELARRVVDTYAQREKSSEAVTDLVDYVNRVKTMKVPPIPQSDPALQDA
                     YLFPYYQKALHEERNAVDFGDLQQMFYDLIRPVPVTAFAASQGCGGGLDEQQPSQGEH
                     QPQQQQQQGKMVPSDVCTALRAEYTHFVVDEFQDFNEIQVELLALLAGDACRVTCVGD
                     PNQCIYTWRGAMPNVFGVWKKRFPQTAVLTLAMNYRSDGPIVEAANRVVKATQMAHHH
                     REERAVTLVQCASEDDELQAVPLVINHVLRRRDAHLGYGDIAILCRSRRRVQLYCDVL
                     QSQRIPVRQLKGMSVDHLASMRSLLAFLRLCVSPHGPEGDANVRTVLNTAPLHRLSAG
                     AAKKFFLSLDSVCQARRAMEAARIRSWRHTIHVDNGSEVGADNGGAQGSRSEGLQPGA
                     ACTSVISGGCPVVATPGVHPESYSFFAVLQELVYHNFSHELFPKLEVSKKNQKNIRSV
                     VRIVVHARELLAQPSCDVEQVLRYVLREGGYEGESMAAVAARTSTPSAATRGAKRARH
                     SAAGWGSDRCADEASGRSSASAYQPRVGALLMEQCASQHNQRQQRYTSSSAAASCSSA
                     GGGGGRWDRWRHGSRRSGAASGSDGVVDEDVLPPEEEAAVWQEQRMNLSELVLHTYHS
                     VREALEREVAHELEKEGGGGEGRGEEASSRSRPSQASGNHSNSRTQLFSKATAADDSV
                     SNFSAGSTTTTMTVMQALRPPAVVLHRVLDEFVSLVSSDDYGPMREIGNADDAAGAAA
                     GAGTAGNSGRLPTSTSPHWIGQVTVGTVHRAKGMEWPAVLLPGCWVGEYPVRPREEEK
                     RVFYVGMSRAMKHLVCFTAATRECRSGSGQAATTASVIDLPAQHTQSGTLEPTPYLAA
                     LGDKLERVNYADLKTAYLKEQGCL"
     gene            <254223..>255230
                     /locus_tag="LDBPK_090650"
                     /db_xref="GeneID:13392093"
     mRNA            <254223..>255230
                     /locus_tag="LDBPK_090650"
                     /product="cyclin 1, putative"
                     /transcript_id="XM_003858697.1"
                     /db_xref="GeneID:13392093"
     CDS             254223..255230
                     /locus_tag="LDBPK_090650"
                     /codon_start=1
                     /product="cyclin 1, putative"
                     /protein_id="XP_003858745.1"
                     /db_xref="GeneID:13392093"
                     /db_xref="GOA:E9B9V2"
                     /db_xref="InterPro:IPR005320"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:E9B9V2"
                     /translation="MGAPHLNSIRACLAGSGHDAFSEPVTIDHLLSLVATPKTGVVSV
                     AYVGTATYDLAESQAEQTSLLLQRGWTVRPIQVADPAVKAVNDGDAHFIQTAADIVLV
                     SGGNTLYAVRRWEETGLARLLKDAAARQVVMAGGSAGAICWFTSGHSDSADPATYLQP
                     SLKRAALKMGLIPQDQISKTEAELADLSTSWSYIRVRGLNILPGMLCPHFDVTQGNGV
                     RREEDFTKMLKRHPTERGIGVDHWALLILKGDGTYESAALPGKTRVTTLGNTSPTSTV
                     PGIFVLDVVDGAVQRRRVPTTGQLSDVLREPAGPVVLDPFERFHAMENPTSSSGSLMQ
                     R"
     gene            <256017..>258929
                     /locus_tag="LDBPK_090660"
                     /db_xref="GeneID:13392094"
     mRNA            <256017..>258929
                     /locus_tag="LDBPK_090660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858698.1"
                     /db_xref="GeneID:13392094"
     CDS             256017..258929
                     /locus_tag="LDBPK_090660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858746.1"
                     /db_xref="GeneID:13392094"
                     /db_xref="InterPro:IPR028146"
                     /db_xref="UniProtKB/TrEMBL:E9B9V3"
                     /translation="MLPYAMARRGKHSSTSSEETQVHAEAGADASARLPAAAPTLRQR
                     RAKADDASAAHSSSAAAAASGAPAPANTNTSAAAGPSSHPTVASSPSCVILFGFGLIG
                     AFFLSILISFLLVQLYVVDGPDVQRTFVHLEMAGKGREWFPVWMSNYLISTVTASRAG
                     DEDSAVVGGSLGAPPGQRRSPAPPPLTGTRSGPPPAPQGTASDAVSAAAAQNSTPAAQ
                     SSSSTRLHCYTLEAYSETFLQPHRESAAPPLFSCGTRVVDLRSEERREVLAACQAGSG
                     AEPLRDGSADPNREGGSLLPTLRVVLTPQEVQWHLVVQPANVVSQRIPLSRVNDDYCD
                     CLDGTDELLTNACSMSGPLTPAVGTRWKSYLVSNQPLRLWETDDVIAQEDAEARGYPL
                     QPRKRGDVGDRLYVSSGPVLPFVCICGTARQLLAPSLVGDGIVDCCAAEDEVVLQGTP
                     YGGASPHRLSDDPKVVEANNRALEATRAAMIMQWKQRRASAAQYKTATPSLYEDKLYP
                     YHTSARAMLVDKGYYSLYTSLEVQQEKQAAAAVLERIYADGHRIQRRRVQKGWDRLGR
                     HLVGNRTKLQLQLSNVTRELESLEEYVRYRMDEARTNDPLAAGVSVQQLQHHARLVHM
                     HEALNSEIQHISLTTLHRAYGDHYEYYPLVRRIMQLEASHLVDSRTPTTLDDATAQQR
                     RERIITPTEVERMNTAAYAAQQPAQPLHVDNISVSDYGLEVMRQTFVAQRFGSREAPL
                     VAQRLGLLPNNNISAYTPGVFNRTTSPFQRAPVIPTGSWQPYQSHRDGRVMVIADPAG
                     DVHLACRACVRPASTLFRGGGRMQWPTRHPEAPPMLSVSNAMEAKKTAKDKLKAASAG
                     ETAKVSQVYTPYHTNMPSVFAVDVYTGDIRCEHDPPLTSSQHRTRGAGRDEDTPRSRA
                     QSVKTHVTYLCDTKDSILHWASNGKCLQEVVVGTPSACTGWAWKVATERMKEVGKA"
     gene            <259987..>262263
                     /locus_tag="LDBPK_090670"
                     /db_xref="GeneID:13392095"
     mRNA            <259987..>262263
                     /locus_tag="LDBPK_090670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858699.1"
                     /db_xref="GeneID:13392095"
     CDS             259987..262263
                     /locus_tag="LDBPK_090670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858747.1"
                     /db_xref="GeneID:13392095"
                     /db_xref="UniProtKB/TrEMBL:E9B9V4"
                     /translation="MPQPSFSRVPVGLDGSPSSASVAVSGAAAANAASSTTRSPTTTT
                     AGTFVSPSVLLLRRSINDPYYFASRAQFSHRHHHHLINRDTAVGSGVAASTRSPMQRS
                     KHRASPGGGGTVSHVTPMFTDDKKRDDSDRVDKLTQQQQQQQAQQPDGGLVAIENTPT
                     ALRRRAQYSRAKPRPIPNSLRTGSDAIAVAAAVDTFYTTPFLQLALREAAEREVAARL
                     RLSVQKMSSKLHTVRVEGLKEATAQLLQWTTQASIESAERQQEQQQQQQTKSDARHTD
                     SAAAAAPMGQSNLVLPPYDAVRVEVLGGSSPAVAHGHYPHHQRPTSSELPQRRDNEAA
                     AARCANALRSPSWDVVQHALEGVDYTSSIFNTILVPRLEVRNAMSTGAPISVQLPSDV
                     ALQWTTLPTTSRSAAGAASGAASQGTPPPENKLLRAATAVTYEEQELALRYIQGTCLI
                     LYHQRRCCAEGCLLYYATEVFQCMRSHIDALFTSQRREREEREGEEQTCQRGKRGLST
                     NHGSVTGARTPGTSSATTAAAFTAALRESGRSQVSVDPSLVRVVVALVDAVEASCHYN
                     PSSLRRFVQTGGVTAMLNLAYCPFMPTPIRAAVLNTISVLLQQVTPLRRYVAAASKAQ
                     GTSSPRGRGGVVEPNPDPLLQRMLENAVHDNPLGRDGQQIPYSTDFGSASKFDSAVRD
                     WFFANGLGNVIASVAQLQDLRNTFQPASFIVPQGAAAATAAATATAVTHANMLREGEL
                     HRKRIGWLLECMDGRELR"
     gene            <263754..>267233
                     /locus_tag="LDBPK_090680"
                     /db_xref="GeneID:13392096"
     mRNA            <263754..>267233
                     /locus_tag="LDBPK_090680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858700.1"
                     /db_xref="GeneID:13392096"
     CDS             263754..267233
                     /locus_tag="LDBPK_090680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858748.1"
                     /db_xref="GeneID:13392096"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:E9B9V5"
                     /translation="MNSLQTSAADAAVACLRVLHRLLQDEEVTLAQLSYLIENVHDPL
                     AHVCLPPSQRPMVVAIPQLSSPSASVLNRYSSPAKHAHPSVPSTMAAAAANEVKARRL
                     PPQPAVVETAAPAPKEATPPKTAKSTGRMRKTSRKASRTGAVSTKASSSSSASRAEAR
                     VPLTFSQYWAIFANLPTLYTVHLTLVQQLDKVLLRLTQIVDELHPATQDTASSEVLHS
                     SAAIPVPDAALNTRKHASALRNPSASPAAGARSVYNEIGIMVCEFFGSELMKHFMAEH
                     MMYTVKYTQQAAPQLLRLSRLWRWCAESSGSSGVSAASLTHLSEMDQKTILQNDLFLD
                     FLWRSFGPSGMPDDDRVCIPASPELQQRTAAGGQGQALPPARALAGGSGGARRSRPTA
                     AASSPAAHLPPIPAMWEGFRTLLVLLATPLSILRRYSHVARCLVESGALLPNYRKRLQ
                     SCFVDVAALRISEETNLVVEELCLHDVRGIMALMDIPGASTNSGGSGGEPSNSGAVAA
                     LCSAGAPANHSSRVLIHYGRLLKRFGRGRHERLIFLFSDWMCYAEESSNGRFRVRGTM
                     PLSGLRVVEARDDPSLGTVNCFELVLPSLSKRITLYAASPEQRDQWVDAIRYTVRRFE
                     AQRQRQAATNGSARSSDMNTAAGDGGMPSVMRPTAPMLMSNSRLSRQRHNDIKWQAYG
                     NLQRRTTEMAPQASHMISGAARVPLPAVAGGPVGGSSSFPVCHSPPPANIPSGDPSPN
                     NSAVRHRSGSTHRHLDYNIAPWSARASVHRRIRSQELIAVHQQQLAVSSSHIATPTQA
                     DGAPPGGGGATVESNSNLNPMVVPALDTGNMDSASPVRAGDRNAPPQKQHSRQILSPI
                     ASTAAVAASTERRSSSSFHSFTIDIMVSSNRGSGGSGVSTPLRRPVSERFEAVKISSR
                     GGNPPHQPLQETFALPEKAARHPGGKRVASSPASSSNSSSGVLDSVIGTAGPPTLVTD
                     GIPASGEPLSASAGAQALRRADSGPPNKSVISVAKVPPTSVTVAEENNSRDSRPATAG
                     DQSASGTGSVMSAAALLEQSVNGGAEEDDSMTATAVVTAFRSPGVIYHRLMTPTSPLV
                     MESRPAAVPRESSDVPSPFRPIMDSSMDFDANVRKPMVAAEPLRKTVKPCHVDPIAKV
                     SHGGDSDDGPVQS"
     gene            <268467..>269969
                     /locus_tag="LDBPK_090690"
                     /db_xref="GeneID:13392097"
     mRNA            <268467..>269969
                     /locus_tag="LDBPK_090690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858701.1"
                     /db_xref="GeneID:13392097"
     CDS             268467..269969
                     /locus_tag="LDBPK_090690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858749.1"
                     /db_xref="GeneID:13392097"
                     /db_xref="GOA:E9B9V6"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:E9B9V6"
                     /translation="MLMLIFGTFIGAIALVGTFMYIVIMGPTRYHRDGVVGKLHRLLT
                     SVPLCVCGFCVSCCFGCDQRKGRLCCSRCAKHTIHERNWFMVIFYVVLVWTVEGLYLL
                     VSLPRLKASITSKAVSWVLVVLSEFLWACATFSDPGTVTAEADRAAQRQQFATKAATG
                     AKKRLLSRETAKSRAGIAGQGTTPGNSKSRRSFLFSPAEEFVLNHRYIVDGMVYAIAS
                     DEAAAQLTRAQKEYTSPTVGQPVQLGQSCTTCHVSRPSRSKHCRLCHRCVRRYDHHCP
                     WINNDVAERTTRYFLGFLLCHAMSCTWACIDLFRNTRQFLVTHHAWGWVLRYPNGRTV
                     PLNLSQYLAILVNFHLLEACLFFFAFFIGLVLYAFWGYQMTFAVANLTVNDLNKIDDT
                     VEFVVTLPTLDLVYRESRKVRERLEQVAERKPKALLALKEPPPPKTEPGYEEGGKENL
                     AYRKRAKKMLTEDLKGLYDRGVWRNLMEVLLPSAPLRDSAVLAKATACVL"
     gene            <270974..>272896
                     /locus_tag="LDBPK_090700"
                     /db_xref="GeneID:13392098"
     mRNA            <270974..>272896
                     /locus_tag="LDBPK_090700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858702.1"
                     /db_xref="GeneID:13392098"
     CDS             270974..272896
                     /locus_tag="LDBPK_090700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858750.1"
                     /db_xref="GeneID:13392098"
                     /db_xref="GOA:E9B9V7"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9V7"
                     /translation="MATTASPQTGSSPTVPTPVAPPSIDEALSYWIGLSRLIHRVCVT
                     SDSTPSADECVPSDRLQRCIGNAEGEPSTFTRYALHRVLLCCGIKQHRVRKTADHMLA
                     QLLSAAYTTAAALTVPVVLLDNESPASTPFRSPVRQLPVPLPVLVADWLKQSSADDQN
                     ASQHNRYCLRVPAVTWSRSIIKWLGSELRGQMISLRPLSRWSMVCAQQSGRMPVVIFV
                     GGASGAGKSTLASLVASQLRVPNVLSTDTVRQVLRTRLCGHEAQFPALFVSTYEAHKV
                     TADDGHVSADNGSAVPHALSADENAIVQGYEAQCELVLRVLDGMLARLLARRESIVVE
                     GVHLLPRYLAAKRAELLVSRVACVPVLVRIPKADSHLERLCIRARGMSMRAQNNRYIA
                     SFKAIRTIQAHLVDSVEAASLPVLVLSNTNMDKSFTALHHTLLETMEYAAVHGWPADA
                     AAAAEVPLTGLVFTSVKDRLVAVVRQRRCRRSATDDKTNTSSRTGASAPGDEEKGGVA
                     PGPCGALVLAPHARLPAHSPAGSSSSSSSNGAAPRARSAELLGVVQRCLLEQGLRYHS
                     RTSNAQADAATVYGSSGVLGARDASSCFHAHVVVRRSFTIAAKSHIGLTASSHLPLAD
                     RNDELDEVEMPSLIGS"
     gene            <273554..>274612
                     /locus_tag="LDBPK_090710"
                     /db_xref="GeneID:13392099"
     mRNA            <273554..>274612
                     /locus_tag="LDBPK_090710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858703.1"
                     /db_xref="GeneID:13392099"
     CDS             273554..274612
                     /locus_tag="LDBPK_090710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858751.1"
                     /db_xref="GeneID:13392099"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:E9B9V8"
                     /translation="MSDTAPGSAPAPVTATVDAPPLSAPTKVKPPRKKPPRTEEAKPR
                     LLAPANGVSAQQQKQRDKEFATHKAHILANLQTNVCDLSPKGSVDAKCLPVMDVLNTH
                     KDYVTTSSCSGRIALFHSIKHSEACGADDGTATPRPRMKRGENAALGWVFVKHGMLRP
                     MEMAQVVGFLCGAPTTPEDVALDAAQLEKHAAHMASVSGSAHCHGAAPGSLLAEMYDG
                     EVEGVLVAARMSGDEVAALPVPTRGTVSLKMEPFVMHVRCRTMEAAKLLHSAAVSDSG
                     YRNSGVVPPGKKIMCGIRGAAGLGLEVPVVLDGVNHVASQRAYVWALLGLANEKMEAN
                     EKKIRLLEKSVAARVLPA"
     gene            <275326..>275742
                     /locus_tag="LDBPK_090720"
                     /db_xref="GeneID:13392100"
     mRNA            <275326..>275742
                     /locus_tag="LDBPK_090720"
                     /product="prefoldin subunit 2, putative"
                     /transcript_id="XM_003858704.1"
                     /db_xref="GeneID:13392100"
     CDS             275326..275742
                     /locus_tag="LDBPK_090720"
                     /codon_start=1
                     /product="prefoldin subunit 2, putative"
                     /protein_id="XP_003858752.1"
                     /db_xref="GeneID:13392100"
                     /db_xref="GOA:E9B9V9"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:E9B9V9"
                     /translation="MSVNTSASESSLTEEQIVQQYNRMRQEQSAIMSRIAELENESHE
                     HDLVATELRPLNKDRCCHRLVGGALVELTVGEVLPDIEENLAAIREALGQLNKGLMEK
                     EKQMDDFMTKHKLNRPGTNQAVTANQNNEGNRGVLA"
     gene            <276278..>277390
                     /locus_tag="LDBPK_090730"
                     /db_xref="GeneID:13392049"
     mRNA            <276278..>277390
                     /locus_tag="LDBPK_090730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858705.1"
                     /db_xref="GeneID:13392049"
     CDS             276278..277390
                     /locus_tag="LDBPK_090730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858753.1"
                     /db_xref="GeneID:13392049"
                     /db_xref="UniProtKB/TrEMBL:E9B9W0"
                     /translation="MFPQGLIDQWLSKSRDGRRSVREDRKATPAILDNIDRLEEYCRS
                     HPYDVFCASTLQHPPFALHALESEAAEQQRLAQPPPVFAATVPSPSAHTTASNEVRGG
                     VCGRYADGDESRASVAAARQHLHNVAARLAAYLQSSGAVRSSASRHKEESQCTVVADF
                     FVHLLSEAAVAAVYRQGIAAQVEAEERAAFQHRQSRRRLQLRVDSKHDGTLERLELSD
                     SKGAGTEAVHEVEGLTVVRPIADYRRLSQGLASLWSLLAQTERRGGLAAGGPPSKKRS
                     RESTVDTGSVNDNNNLWTRVRVDCLRHWLGDRGLPPPPPLQGTAALGESQRKTEASSP
                     AMPGGAWWSRPLYISERDVEFALRKVLADVTASTAS"
     gene            <277683..>278603
                     /locus_tag="LDBPK_090740"
                     /db_xref="GeneID:13392050"
     mRNA            <277683..>278603
                     /locus_tag="LDBPK_090740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858706.1"
                     /db_xref="GeneID:13392050"
     CDS             277683..278603
                     /locus_tag="LDBPK_090740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858754.1"
                     /db_xref="GeneID:13392050"
                     /db_xref="UniProtKB/TrEMBL:E9B9W1"
                     /translation="MSSKLINAVCTMATRECVAELALFHRALRTLHPTLPLYLGCSSE
                     VRDAAEAATDATSQLRALYDDAHVRWVLCLDQYGPVISRAEMERQRGVWYPARHTDFM
                     MEKANLMELALMTAEPSTPTVAFLDCDIILLRELPCVPAAAAVALSPHWIRESDEAIF
                     GAFNGGYVVASTPEVLWEWRQATQTSRYFDQASLEHVAAVFERRAQLHRLPPQHNYGF
                     WRLLQSRCGSVAEEAKRFSIAPAPSPGSEQQPAPMAVHYDGAPLCSVHTHFLMPDPPR
                     DVRLFNAVLKRWLGRCAATNPVCAAVLAHF"
     gene            complement(283715..283830)
                     /locus_tag="LDBPK_09rRNA1"
                     /db_xref="GeneID:13392051"
     rRNA            complement(283715..283830)
                     /locus_tag="LDBPK_09rRNA1"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002966705.1"
                     /db_xref="GeneID:13392051"
     gene            283949..284020
                     /locus_tag="LDBPK_09tRNA1"
                     /db_xref="GeneID:13392052"
     tRNA            283949..284020
                     /locus_tag="LDBPK_09tRNA1"
                     /product="tRNA-Met"
                     /db_xref="GeneID:13392052"
     gene            284079..284161
                     /locus_tag="LDBPK_09tRNA2"
                     /db_xref="GeneID:13392183"
     tRNA            284079..284161
                     /locus_tag="LDBPK_09tRNA2"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:13392183"
     gene            complement(<285299..>286846)
                     /locus_tag="LDBPK_090750"
                     /db_xref="GeneID:13392147"
     mRNA            complement(<285299..>286846)
                     /locus_tag="LDBPK_090750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858707.1"
                     /db_xref="GeneID:13392147"
     CDS             complement(285299..286846)
                     /locus_tag="LDBPK_090750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858755.1"
                     /db_xref="GeneID:13392147"
                     /db_xref="UniProtKB/TrEMBL:E9B9W2"
                     /translation="MYSFSPVMPSKTAASPANELVSSSSNSSVELVDDIRESLDRIEK
                     LLNRGQQLLYGDNAADGKQAYSKGAAVSPDGEPADADAVSIPTARHVDANCGSYQLPS
                     GTHVGLPLRGTGTSAAANASFYPQSTPQHPASRFQRNSEKLCQRLSGESNHRYPLQNG
                     SNRSSLHARPRASPASMGSKRLPPGFKKDKVLVSVRGRRIVQIQKEGGIVPNFEEGLD
                     AHDTPQNFTIEELKERIRRELEEYRRLGPLMHRYESFRRRQCVTVAKRAPIMKIASRT
                     FTAATTAALGSKPVKHVPALASGATPQRAANRFGVHAAAATTKSGPQAASASRQAAKS
                     TNGTPVRSTLRNSHEKGRVETRRANRESHPPVMAPPVSNTYSAYYNPLQMSAGSRSAP
                     CELSSKQTAGCSYVVPPHASNVSTRKPRSPSAAAVSKSSTTTSELATEEPARVESLSG
                     PFMDNKVHSTSTQLSANASPAQLKPPTRTTEPQDDMEEVSLPDSMEDCDVSQPYVAPL
                     DLSVIKK"
     gene            complement(<288226..>289776)
                     /locus_tag="LDBPK_090760"
                     /db_xref="GeneID:13392185"
     mRNA            complement(<288226..>289776)
                     /locus_tag="LDBPK_090760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858708.1"
                     /db_xref="GeneID:13392185"
     CDS             complement(288226..289776)
                     /locus_tag="LDBPK_090760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858756.1"
                     /db_xref="GeneID:13392185"
                     /db_xref="UniProtKB/TrEMBL:E9B9W3"
                     /translation="MRVAATGGATSSAASPAGGNASTSSEVRAARRITEAVLSARAKH
                     KLQHRQPSPPAPAPPSFRAKAKAPRSPESGIEDGVVKDTVTAEVQTAARLALSYGKSA
                     FMTHLVHQHDDAHQRPGTASASEWDQPMVSDAGEPEASAVTASSETCAVLPLRAGTPK
                     IPRAAAGMPGLQMAIDKWWDDLTDEARVRWITSTPQGRRALQHATKLTKFGNVFCGRG
                     RSSNSGAHVVPSMESMLTKYKSTLVQPRLPRAAALVPSPKESILRMKLHDEKDASANP
                     SWKSTTVSSALAGMMHAASENNANRRRLRDRADAVRREEQRKLWHQALVQFLGGESAF
                     TFVHDVKDLQQPRTEAEQAVKREADAQSGGGTGHATTVAPNTPAATATGNATPKEMAD
                     AGAPVAFSDGLLDMCEGLGIRSPRRAYVLSRVLPEVDAANASEGPPLSLAEVQDLAKK
                     CSTEYDELRDDAVRMAHEAGFASAEDAVRAFEREQLALAVARVQARLLMFQENLPLLK
                     RCVNVLSK"
     gene            complement(<291313..>292323)
                     /locus_tag="LDBPK_090770"
                     /db_xref="GeneID:13392053"
     mRNA            complement(<291313..>292323)
                     /locus_tag="LDBPK_090770"
                     /product="cleavage and polyadenylation specificity factor
                     30 kDa subunit, putative"
                     /transcript_id="XM_003858709.1"
                     /db_xref="GeneID:13392053"
     CDS             complement(291313..292323)
                     /locus_tag="LDBPK_090770"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor
                     30 kDa subunit, putative"
                     /protein_id="XP_003858757.1"
                     /db_xref="GeneID:13392053"
                     /db_xref="GOA:E9B9W4"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9B9W4"
                     /translation="MFVDDAAGTHFDFEDTLPKEQPRTEKKLEICQDFQRGRCRLGDA
                     CPQRHIISAYRTVQTKVCKHWLRGACVNGDNCLYLHEYDNRYVPQCAFFERVGECTNP
                     ECPFLHTKPNESQPECAAYRRGFCPLGPKCRLRHVKRESACPYYLAGFCPLGPRCPLG
                     HPIQERYDRDAVSKRILAKMIVERADDPTFNRSATCYRAGCFDPGHLAPDCPGPQHSV
                     LHKALGEIQEPGQPTGGLESGGHGGGGGGSHRRCFLCDQEGHTVKDCPMNTHRNQHRA
                     GGGGGPGAPHGSGGGAGMGSRRRLRREGGAGGGGGGSAGAGAGGGFGGGGGRRRPGRD
                     HY"
     gene            complement(<292988..>294883)
                     /locus_tag="LDBPK_090780"
                     /db_xref="GeneID:13392054"
     mRNA            complement(<292988..>294883)
                     /locus_tag="LDBPK_090780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858710.1"
                     /db_xref="GeneID:13392054"
     CDS             complement(292988..294883)
                     /locus_tag="LDBPK_090780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858758.1"
                     /db_xref="GeneID:13392054"
                     /db_xref="UniProtKB/TrEMBL:E9B9W5"
                     /translation="MDTSSTPLSASAAASSLVSSPFVPCIEDSAHTRRVGRHPVLFQR
                     TLDAVSYRYLTASSRLACTVASSSSDKKVSSVALHATATANAEHAAYVTTLTENYQKL
                     WQQRRLVPKAARREWFETVVVHLKALNALGATLAWLADAPATVTSAALSDHYGERKQQ
                     KSRKPAHDPLPLWCLWQDAQRHLHHMSLRLRPRTPAAGVAYGTREAMRMSDLVRMDSS
                     AFAWRVRQWCRIAALFHSPRCADTEAASSLVDVAEAVHPGMIADVVCRVGPGGSSSMS
                     AALPFPDSFSAEEPEVAHMLLLCLGATSETAAENCLARQYVAGALVYRMLLEVTLGRL
                     RALPRCIFTWRLLRDVVRDHLVTSAAGFLDTDNEQRAVLLEMAAYVEVVVIPYLQHRD
                     CHLESLRHTAAQVHAQFTRLASAKLEQLRAAVARAGAGDGDQTETVAQSKTGTADAVV
                     GDLTAATVPAAEASAEVNKEEQGRLPEAQRHRMAASMEPLLRSACAGGAPAFAKTTAQ
                     PLSVSHTESKSAVQGAKDVIASIILGNTATSDRAERDETGGGHQGDAPTAPSGSWEDA
                     LLSMQHDFHGKRVDDSVLHSSAARISQLQFFLYHYFTQSPTLAFDRVSDTAAAPAHAE
                     AAKEGEA"
     gene            complement(<295608..>302294)
                     /locus_tag="LDBPK_090790"
                     /db_xref="GeneID:13392055"
     mRNA            complement(<295608..>302294)
                     /locus_tag="LDBPK_090790"
                     /product="ubiquitin ligase, putative"
                     /transcript_id="XM_003858711.1"
                     /db_xref="GeneID:13392055"
     CDS             complement(295608..302294)
                     /locus_tag="LDBPK_090790"
                     /codon_start=1
                     /product="ubiquitin ligase, putative"
                     /protein_id="XP_003858759.1"
                     /db_xref="GeneID:13392055"
                     /db_xref="GOA:E9B9W6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:E9B9W6"
                     /translation="MGYNPDIPSTWSIKQLLEYARQRGIDVPSGCEKSELVTIVDEYL
                     TDELLAEHIRKESALDTDVIEDIVGASTASILRHVAHSSYTSVLRRHPEKLQAIIEAG
                     IEQLQSLPFVARLCSARVHSPVQAWLGTLASDCGDGKRLLTVLTASNSDGAASPVCGR
                     FCGEQEMVVRCLDCGADSTCVMCMDCFRHSPCVNHRYRITQSSGGGMCDCGDPTAWKL
                     ESFCSRHRAAAAAAAAAGDGNSASDPLDTMAEEDRVWAVPVLRGIIQFTAVTLLQHTR
                     LQVLQKRAQSRAGKQRRATSGAGNSTASGSGTSTAGSAATARFSDAEAALLNDVARIS
                     DKFDWLEEWMSEVTRQLWELMQASDIAKRLVAQLWAEPVRMAVCGGPGAVATAVRDNE
                     EEKIVRETGTAASMADPVLDALPPNFTCVHMVFLHEASRPVTAHEQPLNATSRSAPWL
                     NNLLRCVGHCLSDAKFRLPVGGLMATYAEYINAQEHAEDKNECLSQYQVQVLTNPDVI
                     CHLMTPSHLPYKAATNTVLHRELSALLYALWLARDTVSGASANPVTETAALSRDGLLF
                     VAHQATPVSLASVTALQSCLSGSPAACYTLVLNRLAWRAFAQVAGSLAISGYICKDPD
                     APTDSQHYPTPDFIGRCISRHMWLWLHAMRVVLSCLLRLPATAATDSSASMPALSHDA
                     IAEALGITTELWNTWRGATAFDTPPDRLRQKGPLLEMLSACRVANGQDEALLLLEHGP
                     MAAAQSRVLGKQPLTEQAGTAANAKTSILAAPALATAMGYTIQALYEISRTMDVVFEK
                     QRDGFCRRCRSIVLERKISTGLPKSQQAAIHRGTSQNEEARDADVRAGARLQAPSTCS
                     VDIVEYTLLEPHAHATTLSNHLPRLFGAVLTAWVIESQRATSRLQSAASSPSAAPAEV
                     LATTRVSGLPRASTNSTAPTGETSGLPVTPAHARRPLRSLLDAFFQLRAEVTRNEQDR
                     LTFSQQLLDSLVMPHVLTGQVFDGLWRRGDYDVSSAVTMYLTFSRGVSAEFDILMMQV
                     LTMELAPADMALQILQRFSYAKRRLRDADTEHASQAPRRRASASHGQQPAEKLPEKPL
                     GVLPTMLAARRPFFRRCLNGYRHFLRLILTIVTDVSKAAFQAPMSSPVIDRIVGGLLA
                     HGKASHSTIVANVNGTARGGDYGDADEDEKDASGNVIKFSRLIDDAIRKLAVAEDSAQ
                     GKQFRLKGVDVWRAHVSLYHIGVVDSHLEEFYKTYRGLASAADAAKPQEAESHALADG
                     NKGDDATGGGGQQQKRISLPPTQLSDTSMYAELVPTTRALLHTDAVLLPALYVLHVYA
                     SCHVPAGVAAASDVKAALADKEGTAASAQESPLCRHDNAMHEGADDGRESTESGSEDD
                     PHGDGREDANVITREALLHATTTLYLCVQDCVSITRAMRAIEGYNGEMASATEKGVIS
                     WDLLELYLRRFAINEPSFTHASCVQWLPLPELVPCQTLLQKLQTPVQLHTHTSNGTPT
                     VTTTSSSADMLHRLRGYLLSNKDADPYGCLEMVEAVLVQTGLATFNTADLLDEQKTKD
                     EAAQSRKKVIQERQAMLMQRMRSRALKASEKMKAAATAAQQQEGQRASEEASGPAASA
                     SEKSPTGGVIGSLLAKLLLELTTLDCCVCRSSTEEPLFLLCHTGTSGVLPQLGALSLP
                     DGRHVHSHLSMCGHAAHKSCVEKVFVRLSVLWQRWNFRSQFYLGPTEFNCPVCTTIIT
                     ALCPMPVLSGGGNGDSTTPTSRTTRVLSSAATPFASLFEELQNGTVSASNQRAVDVAA
                     EFHTTLANAAVGFSPSEDVPAIVSAEDELQQKNEAAWQLSEAIRAFSYACHLQLEAIK
                     AGQELTHRDLIGLLSVLVSIMPAELERQQADLRSNYARNMQDNESLLVMDALLQPRNA
                     NRLISAHVLTQVLPSMPANFVARLLAVACASNKDDNGEGAYAAAAAASLEEEFTGVTA
                     ALWQTVGVLTLLKALVVEDAHHGVVLRSSTFTVAGAVTFAVLSVASVRTPVSRCTSIV
                     RMLQYLLPVPHKSTEAELQVVGQDILACMQAATTTATLSCSRHSTEIAKSVVPYTTPE
                     EWVARIAEKLLHLPSVYTTVLTRFAEHKLCTICHQEPAKPVVCCRCGKLMCMQPPSSP
                     PELYTHTRTCGGAVGIFLVVRTANFYVLELTSGRVYHYPSNYTDEYGEHDRNLRRGIP
                     LFRNTEETQKLVLTWMLNKWGAVSSIFGVSNRMDLSTL"
     gene            complement(<303963..>306959)
                     /locus_tag="LDBPK_090800"
                     /db_xref="GeneID:13392056"
     mRNA            complement(<303963..>306959)
                     /locus_tag="LDBPK_090800"
                     /product="acyl-CoA binding protein, putative"
                     /transcript_id="XM_003858712.1"
                     /db_xref="GeneID:13392056"
     CDS             complement(303963..306959)
                     /locus_tag="LDBPK_090800"
                     /codon_start=1
                     /product="acyl-CoA binding protein, putative"
                     /protein_id="XP_003858760.1"
                     /db_xref="GeneID:13392056"
                     /db_xref="GOA:E9B9W7"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:E9B9W7"
                     /translation="MMRGGAADGAAVLSEFTVLRKPSGDNKYWHTAVHQGEPVTFRVL
                     DDSGIDPVDGAGYVMARVQAMQKHMQEARVDVAAEHAYRAVLVEVSLLDDPMAVPEET
                     QRDMDCAVDLWCPLHLALMTSNKAAAQALLQFHVEHAVTAMTYIASTPSAIGNAGAVD
                     ALDSPPVAPALGDDAPDASGDDHTASVLPVAASPILECHVHRELGGAVVLLGHFDGRV
                     RLSSSAAVRKSRPPTPVRGGSPHAAPISSSPGGIESAIASGCHCSTGTAVGEDALVQS
                     LCKHNDALLREEDALFEDKGEEYCLRNIIIAMRPLLQSVVLEIKRRAQCTTTTAPLSL
                     QHQHHIHKASRACATPVVPESAIDFVHDYCSSLSMLPHHPPLLIDGDTVFDVCNHGDL
                     ALLAKVMDVFEGCFAPILRGQTLLTDRCAGGRSVGFTALTGAALPHNSSLSSPPSLSG
                     TGQSSSPGFLSLGGDASAHSMAGTSHKVSVGRHLHALPPAPFWWSCPPQNVHRLAFVA
                     VWIGCREAIEESSGSGRRRRAVSISNENRVTMVTIRQLQESRVAAQKLDSTIWSGHLI
                     TIMKLLSRECSLEDYVDFVEEGGYFAFTSPRGFSGLFLSVLVSGVMAAALVQEPAMLR
                     VLRCKVETLLADLPGRPSPLRTYVMSRPSTHAERFRELWLDAGCYGVANPGGGNGQND
                     AGETETDGFNPVGGIQSGERRPMKFRSRIELLYYAVVEQVVAAAEEAWTMHEAEDGDS
                     SEAAGGSAAPSSPWPSGATKAEALTALQGWLLMWANFLTSLRDWTPHRGSFSCSTASS
                     QMPQQERPQHSLNSGAEGHLTVGGMSPPLTATTAPHHEHTASSEDLFGDDANETADMV
                     QRVSHALVERLETGQEPLPALRRALFPNGANDIETGAPAAGASAHVDKALPVSSIEQE
                     FASAQHAFAATAGKESDEVKLKFYGLFKQATVGDVNTDRPGIFDYAGKAKWDAWSKLK
                     GISLLDAKRMYVSEYKMMVELRKSRK"
     gene            complement(<308022..>324401)
                     /locus_tag="LDBPK_090810"
                     /db_xref="GeneID:13392057"
     mRNA            complement(<308022..>324401)
                     /locus_tag="LDBPK_090810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858713.1"
                     /db_xref="GeneID:13392057"
     CDS             complement(308022..324401)
                     /locus_tag="LDBPK_090810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858761.1"
                     /db_xref="GeneID:13392057"
                     /db_xref="UniProtKB/TrEMBL:E9B9W8"
                     /translation="MALLEEARRQLDAEVCAYIRSMQPAPPLALSLNNDVGAAAAAVA
                     SKVLPSAADSAARAVPIKPPKSHEAGGGASDESHGTSHASRTAKPPNVKQARARLWEL
                     IKKLQCATFVAAQVSSTDNDAAPALRRRASKSALKTQATIHPEASATAARHGGNPTGA
                     RGRAADADTVEDAAATRTGSRPSSPPHGLVRIASTVTNATTAGTGRGNAAEHNTSASL
                     RRLNASLAFTWDCLHYAAALAEAGLGSDAQSFFLQPIAHDITSPYESVLARCVEQQSL
                     ADGGPLQNSGNASAGSAASAAATTAMRTPRRQHLSLGGGRGREDRKRTSTAGCSENAG
                     NSGARATAEDANVEEGVRVTDALDVFAPDVPLPLALRLHKCVLRYQALSLYIQFGEIM
                     KSDLYGDAAGFATALEACACVEQLVALEQRVLRTPAFSAASVLKREEAKLKEDVRQAT
                     GAPPKTVDTIVVAGCRLVDLMAEPPMESPSSVALVRNARTRDGEVAQHIYAVEDTAAP
                     VLFAMRQYVANMCQRLLAYLSSTSALATNVASAVVRRLIEALRTSLSMSELHHVDTRG
                     PAPAAQNTTDERIRGGVGDKTCIPLAAVEYLPWRLHEYSLLQSCYMHLQEDPSSAPAA
                     VAVAQRALHQVLQLMELEYLDPVPPPASSVYLLESAVQQCAGQLLVAIWRGAFVQDGL
                     PSAMQLAAPAEMVSKMAANGSSCESPRNATATVATASSTMASITALIQQTVAHLLSVQ
                     CSSPPAASAPSLVSLPPRATQQHGQCSGNSTDSMNGTRLLVVLWACIAQVQQQCMLLA
                     GNSEAADALRAAATSGVQYDDEDTPVDGASEAALGKGPVLQSASASSSAGGGLPAAKS
                     AKKGKAFNSSGGAAAPAKHKLDKEAEEAAQLSQEQVAAATAAAGTSSFSPPTSISHPH
                     PSVVALATSFPRMALELTLQLITAIEAAGATPCYTGGTNSGNSNGGSEAVARSSMGAQ
                     WRLSKADAGFGVKDGADRKSLKSTRSRAASMTSFSETAAIATGAAASALFAGVHIRMP
                     HTMYRHCVETLEVLLHGAAMAATELAPVGAETVVPPSSLGSHGSGTRLGALTHAAVLR
                     DAEDTLRFDDGVDVVAAGAAGAAGGAANSLCASTDTTAVDTPHVVQQKAHEASLMPRC
                     FLYNAVDARCLSRSLTWEALFLPSSLMAPGTAAALAARGAREDVEDGVQRSVTAFRTL
                     AMASSQLAIVVRIGVALESWWRSQRQQAATSAKLAAATTASSTAKGAISKKKLNNSAT
                     APRPLPRSSTPATRSVAMEACIRCIELLRVLALNAMIQRHQHRLAKDESALTATLLAF
                     AAVERALSGADAPTTSTNPLLPPVQCPTEELAEYARLYSLAQVGQRLSQLQRRYIGGD
                     GRHVREVGLREFTESAGLFSVDTAAGSCSSSSGGAGGDSLPCTSASPQSLQLYRASAT
                     LLDKVTAALCALPPPPTSSSVDGASESVASSGVTAMAAGGLHTPMMTALSMLKPVVAD
                     VASFLLRCGGELRSQWQRHRALRQLRQATTVHGDATKTNANAVTADAPLSVDERELNA
                     EATYATMVLCVLTSMWRSGTSGGSGGMQLPDDRGVASLVRGVESGFLQLVPALPSSSA
                     TAGEAKAAAAVAETRVPPAQLVRLIAHGVTARRLVDRVRGQLQRRVESLLAHAVPRSD
                     IRDAGAPAAATVATCAKSSNVGQLSTARDALTELTSLWVAVRWQLARLQAHKSSYTAQ
                     HMDLETLTVRQEQQQVYGRTTAKELRILRALEQATPVLPVTAKDEEARLRRWVAEQRQ
                     QQSQSQSRMAVAMSASFLLLDALVCTALVPLNTADPSAQQRLLDEAIRAMLQAEAECA
                     AKKPRKRSSNLRGSFSLTRAATAVAAEALVLYTPVLLWCYLAEACYVYGTREQAERVR
                     AVLDAQMLKEMPVITYYTNDGGAVTAVTTSFVQRLMLQPKWSTLQASSTTTQLAYCRT
                     LNSMAAVDTSKAVSGSDALGSLQIVYRLVLALQIQRMLGPSEAHGGGPEGTGRGTRGS
                     PTARRDSLPSSSAAPAFASSPLTVDTAQQLVAAILNYLSRSSGNTESRPTLKTAAAPL
                     LLPPLVALCEVLLGLPPSSPEWADAAVQLLAVRVLTLFMEQLTYVMSSTMTAAGAVAC
                     LPAVADAMLRLLWATLVHVWNNVLRNPNARQRRSLLAVAQETQWARRVYDGHQRLMRQ
                     QEAVEGTLDAESDEKGAGGSGKSGRHARNTSNGSSEAAAGAQGDSGASTCPVPPLDFP
                     GVVYIAFEGAPDGGSRAQEVLEAKAEKGDGVTRTASAAPASLSPATAATGAADSSKRG
                     SACEPSTVSMHASAPADLVELLEEVLLHVPTLWPLIFSAAMDGGAVADAEGSAHEAVG
                     AMASPKPQRRGKDSAEEAEQQRPPPLMDSLADFVRFAGQSASRVLRSQPAASIADVAS
                     SSSASGVQSSLLRLQGVPAIYADVVVALRQYSAMITHGAATAVTGAAAARGGGGNRAH
                     TGGGGGTASAVLLDVLGKYKDDPAYAKMAVHMVREMLTMCSDAHDNLDNGSGGGAMSS
                     SAGTGTAARKRNTGTNAPGAEVGITPIAARSTSVAAAAAIIADARLVMHTVREQVEQN
                     RRSMEAYLDSVDSETRAWLARDGYGLCSSPQHQVAANAGARESLPIAASAGKKDGGKA
                     AASKRKLANRGAAAKKGAGKSSAPGGNEGGLEDEEKSRHPADDEPSYTAVTRVWNFAE
                     QHHLKRLTCAVAWWRRRRAARTLRHRYTQYNMPFMAQMHLYEAALLHMGATAQYTAVA
                     HERRVQELLCLVSGDGSGDGDPRTGAAVDRKLAVFNPTASAAAAAATQGGGAGSGSPE
                     KLSNSISGALAETPEDLAQTTVELLQHCARAALLFQYLWLPTRASTAVQLAVRHLQQL
                     RVTLPQKGLSVSSTTAITALVNQLLEVPLFSIAAVQHGYWDARRDVHAGVLQPTVVKV
                     GADVSWSHRFRFHRSVPSLLSLVSLLGQHEEMQSVQEARLHALRQRQHEELQLRLCVE
                     SEATTRAEAERDELQARVNILQQMQELLPQLRHSAAVKATLLVAAELLTSFETGLDHL
                     RSRHRSPQGLPDAPQTVSVPSRESVHAAAAEAASTIQYFTFESVPRGGCAAATSDARG
                     TMTMAGSHKEASRGTGGQLNTCSGRGGGDAAGLGSVGAAHYGRDMREAVLVEQLTCLA
                     RVVVSVQPTRCEAAYRVAQRLTAARYAEELLPRILQIETESRGQPRPETRAAYDQAIR
                     NVPEVLLVLRAARTARAQLSNSEAQATNTQQQLLLQPDLASAESLSAEAMPTRDPSAS
                     DTSASWRAAVKLYQRAAQGLRAAGLIQPLGECLYEEGGLYYAASHVSEAAKRWSDAVD
                     CFLSTPHALEDWHRHRTAPPAPPSGRRSLEELLWITAALTALANHAFPTDSPRATDAT
                     LLCALLVHQSWRLPGVVSTAASSDSAGRTAVTRAQQPHLPPAQYCLLDVHHVSASFSD
                     ALRPTVVGVSQQHSPTGMPGALADVTRGLISAAQSLLAKPSSACYSSESAVLAAFSDF
                     VATVVLQDVELTVEARLVRAAAAAHLGSFSVAMRDIYGVCIGAGLPQPVLASLGAEET
                     LPGFYSLGCAAASSAGATAAAVATSLSSPPPSSSATAPSSFYKDEESPSSSHNTAAVR
                     AFLAACLPGLPLDAVAKHNTTVGNSEAAVSALLPLTVGVLASAALEERYGACLTRRVQ
                     LAIAELFVRLGTCDSAFLLTAPPTVAAAAASSSLAAATSSSASSNSAGGGGGQNRASL
                     GETMATPRVGSGGSRGSQPPPPPPAATGRGDRPVNACTEACRYASALLQSLASADVCF
                     ILTGQSSGVMEGGGAAGVGATRPSGSSAAAAILSTQVSKARPGTSSHGAVAGASEAVA
                     AEPRTGVSKQVDGTDGGGGGSVAPGSPCAAWLGTLGAIRQRALLLTAELLAAQGHYGA
                     CLRRLAACIAEHNEAQQYKMYHRQRQSSSAAPFPSHATSTTPHPPSRSQGPHALLKGL
                     GVQGSDQALASFWFPYDHWVRVWLLMCRCYSHLRQYPQLEEAAGTQGLALCTAFGVAG
                     VQKSDNSSIGKDASCWTVFQLYRLYALMQMGRLREADDVVEALELGHCAAAATSSAAA
                     VTADSPAMGIAEDRWVAAAALRWWRTHRGKTIESAASRDVLEQLVRWAITEHGVLPWR
                     PSTCSSSPSSSTVASPPHQQQHYVLVSPSARTILPSLALSRCATTATLWRLHDTMNHH
                     ALEQQQLSMAAVATPAALGGGEASSDEARGSGRAPQQRLTTPNCGRMSNSPSTDMASN
                     LLTSGVPATAPSGAAASLVQALEVVSPQYITSVHASFWFESQLWAAQLKVQEVCAHLL
                     AGAREVDVEVEAVVRGGGGGAATRGKSESACVASQTGVPPLLLSREDVLRALPAPVRN
                     VCDELLRVLHCCVELPVQRHAYVRAILLDLTRVVSTYVRLLRARQRHTPLPQGTQSLS
                     PATTAEPNFVSELESIAAACALLAGLVSDMERRVRTGADSLRGYATDPRVTAAASAIS
                     EANTEEQGQAPWPESLWAALQRTQDTVGRLVPTAHSDNAGGSGAAGSADVLSNPFYSS
                     PSIHPKQPPLGSGAASSAGSAGAESDRGANAGRGYRGSSKRLSALPAPGTLPTMSATV
                     AAQLSVPTIALTYVMLCNEAAAARALTPVADALEHDIAQQLVTRHLQRLTTPANCTYL
                     CYRDEERQALLESVGAVLRQQQQQPQQSSRRGGSGGHSRRVGAASSPSTNAATGADGG
                     GGSLPSVIFTEADVWRALAPPVLLAAVPTSLFSALGADALGAPLYNSVAAAAVCVVAG
                     ARASGGPAAIVGRDTSDGGKASQVRNSSRDGAHEARWQLYLSVSPLQDAEVAAAPPPL
                     LPGSVVASLENCVLLPPSHILNAVAASAESSGAGAAAAMTTTSASVSGTAASRARIAS
                     RQSAAGGSAGATGIHARCTGGSIVSAADRGTGGAWWPPLIASAATSTRELLVPSTNWA
                     LLDSIQQCQLQQQQQQRESSRQDTDGGVKLPHSPSLAAPAAPATRGVRKLGRRSSFSS
                     VAALTAAAGCGGGVSNAALQHKNDGAAPPCEPAPLRWTCVSLEVSGSTVRTLRRHLRA
                     VRACMWRVEAEEGIARGAGEDASVRKNGWGSNRCTEDAVSGATGAGAAAPTAVEAHGA
                     KRRDDHSSGIASLTVGGSSVDSDAANDHAAAARCALAAAVAQAQSALRSRVLAGGSGG
                     GGVGGTAPGGSGAPPSAVQGAAGDGGARAGFNSNYPGGSSSAGLAAATSPSTSAGRKT
                     ANKTSGPGRNVSRASSFGGHGNGAPAAGGADGLQSGFHVTHDLADAARARQVAERRRR
                     LLQLEEELDEAKSSLLMELLETIVSAACASSLCPTAAEAMLDEARIEADVQRLLPRCA
                     LSSDVIGFLEEWIGSHAVLNVHGKDVDHDTCGDGGDDADGEDSCSGRSRTTSLRFYSP
                     GLHEWMQRISRYVVEQQQQKR"
     gene            complement(<326225..>328420)
                     /locus_tag="LDBPK_090820"
                     /db_xref="GeneID:13392058"
     mRNA            complement(<326225..>328420)
                     /locus_tag="LDBPK_090820"
                     /product="oligopeptidase b"
                     /transcript_id="XM_003858714.1"
                     /db_xref="GeneID:13392058"
     CDS             complement(326225..328420)
                     /locus_tag="LDBPK_090820"
                     /codon_start=1
                     /product="oligopeptidase b"
                     /protein_id="XP_003858762.1"
                     /db_xref="GeneID:13392058"
                     /db_xref="GOA:E9B9W9"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002470"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR023302"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9B9W9"
                     /translation="MLSGNTIAASAQPPIAAKKPHRVTFGYVEGEDRGPNPMNPPRYR
                     EDPYFWMRDDNRKDPAVIEHLNKEKAYFQARSADIAQLRDDIYTEHISHIKEDDMSAP
                     YVYGKYRYYTREVKGKSYKIYCRVSKDKEPGDVAAEEVIIDVNQVAEGKPFCDVMEVK
                     PAPPEHDLVAFSVDMSGNEVYTIEFKRISDPCQTIADKVSGTNGEIVWGPDQTSLFYV
                     TKDETLRDNKVWRHVMGKPQSEDVCLYEENNPLFSAFMYKAADTNTLCIGSQSPETAE
                     VHLLDLRRGNAHNTLEIVRPREKGVRYDVQMHGTSHLVILTNEGGAVNHKLLIAPRGQ
                     PSDWSHVLVDHSEDVFMESIAVRSNYLVVTGRRAGLTRIWTMMVDPQDGVFKASTGLR
                     EVVMEEPIFTVHLVAFQMLEYEEPTFRMEYSSLATPNTWLDVNPQDHSRTAVKVREVG
                     GGFDAANYKVERRFATAPDQTKIPLSVVYHKDLDMSQPQPCMLYGYGSYGLSMDPQFS
                     IQHLPYCDRGMIFAIAHIRGGSEMGRAWYEIGAKYLTKRNTFSDFIAAAEFLVNAKLT
                     TPSQLACEGRSAGGLLVGAVLNMRPDLFKVALAGVPFVDVMTTMCDPSIPLTTGEWEE
                     WGNPNEYKYYDYMLSYSPMDNVRAQEYPNIMVQCGLHDPRVAYWEPAKWVSKLRECKT
                     DNNEILLNMDMESGHFSAKDRYKFWKESAIQQAFVCKHLKSTVRLLVRR"
     gene            complement(<329820..>330611)
                     /locus_tag="LDBPK_090830"
                     /db_xref="GeneID:13392101"
     mRNA            complement(<329820..>330611)
                     /locus_tag="LDBPK_090830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858715.1"
                     /db_xref="GeneID:13392101"
     CDS             complement(329820..330611)
                     /locus_tag="LDBPK_090830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858763.1"
                     /db_xref="GeneID:13392101"
                     /db_xref="InterPro:IPR027887"
                     /db_xref="UniProtKB/TrEMBL:E9B9X0"
                     /translation="MPLTCRPFCEWALAYMGTQKHTPSIIQQRNSMAAAERDPDDRNV
                     LDFSTYEDYLDQQVTGEDLFYLEDQDAARKIVELGYKGKDVLSRDEFEAAQHLARTGP
                     LKRRESAEVITSAGKDVSDSPLLTALAKREELVRTGKLATVLFLRDYVSGQEVSAYID
                     YGYRLRSENFEAYFKKEKKLLPKRSDLSYYNWKTHTLFYNNSPTFQVLADSALGLVMK
                     HKRDRKAIHVDPNSPSPGENCSRTVVPCKDYLQAVIYDHVTRRKN"
     gene            complement(<331046..>334789)
                     /locus_tag="LDBPK_090840"
                     /db_xref="GeneID:13392102"
     mRNA            complement(<331046..>334789)
                     /locus_tag="LDBPK_090840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858716.1"
                     /db_xref="GeneID:13392102"
     CDS             complement(331046..334789)
                     /locus_tag="LDBPK_090840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858764.1"
                     /db_xref="GeneID:13392102"
                     /db_xref="UniProtKB/TrEMBL:E9B9X1"
                     /translation="MPSRRKAHKRGGPQMPQEDAEHQQSSLGVIEDAPASEPRSTTVV
                     VQQPSPVSGGGTDDDSYMSVLTDEEDSYRLVIEHDEHLERIRAYRDFHDQLACMKRAA
                     AGEVDRDSSVTPKRVFDTSAISTAPTSPEVPPTTRAPPTPSQQKQSAALGSHPSITPL
                     VRTPTNRGDAFPGSENHLAAPLMCMERGASPSRPHKAADAKEVSRLQAENARMAVELQ
                     ASQEAVQRLHDSLLEARGALLHRVRLEAKDGAVGQVASERQQHSFLAATGACEAAAQH
                     ATSSRSPLATPTAVFSPSNSKLPAPATSVPAAASSSVGRDHPPPKALLRSPANDLSDG
                     GVGALCPHPSTKRLGVAEFFWALQVAPPPSTRQGGCIYGDRCQASAASLRRPPEMADE
                     DIPLGGAYGATSRPVERVSSASAEKPPPHHVSRYHLDHWHNPRQRQGAETEAVALACE
                     SAWLNSDYYCYHIKEEMSSLRVVSSPDEAVDGSGSAVPAMNDNEVGRRLPHHIPAAAS
                     PPLAEDNTPLSSPTPHSTPVATAQWSVLEGTVTSVWSPAKTRSAAMLAGIVSSPAERC
                     YWLPYLQRLWVTSVLRHLLLFFLVTAICVLLFIPGVVLATVNVFEAAEGEDFYALHNR
                     FGRSAMLVAARLDACTLVLFAFFGALCMINHRQQPQSLASVDAQQEEAETAAAVSVPA
                     AGSAAPATTAARQPWRSIFSVKSVGAFVHLMLCAGTGLMFWGTVLLREGCRNTNLPLA
                     ILGESCYGAGEALLLAGLGTVVSAEVGVAAGVIVSLQILFLSWLIVNVFGFFVLPSLS
                     YYLYITAAMLNALVYVNGFIGALVFSVVMLCPRDLIERAVRASGKDITPRNLWSAARH
                     DVSLCFLLRALTVGLLTAAVVLLMSCGYAVFIPTQAAAAAVAESTKSHELMSTSTGKG
                     SRATEATGSLTTYQDSWATHQRHAPVLLFTYALVTMPMCFIPRLAALINRWCSVPLLT
                     TLLCVMWIISTGASWAPVLGLGALASNSGGKDGVAIAAVSAVVSWCSGVWLWLAERHI
                     LNPCVDACAIATGAIYTVVVSSLLRSMVNAGVLLPVMHPNRWRMAFHERDRHSEAAAA
                     RFPSESTPLLEASVQKGCCKNAKAAAAGAVCPDTAAAPHAGSANAPTATRTHTGEESK
                     TYAEELQRCVRMQLRGGPAVMTVLACTLIMVVLLLCVAVMTTAAVLLIDRAESPVYVN
                     RLLPGVTLDEHLIAKSTLTFVLIAAMLVQWVEVAHRFRRCRSS"
     gene            complement(<335914..>339786)
                     /locus_tag="LDBPK_090850"
                     /db_xref="GeneID:13392059"
     mRNA            complement(<335914..>339786)
                     /locus_tag="LDBPK_090850"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_003858717.1"
                     /db_xref="GeneID:13392059"
     CDS             complement(335914..339786)
                     /locus_tag="LDBPK_090850"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_003858765.1"
                     /db_xref="GeneID:13392059"
                     /db_xref="GOA:E9B9X2"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="UniProtKB/TrEMBL:E9B9X2"
                     /translation="MPASAWQTVLIQPWISLASTAGSHGDAGHASPSGGTSRRSPSSE
                     QHGVTSAARLAEINAMQRELEAVEHFARGEGDGGDDDGNDKRLAGELSQAYTRVLAFR
                     SQSRGYSSLRAGDPHRGSEEGTIVVVDNDDDDPNPELTRQIEHKLAEFRKRIANTLSG
                     LKTARRDQRELQAAQKKVQVSLEDAKRQLREAQEKVQRIDKRHLHEIQGYRLPPAVVK
                     HVMDAVLCVLGEKAKNWTAVVTAMRSPSFISNVVSFHHAQLTPADVQELKKNFISSPR
                     FSYADVLRGSHALGQFHEWVIRQLQLIEAESAHAKFFGGKRESSRELALAREKVEAEA
                     AELRHLEEELEALMREQARQLQERRSGTLSPCLTGGEALSQRPSPPLTKVLLPASESE
                     GAAMPDPQRSRRPSMHATSGAEAMANNNGAAAVSDGAQRRSSTSVTAIAVPAGCSAAP
                     HTAADAAAAMTDSAMEMTTDGVAAVNRPPTAVMLAQQQQLAPAMVSPGIRWICPHPGA
                     LHSSSYVLRSSILCVLGHQQERTSEKPGETSPDNETTTPAPDMFELTTAQQHFVAEAL
                     HGPARALPPPPPSSATAGSERSSHAAIVTQHTKTFTGKEWETVVKNSPDKLHRAFVED
                     VAMICQVPNRAVTGVAWVLQGLHVQCAVCHPSSDSSEAVQAAIEKGAYPTVMALYAQR
                     QCTPDSLDEESTRQRHQAVCLASMKEEIRAAQEAEAEARRETQSLRDAFEKEKQALME
                     QLEVAQTSSQAGDHDDVRADLTLQEALETRTAQLGHVQASLAESQAKAKRAEDQLTTA
                     QVQLAAAEKRAAKVEADAEAARTAADLAAINAEKALEDLGSQLRAAHAAFEGERTRRQ
                     TELVEAQAAAAARETRLLRQLDAMKHRLADAQPREKAMEEDEKARQDFTAAADARRAA
                     EHAAQVAELERKLREALSAQASLQEEHKHFRDELARAQAQAAENEKTRLQLQESMESV
                     RKQRGYQQQHGAIAAAIPLEHCRKNCFERAQVRAAEADASLVEALRAQLTAIEVAINF
                     CRAELEVQKSAEAAARERQAARRAAVTAIREKIEDLAENFTTVAAERQRQLPQQLASE
                     KEALIGELIAQLEEVEHEKAEIKTATARAQRLFATMHRQVADAQERAAQLEEARRTAC
                     KELQAMTATVSAEDADNSITDAKLVRSGSMQGHQEALVDISARVIAASAALASASDAL
                     ATHQQQRAAEPKQEEAFIANIFREGDGRRRRPNRECSELAAQIMGEVYDAATGSFLSR
                     HRWTWMNVCLGVLLLLSFTTLQYKKYEV"
     gene            complement(<340879..>341523)
                     /locus_tag="LDBPK_090860"
                     /db_xref="GeneID:13392103"
     mRNA            complement(<340879..>341523)
                     /locus_tag="LDBPK_090860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858718.1"
                     /db_xref="GeneID:13392103"
     CDS             complement(340879..341523)
                     /locus_tag="LDBPK_090860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858766.1"
                     /db_xref="GeneID:13392103"
                     /db_xref="GOA:E9B9X3"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:E9B9X3"
                     /translation="MASLAQLSTPLPSEPSAAAPPPTASAPAGALHLERFLESVLKQN
                     LDTVLSQRDELYATVAQCAQLRWLMEDMQALSRYHSFIEASTAAEAAAAVALSASSPL
                     ASGAANASPPLMSKRAQADAYKPPRKNKILVDLGNHFYTQGVVKDAGVLFMNMGCGVV
                     LPMSLDEAREFLRKKEAVVRRMIMNKSKEALRIKYRIRLVTEAIARLHERHLGL"
     gene            complement(<342034..>343626)
                     /locus_tag="LDBPK_090870"
                     /db_xref="GeneID:13392104"
     mRNA            complement(<342034..>343626)
                     /locus_tag="LDBPK_090870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858719.1"
                     /db_xref="GeneID:13392104"
     CDS             complement(342034..343626)
                     /locus_tag="LDBPK_090870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858767.1"
                     /db_xref="GeneID:13392104"
                     /db_xref="GOA:E9B9X4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9X4"
                     /translation="MTVALIVCSVVFVLVLGSATVAGGRPKQPISKGTTAGTSSHASS
                     SLCPRCPLCSRSGTPIKERLKYCHTTSGYIISLFSWGTSALAGKQRTGVSNREQRQLY
                     PLELPFATDDAVRKQCMRDMQDLLLARVRGQPQVVMPLLDVLRRKLAYPREPVVVHLA
                     GDNGVGKTHTARLVSQALSLRCAPDRDVCDAGDNLLTIAGTGFDGLSVAEARQRIIGQ
                     IITHTDRYPHGVVLIDDLTAMDPSLVSALAPLFGRAAHFPEQLTRPSTATAAGARHAA
                     AKSLQTMHESTKGLGPDGGRGSAAKKGEDEKWEAAAGTGGAQPSTSEMASSSLSSGQP
                     PPPLSQLIIFVTTDFGRQGRTVGKSRTEIEAMIQHDFADLYGTLLPAYTRTFVYYPFT
                     SAMAEDVVRSAVTDLPCALGERLIASSTISDEAVSFLVQQHRQLWSGKENGHALRRLV
                     EDEIVSQLVVYWETHAQQKHFERLRVHFELDEASMRVLLRTPHTSRTTASQPPAALSS
                     VEARAYGHGGADDGDGEERSDL"
     gene            complement(<344662..>346992)
                     /locus_tag="LDBPK_090880"
                     /db_xref="GeneID:13392105"
     mRNA            complement(<344662..>346992)
                     /locus_tag="LDBPK_090880"
                     /product="DEAD/DEAH box helicase-like protein"
                     /transcript_id="XM_003858720.1"
                     /db_xref="GeneID:13392105"
     CDS             complement(344662..346992)
                     /locus_tag="LDBPK_090880"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase-like protein"
                     /protein_id="XP_003858768.1"
                     /db_xref="GeneID:13392105"
                     /db_xref="GOA:E9B9X5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9X5"
                     /translation="MAGSSARLPTVGCSCSAATLAYSRTYVRSSSTRITESSSGSIVS
                     SSLPWSQHRCQVRTLIVPRQLKAYGGTFSQSIGERVDHAASHQVLQSLSPSRAAQSPL
                     LAKPVKTKMVDNFADMLVTPALQEALADMGVSTPSPIQQTAIEAVLQRKNTVIAAPHG
                     EGKTLAYLLPLYQNMEKDRDVYKIPLRERRPRMILLAPTKELVEQLQTVCARLDAATG
                     LTSVCFTSRKRSKYHLSRMLKNTMADVLVMDPKLILRLLRTRRLFIEDLRYFAVDEAD
                     AMMSSLHDHDAVQLLMKVQKRNQFKYLWPVQTQYVFVTAYMTRKLEYIVGRKISDPVT
                     CMFRQQMHRPQARLRHRFYAIRREPEKFTVLMHLLRKNGHVPLPMDTDVAEVDVHTNP
                     RKLSGSLAEWHEAVQRCAWKEQQEQEKNSGSGEAVTDDVVDVDEVAVGAPEEASAAVP
                     SARLSATENAAAGDDYDHDSYARYTLERVRPLHWEHLTTVAAPFTCPIRRTVFAEGRR
                     TIVFFRNIDATTAVFYQLRSAGFAVSLLHASLPYTVRKEMYADFASGRTNILCATDLA
                     ARGLDLHVDMVINFDVPTNALAYLSRSGRTARMGREGQVLNLYNKHQGVIVSAIKAFL
                     KDNLPMEGLTNRKADMMQPRYAEWRTHKINALARSYVSLITRKTIPAHLERTYVHHNA
                     TWRPVFHPQKTGIHGGVAPRQQQKLMDRVREQAVWFRRGQLARRKGGRAKFGSRTMKR
                     GVWNDIGGVASREVVNEAQNPSPAGPNFGPPSGPPQ"
     gene            complement(<347661..>348857)
                     /locus_tag="LDBPK_090890"
                     /db_xref="GeneID:13392106"
     mRNA            complement(<347661..>348857)
                     /locus_tag="LDBPK_090890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858721.1"
                     /db_xref="GeneID:13392106"
     CDS             complement(347661..348857)
                     /locus_tag="LDBPK_090890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858769.1"
                     /db_xref="GeneID:13392106"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:E9B9X6"
                     /translation="MSARKFVAEYVSRHLDGLTVLASLADRPAAAAGSSSNSAAAKPV
                     ICTHNGSFHCDEAMACGLLRHVPEYREAVILRTRDPKQIDACDIVVDVGAIYDVDTNR
                     YDHHQASFHGTMTTPKKAYKTRLSSAGLVYKHFGRQIIRQYVEAVLQPSSPARAAVLS
                     MTSWSESRTGVSDAELDVLEDALYANFVEQVDGIDNGVECWGLADPAVGTLVPNYKQS
                     TNLSQRIGQLQAYWNEPENGDVVAENANFAVAVEMAVTEFFGALTYLAFSWLPARSIV
                     EAAFQRRHEFDESGKIMVFKDVKVCPWKDHLLELEAESNCLGAVLYVVFSDGKGWRVQ
                     AVPKTSTSFENRKPLPYRGLRDDALSAACGIEGGVFVHVSGFIGGMKTFDGAMALAKQ
                     ALVVVN"
     gene            complement(<349751..>350560)
                     /locus_tag="LDBPK_090900"
                     /db_xref="GeneID:13392107"
     mRNA            complement(<349751..>350560)
                     /locus_tag="LDBPK_090900"
                     /product="ras family protein-like protein"
                     /transcript_id="XM_003858722.1"
                     /db_xref="GeneID:13392107"
     CDS             complement(349751..350560)
                     /locus_tag="LDBPK_090900"
                     /codon_start=1
                     /product="ras family protein-like protein"
                     /protein_id="XP_003858770.1"
                     /db_xref="GeneID:13392107"
                     /db_xref="GOA:E9B9X7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9X7"
                     /translation="MPAAPTLPPALPTSLDYPRIKLLAIGDVGVGKSCLIKRYCEGRF
                     VAKYIPTIGIDFGVKKVEVSKAAVLQQRSSEPSPPAETAQSGGGASSAIPSAVRVNFW
                     DGSGDGDYREILNEFYEAAQGVLLMYDARSAQSFTALQGWWEELTMYCQGMPAASGGG
                     GEGSDPALAGAGGKRASASSTVTSGTAAGKAVGRTDGRAPIVVLCANKVDDTAVPGAA
                     APRPRAVSEAQGRAWAREHGCAAYYETSASTGQNVKEAIEDLVVRMVAKFM"
     gene            complement(<351703..>352023)
                     /locus_tag="LDBPK_090910"
                     /db_xref="GeneID:13392108"
     mRNA            complement(<351703..>352023)
                     /locus_tag="LDBPK_090910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858723.1"
                     /db_xref="GeneID:13392108"
     CDS             complement(351703..352023)
                     /locus_tag="LDBPK_090910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858771.1"
                     /db_xref="GeneID:13392108"
                     /db_xref="UniProtKB/TrEMBL:E9B9X8"
                     /translation="MNSYVKRYVGTDPRVTHLVGFKRASERRLVVVCALAALGIYSAV
                     YLYEEKERNRRHASIKKDIERERWRARELGLAAPIDDGFAERYEALDGNTRARHQQAL
                     KGNE"
     gene            complement(<352871..>354442)
                     /locus_tag="LDBPK_090920"
                     /db_xref="GeneID:13392109"
     mRNA            complement(<352871..>354442)
                     /locus_tag="LDBPK_090920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858724.1"
                     /db_xref="GeneID:13392109"
     CDS             complement(352871..354442)
                     /locus_tag="LDBPK_090920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858772.1"
                     /db_xref="GeneID:13392109"
                     /db_xref="UniProtKB/TrEMBL:E9B9X9"
                     /translation="MYSFSLASNRKSAISNSSGLAPPAAAHVIRAPSELKPHQRLPQP
                     PNEADDDDDVIHVSNARFGWHPAHEHAPTSSLYAVRPPAEQLVHVHNLNAYMALRDAA
                     DWSVEVQREREQKKRRALAQHEAVKLEEQRHRDAQEEQTKKEMQQRRWERQQERAELR
                     EADAMADFQDRNTQFLQNQLWLMQLGSYVRQTDAQHKAHAREELHKSSFSRNHLDVGH
                     TSTTSWGGTNVRGHHTSAPSTEIDLRQAAEATEEAYVRLSLAYRNEAQRSRAAAAILN
                     PGELTGKGRSRPRATRSVGAFASPTSPSAPSQAATAVSTPPHSPAASPAPTAVTEAAA
                     KVSAPFHTAPPMFTHTSEENMGQHANAIPYTYIPEYFDAPSAAATAGKVPAPRRAGEP
                     PEQQETGAVMPLPLSPVPVSRDVTGALQARYYPWALYSAAAVRKSMLPPLPPPREASL
                     PVRRWGAAELRDSMFGHCILEDGTIQDQCERKKMCAAYLGYTTLPRDNATATSNAAVE
                     PQEPLHFGKRMDIWL"
     gene            complement(<355414..>356886)
                     /locus_tag="LDBPK_090930"
                     /db_xref="GeneID:13392110"
     mRNA            complement(<355414..>356886)
                     /locus_tag="LDBPK_090930"
                     /product="histone h1-like protein"
                     /transcript_id="XM_003858725.1"
                     /db_xref="GeneID:13392110"
     CDS             complement(355414..356886)
                     /locus_tag="LDBPK_090930"
                     /codon_start=1
                     /product="histone h1-like protein"
                     /protein_id="XP_003858773.1"
                     /db_xref="GeneID:13392110"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y0"
                     /translation="MLRAALRPSCVLHAAFLSSFSSAAVHNEAASGASMASNAISSAA
                     ASLWMQNSQSHDGAAATMHTQQTDVTGAATAQDHGNALVVLEEDNTSGSNGYVDYFMG
                     GFGPRHLAEVTVVPESAGARAHGSRNHANKADAAAAAVEASSSSETATAAAAALPTRR
                     AGGDDGAVARRPVITKARRIRLASAASQAAEVLQSVGSPATALLLSQRVQQLQAEEAL
                     LNASLQRLKAERDLATVRHTCGEELDNYRRGVQQREQQVVRAAMTAGTRSQDPVVSYS
                     QESGGSAGGDTLQTVVEADLLGMPATADAEAAAAAAKKAAAAGKAVQKSGRASHAAAT
                     VISAKKRLRYGATAAGGHKANASPKSLSRRPAAPAASKSKRPSLAKQTALKARAGKQP
                     AAVCKDAVKAKPKAPLRMKATTPAFAAATAKAAARRQKAKVKAAATKPSRKLTKKPTK
                     PRTTTKAKSVRARPPAKATPSARKTAAKKRPTYEKRPTRR"
     gene            complement(<358415..>366001)
                     /locus_tag="LDBPK_090940"
                     /db_xref="GeneID:13392111"
     mRNA            complement(<358415..>366001)
                     /locus_tag="LDBPK_090940"
                     /product="phospholipid transporting ATPase-like protein,
                     putative"
                     /transcript_id="XM_003858726.1"
                     /db_xref="GeneID:13392111"
     CDS             complement(358415..366001)
                     /locus_tag="LDBPK_090940"
                     /codon_start=1
                     /product="phospholipid transporting ATPase-like protein,
                     putative"
                     /protein_id="XP_003858774.1"
                     /db_xref="GeneID:13392111"
                     /db_xref="GOA:E9B9Y1"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y1"
                     /translation="MGKVKASFGSLVAAIRSTVSCTSPGDNVIDDEDENNFMADNAKD
                     GGASESGQPAFVEIDLLRSDRNRQRNFPDNSIRTAKYTLLTGLPLSLLYQFYKISNIY
                     FLLVMIIALVPGASPINPFSSIVPLSFVIGAGIFKDLWEDCKRRRADRQANEMIVYVL
                     RACAEVSSKGSTTASSSSSGTLTEKQNSTSDSDGAAAASLRVHGGHNHQQNPRRWRQR
                     IVRVVSRPSSPREDTAVSRKKSYDGKGVHAVEEVEMTTYGRSCGASTTCPTALSLRRT
                     SAQPQESATPDAATEPVVTFQPVRSCEVYPGDIMLFRLGEEVKADCLILNTSLPDGLT
                     YIETANLDGETNAKTRRAKIQTVEALGTVEDVVEKALGVSPRNAAAVHARMNGIDAGP
                     QDVWGVSGEAAAPAKVRVDCCDAFGGAHAVSTPERWMNASGGGTAATDAKRLDASLTT
                     ASPVALGKGSGWPMLSAKTVAAKGGDMVVPTAISESTFPPGDLHDYSPQHQHNSQTPV
                     GRECPERKAAEHDSAAAIAERGAAPLCHQHEHSFSDQQKHFTSSSTTGVPLARSSTDL
                     SAAVSGNFHSVASNVTSDMSPERILHQRLMTLKERLAEEGQLPMPLQLRQLSEHYERT
                     VHSRTNSAGARVSSLHGCPHNSTNRAGESESLFDDDAHHHHRSRESQQRRVPEPRRRD
                     GAGDAETAATGPGSGAGPRGQSRGFSAPNKPGVFHNEPLHGNHIADGSDRAFEAAPGV
                     LPASGVVLISCPPTPDLSMWFGQLRLPSGEMVPLGIDQFIPRGCLIRNTDWVIGAVVY
                     TGRHTKMLLNLRPKPHKVTNMTRRLNQMNVLFFAFNQVLIMLLCGLAIWSKRQLLRKV
                     PGAKTDHSAWYIQWNLERYSDVSLFWWRYLTNFVLVSYLIPLSLYVTLEFNKAMQMLL
                     IGADKRMAVFDEFTGAIKKARPKTSELNGQLGHVRYIFTDKTGTLTENLMTYVGGVVD
                     GHTHSETEQPGGIGRALLRRSTAYTAGSVLTSVCPNSMGSARESSLRCDHHKHRRLSS
                     SLGREASTLGDAAVADSLAGMRGESALVSADVAASNSSSCSAAGGGDQHSSNHPFQRL
                     AAVMASHIAVDAHANGDDDTIRQSPRTVTAASPASLVATVDIGATSPHLPLSSSYQCG
                     SGAFGRNAFPALGNAVPGADGNEPGGLGSLAGLRNINEAVLEREPLFCYLRAIALCHS
                     VVCFPVDAVDGLADSQQAAENGKGAPQETKGHKDRRRDKDHNATAAAGEGSAPQKRKN
                     SHHHNRADDGAGKGAPRRRRGSASTADPDHSRARHQQSHETAHHAPDLVPLSKILSLN
                     DISVGNFVEIPYAVPAGPAVCEDLEPYTASGTNSGRGVSMSAHDHLTRANTASFVTAA
                     ASADGRGQHQYHHHKTNTNSAVPAATTVDLGPLTKDIFNLSRNNTSLLHGRTSSTSWY
                     QNRYFNRAMHNRNLSAHVSHDGGERNPTPAASPSTTMYPVGSAGEFAGQAATPAEAGG
                     SAAVAAAEAAVPIAASDLEPFIDRSKIYEGQSLDEIALVNAARENGFSLFERTAKQIY
                     IKALGRVMCYDIIAELDFTPQRKLMSILLQRRPDLDSEAAATSVAAGVSAHYHRRAPE
                     SSAAAAAAREASGLFAATASGVLPECGVASRPPQSQSHDGLCAFPAQGKKANGDGAAS
                     SLPGEDARLCRAKTTSAFTTLTAAELPLPLSRPRTVVLTSEAHESTAEQREEEDGNRS
                     ADGPAAKMLPPHSILLPPPTKQQRVPHLGGSGVFTATPPPSSAQQLAHQPSGGGMSPY
                     HDGFGSSAGFGVSAAAGAPASAPGKYLLLVKGADSSMMEIVNMQKRANVRVKDKMLKE
                     LDTMSQLGLRTLILGQRYLREEEVRGWLPIFNDAQCAMQDRSEKLHKAYALLEKDVDI
                     VGATAVEDKLQEEVPQTLEFCIQASIVVWMLTGDKRETAVTIAHTSGLVKAGYTDYVC
                     HLDVSDIIEEEALLQQKQRYKETCRLKAKDGIGDGVSSLENVSSSSSDADSALHSPVA
                     STTTRAHLSGSSRMHSPQLPKALTQAGSVDHATVVSTASPLQETANTITGGDSIGAGT
                     SIAVDAAQRFLMRKCARIEEQLKAAEDKCSEGQEVFDDRVVVIVVDGKTLDFIFQDCN
                     RARRFFLLGSRCRSAVCCRMTPLQKAKVVRMFKRNANAVVLAIGDGANDVSMIQESSI
                     GVGIMGLEGSQAELASDYALPKFRFLKRLLFVHGRFSVFREAHCVVYSLYKNVIVTVG
                     MVSYQFYVGYSGQTLIDSWLLGMFSVFLCSLQPLMIGILDKDVEDELAESLPRLYPPL
                     SRESMYFSCTYIIKWLVDGLIEGLIFFFFLMYTVGVQDNLYTHMTAAIEDYGATFFTM
                     LVLVADLRAGTLVTYYMLPFALVIGLAIILVPALELAYAALHDLAGSNWFVHVANELY
                     GTSGKFWLMLFFACGVLVVFTMASNMYIQLFAPWHNAGFAMRAARRSHHRIPHQHTKE
                     ELKAEYTRLLARCEELTKLQQKRKESAAKNSGAKGKTQMTTTAAAAAR"
     gene            complement(<370617..>371177)
                     /locus_tag="LDBPK_090960"
                     /db_xref="GeneID:13392112"
     mRNA            complement(<370617..>371177)
                     /locus_tag="LDBPK_090960"
                     /product="ef-hand protein 5, putative"
                     /transcript_id="XM_003858727.1"
                     /db_xref="GeneID:13392112"
     CDS             complement(370617..371177)
                     /locus_tag="LDBPK_090960"
                     /codon_start=1
                     /product="ef-hand protein 5, putative"
                     /protein_id="XP_003858775.1"
                     /db_xref="GeneID:13392112"
                     /db_xref="GOA:E9B9Y2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y2"
                     /translation="MSCAKEASPSLSQQKRSDVRRAGLSGFSSAIYRGALNHSASAEL
                     QEGYRILTSGQKENIISDKDLFKAVHGCGLHTTEEEVNDLLRVVHQDERTLGLEFSEF
                     MMLMTKEIDEKSIEEMRSAFSLLDTNKTGTITKKQFTELFVSSGEHSSAEELEELMLL
                     AETSEELEVVDYNKLINELAILLNKM"
     gene            complement(<372847..>373296)
                     /locus_tag="LDBPK_090970"
                     /db_xref="GeneID:13392113"
     mRNA            complement(<372847..>373296)
                     /locus_tag="LDBPK_090970"
                     /product="calmodulin, putative"
                     /transcript_id="XM_003858728.1"
                     /db_xref="GeneID:13392113"
     CDS             complement(372847..373296)
                     /locus_tag="LDBPK_090970"
                     /codon_start=1
                     /product="calmodulin, putative"
                     /protein_id="XP_003858776.1"
                     /db_xref="GeneID:13392113"
                     /db_xref="GOA:E9B9Y3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y3"
                     /translation="MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP
                     TEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFIS
                     AAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK"
     gene            complement(<374667..>375116)
                     /locus_tag="LDBPK_090980"
                     /db_xref="GeneID:13392060"
     mRNA            complement(<374667..>375116)
                     /locus_tag="LDBPK_090980"
                     /product="calmodulin, putative"
                     /transcript_id="XM_003858729.1"
                     /db_xref="GeneID:13392060"
     CDS             complement(374667..375116)
                     /locus_tag="LDBPK_090980"
                     /codon_start=1
                     /product="calmodulin, putative"
                     /protein_id="XP_003858777.1"
                     /db_xref="GeneID:13392060"
                     /db_xref="GOA:E9B9Y3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y3"
                     /translation="MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP
                     TEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFIS
                     AAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK"
     gene            complement(<376085..>379771)
                     /locus_tag="LDBPK_090990"
                     /db_xref="GeneID:13392114"
     mRNA            complement(<376085..>379771)
                     /locus_tag="LDBPK_090990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858730.1"
                     /db_xref="GeneID:13392114"
     CDS             complement(376085..379771)
                     /locus_tag="LDBPK_090990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858778.1"
                     /db_xref="GeneID:13392114"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y5"
                     /translation="MVKQRMTALDVRATVEEMRATLIGLRLLNIYNIGNKMFLFKFGH
                     GENKKNVLLESGTRFHLTELAREKPKVPSQFTLKLRKHIRAWRLDSIAQLQHDRTIDL
                     CFGVPSTEGCFHIIVELFSKGNVILTDYAYTIMMLLRTHRDDEGLKLMVNQVYPVMAP
                     FVAAVAAESAEAQEVDTATVVSAAASVARTAAAAAEEPHMFLYPPHVDASGHLHVQHT
                     ADADLTLAQRQLKEERTRLMKVDWEVGLSRSNDRTVVQTLVAGIQHFGPDLAQHVLTV
                     TGVLNTPRKSWTQSADNVFEALRPGLLEAFDLAKVDLTSAGGYLIKPKAKPASTAHTP
                     APPAPGASAAAADLVAVAEQYESFTPILLAQYTNDGVEALYRTSFGRVCDEFFLITET
                     ERIDASNAKRTKTAKSKEDKFAADHARRINALETDIAANQMKGEQLILNADRVDEAIQ
                     LINGALATGISWDALRMLLKRRHAEGHPVAYMIHDLFLERNSISVLLETVLDEEKGEE
                     DCDVPPLVVEVTLSKTAHANAADYFSKQKQHRSKLERTVAATEKAAAGAARKGARKAA
                     AQKEKKVIVKERQRNWWEKFFWFRTTAGDLVLRGKDVQSTELLVRRVMRLGDLFIHCD
                     VDGSLPCLLRPMNDVWQELGGNNAGGDLTASPATQPVALHSVCEAGAWCVAFSGAWER
                     KQTTGSWWVYASQVTGGTATGAYLYAGERHHLPPQSMSLGCALLFYVARTVREPAAVA
                     RAESAASVDNDDEGPEHVEDNAVDSFTVLRRELPSFLASPADAGQPSGAGEAVVPADA
                     AAALVELPSVETLRAEQRKQRNLFVAGGCNSSGGGRVDGRQKKGKAAKKGGARNSRVD
                     RAGLQGTPAATIAFLPSSAMEDGAAAAVAATATQKGSAQGRNLTKHQKKKLKKIQDKY
                     GDQDDEDRMLGAQVNGNQLSRVQLLELQRRAEQRQEAEQAKRTHEKANLSAQRVFCTP
                     QYRSLGNDNGQEDAEEEEEGEDVEVVSEFTDDGKEAETNVAVVGAAAAAEAGGSDEED
                     EHAAAVEEAGGGCETEEEEEATEAGAVASTAARSRNDRDAAIVQQSAELNRAFPHYTM
                     RPGPMDTVQHVVVVCAPTIAVSEYAYHATLCMGNAKKGALAAKLLQLFTARAEQGEAG
                     ADGTSTGVSAVSPGAQGSKAKKTAAKKGSGGAPTDCPRSPSWAPSPAAATVNPSVVKA
                     LQMMSTNDVVEQLRANVKPIEFHL"
     gene            complement(<380212..>381999)
                     /locus_tag="LDBPK_091000"
                     /db_xref="GeneID:13392061"
     mRNA            complement(<380212..>381999)
                     /locus_tag="LDBPK_091000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858731.1"
                     /db_xref="GeneID:13392061"
     CDS             complement(380212..381999)
                     /locus_tag="LDBPK_091000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858779.1"
                     /db_xref="GeneID:13392061"
                     /db_xref="GOA:E9B9Y6"
                     /db_xref="InterPro:IPR008829"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019872"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y6"
                     /translation="MDDRSLKLAEDFVSARYIEAGRESLRATARIMRSILAQRCCPDE
                     GLTDAAIELILRQLSLMDTNNLAHHVGGGEREGRVVSALVRMRHFHLTHGIGRSGDLF
                     SEQPKAAGSSLLYKITNVLMLDLIRQAGAPSTAAAVVVPMATGMTLALVLRCVAKTHM
                     KELMKEAEAVQLQRTVTKDSTSATSAAPVQEPPMSEADRDRHDRTSLPVPATPRYVIW
                     PRIDQKTALKCIDAAGLVPVPVQLRPAVPLARSAAPCVSTNRDSLDRGQDSIGSPSTP
                     TSSSSLFLECHVDDVAAAVNAVGGPSQVVCVLSTTSCFAPRLPDNTVAIAQYCKKAGI
                     PYVVNNAYGVQSRRIMTRLDAAQRLGRVDFVVQSGDKNFLVPVGGSIICSGDKERCKA
                     VAALYAGRASMSPIVDLFITALSLGRRGMQTLWSDRYKCRARLIRQLRVFARERREVL
                     LVDDSDDDKADEDTVGGSQRTSNAVVPRNDISVAVTMRAYGLPAAEASSSGAQLGSEQ
                     AGRVTNWAAARALGAQLFRSAVTGPRVITPAPSTPTTIAGCTFRNYGMHQDREPPCPL
                     LVIACGIGMSESEVDALMARLRDLWPVPA"
     gene            complement(<382819..>384669)
                     /locus_tag="LDBPK_091010"
                     /db_xref="GeneID:13392115"
     mRNA            complement(<382819..>384669)
                     /locus_tag="LDBPK_091010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858732.1"
                     /db_xref="GeneID:13392115"
     CDS             complement(382819..384669)
                     /locus_tag="LDBPK_091010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858780.1"
                     /db_xref="GeneID:13392115"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y7"
                     /translation="MANYVDGNPLGVAGQEAGKGTGALLAAVQRCSAELSHEFGEGVA
                     LMTSEPAAATTSSHASPLSPEQQVALSAGAVTCLSVASLPGTTDTAVAVVGTTVGTVA
                     LLLIEGSRAVYKVAERSLTEWSSGAITAQDAIVDVAFSMDPAGRPEFVSAASAGCVVV
                     VDVQLLYRPSGNGSHSTDEEVGDTATDAPPAVVHRAEWHQETEPWSNSALRAKAVEAL
                     EQSDAQLMQRSCSDVFACSFVEADVVRILAPQRLQAAVAIDVALIVVLSSGALHYVER
                     VVEGGSVRLLAEHHWQRLAKGAAFTSHASAATQGEDSAAANDFSTDGASVRILTDSRA
                     VPHVIYRYRLSPYHVQACQDGGQTASVGGGNYGMAALALSSATESVTHVCDAHLHFSE
                     KDAACHVVLAGTQRVPVSKVGYMSLASRVGSLGHAQQQHSGVTGCRALAWWAVVQNAV
                     LPRQTFDRSALERQKLQQQQPHNGHAFSPFRTNAGSPPFTVHVQSNTMALPCGLGACP
                     ASALTSPATSSPATAGAGVASGVSAVGPGQGSGFAAAFMLTDVLVLASGQELYVGDLR
                     DVPRSARTLPVLRPLRSFGSVVEGITAGPYMDARAVLVATGSRVAPVLLV"
     gene            complement(<386487..>387839)
                     /locus_tag="LDBPK_091020"
                     /db_xref="GeneID:13392116"
     mRNA            complement(<386487..>387839)
                     /locus_tag="LDBPK_091020"
                     /product="elongation factor-1 gamma"
                     /transcript_id="XM_003858733.1"
                     /db_xref="GeneID:13392116"
     CDS             complement(386487..387839)
                     /locus_tag="LDBPK_091020"
                     /codon_start=1
                     /product="elongation factor-1 gamma"
                     /protein_id="XP_003858781.1"
                     /db_xref="GeneID:13392116"
                     /db_xref="GOA:E9B9Y8"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y8"
                     /translation="MAALSHARIIPPHTHTHSFSGLLYIPSQASPKKVDSAPKQQHAE
                     PMMTYKLLAPLHPESARAQKIMVAAAYANVDVELKVCQYGQENETPEFARNCSPCMRF
                     PSMQTEEGYLFESNAIMRHIARVEKSGAKLYGATPFESSQVDMWLDFASSELDAHNMP
                     YLMETFAGIPAAESAMATLEESLAGLELWLETRTFLVGERMTVADISVAFALQWVYRM
                     NVKHGEELTKKYRNAYRLYNTVMQQPKTVEVLKQWGATFGPAKAPKKAAEAKPKAEKK
                     PKEAVEDEEEQSAKEEKKANPLDALPPSSFVLDAYKREYSNTDTRTVAAPYFFEHYDT
                     EGYTCFWARYKYNEDNKKQFMTANLVRGWFQRMEHVRKYAFGVALIIGEDAAHELVSF
                     WVFRGKGMPEIVSEVVDTELFEWEEIKDVQAEKEKITDYLCWEGPTIPRPVLEGRCFK
                     "
     gap             388035..389729
                     /estimated_length=1695
     gene            complement(<390891..>391181)
                     /locus_tag="LDBPK_091030"
                     /db_xref="GeneID:13392117"
     mRNA            complement(<390891..>391181)
                     /locus_tag="LDBPK_091030"
                     /product="elongation factor-1 gamma"
                     /transcript_id="XM_003858734.1"
                     /db_xref="GeneID:13392117"
     CDS             complement(390891..391181)
                     /locus_tag="LDBPK_091030"
                     /codon_start=1
                     /product="elongation factor-1 gamma"
                     /protein_id="XP_003858782.1"
                     /db_xref="GeneID:13392117"
                     /db_xref="GOA:E9B9Y9"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="UniProtKB/TrEMBL:E9B9Y9"
                     /translation="MTANLVRGWFQRMEHVRKYAFGVALIIGEDAAHELVSFWVFRGK
                     GMPEIVSEVVDTELFEWEEIKDVQAEKEKITDYLCWEGPTIPRPVLEGRCFK"
     gap             391207..392232
                     /estimated_length=1026
     gene            complement(<393924..>396917)
                     /locus_tag="LDBPK_091040"
                     /db_xref="GeneID:13392118"
     mRNA            complement(<393924..>396917)
                     /locus_tag="LDBPK_091040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858735.1"
                     /db_xref="GeneID:13392118"
     CDS             complement(393924..396917)
                     /locus_tag="LDBPK_091040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858783.1"
                     /db_xref="GeneID:13392118"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z0"
                     /translation="MNIWLRRALERQAESAIAEAIRDGKPIPEAAVATVASIALGAAA
                     ATPAQATAVEPKNNDASTSAKTPAAPPAAPKTSFAELMRQHREGLVPPSAQPPVKATT
                     VVKRPKGTKSPTPVGTPAAEEALPTPAPNKKCAAKSASQARTAPEAAPATLSPSEFEK
                     ATGEEGGPTQTTPTTEVNSSATASAAAAVHQAAVRKRSKATNSVSAKRAHDTSAATSA
                     ATTPTQVTTVKGKTSLEELRARRNRTTAGGSANHHSTPHPGEGGAGVASSSSAGNAVG
                     GHAQQDEYNDSALDAVSRLLLRYCLGDRATEMAPSTVAAANGVDVASSSTEPVAAPTA
                     ESPPAPTRTTTELEFFNELMELCANDSLTPASLELLRELFQHVRVLPRPASSSNAGKN
                     CENADTGAPAVQDGMAKMVELDAEAYREAARRREYVQQVIMVLLNRLKHMKTQEQRQR
                     QKCCGGTAAETSTSAAAAPPQPVTGYGAPFIKVGGVSLAPPPMSPPAQQQQQSGMMYP
                     EGQRTASAAPWPSMAEMAGAYPDEATAAAFTSDMMAYGYPNPYAHLTVFSQHQPVAPP
                     VGWPSPFHSPTAGDRRGRCGHHGSKSPNSNSNVAARLVASPFPGAFPIIPPPATTDTS
                     ADAEDREMQELFRMIRAQLTQPVNTQSSSVTAISSQVESSVNLSGTAPVEVSQEERTV
                     LRHVQMDFKKHMEEHQQQQQQAAAKGSSVPQPPPQTASTPLTASLTAPPGTGAAPPRR
                     MHATPGATAGTSDSAAGTETVAAAAAQVESSKSQGDHTLTANQANCLEETGEAAGESP
                     SARSTTAPAQEEEGIVTGKTTPAKSRGTTLSLNAKPFVPGGPRGGNSSTTCAIIKPTA
                     TAGSTPTKTTFNYHAKPFLPSGSASSLMPPPPRKSAKMNVAAPAFVSKQQQQQPQATA
                     SPSVTSSPPTSGPPFNAPTTGIPAMPPPLPKSAADPWASYEMFARWRDMMEAYYQNVF
                     AMQNAAATTTGTSSPSAMIAPSRPA"
     gene            complement(<399074..>415159)
                     /locus_tag="LDBPK_091050"
                     /db_xref="GeneID:13392119"
     mRNA            complement(<399074..>415159)
                     /locus_tag="LDBPK_091050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858736.1"
                     /db_xref="GeneID:13392119"
     CDS             complement(399074..415159)
                     /locus_tag="LDBPK_091050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858784.1"
                     /db_xref="GeneID:13392119"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z1"
                     /translation="MVFAGYIAFILSTYLGKFIKGVNKDSVNVSLLRGSIELKKLELL
                     PDLLYFCEHLQLVSGTIGSLSVKIPWHFLYSKRCEVVVRDVSITVAPKHQHSDTATAF
                     FRSKEEFLTAVQVVVVDATKQKKKKYSKSGLLNRLQQTFLKNLAFHLENLSFQLEDKT
                     GCWKGQTARVQARFGRLTCEATDSNYKSTFVQPEDSIANESLYRLVSYEGVSVRLLYS
                     FKDEEPLQRRSSQLQNLESVDSFINAEEVLVSSEGAMAIYLQKRSATVQTEPRVWAAL
                     MTRKTTLQWSAPCTTAIGILLESVKQAPRRAFFWDNRPASRIRVGDPAGTSRWWSYAI
                     GKVVTYQKARRDRRRFDWAAYQRRKLFLASLFTFCLQLLQAPWIPDSEGQSLSEEQLV
                     RISAQDAMACWHAAKECFAQFQRTKRPPQGSAYAQYLQYFYLNEQKSCEEPLLELSPL
                     TALPAEIGLTIECAELAVSLDQNLRGATNQAYIGVTASKDKLCVQLSAATATVVAEAD
                     EDKPVLAITGSDTAGVLLMASKVGHSPASVELVIEEMVTCLDLSFQELLVTKVASYIV
                     AARPFLNQDFSDVSNAAVLVGNKVDHPEMRTQQEPFSSFGIIVKSVTGKADGVCLHAK
                     RAQLALALSRPPVAEIQEISAIVNDATLVQLCSVAVTPALGSDGIRIEVVTDSANIST
                     NVEGFEYVKLLLGSMKQQWSSRTNNFVSDLQARRSGDAKQDALSKEKSQVNLALRFEF
                     IEYGALALETFSIRTTFGDGWHIHLSAAGGTTEWWCHSIPPQPQESFIDIHVWAGGFL
                     VYSPFADSIEGNGIAFTCNFNHVTVCLGNDLISSLESLYDTVMMILCDDEDRHVYLSE
                     RDKYTAPQIIGLFTGSHMMLLLDSKSGDLTLLPGHTDTEAAAAAKAAAGSADFRRPGA
                     NPPPTPPPLTLELLGEECLHVSLQRYGDKRMDIHVALQRGVNAYLIGAPAHIPLFVPR
                     DSMRAEVELHMCAPSDVDLPIFPYGRLNVVMKLSNVGTVMHIPTLTAVWTYFDTPSLP
                     LCRLRNIGSRLLFSSRPSQPGATLAPRSPASASVEAVGAAAFARISRPSGGGARSASA
                     PLSTLAPFGMYSTPVFPSDMRLSVEISESELYYPWGEGSVAPLYLHAELTNCEVVMLS
                     RDGCVEVTVRGFLAMPRVRAALHTFPRAMSETTAQCAEASTTRTAAESRDEHGTYEKA
                     PPWRTSEEHTARPCSSQSASSTAQQTSRGARAAHSPAAAQAAFPSEEYLAAPQHCASP
                     PLASSLIQVHVVYTMDSRPPFSPESPDESLRVSLTATAVPGIGALPGPLHASLRSPAE
                     VAAWLTFFTFFNLTNTVPLSTSSCVATASPTFVSAGNSTSGGSGGSIPTAAAQNPRRL
                     IMNVHTSPIVFHLPFAAAAAVLWEGLDFVASPGYSVLRVPKLDVLVHEQLWCTAATGV
                     ATSVQRLATLRDNGYAVLSLRSSSSGSIGEVDMMPAILFESHATGPTAAEVRRRLVLP
                     AIVGHLAHATTLVQLQKCFTLAAVSAVFAARNAQTALLNAVILQESQRRKLRYACCCT
                     TSTGGGGSSSYSSGTDADAEAQLLPLISPPLAIHIHSGCLTFEWMSGLQHGLRAGVTV
                     AFANARCNDYDVHNHLSAAQPADDSCDTTAHCPQRFPLALSMPLIVEVEAVEAYVWWA
                     NAERTSTAEAAVGEEVASLDGPQSTSKQHPGVPLVTACMPLLLYPFQVHTRIDTAAQV
                     AGTDTGEAAHERGTAAAAASDTCLSVQQEDARVATSEEELVLSFAVSSGDDTIGTAAR
                     RSQSLSSATLHTMPSTPSDRSSVTAAAVPTTIMYPMRPAEALPTSVFLVTPIHVVLNN
                     SAYIVLSEMLLHKVQGTSAATAAGAQGAVAEATPPVSQGVAIVSQYYLKHCVVEPPTA
                     ARGSATTSSASLSSPFPPLACSRSEPSSYTRSARNGFGGSSGGHASSSLVRAQAVRAK
                     TIYVFRYDSAPKQRVWVESQSQTSWQLDQQQPNGDNSVEKDEERGLKPSRNGAAEIAE
                     VEKRSVPMSHTPLSSLHAMDGMRMLEAPAVHDGPANLRGTRIHEGPSKLSSSSAVQEE
                     KRREPHQHPRPSAHVTMAVPTLSPQAATQPRLQMRITVAEVCLRLVYYRDVETVAAAV
                     SEERAFWQRYAEVHASARRAAAAASPVSATTTQTPCLMTFLAASVAPLRSLYPASTNS
                     ITARSRINRSASPLARSRTPLRWGQLPALPASAQQQLLAPTAMLEEACVDALCVRLSG
                     IIVSSFTDARSVQLESCVCTSVKSPSRPLLSTTQVELYVPSSAVAYPSAGEAAKTVTR
                     DLQGAAWVTKVLRGMETAPEAESVGASPTMSPKDTNAIAAPSAPVLPQPQPSDPTRQA
                     ERSHLADSPSLAAAPTAASTSVNGWNCNGDGGHRQAIVMQGEVGCRLETLTIDLSAAA
                     LRAWLSCLVEQPVAALRAATEKEKRAEPVADRSQHAVAVATTTPILSPVQWKPGQGLR
                     VHEIREAFWELEHDITLSRDGLVLVFSSQETNLLTVYLNGHDITLDPSLLLRPAGLQR
                     VVMVVQGGLTVRFVGSGRVRLPLALWSSSLVETTANVGLETALLPFMAIGEGSYLECP
                     QVRLGFTEPPAESSAGGGNGRETAASSQRPVPDSLAFISKASAAGVKAAEGSEDASVD
                     ASPPPPPSSHADPHQSQLVHRNVHLYMPHISAIIEPRRESRQLRIRTAVESWMSLCNG
                     QLLRDDVRCTGFMVLSESIYDAATTTARTTVLGPVDVSVCSSNGRHHAVSLGPVQVDL
                     GRSDLLIMSTYAGELQALRLYAKHLTHSKVERAFLELVEATLAWKASAATTNNTGVHG
                     EEDEHDSELYDGADSSDKSEEKEGGEERRSSGPRGGAAREQTVAAVPPLQTDFARASH
                     TSDASGATASTAAVREGAMTIDRPRSSSTGPRKESHRQPSRPATPQGSATRRTGTTKA
                     LLRQFVAEGGEVQEEVRSRICAEDDQMRLIPTVDVRRQQQQQQRQRRRQRLLRRRQPR
                     GFSWVVFTPSVEVIFSDHRYPLMQVCVQDVMVRRTSSSALASTSLVRCQRASVRVHGR
                     GRWDVLLKPSAALTWSLTQTVSLHSSNRHVSLVVEGVHWQCSHLIVAKLLYMNHQFST
                     LATSLRRRLTMAAAAGGEASSAAAPASVAHVAMAPAVTKFRGEDDSGRDTSSDTTAGS
                     ASVSTDGDDGNDSGHSKRSSSSSRQSNASTETFSDTISRRQRRQLRQDAVAMGAGGQS
                     ADSSLTMEATPSSLSFAASSVVVNEVPATAVTTAADRLAATMRPSQRGGYRRPSVTAG
                     AGTPVTTAAVSPGMATHRLLNSFSHTLFAGICERVEVAKVSATATPDVLSAAARSADP
                     SSLRSTAETAAPMLWRCNELYRLPPSSTTDIFISYRRAHSLMLTFFTAEFVEWDGVNC
                     AWTLNAKGETALAARAIVSTAKPSPTVPPPRQQKQLDTSRGAVSATTTNWFAFTSLQY
                     GMARALTVSTTASRGAAATPATATGISDYGGGNGNGGGCKVLAYSLALTCVDAEEEAD
                     TSRYPIVVASGEGGHDGLTPVPHQQQQHRRHARRRSFTASSADASALLSRSASSMCVG
                     SLKKGGALLGGSTPKGAAPQMARGSSSSSSRAGASHRTSDDFVPAQCGEPLLHRSHDR
                     YDRLQMVQCGAASTHSLPDQRRSSATISTTTGNQKPAAQRSARPHSRNTARVPPAVHR
                     GRLQLPYHVKTATTPMASWQDTEGGGGDLLVVRLQARSSLFNETGCTLQLLPSLQLLT
                     APNSVDGAPSLPATLTTVPPGWQLPLNEEDVHNEVVLRVCCPSTRWMPSPAAPSATAA
                     SSTGMTVSGPTAGVAETMDDATTHLCWYETRTVLGQLQSGRFLSFRRVDLAGDAAGPP
                     VDVAGAATAKDLASSLHRCATSHTRDDHDERLLILFVIHTYSADGLMQHISLYPRLTL
                     INHLGLTARVVVFQQDPLAGPQTPDEATLIAQWTAPRVGRGLHDQERFYRSLVALGAH
                     DALPHQHALPLHFCTYGSNLVLGLSFTQSTGDAFFTADLDPVVTHLRDAVDRHPRLLQ
                     LRDSHGRAFYVQVSVMSRTVVLSVALWVYNLTEYPLLMSDSFLQRRLCPGQNSTSGII
                     PSQGEPFLIGCQLADFTQGFFAIGMDGSWSSAVPIDVGSSGVFVSALSRLGITRSCNY
                     SILFPNAQEGRPMVIQITPRWVFYNNTPKQLRLQFRFPGLETAMQQAEKRRRRLRMRE
                     MDARAAENDIEAAAVPFEAAGATLQGARHRLLLEADDTVGALNSIAAVQLNPGDYHVS
                     CIGPIEGNQFRVQEMLQGILPAITSIHAAGRVGHRDVSSYYESQYTPYMDVDRPGEAT
                     FNLWAAPRALGKQVAVNYGSDLIVQRPSAPHPTELEPHDMYSADAVITGRIAVAVQSA
                     DDVLAVLLQPIQGTKILLQNRTESHTVMARQLGSSRRNRIPPRQNRFFLWEDARQEHT
                     IRVHLLGYKGRWFDVDFSAGECQVTRHVDTEAAAAAEALDHARRLHPHPTQVKLEAEL
                     HGRTAAAADFSFHVRGYTNTEKTLVTILVTETPVPVYAAIDSWRTSQAVSLRMTMVQL
                     SWTQEMSTHVATAAKFATPFAIDDGGDGVVDSGASGVAIAPVEGTDRGGDTVTAAPPS
                     SVANAALFSIILEGVQLERLATEDNENFYLAVHQMQWVDEKRKAVFVYRARPRLPPAM
                     AMLQAADAAQGSASVAAPMLRTPRLSSSSPSSLSSPSCAKPNPGDRAGSLTRRRQLHR
                     TGSPAVGTAAAGAKSRDVSSGGYGALLEPITATANRLLSTALGRSNAFLLCMEKQNDL
                     EISYSLIKYADGVTRYTELRHVLTPLVVVLTDFLVVDMIQEVRRLRVLLRLRKQTAAS
                     QTTTTSPVVLTVSSLRQQQRSTWRAFGDEDTGSGVMVGVPGKQAFSKPCARPPSWKLG
                     QRSGSVVVVNGDTEADVLPSEQPTLAAQAAPRRRSPNERTSSEDAVQRRGRQTDPLSR
                     RGSRDRIRDGDKSNATAASSVHTRRTGSSHTYDSKAGKMRSATRRLTTTTPTSPRRSG
                     PSCAVIAATAVAVPPQQQHQQGDGNTAGFLSQAFFLQKLVQEVRTRLEQRGTDAMAGS
                     LAALATRGEKQLQPGSGKLLLLPGGIAGAGPQAQHRQLLRGATSAAVRHYQSAMHCDG
                     LAGVTTVDADGSRAVADVGSSGAKAAGDGGVGSVSTASFMFIERLEVQRVTLYVTFVR
                     HSPDPLRPLLGAYAWMLPSQLCQREFYLPAWTLTRQVETPASLQARLVRWGMHSLREQ
                     WTKVTKLGTLLDALKFWQHRTLLLHGAPRPLTLSRVQQQQQQERGGGGGQPLATFAPC
                     ISSGEEENDENTDDDSGNADPQRGGAQVESPIAFMKQRR"
     gene            complement(<415643..>416581)
                     /locus_tag="LDBPK_091060"
                     /db_xref="GeneID:13392062"
     mRNA            complement(<415643..>416581)
                     /locus_tag="LDBPK_091060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858737.1"
                     /db_xref="GeneID:13392062"
     CDS             complement(415643..416581)
                     /locus_tag="LDBPK_091060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858785.1"
                     /db_xref="GeneID:13392062"
                     /db_xref="InterPro:IPR018997"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z2"
                     /translation="MNAVKLPEEWETLCSTSDAEVIHECINGVFRRLLANLLLDFNNP
                     KFRQVKKDNKALRRLTESLPAGFIEFLFSSIGFAKHEDAFIFEGSLESLKHGDTVLSC
                     IEDIFGKERLQAAQCGLYRLRNLAIKKAENGLTQREMATATARLQRARPLSQEEDAKR
                     QAQQGGTEKDVAEEHAVKEAVRKTLLNTGRVRNGFFEARDFSVRTMQHGRVYACTKKC
                     PDHCVEAHWHLFTGRNILYSHLAHLSADGTRLLHLGPEHGYQYNSLPGSANFGKMIHF
                     SEKLMDENGRLVHIKNDDKPVTACIYCGRAFAELLL"
     gene            417090..417165
                     /locus_tag="LDBPK_09tRNA3"
                     /db_xref="GeneID:13392120"
     tRNA            417090..417165
                     /locus_tag="LDBPK_09tRNA3"
                     /product="tRNA-Val"
                     /db_xref="GeneID:13392120"
     gene            <417222..>417289
                     /locus_tag="LDBPK_09rRNA2"
                     /db_xref="GeneID:13392121"
     rRNA            <417222..>417289
                     /locus_tag="LDBPK_09rRNA2"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002966706.1"
                     /db_xref="GeneID:13392121"
     gene            417405..417475
                     /locus_tag="LDBPK_09tRNA4"
                     /db_xref="GeneID:13392148"
     tRNA            417405..417475
                     /locus_tag="LDBPK_09tRNA4"
                     /product="tRNA-His"
                     /db_xref="GeneID:13392148"
     gene            complement(417654..417726)
                     /locus_tag="LDBPK_09tRNA5"
                     /db_xref="GeneID:13392146"
     tRNA            complement(417654..417726)
                     /locus_tag="LDBPK_09tRNA5"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:13392146"
     gene            <420223..>422070
                     /locus_tag="LDBPK_091070"
                     /db_xref="GeneID:13392186"
     mRNA            <420223..>422070
                     /locus_tag="LDBPK_091070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858738.1"
                     /db_xref="GeneID:13392186"
     CDS             420223..422070
                     /locus_tag="LDBPK_091070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858786.1"
                     /db_xref="GeneID:13392186"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z3"
                     /translation="MPSNKVLVVTGAVLASAALIGTVVIMSSHKKSTEDNDDDAFCAP
                     LSSLSQSKKQTFSVAKNTARPSESAASEATASQKKPKVALETQPAAAKMDAAAHADVK
                     VPAAADAAASLLEEALDELEPTRPAASAEETKVAGKRTVAEVAAADTADRKTFQHLGI
                     SMKVPEGWEVREELSPIPNVAMVTVWNPEFEHFPNAEMPGAVPVIILSVEDIRGENLN
                     LVEFKDRSKDLSMQQMLMMTGGVVQPIVRKDSSVQEGSFRHILEYSQSMPPFFDLSVI
                     NLLEVRNGVAYVFQIMCNPKIMNQYRPIFTQLARDIVVTPMDSSSLGFFRVHTGKVSM
                     DIDTTWSWSYPDAGDEAALHLAQFQLASTVKKEEITLYEVSKAPATVHKQRKEKTVDG
                     VTICSAFDGTQEKKTFTYNNYCLVVHPQQKAISYLSEAALVRAVKSVTPSTEPPKPKC
                     GAAFITTEYGYTFDVIGASRVVSTKLGNGTVVYAPQGIPSDPSKAASPEETGPTVTIR
                     IGKPETDPDCMGSIEEWTARIREEAANGTITKIQVVQLKEQECLTFLSKEMQEVSPKE
                     KVEVVGKVFIFVRNGTTTLVRWESATGTWRKYERDMEAFLESFQFLESV"
     gene            complement(429810..429881)
                     /locus_tag="LDBPK_09tRNA6"
                     /db_xref="GeneID:13392149"
     tRNA            complement(429810..429881)
                     /locus_tag="LDBPK_09tRNA6"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:13392149"
     gene            complement(429981..430283)
                     /locus_tag="LDBPK_09rRNA3"
                     /db_xref="GeneID:13392122"
     rRNA            complement(429981..430283)
                     /locus_tag="LDBPK_09rRNA3"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002966707.1"
                     /db_xref="GeneID:13392122"
     gene            complement(430117..430192)
                     /locus_tag="LDBPK_09tRNA7"
                     /db_xref="GeneID:13392187"
     tRNA            complement(430117..430192)
                     /locus_tag="LDBPK_09tRNA7"
                     /product="tRNA-Val"
                     /db_xref="GeneID:13392187"
     gene            430266..430337
                     /locus_tag="LDBPK_09tRNA8"
                     /db_xref="GeneID:13392184"
     tRNA            430266..430337
                     /locus_tag="LDBPK_09tRNA8"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:13392184"
     gene            430404..430474
                     /locus_tag="LDBPK_09tRNA9"
                     /db_xref="GeneID:13392188"
     tRNA            430404..430474
                     /locus_tag="LDBPK_09tRNA9"
                     /product="tRNA-His"
                     /db_xref="GeneID:13392188"
     gene            complement(<431459..>433246)
                     /locus_tag="LDBPK_091080"
                     /db_xref="GeneID:13392150"
     mRNA            complement(<431459..>433246)
                     /locus_tag="LDBPK_091080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858739.1"
                     /db_xref="GeneID:13392150"
     CDS             complement(431459..433246)
                     /locus_tag="LDBPK_091080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858787.1"
                     /db_xref="GeneID:13392150"
                     /db_xref="GOA:E9B9Z4"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z4"
                     /translation="MLPRSSPATAAPQPASGGGAPAFSVPVSSSRSPQRGASPPLSAS
                     SEVPPSAESSPANGSSSRTSSSYSDSDDERHRAQGSGGGVRGAYNAAAASADAPKSRS
                     TRAKRWLKKKLIPDFVHEYGRTVYGGNPLSQQTLPGVFNYPSPFILVPIFYVLMVPFL
                     VLGALVLVKGREYHIVEQEYSHIHQYQYVPSNSSVNINHGILQFTVDGVTHAQGTRTW
                     LEINISHRMKAPVYMYYKIANMHQNHRDFHNGRSNSQLRGKSKIDKAYLCKPYTYPGF
                     RSDEGDTPITITDVTGTQVTRPARYFTYNPCGIAPWSKFNDTFILYRKLTPAEVVQAN
                     ISGVPVLHGGVDSTTPVTLICNGTDFGLRGEPLSGSVTKNHCSKMGISWKADREIRFR
                     NITLREDWWSLYYPYPTTNEYLRNGWYLHEPGHALPDPSDYDLHVWMRASFTSNFRKL
                     YRIIHVPLHPGTYLVDISEFYDVVSFRGRKSVVLQHANWVGGRNIVLGVVFIIMGCAS
                     FVLGVTFTVECMLQLNGVNRYKRLREPKRSWYVFQPNDPEFANYYQLRLRRHIPMAQL
                     QSLRKAVAELENLVRDGEVNRNGANGQRA"
     gene            complement(<434360..>435301)
                     /locus_tag="LDBPK_091090"
                     /db_xref="GeneID:13392189"
     mRNA            complement(<434360..>435301)
                     /locus_tag="LDBPK_091090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858740.1"
                     /db_xref="GeneID:13392189"
     CDS             complement(434360..435301)
                     /locus_tag="LDBPK_091090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858788.1"
                     /db_xref="GeneID:13392189"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z5"
                     /translation="MSTADTVARPIASPSRTVHTSSSAPAQCSLTSARGRRAHKMAPF
                     GSPQPVLLRNPYGMERPRLVDALHGGGRAGFRAHQHGSTSSSHADAEVLLSRQDAALY
                     DACATRLRVVRQERRALAAKLAASKQQLEHAHALLDAWREKPKQPPATAQTKQAERDG
                     AVPEPQPSSSPRKQETERMIRQLRELDRENDELRRRYEALVQEKRHCLTVHNARLRRV
                     LAAAAPSSTTSRRSSATAACNESSAFARDVKILDTRLATAMAQQQALQQGLALAVAKE
                     RGRITALTHLQARGFACMYAPEPNGSAITSASREAGA"
     gene            complement(<437232..>439292)
                     /locus_tag="LDBPK_091100"
                     /db_xref="GeneID:13392123"
     mRNA            complement(<437232..>439292)
                     /locus_tag="LDBPK_091100"
                     /product="phospholipid:diacylglycerol acyltransferase,
                     putative"
                     /transcript_id="XM_003858741.1"
                     /db_xref="GeneID:13392123"
     CDS             complement(437232..439292)
                     /locus_tag="LDBPK_091100"
                     /codon_start=1
                     /product="phospholipid:diacylglycerol acyltransferase,
                     putative"
                     /protein_id="XP_003858789.1"
                     /db_xref="GeneID:13392123"
                     /db_xref="GOA:E9B9Z6"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z6"
                     /translation="MHIETSIDAMHRPPPVEVSPSNPRVSAARRYAPSVVGGQHHHRG
                     QHKGLSASGQPKSRWMRLRSFMFGREEFVDFDNAFASPTDSAKVTDSQRRTARMIERL
                     PLPSWMKHNLFDVVDFLTRRRVHLVVLILAVLMFVIAPEGVMEDVAGSFTVDEDARPG
                     LTFFKKYNRGDTYLPRRHPVVIMPGFITGALEVWETSLPCARQKSFFSGFRQRMFGPQ
                     MIYLILSDPQCWLDMFSMNKKTGMDRDDTKVRADSGFASVDYFVPGYWVWAKVLINLA
                     DIGYDPQSMAVVTYDWRLSPGKAHERDGFFYQVRNSLRFLCQKNRKRAVVISHSYGAT
                     VALAFFRWAEQRESGFMDRHVAYYVNVGGVAMGVGKAASALLLGDARDTLNIQWAARK
                     MFDTFISQEARYGLSRSWSCLVSMLPRGCEEAWPGLTVLPNGTALGTRGTAELIRGEC
                     QRSGHEDCVRQIDSFLETIDDLPSLPQAPNTTVACLYGVGLPAEAGYYLMWNPDEANI
                     ETPYVGNSSVFNNNTSHGVRMSDGDDTVPLMSLAYMCRAVNGWRRNVGRVVTREFNHS
                     VSGASSLNLRGGKLSAKHVDILGNYEMLEIILKIASGIDEEGVEKPENDEFNYTNADT
                     GETSTLQRRVHDRIYSDVDFIIRSNLRSCLRKKNKPIKPIESYEDDDEFAWSGTSKSS
                     WQQR"
     gene            complement(<442321..>443073)
                     /locus_tag="LDBPK_091110"
                     /db_xref="GeneID:13392124"
     mRNA            complement(<442321..>443073)
                     /locus_tag="LDBPK_091110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858742.1"
                     /db_xref="GeneID:13392124"
     CDS             complement(442321..443073)
                     /locus_tag="LDBPK_091110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858790.1"
                     /db_xref="GeneID:13392124"
                     /db_xref="GOA:E9B9Z7"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z7"
                     /translation="MDVRAPNIIVNPEKFELVLHANEDCTFELTNVGYEAIIYRVRTT
                     APLRYYLKHSKGVVKGNSSAKITIFLNQKTFAEGLPVGVRYTKDTFRVECAVLGEQDV
                     IEAHGANLANLIQKKKDANASSVVQKYISCRVLLDAGDSKDGAAGAAAGKAGAAGSGG
                     VAAGGDAAGRGSGSAGEKSSSGRKSMTAEQMEQNTLNEKRRRNVSGGQLAVRGNHMRL
                     LRIAIAAVVVVVFAMWVMRGGDGDVDVEEIAE"
     gene            complement(<444259..>445152)
                     /locus_tag="LDBPK_091120"
                     /db_xref="GeneID:13392125"
     mRNA            complement(<444259..>445152)
                     /locus_tag="LDBPK_091120"
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /transcript_id="XM_003858743.1"
                     /db_xref="GeneID:13392125"
     CDS             complement(444259..445152)
                     /locus_tag="LDBPK_091120"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /protein_id="XP_003858791.1"
                     /db_xref="GeneID:13392125"
                     /db_xref="GOA:E9B9Z8"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z8"
                     /translation="MFSSYILYDTVAIEAVYFPRHFTNECADSGGAAATNTTSGPSSA
                     ATATVAVRSDGDNECYSLTLRDILLHRLTERYVGRVIPSRGLCVAITEVMEYSASSVR
                     GAAASAWLTVTFGVCVFAPNPGTRLKARIAYQTAAGVYLTMDLFVAIPFLVPAEMLVP
                     GSRFSAAQGFWYLPLDTEDQEGGERSAELGAGPAVAGMGQGSGKDGDGYGSDTLASSA
                     LSSTTAAAAAPYNAYMVGAEVIVKVASCTVQSEETVSAAEDADGASGGDSGAIPIMEL
                     RGSFVGDALGPMSWFEKDDDA"
     gap             447663..447761
                     /estimated_length=99
     gene            complement(<447763..>448602)
                     /locus_tag="LDBPK_091130"
                     /db_xref="GeneID:13392126"
     mRNA            complement(<447763..>448602)
                     /locus_tag="LDBPK_091130"
                     /product="eukaryotic translation initiation factor 2
                     subunit, putative"
                     /transcript_id="XM_003858744.1"
                     /db_xref="GeneID:13392126"
     CDS             complement(<447763..448602)
                     /locus_tag="LDBPK_091130"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 2
                     subunit, putative"
                     /protein_id="XP_003858792.1"
                     /db_xref="GeneID:13392126"
                     /db_xref="GOA:E9B9Z9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B9Z9"
                     /translation="MAEEDIADFTLDDEKVIDTDQGLAKQDFSKIDLDELNVDTFEVM
                     SRQATINVGTIGHVAHGKSTVVKALSGVKTQKFHREAVMNITIHLGYANAKVYQCETC
                     PRPTCYQTYPSSQPDSTPCPNCGETMTLKRHFSFVDCPGHDVLMATMLNGAAIMDAAL
                     LLIAANESFPQPQTLEHLKAVEIMKLRHLVVLQNKIDLVGEVKAHDQYRHVRAYLDNI
                     ALNVPIVPISAQLKRNVDYLLEYLLHIPMPVRQLKAPVRMTVVRSFDINKPGEGDIES
                     LKGG"
     gap             449156..449254
                     /estimated_length=99
     gap             451681..452957
                     /estimated_length=1277
     gene            complement(<452959..>453159)
                     /locus_tag="LDBPK_091140"
                     /db_xref="GeneID:13392127"
     mRNA            complement(<452959..>453159)
                     /locus_tag="LDBPK_091140"
                     /product="translation initiation factor EIF-2B gamma
                     subunit, putative"
                     /transcript_id="XM_003858745.1"
                     /db_xref="GeneID:13392127"
     CDS             complement(<452959..453159)
                     /locus_tag="LDBPK_091140"
                     /codon_start=1
                     /product="translation initiation factor EIF-2B gamma
                     subunit, putative"
                     /protein_id="XP_003858793.1"
                     /db_xref="GeneID:13392127"
                     /db_xref="GOA:E9BA00"
                     /db_xref="UniProtKB/TrEMBL:E9BA00"
                     /translation="MQRPLYALRLCTWLRRRCRSHPSPPVVARVYAPSSRRSPIHEGD
                     AAPLPIDISCMCGPPPPLLSPPP"
     gene            complement(<454006..>454773)
                     /locus_tag="LDBPK_091160"
                     /db_xref="GeneID:13392128"
     mRNA            complement(<454006..>454773)
                     /locus_tag="LDBPK_091160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858746.1"
                     /db_xref="GeneID:13392128"
     CDS             complement(454006..454773)
                     /locus_tag="LDBPK_091160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858794.1"
                     /db_xref="GeneID:13392128"
                     /db_xref="UniProtKB/TrEMBL:E9BA01"
                     /translation="MATIPTNTATATAPSKGGRAAVQVRSPSGSPLPNIELDEATIAL
                     IKENEQMLQTITTLQHELDKQQVRLNDAETARASLVDEVAELRSQLGLATSEATTSTG
                     KVLNYKTAFTDLQHAFDQLKRDSDATKEKLEEATKRERVLMQSASNTARQQSQMKESF
                     DLVTLALRMPNSFLISIQRIMEKLNDPALRPADRKRKLKDDIDRLQAQVAAYEPDMSS
                     SVVVSADGTPSVDIPIRQCVYAFLSVIMTLLKNEVGK"
     gap             456796..456858
                     /estimated_length=63
     gene            complement(<457848..>459224)
                     /locus_tag="LDBPK_091170"
                     /db_xref="GeneID:13392129"
     mRNA            complement(<457848..>459224)
                     /locus_tag="LDBPK_091170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858747.1"
                     /db_xref="GeneID:13392129"
     CDS             complement(457848..459224)
                     /locus_tag="LDBPK_091170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858795.1"
                     /db_xref="GeneID:13392129"
                     /db_xref="UniProtKB/TrEMBL:E9BA02"
                     /translation="MFLFRHSAEPMEEEEEHHEPVDSTMEPHNADTAAAEERRTSADV
                     ADGDISREPSGFAESFEETGGAPHTPREGTVPPPHVHDMLQHQHLHDEDDVEADMAAA
                     APAASAPAPSHGVPALPMPHTCNEDSQAEADGNGAQRHRSYSHTSRFAAPSPRSTSGI
                     SRGRSYSLSGLSAAELADVHEQRYRRCTSVVKSARCISARRASSVNGVVGVIDDLYTL
                     ASRRSSVMTEGERVAVERMMENEYRRQEAAERSAQLALARESTIVNEELAREKAMYVR
                     RMRLNEDLHARLAKSSRIRQERMTAAAQRRQEIEQERLRVLYDSMMEKDTRYHFRNPY
                     EMMAAQRRYSIEMRNPAAIAPQRRTSSPSTRANGNAQMSPHSSDGVANGTTEDRCTSS
                     PATRRRSSTPSIAKSKPRQCLPLDAWKKPEPPRKDSCRSDISAEHRCRSPNDWRATAV
                     LEHPRQWR"
     gene            complement(<460222..>460950)
                     /locus_tag="LDBPK_091180"
                     /db_xref="GeneID:13392130"
     mRNA            complement(<460222..>460950)
                     /locus_tag="LDBPK_091180"
                     /product="mitochondrial RNA binding protein 2"
                     /transcript_id="XM_003858748.1"
                     /db_xref="GeneID:13392130"
     CDS             complement(460222..460950)
                     /locus_tag="LDBPK_091180"
                     /codon_start=1
                     /product="mitochondrial RNA binding protein 2"
                     /protein_id="XP_003858796.1"
                     /db_xref="GeneID:13392130"
                     /db_xref="GOA:E9BA03"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="InterPro:IPR018539"
                     /db_xref="UniProtKB/TrEMBL:E9BA03"
                     /translation="MLHRVPTLWALRQRAGVTAMAVFGGLSANTGQFACQASPLQQAR
                     WASSDAAAPTSNNAQRNNGRNSNVQSQRGRRDAMPPAFDIVHWNDEDITAGHLLRVVH
                     RDGFIVLDYHRQRCVTAELREDGSRAPNPNRAERVVTVTLPPVYVARFLGVLEGRMSK
                     LEVQSRFTNASFSPNAAKGKHHYTLRCTSMKPTTGQIQTVDGADVHEETVEWTVEFDA
                     AESLMLHRFLTQALHYNTGFSRKV"
     gene            complement(<461925..>462383)
                     /locus_tag="LDBPK_091190"
                     /db_xref="GeneID:13392131"
     mRNA            complement(<461925..>462383)
                     /locus_tag="LDBPK_091190"
                     /product="mitochondrial import inner membrane translocase
                     subunit tim17, putative"
                     /transcript_id="XM_003858749.1"
                     /db_xref="GeneID:13392131"
     CDS             complement(461925..462383)
                     /locus_tag="LDBPK_091190"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit tim17, putative"
                     /protein_id="XP_003858797.1"
                     /db_xref="GeneID:13392131"
                     /db_xref="GOA:E9BA04"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:E9BA04"
                     /translation="MTSILDPRQPIEPLQRAMMVAKDSTLATAMLNVFGGYIMGFGFS
                     LFGSMISAETSTQAMGTADFFRHSLRSAHRLGGSFAFFGFLFGGIEVALEKRRGRKDQ
                     WNPTIAGAIIGGGYGWRSYKHPGLAAGIVGGAAFSLVFEKMLDAMGMAQH"
     gene            complement(<463420..>464115)
                     /locus_tag="LDBPK_091200"
                     /db_xref="GeneID:13392132"
     mRNA            complement(<463420..>464115)
                     /locus_tag="LDBPK_091200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858750.1"
                     /db_xref="GeneID:13392132"
     CDS             complement(463420..464115)
                     /locus_tag="LDBPK_091200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858798.1"
                     /db_xref="GeneID:13392132"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:E9BA05"
                     /translation="MLTTCSGSPIHASPFPLPILPHPKRREPHRVTTQRTQTRRDLPE
                     VQHAQTERKAKMAATNSRVFFDVHFISFHDDNLPGTAITDSKAPTSFVLTTGGFPQEV
                     IVQTRAASAKISKLSVALNDAKDILVEKCCGETPTAFEVMAERTLARGSVGGSSSNPS
                     AAAAAADGGVGGPQTETFDLDPEGAGRDIRFIRLTILSGYSEFVAVYSIDAWGEESQQ
                     RVAVLQSKPEVVM"
     gene            complement(<464630..>465487)
                     /locus_tag="LDBPK_091210"
                     /db_xref="GeneID:13392133"
     mRNA            complement(<464630..>465487)
                     /locus_tag="LDBPK_091210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858751.1"
                     /db_xref="GeneID:13392133"
     CDS             complement(464630..465487)
                     /locus_tag="LDBPK_091210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858799.1"
                     /db_xref="GeneID:13392133"
                     /db_xref="UniProtKB/TrEMBL:E9BA06"
                     /translation="MPPLHSRATRQLVKERNKIEGPRSLHRGIHYQENEAHASSYMQN
                     AKKKRADHRDLLVHHQRINEDLQDIYTRTAALHSDNMTMEERIEENWKKFERIGGKRP
                     ANVRTRGQDAVLCANQTAVPYAERLAQVSQQKKELRERGAWERLTHGEAVDYSKGSAL
                     HAAKDRRVQMFQRRQLRRAHLLRRVGDPTPLKQSGTYDMNSGTLQVFNKTIRNVQREV
                     AHDARIAEVRKRRKNSRSQWDLNESGNVNRPDQEVLRYSRDWELGPRRKARGGGGGRG
                     GRKRGRDEL"
     gene            complement(<466463..>468682)
                     /locus_tag="LDBPK_091220"
                     /db_xref="GeneID:13392134"
     mRNA            complement(<466463..>468682)
                     /locus_tag="LDBPK_091220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858752.1"
                     /db_xref="GeneID:13392134"
     CDS             complement(466463..468682)
                     /locus_tag="LDBPK_091220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858800.1"
                     /db_xref="GeneID:13392134"
                     /db_xref="UniProtKB/TrEMBL:E9BA07"
                     /translation="MQHTSSSVSSADTLAAVSLRRRATQRAEPTSAAAKVVAGGGGRA
                     RPVQQGSGRKLVASKELFFAGFPCMEPYRRQAPGATKPSTTPASAVAYSKQFVRGFFQ
                     QYGAVEALFYDENRGMGSVVFADGADAESCYLAVHLSFIAAPDENGGMGQPTWEKDRP
                     TEALDERKARALDLLLCLEFAQCCPFVHPFLLTRDAFLVGGEKQWEVPGGELSRALLL
                     HKFPVLLLSSDSRPSATEPMVPVAPHVVVRWEAETAEAPAPRVEVVEDGDRGPAAAAH
                     SPETVPSPQSRPVKRVGPTFPGRGIEPAVIEEALWQILQPAHVAAQDGNVVTVMDMWW
                     EYYNLYALRKTQPSADRIADDAFLYAAQPSLAQEVREVQRQSREYAHGDEAAAQQVML
                     RLVHDNLYHSALCYLGVKQKFKYDPMWASLMRDLYKDKVVLHVQAWRALAETAEAAKQ
                     GSAVDGGAHNAKLATTSSSSTATGPLNTRRGRAVKAALKALYEPQPTKQEDIEALRAM
                     EQLWRTMPRTEAAANLIENVKLLEKIKGGLVDRNGHDKVDTRPPLPALSPDGGNEQPS
                     DMSMEAAYPTMNAAQRDEQLYSAVMQNVDGYVETGTADELVGLCEHPKLFRYVKGHIG
                     YEEAHRLPSYWRAYLNALWVPLIAFLLLGFGTYYMVDWLGINEAHEKAVAERQRREFH
                     AHLLNLLNQQQAFLDQNGTDGAHLNATLQALNETMRRTSEAAARAGKKFRIELKQDL"
     gene            complement(<470556..>471146)
                     /locus_tag="LDBPK_091230"
                     /db_xref="GeneID:13392135"
     mRNA            complement(<470556..>471146)
                     /locus_tag="LDBPK_091230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858753.1"
                     /db_xref="GeneID:13392135"
     CDS             complement(470556..471146)
                     /locus_tag="LDBPK_091230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858801.1"
                     /db_xref="GeneID:13392135"
                     /db_xref="GOA:E9BA08"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="UniProtKB/TrEMBL:E9BA08"
                     /translation="MSNEEVFRISNVSGYSVEMPLATAKELLGMLNMDQVFRAARAGT
                     DDTDESDVDDGDTEPVKAEGTDYSKEVLDVVRAYALLPPDERTSSIPRPLTQDLRSVV
                     YAGEMELVEKAEREDYLVDLLNCALFLRFSQLSALCAAYMAVRIDEIAKAAPDIMEGA
                     ERIRKFLHMQNEWTEEEMGHLRREMEYAKSVDPNVY"
     gene            complement(<472418..>474592)
                     /locus_tag="LDBPK_091240"
                     /db_xref="GeneID:13392151"
     mRNA            complement(<472418..>474592)
                     /locus_tag="LDBPK_091240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858754.1"
                     /db_xref="GeneID:13392151"
     CDS             complement(472418..474592)
                     /locus_tag="LDBPK_091240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858802.1"
                     /db_xref="GeneID:13392151"
                     /db_xref="UniProtKB/TrEMBL:E9BA09"
                     /translation="MSTASLRHSTAAVGVEASRSGNLCSTPTGAAAHASTATAATTKS
                     RSARSPVATVTSPSSRSSHVSQSTLMDTDQSTPSVLSGEEGEESEEERGRDEGAAGAS
                     GGKRPSRDSRNLGDEGLDSVEVSSSSSELMPQSGSPANTTAAMPNGRGARRHRDPVVS
                     TSSSFTSNTTSSSSHLTTSGGGRSKGHRRSSTVVKVGAAEADDDFDEEAKGDAARADV
                     RVALDTAAAAAMASTGSARSGSGRPSTSPPPPDWCSPSSCHQRTPCMTDEDDVGAMIA
                     EDGLGAQGGILPALRSSRTESIGCFSPSTKPPLAPGAGGTATVSVPSPMDHTSLTSAT
                     PAATPASAAAETALATKRNSGGAGVKPLTSSLAYAGGIRITSSAIVLDLVRSASPCAS
                     PSSGKAAAAVPVAQSAASAAGAPPTAAASTVNIRSSTLLVCIKYMKHFAEAEAQAAAD
                     AAAAGKRRKHLRHKYRRHKYRRGRHGSDSSGNDDDKDSSATGTSSASSLSITSGSSSD
                     NSDEDDADTEVSTVSDSSFSPMSIGAPPGGPCASGGAVRRGYLAGAARGTGLGTPGSP
                     LGGPTAIPAPLTAPLVALLSPWEKDFLYMDLLGAPETVLTASHAILDVCPGFDYGSPS
                     VHLGDVKVKAALMAPPPPPEGVRTLIEVMAAAKQLQIEPLHALCAGWLADFMIRASYG
                     ATDNFEAAHLIRQCLRVTSDWSRRETDCLKIENEWPANEESE"
     gene            complement(<478414..>480210)
                     /locus_tag="LDBPK_091250"
                     /db_xref="GeneID:13392152"
     mRNA            complement(<478414..>480210)
                     /locus_tag="LDBPK_091250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858755.1"
                     /db_xref="GeneID:13392152"
     CDS             complement(478414..480210)
                     /locus_tag="LDBPK_091250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858803.1"
                     /db_xref="GeneID:13392152"
                     /db_xref="UniProtKB/TrEMBL:E9BA10"
                     /translation="MSSREASRAAAEPAPTPSSEPPRQRPADAVAVPASVQRFYTHFM
                     TLLTQQGRCGPATIAAAVSTPSAPLQHRSTSTTDGQDGTEDNALRRLTCAQEDALGPL
                     LWQWLVLFSLAVQQAGEAPQERGPAPSAMAVASAMCSATPSHALGPHDVERLFRSGFS
                     SLLPVAGSGGGAGGLRGSRMPPADPPAPWHSVPLAKQSGPERALVAALSAISCNGPLF
                     SAWCALCYTCVGASLLVSTSQRRHEGGDAAAGLSTSGFSASEEAIRSALRRLRHAWNS
                     AVELADAPRRSVDACATLRLWATVYTTCTALGSAAEAAPITHEKAGESRALQAPPLSL
                     SLWAVQWYRECTRVAAHGADEGFHSEEAGVPVELVTRVMRYMCHRLEAEVVRRARRHE
                     RTGSAASLTATAELEEARAKTTAPVLTAPPSEASAPAPIVPTLRVGALTALALQSVMH
                     LVGDDADRRGGAAKRSGGRKGGAPLRRRRRAWQMSSDDDDGSDVDSSVEDPDYGGGTE
                     GSWSGRTDAQSGASRFIFSQQERYEVAIASGVLTTYSVCPADDDVAQPADRHYMHRLT
                     GEQYLRNGTVHWWTLRDSQRHRQLMAEARNTS"
     gene            complement(<480779..>485410)
                     /locus_tag="LDBPK_091260"
                     /db_xref="GeneID:13392153"
     mRNA            complement(<480779..>485410)
                     /locus_tag="LDBPK_091260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858756.1"
                     /db_xref="GeneID:13392153"
     CDS             complement(480779..485410)
                     /locus_tag="LDBPK_091260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858804.1"
                     /db_xref="GeneID:13392153"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9BA11"
                     /translation="MRDDVVDVPSSAASLLEAAKKWLACTPWEAPQGAAGEPTAATVL
                     CELVELSRLRHLLYTATARRAEQQPAPYGTESPSASPKAADDSAEASSNIDALRRGRQ
                     QHTSSPCPTPTSNAQMTRTAVRQRFKQLLKRSSASVQALYRATRKTDLILSSKTSKAT
                     STAPAAPTSFACVADIDAADVFWALVLYVSAALCWRQRRFLAAQRRADACVEDVVSSS
                     RDTSESHPLRPHVSSQPSRQESAHSSLSSTVDYFTGHTPRDTAARHGAGGGAGADFSS
                     ALRSHYALGKTAADNAPFSRCRRVLERLLPLLESRLSEAQLWRQPSLLAALDVLARGF
                     AMAEGRVHALSSRSGMGTAARCPLCYAAALDNELAVEAFLHLRCYAAAYQGAEDVAED
                     AGAQHGRQRGETRNGFDRAELSSCEVGWVAACRIALWNNCRASLMRLCCPPLFCTATW
                     WPHQEACERARCRRYALLEALWISWWRAETWLASGPSSPEITSTRAAISRDAAARWRS
                     ALLFMQVVLPAAEAAAREPGAEDCGVEGGAAEKHPNSQRANLRALLAHLVQLPIVTEL
                     MQQVLRPHQDEKCERIHTAGARNCGASGTVFHWLSQQGDVPLLTLLCHTLDGRTAAIT
                     AGKAPVGRPAAAAEAAAGHADRAYIIQLGAAHARGESVGDYRRHRAALPAPEAAASGA
                     VASIGGPVSQPAPTDPGRGLCSSVSVWGLHLMDTLGQNALDVACRRQHLPCVRLLLQA
                     GLSPNSLATLVSDKCVDSLPLPLLRLLYDPSFLEGADGSRSTPHMGLAERLRQPTCPA
                     AAASRTLAQLAFRLWTEKVQQLSMVPQAADGEGFVLDQWLSAYTRCQAAQDRVLRSAM
                     AALEFDAYEPMARLVVLSVLTRKLNDWLATAPSSVRFGASDSPVGTSGSVRGDAASSR
                     STPTVSQPQPAPPSLWQLRLQHTVALRLYTQLTCPLGRALLRRAVDARCAVCDALAAR
                     EDRAASALLAASAVMSAPSTAEAASVGDEGAEVAKRDAVVLSPEASVPLPPGASSLAL
                     SEPVKSRQELQGLYERVLADAHTLDARLVAEHQQRMCAMVARGGSEGHCRHGGTHPRH
                     LRASLVATHGVATVLRGRHHEHRTCAMRHSHRSSSAHDDEVCALYALAVIPSAEALQS
                     ARWETSTKRCSVEPQQPHHTTPGVRRVVEPTLWTFTSAPQQIWLRLPDGVDLDRLLRE
                     NDGGGFGVVADDVPLTAPVQRGDLVTFRCSSGGDGAGRSAGISARAAQQQQQQQQGAR
                     AEERRHSPQFVVQQVFSERRTLPYLVWKSVTAEDKDLQHQPPPASLVLPYAVAAGTPA
                     WTVPHRAAPRSTSGATDPRQDSITLHACCLPVSYVARMTSAQLHDRHPLDWLLQTRRA
                     ANSSPSASESGLADVLTTLQWSATWTARWAQTVWAGHQPCWLEERMRATNDSSDASQG
                     HGDSSRECRTHSSSRSPDCCTGDGGRDVVHLTDPFYTFDDADAADGRDNFAVDGGRRS
                     LRVLRTLTSGDTAPHEAQRLSAEVDWPSRAEGCSAVVTADVVLGSATVV"
     gene            complement(<486555..>487817)
                     /locus_tag="LDBPK_091270"
                     /db_xref="GeneID:13392154"
     mRNA            complement(<486555..>487817)
                     /locus_tag="LDBPK_091270"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858757.1"
                     /db_xref="GeneID:13392154"
     CDS             complement(486555..487817)
                     /locus_tag="LDBPK_091270"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858805.1"
                     /db_xref="GeneID:13392154"
                     /db_xref="GOA:E9BA12"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BA12"
                     /translation="MSSAPQHNGAASVIVAERATRFFMALFIILGYSRALQHADARLE
                     RQAYVAYRTPHLCSYQIMQSVACPDAKPMCCVASSAIRCCSGTTSCGNCTEEIVGYEM
                     PKSSVIVGCFSLSVLVLLGSIIMSGVGRHLAWVLEHRRVIENYRKRLLLRRAEAREFK
                     KELAETEVKDIDDTVGCVICCARHIDVALTPCGHVCCCHFCAKRLRECPVCRSALQRC
                     FDLPLYYVKQLLSAAEAAEDDNGGGVSESALSPTEMATITCDSATATSARAAREEDPR
                     GAGEAAFAPATAEDHSVESAMASLHSNCCSSSTRSGIVAGMHGSTERPTRSTLRVVGT
                     SEMGMVNPFRSRYSRVPYSDEDNDGDGRNKRMGSGTASASPLVRRVPATGAVTSPSEA
                     RAAAVEEADTATSGVNAHHSHVYISVER"
     gene            complement(<489041..>492907)
                     /locus_tag="LDBPK_091280"
                     /db_xref="GeneID:13392155"
     mRNA            complement(<489041..>492907)
                     /locus_tag="LDBPK_091280"
                     /product="AAA family ATPase, putative"
                     /transcript_id="XM_003858758.1"
                     /db_xref="GeneID:13392155"
     CDS             complement(489041..492907)
                     /locus_tag="LDBPK_091280"
                     /codon_start=1
                     /product="AAA family ATPase, putative"
                     /protein_id="XP_003858806.1"
                     /db_xref="GeneID:13392155"
                     /db_xref="GOA:E9BA13"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BA13"
                     /translation="MDLLRLYVEFFLLCVQPTVPCRTRAAAAVADAGCNGSYPAAAAA
                     KPAAADVAAQLTTLTFISVPHCVRSFLEGVALLRKDGEAAPAAAGKAAGRKRHRGSIE
                     RNGTKSVAADDPVFEDGEDSDLPYQPSVMLQRLREYGEVQVPGFESDSAYLAAKDVLV
                     YLKHYAYLVSGMALSAAVLRNIELVGLDFRQQCVPCMAAVTELVGHLIDAQLHKMQRL
                     PRVVRLSERLRLSAKAARTLEYLLVCHCGRYAAGNIAEPLRPANIAYHNDLTPQELLS
                     ILSESGVLWKQGLIFSDIKMRTTFMECKYALPIETIAALSGDQLSEEQLIKLERTALL
                     EVLNEERNAKTTSTAAAMPAPRAEEHVGGSRSVSPSPKRGDEEGDVEDEEDDDATADS
                     AIALTEEALDSVLEDIDPAVLASKDQDAIYEAVSHRLGNALAGRTATQVGGRAVAAVP
                     VAKNSAATETEEAVKGGKSSREESAMVAPATAPPTAPPSRTTDTAPRPEDGREATTAT
                     SAPRKARLVLADINPLAQRYRCTGTGAGAAAASSSPSATPHTDSSMRGVPYESDIEYM
                     DAAFRILANMIRIRYAEGDMKDEEDSYTPKSKVEASIRELKGKVRVAAAVHESRLQAT
                     LAARVFTPRIEQLAQRLQLTEMEKQIMLFMVGNVISHDMLVAVNGRYVMRDGQRLITV
                     GYMLFVLCESLEERVVARRAFYQSSPLVSNGVLSLTLDAVGRSCFNTDLMDYLVDIDR
                     KIVDDVMGIPAETAEMVPGSQLYFPEVELANVVLPTSTMDRVLSTIEHYSLFEQCKKS
                     SGFGDGLGTSKGGLVMLFHGPSGTGKTMLANAVAHHLKKKILLVSVSQFRSSTKAEAD
                     ALRFLFREAKLSDAILFFDECEALFEDRTSNGTVTALLSEFERYDGLIILATNRAQNF
                     DEAMNRRISLMMEFRPPDHQLRLRIWRSHIPKQLPMNEDVCLEKLALNYELSGGLIRN
                     AVLAALSRAVAREKSSTPKLTMSDLDEGARLQLRGFFLAAELPEGMSEFYLTPKRTLA
                     ELVVEPDLAKKLEGIASSAKSRSTLYTEWGFSEDANDDCGTLYLFQGVSGTGKSLAAE
                     AIAYECGATIRLCNVAELLLREEMRVHVVFEEGRRLGAIIVFDEAQVLFNESPKSLQL
                     SQLIQYHARRYPRPVIVIATTVNRDGGGGRHLFSTASINSRSSCMLFQAELTFALPRR
                     LLREQLWRKAFPERVPTSSDVDYGRLSATSISPKLIRTIAFNVCCTAALLPVSERVVT
                     MAMIEAEMERTVARERTAVSASAMFA"
     gene            complement(<494087..>495406)
                     /locus_tag="LDBPK_091290"
                     /db_xref="GeneID:13392156"
     mRNA            complement(<494087..>495406)
                     /locus_tag="LDBPK_091290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858759.1"
                     /db_xref="GeneID:13392156"
     CDS             complement(494087..495406)
                     /locus_tag="LDBPK_091290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858807.1"
                     /db_xref="GeneID:13392156"
                     /db_xref="UniProtKB/TrEMBL:E9BA14"
                     /translation="MPAAPHRQSSAPPSSFLPPEPLCVADILSELLPFLLAAPQPRDG
                     CSPSSSAQEPAEDPVLPIPPTVASEHRVQVSIRGQRYETAMEVALTYSLFFFVFFHWP
                     FSEEDEGSDAAGCTNDVADVKRAPRSVGDAVMAAAAARDLPKETQLLRHYTRVVEPVL
                     RVFLDHWAAPLDAAAAAQTEGESAASAETEEAGDAARLPLLPPLPHPVRIAYDASTRV
                     WKFEFAARLTAEAAAEARSGRQCGDSGAAVSLAAADGCAAVATDELNNSPFLLLQSKY
                     MGLLLVFLRRCAKVRAERRAAGEGAAACTVAPYPSLPIRWAEMNYDEQLSVVQLIRRF
                     GVVSLARTYTHPTAPVTTSLYIGAEAAAATARAKAEGEACSLRARASESISKQQQEIQ
                     QAASVAVDTAEVVKKQCIDEDDFGLVLSAKGCARCGMAEHSTEECHF"
     gap             496740..496838
                     /estimated_length=99
     gap             498297..498332
                     /estimated_length=36
     gene            complement(<498333..>504473)
                     /locus_tag="LDBPK_091300"
                     /db_xref="GeneID:13392157"
     mRNA            complement(<498333..>504473)
                     /locus_tag="LDBPK_091300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858760.1"
                     /db_xref="GeneID:13392157"
     CDS             complement(<498333..504473)
                     /locus_tag="LDBPK_091300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858808.1"
                     /db_xref="GeneID:13392157"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BA15"
                     /translation="MNAYSLHGKRCADPSHWPQWIPLTGESNASLPVPPQPPSSTLST
                     NATSSPGIDEHSREACMNALLQYVTQWMAILPSGVSSGTEAALHGAGIATGTFSMNAT
                     DSACASLSVQPVAMLNAMLVSLPTAVAAPPVQGRQQGAASPPRPEEAAEPGSSLTSTK
                     VPELTPIIEDTPARPPQLLDVAAQLLRHSKWLASGLSHAAGPAPRLPSSALVSHAYQH
                     ALLAACSSDWVMQFRRAYKAGTATDSTTTAKADARGLTAPLPWTLPPAVLAESSTSGY
                     VMQPIEGYRGTLVLLLFHPLRVVRVWARDVLLRLMTCTAPQHEASAPGESSSDGGERA
                     LATLLSFSLRLLCTLKHVSVLPAQVSFISLHEHPSWTASAAPERHVDAVKYVMQDRIH
                     TVVDGIFHLLTVLTAWDMHFGKAVEALTMTSTATVDRASATSMPILLGKCRATVLLLG
                     GSLVLYGLQGLHQGIHRALLEAWRDQQHRHLRSSSARGDLFCASQAAMTQLLGPLNTL
                     LSSNPRMPRANAVAATAIRKALAKVLVHCLLDNASGLASSKEEEAWRRARLEWLWMFA
                     AALEPPTPRAAAPLLADGPNASAPSSADHTGTAAPEHQGSGTTKATGQDDVGTGTLVW
                     VPERCAGWLLRPLLKNAAQQFQWAKAMVAAKAKPSAGGAATASDGTDSAIAVLDKAVY
                     GVSMLLDSLATALPRLVRSTYLHDTLVAHESQLLTLAIGGIVHTRSTHALRLHRLLFH
                     ADVHAFAAGAAAQGRGGTAPAGTLGVPSVCLQRLWLTLPTLIVQVCKSGAVSPADCGG
                     HAGSAISGGPLPLSEVVASLCGALTVLAEEDAMPCPQWLFMSPAKVMSRAPPPFQWVV
                     QRCLRTLAGTLQEQQELLKRVWLRLPSAPTEAAYASAAAAAASRALTQERPLLRLLFA
                     LRVAAAEDAEAGKLAERLTAVFCVGVTSSVSRTLSTEAAMWVWRRVVVTQPELRLHPP
                     PPSTASTAAAAAAAGDGAYAAWDMNDAVVTSTARAQGHRWLVLLCACHFDQMSEWEVQ
                     CGWWMAALLADVVTLDVEQRRALAEQVILALPTAPMLALSEAATHAVGSTHPPVEEAA
                     EGQCGAIEKKGEHQLRDKGAESAQHRHSVVQRLLIHVLRKAEQYPQASLASVLLRISD
                     ALPPAVAARDVQFQQQVQPLLVQLCARSPDVQKCLTRNGAMWLRRCTEQATQTINECL
                     AEQERRFRQFELEEATLRREEVEAAQAAVAAERLRHANEAKRTAELGQQRAVKRSTAA
                     SEVSQSGSDGGVVSLPMRKPTTTVSHHSDHGSSAVAATRRDLRQQQLFPDLSLAHLAV
                     KRERTPPVDGADMRSPKSVPPRPAGNGASAMIALNVDSDEEDVMVAASTVQLLGSFAR
                     PASPCAVTPPSPASAPAPLAKAPKTSPSTTASTTARAAPTRLQHKLQEINARNTHRVH
                     HAEQLRQLQERLRRVAISTNLLHLQPPLVHDIVGPASQCMAPEVPVLPEVFVSASDGF
                     RRVSFDGSAASAGGASLNASATMPFGDAASEYAVRFAPHIALELRYDIIRNYEDFLDD
                     VCKGHDGRDTNSSHYYRHSAETAPVTAGEGASPSPVNGLWNSLLPLHPGIPPACVAVQ
                     SSCAASRGHSGEAMPGPQTLHFDVRACANPAVDVYLQRQQQRAQDTHSSAQRSSTTST
                     TMHPKSVHAVVVAAAQQGLSAAFAEGDVVAVLLPLQTILAKWAERELRRPLSDCPVAE
                     LEHRVLEMLDTLPRSWRTLGCAVQVCEVQSLSPGGRAAHLCATPSVVEQSSGGHGPPS
                     LRFSHVFRMAYDTTSSPTFYVTKLTSVNASLMELEALHKIDRTRFAATLYDPRSTAPV
                     GVAFCGWANSLLSTAGPSCTVPLLDQLRARLLLQQQLNDWQARAIVAVLYAACPGWDD
                     GVAEQSTRAPVPRAPEMLVIEGPPGTGKTQTIGLLTLNLLHHLSRTWGTARRILVCAP
                     SNCGVDEALLRVVRLREQLRGAAPGGALPPAHAVLAGGLLRIGVRDRVDREVLRLQEP
                     VFFDDVVERHLSGTPATAESLRRGERAGDSR"
     gap             505244..505342
                     /estimated_length=99
     gap             505976..506074
                     /estimated_length=99
     gap             506345..506417
                     /estimated_length=73
     gene            complement(<507138..>507692)
                     /locus_tag="LDBPK_091310"
                     /db_xref="GeneID:13392136"
     mRNA            complement(<507138..>507692)
                     /locus_tag="LDBPK_091310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858761.1"
                     /db_xref="GeneID:13392136"
     CDS             complement(507138..507692)
                     /locus_tag="LDBPK_091310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858809.1"
                     /db_xref="GeneID:13392136"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="UniProtKB/TrEMBL:E9BA16"
                     /translation="MEPESGARAVELAAAGNVDDVHVLPDASKTGSDVRAYYYACRHC
                     RVRLFDAAEVLPHDPQEGANKTFKFRRGGPLQSDGALGDVSSGPLSAAELCTSLFLDP
                     DQTPWVAEDMREANSSGAVVQPDTIYCRNPRCRAKLGMQSWAGSQCSCGAWITPAFRI
                     HASAVDKMLDVTPTSAAHATFSPH"
     gene            complement(<508515..>510473)
                     /locus_tag="LDBPK_091320"
                     /db_xref="GeneID:13392158"
     mRNA            complement(<508515..>510473)
                     /locus_tag="LDBPK_091320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858762.1"
                     /db_xref="GeneID:13392158"
     CDS             complement(508515..510473)
                     /locus_tag="LDBPK_091320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858810.1"
                     /db_xref="GeneID:13392158"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:E9BA17"
                     /translation="MSATPKLYNEADVAALVRSLDRAEDHHIFAVDVLETYPYLAESY
                     TKVCPRRCDLATAAQKALEGAYSYDLRLEGLKADIALMASNCVAYNGPTSAYAETAAK
                     FERYALEQIDAFVLEHNGGCRVSRLRLPRASASQEHASADGTAPKKGSAGTSAAHKTA
                     AAAPPSTREMVQLVDSLNRREDGGAFSVDVAEAYPDLRDSYRKICPRPMNLILMRQRA
                     KEGYYTSGSATVYGDTVAASLTRLREDIELLVRNCITFNVKVESWVTLARSFQAFAHR
                     RVDDFVLRHAAFLRGTTMGAEVYESKGNASTSAPLATASGSAGGDDADRSGQASPTAA
                     ADTVTVTSGGIGGSAAAAGSRKRERVDERVAASGGRLRAPVPVSRVQVVAEATPQVCP
                     TPLQPSLTIPPLLRRRLTMDHVRHTRLPLRRVGVSVLRDELYPPAVSPADVKASSDSS
                     AAAGGAEAATTSTAMVNIDASCSASHVLKLLRESVVKFFAAQRSGTDFVDTFAYSARE
                     EQLYLSVLAVVAEKYQSTAAHLLLYETESAELQEWAALRALDSCRDAGRTAPAPADAG
                     DTIAGDLHYLYFVRFLVQWPQLASLCCTTATPSSVPASAAAARGASGAAQGSLRISRE
                     QLKVVAQVTHITQEFLQFLEAMEERQRQ"
     gene            complement(<511991..>513016)
                     /locus_tag="LDBPK_091330"
                     /db_xref="GeneID:13392159"
     mRNA            complement(<511991..>513016)
                     /locus_tag="LDBPK_091330"
                     /product="mitochondrial carrier protein, putative"
                     /transcript_id="XM_003858763.1"
                     /db_xref="GeneID:13392159"
     CDS             complement(511991..513016)
                     /locus_tag="LDBPK_091330"
                     /codon_start=1
                     /product="mitochondrial carrier protein, putative"
                     /protein_id="XP_003858811.1"
                     /db_xref="GeneID:13392159"
                     /db_xref="GOA:E9BA18"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BA18"
                     /translation="MAVAGPSWPTPIVPPVDEGEWALLHPMKTSLVALIPGAAQGATT
                     VVLGHPLDTAKVRMQSGGPHTCRSTVGTMWSMATAEGPSSLYRGVAPPLLMEGIKRSV
                     QFALWDWMRAFARDASASRNGADGAARGGAGGAWEAVRDCAHCGLVGIGSNSFVCGAV
                     AGGVGTLIGCPMHVIKIQTQCQTAMGTRNAWTCTRSIYDREGIFGFYRGFRCNVAKDV
                     CFAGMYLGLYAVLREHPVFEPPSASTTAETTTTTRPTRKTNMCAFLSGAVASMATWGL
                     LFPLDTIKTLVQARQAHAVLSVLRQPALLYRGLAASLIKAGPVSGVAMAVYEQTWAFV
                     NKRPTLR"
     gene            complement(<514553..>515656)
                     /locus_tag="LDBPK_091340"
                     /db_xref="GeneID:13392160"
     mRNA            complement(<514553..>515656)
                     /locus_tag="LDBPK_091340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858764.1"
                     /db_xref="GeneID:13392160"
     CDS             complement(514553..515656)
                     /locus_tag="LDBPK_091340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858812.1"
                     /db_xref="GeneID:13392160"
                     /db_xref="UniProtKB/TrEMBL:E9BA19"
                     /translation="MTTATSVSVRPTTASGVLCNSFPTAATISVASTKTHTHPLPEVL
                     RGKRSAESLSWVTELYGHEASLPAVFASVAADGTRKSIKKASPLANTANQSFLASSGQ
                     LGTLPSLSALHNQNQRVPHMRSLTSAELSGAVGGGASFSAQVLSDVSAASFSATVAAA
                     ATNVTSFYRQRKNVSWRCMLCGYHVLAMDQDGAPLPFSASAFGNVLPMTCPRCKMSHT
                     SWQPSTPFSEEGNHMNLPTTLSNRYLVPLPGQQPLRAKDAEATGAAGQSGAAVETASS
                     VVAGSRSAQRVGFVSALATQQRSIPAISAVSSVQRRAYYCGRCGRRLLRMDVNGELVD
                     MDRDKDGQVLPITCPGCMESHSDWVLKPYAVNR"
     gene            complement(<516700..>518433)
                     /locus_tag="LDBPK_091350"
                     /db_xref="GeneID:13392161"
     mRNA            complement(<516700..>518433)
                     /locus_tag="LDBPK_091350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858765.1"
                     /db_xref="GeneID:13392161"
     CDS             complement(516700..518433)
                     /locus_tag="LDBPK_091350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858813.1"
                     /db_xref="GeneID:13392161"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:E9BA20"
                     /translation="MPKLSSSKAKVAAAAASGPPALYGEDLSGPPLVVEVTAPSVWTA
                     TAGADASSNEECLTGGARWGHAAILSPSESVLCIVGGAPCQRPHAAEQAPAPLWEYTS
                     VAPSRLPTAMSASAMKAPVAAARAWKAGAARRAARQDAIRGANAGAAEDHDWPLFASW
                     WASWPSGNGADGPAVMYADGGWSGACRIAGVRAFADGANGDPSFTPPPSSAAGTSSTR
                     SHHSVTCVLGRLLRFGGETQQGTAAALEEIDGASGSLDEKQQADGEHRNAEGREVAVP
                     EPTSTTPRLQPALGPPPPPRAAHGACSLSQRYIVIVGGRQVHTQADDVSAVAAGASAG
                     KGARAKKTTAMRALSPGKRGGASGKDGKGSSAALEASVPASATLTTLKDVAVYDAKLG
                     AWLPVRVVGGGAVPCARYAAAVAAVPMPGAAPPTSRHRSPVADAVQREVLVVGGLDAE
                     GAVCADAWLMQVMSGADAELAEVPAGTLADSASTAVPVVKIRWVRLELPKAAASVFQR
                     HHAAVAVSSQRIMYLVGGCGPHGAAEPCACTLQLPPLTSASVRLADEAGGDAEGAVPK
                     RPSANAKGLTA"
     gene            complement(<519256..>519912)
                     /locus_tag="LDBPK_091360"
                     /db_xref="GeneID:13392162"
     mRNA            complement(<519256..>519912)
                     /locus_tag="LDBPK_091360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858766.1"
                     /db_xref="GeneID:13392162"
     CDS             complement(519256..519912)
                     /locus_tag="LDBPK_091360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858814.1"
                     /db_xref="GeneID:13392162"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="UniProtKB/TrEMBL:E9BA21"
                     /translation="MHATKSGVTTLSASAGKSDVPVMPAGYEDAAGQPNAVFVNVYDI
                     MKSNSWLWSVGLGVHHAGIQVYDKEYQYGRCEEGSGVRVVEPRHSPPHIFREQFFVGQ
                     TQLSALEVRELVATLEQRDTWQGNKYHLVKHNCIHFAHALCEALLPPHVRVAQMRTAL
                     PSTYQSAYMEEVEVDGQQYSLPVLIPPHVSRLGSYAASYLPESVLQLLDSMDNPFSTP
                     "
     gene            complement(<521776..>522540)
                     /locus_tag="LDBPK_091370"
                     /db_xref="GeneID:13392163"
     mRNA            complement(<521776..>522540)
                     /locus_tag="LDBPK_091370"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858767.1"
                     /db_xref="GeneID:13392163"
     CDS             complement(521776..522540)
                     /locus_tag="LDBPK_091370"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858815.1"
                     /db_xref="GeneID:13392163"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="UniProtKB/TrEMBL:E9BA22"
                     /translation="MDGASADGGDGAPASAERHSLKPLMWIEEVRDASQPNAVFLNVY
                     DVSGSSTLLCSVGWGVHHVGVQVYGKEYQYGHRPIGKGIGSVKPRHSPPHTYREQFFL
                     GQTQLSAFEVEKLVVAFSEKVEWLGNNYHLVKHNCIDFARAFCEALLPPAVRVEQARR
                     AEEAGLPQKMHMVEVEVDGMRHSVPVLIPHHVDRLARYAAHYLPKSSMRSFDRLESSF
                     FSMSEVPQERGQPTAADPNANRSTTPTPQPRTRTGH"
     gene            complement(<523859..>524911)
                     /locus_tag="LDBPK_091371"
                     /db_xref="GeneID:13392164"
     mRNA            complement(<523859..>524911)
                     /locus_tag="LDBPK_091371"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858768.1"
                     /db_xref="GeneID:13392164"
     CDS             complement(523859..524911)
                     /locus_tag="LDBPK_091371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858816.1"
                     /db_xref="GeneID:13392164"
                     /db_xref="UniProtKB/TrEMBL:E9BA23"
                     /translation="MLSTSPHQFDSAAAVSDVVILPSSPNDDSPMSTQGLTPERVAQW
                     TLKDVENHIFFMVWVCGIPVHARYIVHVLEHSAVISRRGGEQIPHGGSTRESLTAVAQ
                     ADVLAPVCRRAAELRQVVSRWPIMATLPDLQNHESFSEIVSLGVLSEEPEHEGGAIRP
                     AEGGERWVHCGSAKATTSSSTSSLSCSTVHAGAVTPAEGFANVAALALRSPAERDGTS
                     LSSEPSATWCAQAYWTAWAQAQQWIAGWPTFCSDAVRNTGSLSGIDAAAASAWPHLRP
                     ACALTAPGRRRLRGGDAPITSGVVVVDADEGDARGSTRGAGPTFSAANDAVRNSKAQR
                     REAAEVVVIDSDDDDL"
     gene            complement(<526759..>528576)
                     /locus_tag="LDBPK_091390"
                     /db_xref="GeneID:13392165"
     mRNA            complement(<526759..>528576)
                     /locus_tag="LDBPK_091390"
                     /product="paraflagellar rod component, putative"
                     /transcript_id="XM_003858769.1"
                     /db_xref="GeneID:13392165"
     CDS             complement(526759..528576)
                     /locus_tag="LDBPK_091390"
                     /codon_start=1
                     /product="paraflagellar rod component, putative"
                     /protein_id="XP_003858817.1"
                     /db_xref="GeneID:13392165"
                     /db_xref="GOA:E9BA24"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9BA24"
                     /translation="MNGSAIIPPTYPSRDVQNVENHRAVAAVAELAENGLTIADNFVT
                     YAEGRLPPLAVNGERISEAVAKLHERYRHERPAGWDEARFMGECEQRVTPEEIEDLCT
                     RPALDASAFANTLYQLTDKDLPRGRYLVLKDSLNAIKLHAPKSSVVNLPETLAALHEI
                     QHVDPTEEIKDELSEMDTQQHKYAAQVDEAQAVYDTALSHGDVVEVERAHRHLIAARY
                     EYLVSYVKRLHFLSSTEEDSEVVHFGERLQRLREDAEDAVKAFSDDKHAIKSAVRADL
                     ERCEESRAREAATHEAAKAAFQHQKQKMEASLSSVVEHKVQLVNEILEKAAELRKVME
                     QQRAMTQDVVKAVQEEAKRVTAHEEFVTIGDQHLQRLRRCLEYCHGCEPVIREMEKYV
                     KNMVEKLPQEDAEKALNSIIDHEADEFLKAYRAFVFVCGELTVKKTHRLDTLERQARL
                     AQHNRDSSMDSLDPNYKHYREELAEVLAQAQAVEGVINALHATQDAGEQVFESVEELV
                     LTSCERAEKPFVHPLQEFGHESVAARTRFVNRSMKYVEGEEQEVFQKKARIAEAKALV
                     EQEQEALERGVSAAAIAAPAAASLNAADGTVPAPAQIEA"
     gene            complement(<530189..>532012)
                     /locus_tag="LDBPK_091400"
                     /db_xref="GeneID:13392166"
     mRNA            complement(<530189..>532012)
                     /locus_tag="LDBPK_091400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858770.1"
                     /db_xref="GeneID:13392166"
     CDS             complement(530189..532012)
                     /locus_tag="LDBPK_091400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858818.1"
                     /db_xref="GeneID:13392166"
                     /db_xref="UniProtKB/TrEMBL:E9BA25"
                     /translation="MTRKVAAAAVLATAALLLLHTASFASVAAAAVSPTQVSSPPTAA
                     QRQRLRSLAAYAERVGMALELFVGRHYESDTTDIKATASQFAEDSHLHPSAISAPMPS
                     ADRMPLLGFVTQCLQHPHIVVQSSVQSVMRFASAGRTLASVLVGASLDKDTEALLAKV
                     EADADLHAEVGSDMAPLFVSPTNAHRTPAAIRQAARAVSTPPTKVAPLRQVFCSSIHQ
                     PAETLVTQPAEVTPLSCISGVNAYSSNAIVACRNSNDTYTAAEYVSLSLHEQEQCDGY
                     ISKDEPFTETCVCAQDYYMTYVNESSYLCRSRPLDVQILLEDKHLCFSQADVALGLPG
                     TMEGEYCIKTNRNGTLQLPVTWKYNFLSDEAMLAASVFSHHVPPQVPQESEGLQWVVM
                     SGSRPVMGNYSELSMSTDVFSYLVAGYAGSGQSPPSPNDVGFYLSASTELLSAAAFSA
                     VFCFTSPRKTKDQLKEVPLKTESVLKQYLGNPDGVSSHSLTLDLSTVPNEFVEGNQMY
                     VEVGLKGGPSIYYYRVARIHVSFTDLAEPPTNAHEYKKPLDPLYTLLIAAVSALVIGT
                     GLAVLWYYCMQPDDYDDRLVSDAQRKKAQKHHPGVNSRSVD"
     gene            complement(<533735..>534070)
                     /locus_tag="LDBPK_091410"
                     /db_xref="GeneID:13392167"
     mRNA            complement(<533735..>534070)
                     /locus_tag="LDBPK_091410"
                     /product="histone H2B"
                     /transcript_id="XM_003858771.1"
                     /db_xref="GeneID:13392167"
     CDS             complement(533735..534070)
                     /locus_tag="LDBPK_091410"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_003858819.1"
                     /db_xref="GeneID:13392167"
                     /db_xref="GOA:E9BA26"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BA26"
                     /translation="MASSRSAPRKASNPHKSHRKPKRTWNVYVGRSLKAINAQMSMSH
                     RTMKIVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEG
                     TKAVSSASR"
     gene            complement(<535192..>535770)
                     /locus_tag="LDBPK_091420"
                     /db_xref="GeneID:13392137"
     mRNA            complement(<535192..>535770)
                     /locus_tag="LDBPK_091420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858772.1"
                     /db_xref="GeneID:13392137"
     CDS             complement(535192..535770)
                     /locus_tag="LDBPK_091420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858820.1"
                     /db_xref="GeneID:13392137"
                     /db_xref="UniProtKB/TrEMBL:E9BA27"
                     /translation="MQAPKTSTSSEKGEVVPSSRQSLSETPFVADPAEVAAFDIPVEY
                     VRRIEDAQRAYGNHYMEHRMYTDAWNHAALTLGFQCCWLGVGAWIVSRGLSYSDPMNS
                     VVARWVQHSRVRRLTTPISCFGLFILTATCMQLPYDFRLLREASAGIDRQTALMKKSM
                     GERHLAYREGKIAKEQLEGKEAEAFAKGMKAQ"
     gene            complement(<536960..>537346)
                     /locus_tag="LDBPK_091430"
                     /db_xref="GeneID:13392168"
     mRNA            complement(<536960..>537346)
                     /locus_tag="LDBPK_091430"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858773.1"
                     /db_xref="GeneID:13392168"
     CDS             complement(536960..537346)
                     /locus_tag="LDBPK_091430"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858821.1"
                     /db_xref="GeneID:13392168"
                     /db_xref="UniProtKB/TrEMBL:E9BA28"
                     /translation="MPSWDATLAQPVSEPESGEGKRVRRKAGTASFSQQLKSLFRPLS
                     SHSSEWEPRAPLLVAEASPRLQPCSASAEPRGSEWAHDAHRCSHVRTHKPRGNGDHRT
                     GAAPSFSLAHALLCPYRAFLQPHTRQ"
     gene            complement(<539242..>540048)
                     /locus_tag="LDBPK_091440"
                     /db_xref="GeneID:13392138"
     mRNA            complement(<539242..>540048)
                     /locus_tag="LDBPK_091440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858774.1"
                     /db_xref="GeneID:13392138"
     CDS             complement(539242..540048)
                     /locus_tag="LDBPK_091440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858822.1"
                     /db_xref="GeneID:13392138"
                     /db_xref="UniProtKB/TrEMBL:E9BA29"
                     /translation="MMMPMTGSRNSPVRPSGVVRHAHETDKPVIENCAQSNPLLDAPP
                     DPPHKAGKRSVVSCAPSGTSSAARASDVAALLRHAVVRDLIRENEGMLMEIAGLQETK
                     RLWCATQLRLVTLEESAARAALKAAESIARGVWATRAHASLAAHVQRLEQQLSDEAEE
                     AAELRGFAELAQAQLATSPRPQTEGATPEKEKYASPPAKGRRGSGMGDVDGNSQRASL
                     EEITNVRGSVKRLRSVESSDSSGTPRGQARRTSSSQKSPGALTKVCKTIY"
     gene            complement(<542278..>544020)
                     /locus_tag="LDBPK_091450"
                     /db_xref="GeneID:13392139"
     mRNA            complement(<542278..>544020)
                     /locus_tag="LDBPK_091450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858775.1"
                     /db_xref="GeneID:13392139"
     CDS             complement(542278..544020)
                     /locus_tag="LDBPK_091450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858823.1"
                     /db_xref="GeneID:13392139"
                     /db_xref="UniProtKB/TrEMBL:E9BA30"
                     /translation="MFSASHVDELLASTVRTLQRSQVLLDERRSVIQGRQGLPPVFCV
                     AASSAAAASAGSSAAAPHASTSGSFADTVRSLQSLGEFRSYVEAAAEMMKRVREEGMA
                     PSPAMQQRRARGQDFALLQSMMRGLRGAMTAAWQTSEATAALWASSTEACGGAEEAAA
                     AEDAASAAAGSALCAVPGAHSGSTRSSGAQLTSTLIFSAFCVDLAIAVPRAASAVAAE
                     LASVFQPSSDNVRPPSLVSEWMRDGNVKLSALLRDVAALLPPPVKTRLVARLADVLFR
                     PSPALPRSPKESSGHPLGFELLSGGQLLLPTLDYYLLEQYPSSLASRWFLQPLQTTAE
                     HLRADYYASADQFHVQCRWLLRLVLTLLYACQSAALPTSASSRPALERRLRTAQRLYD
                     AWLIPLEKTFGNGTARHGMSVSFNRALVQPHGHVVERLLFASSPASGVSGVSKVVQQS
                     REWSGILYSAQYRLLLILEKLAHSEMAQVNGTSSTSAKQRTYEAMLRQNGGKVSVSLL
                     QTLAEDKQLVLDETPSRSPDGHRLYKLHDGLLDGSGKAVFVYLDDGALFTKVGRARAF
                     QRVKSVEDIFKSLQ"
     gap             544792..544876
                     /estimated_length=85
     gene            complement(<545505..>547490)
                     /locus_tag="LDBPK_091460"
                     /db_xref="GeneID:13392140"
     mRNA            complement(<545505..>547490)
                     /locus_tag="LDBPK_091460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858776.1"
                     /db_xref="GeneID:13392140"
     CDS             complement(545505..547490)
                     /locus_tag="LDBPK_091460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858824.1"
                     /db_xref="GeneID:13392140"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:E9BA31"
                     /translation="MGFFKRTISLDSIGVVYDELHPQSRDGAAAHGAEREQSERRVVT
                     PVLTPSLNVARIDDVLSETSTTAETRTYSSSYPVTTTSVRMHHLREASGDFTFTGQPR
                     AVVHFRSCITANDARSRLHARAGRGGDGDGDNAAEAMLPVNTGPFSADIVCIILLYVD
                     TGTHADIVQLGSVCRFWRFYANLAPHWTYFRCREWRKQANLPHYVRRIVAKTKVVTRD
                     EYIRERMKVEDYKKKEYIIGTARHIRWCVATGIMVGVMLTANFVVAYFLGFLRTALSS
                     DLSLGITTFVLLIVATLLEITLVIFPLAGSSVSSTNKHSTMRILAWCVFMLVCSMVLG
                     TISALAFTRVRASRHVLDGPTIDLTMSAPCEAYSSKNLPSFVLVPAELSDLRWRPITL
                     DESEKQLIPYCVPKSGEGYDAAPTCFVLMYFDANYSSAVFQNESALLTGRDVGTRYAT
                     SFDPFFDSVQISGLWCNKSGHPQVVALTQAVYSSVKARRDRLYPTTADWLDPSKRPAT
                     FSTISMRCSSAIHRETTENPPKSTELWYGNAAAWKWYYVPLVTTYAQVRSTFQRMHDH
                     FLRYAFLCHIFAGVMWVMMLFAQIIFKTASNMILGVATTAALVCLNPLTMILSGALCV
                     KVSDSYFMCDAGSGGALIGGGVGLTFLVLTIYVTARE"
     gene            complement(<548262..>549872)
                     /locus_tag="LDBPK_091470"
                     /db_xref="GeneID:13392141"
     mRNA            complement(<548262..>549872)
                     /locus_tag="LDBPK_091470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858777.1"
                     /db_xref="GeneID:13392141"
     CDS             complement(548262..549872)
                     /locus_tag="LDBPK_091470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858825.1"
                     /db_xref="GeneID:13392141"
                     /db_xref="GOA:E9BA32"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:E9BA32"
                     /translation="MNFCTQMQRRRIRYQSRLLDRYIVFAVLGVVAYILVLSLIAESL
                     ATGVRDRAKAKVSAAEVKHATSSIPEEVFWPHRWPAAPISEVHIIKEAMEYVTASLTK
                     VMPFTEHLPEAQLAAWDLVLLTGVSTEWTPTAKELKAAAEAALSTAVSTAPSEALAAV
                     REALESAAVVWSMKGAAGEADEVREFLKGMPEIPAPAVTSAASWSAFSREVWSCVTAG
                     GASFTTDSITAAHDTLRKASESFWHPGEQAAAVPPLHDSHLLPLRSGTYDAVVPFARL
                     LLQLWVRGGRRDSDKQLVEAYDAAVMSIVQDLFYTRTVTAGVQAMNFTFVGSRAEALV
                     PVATPRMCALAGVLAQGIRYGAHRYPARPSSARYSEDDVLQAAEALATSCFQLYAEPA
                     GRKLRSAVYVTGSGPVPGYTRATNDDTSASLRSSYCDVPGVLLESFYELYQTTHDAMY
                     GLWSVLVMRQDTSDHCGLRKTDITSATPWRRHIRELRTLWLLFHRMDCLVYRGSRGSR
                     RMCGLATTTIVSPVTGHLVPVPNTPAAL"
     gene            complement(<551616..>553337)
                     /locus_tag="LDBPK_091480"
                     /db_xref="GeneID:13392142"
     mRNA            complement(<551616..>553337)
                     /locus_tag="LDBPK_091480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858778.1"
                     /db_xref="GeneID:13392142"
     CDS             complement(551616..553337)
                     /locus_tag="LDBPK_091480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858826.1"
                     /db_xref="GeneID:13392142"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BA33"
                     /translation="MPPPSTLHRGSEWLSQCMRDIKAAKLQQTVRPYSNGTPAGEALP
                     VRTIVATSRIHRGEHLGTVKCNSIMTGERASQLLRRACRGEPSQTDATAATGLQPLAA
                     QRFDDLVSRISSLPSAVSVPPHLLLSRDALLVTVALYLTRSPLNAGVLPAESPLRAWA
                     DALPRRPPPMGALLRSSFLSHDNVEPLPRRLRLGQRTKEVAPGEDVAAASTELMVQAV
                     EQGELELADLRRPEMETALTPTVLTNYFKGRMSALTQRQRQSQRARGGVAEAEEGALH
                     LFMTWERQLQTHFVDALLPVLLLPSCGSCASNLEAVQDSAAWLGEESALRWAHFMTRS
                     RAVNLNWRRPGPPQLSIVPLVDMLNHTSRANANVVYQREDSGDVCVTASRTIEAGEEL
                     VLRYNHIGQRGCLFGDLPRPSKPTAEHERGRLSGKAAAVADEVHRIEKRQYWELYACH
                     EDEEAAQQTGHTPSTSFRASTRFGTFDPASPTAVGQQEMEQEVQWLWRFGFLRSNEEK
                     NREAALLWSRSLRSRIAHLTDVRRKGRPGEFVVGVPEGLQHLREQREQLERDRYKSKK
                     VFPPQQL"
     gene            complement(<554506..>554925)
                     /locus_tag="LDBPK_091490"
                     /db_xref="GeneID:13392169"
     mRNA            complement(<554506..>554925)
                     /locus_tag="LDBPK_091490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858779.1"
                     /db_xref="GeneID:13392169"
     CDS             complement(554506..554925)
                     /locus_tag="LDBPK_091490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858827.1"
                     /db_xref="GeneID:13392169"
                     /db_xref="GOA:E9BA34"
                     /db_xref="InterPro:IPR008880"
                     /db_xref="UniProtKB/TrEMBL:E9BA34"
                     /translation="MPVDYSKKLDALRELYERVQQKDANIPEDVYAAAGVKNKARLKD
                     IEKEISTTKKKVSQEVKKVTNEEIEKEYEALAKEHNMTVEEFKETVMGKGRQPALGSE
                     FSERHAAQRRERAEQRDLKETRRQVERGDFDMAVDYV"
     gene            complement(<555677..>556240)
                     /locus_tag="LDBPK_091500"
                     /db_xref="GeneID:13392143"
     mRNA            complement(<555677..>556240)
                     /locus_tag="LDBPK_091500"
                     /product="ubiquinone biosynthesis protein-like protein,
                     putative"
                     /transcript_id="XM_003858780.1"
                     /db_xref="GeneID:13392143"
     CDS             complement(555677..556240)
                     /locus_tag="LDBPK_091500"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein-like protein,
                     putative"
                     /protein_id="XP_003858828.1"
                     /db_xref="GeneID:13392143"
                     /db_xref="GOA:E9BA35"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /db_xref="UniProtKB/TrEMBL:E9BA35"
                     /translation="MKNCMMADQRGRSILKHQPVVGDEALEFSRGLAPSTFGFRYAAY
                     MDRNHFLPSGRTAVKHIADPTLAYVMTRYRQCHDFVHIITGCGRSIEEELAVKIFEWK
                     HTGLPLGLLSLLGGAPRLAAAQWAHMRLYWEWASRNAPCSRHGEPAVPMYLNVPWEDM
                     LAKEYDEVVAYTGITPLPQFLEKRQQH"
     gene            complement(559460..559930)
                     /locus_tag="LDBPK_091510"
                     /pseudo
                     /db_xref="GeneID:13392170"
     misc_feature    complement(559460..559930)
                     /locus_tag="LDBPK_091510"
                     /pseudo
                     /db_xref="GeneID:13392170"
                     /db_xref="PSEUDO:CBZ32109.1"
     gene            complement(<561996..>563237)
                     /locus_tag="LDBPK_091520"
                     /db_xref="GeneID:13392171"
     mRNA            complement(<561996..>563237)
                     /locus_tag="LDBPK_091520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858781.1"
                     /db_xref="GeneID:13392171"
     CDS             complement(561996..563237)
                     /locus_tag="LDBPK_091520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858829.1"
                     /db_xref="GeneID:13392171"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BA37"
                     /translation="MHGIRRWRVRLVNRACQSLPGSLAFSACRHCATVPTEDDVRKAY
                     KVLGVHASATLTDVKKRYGDLAKEHHPDVSNSSAASSTNRMTDINNAYNTVKQFHQAG
                     RRLFEATRAPNASGASDSSSSSYYSKQDSAYQPWYEDMDPLMYELMWEEMRRQNEEDG
                     FVRNMHVEAFYRANDRWRPPRGNASARPRQSSGSCDGRQSHAGKKSSSSTTWPEEQVK
                     AMVNMYQDGKSFEFIANALGKESAAAVLEEFNRWSSDNQPQRRKGAKPHHAKRHRYHG
                     GHGPFYHAESPDEVPFELYEMMEEEPYFDGSSEENGDPFGYYPGDEEAYDMPYAHATP
                     FYGVHQMSGGPAPHGHFEGGVGRVHNSSRKMSHRSMRNHRGGPPNKNRRYGGTSSNHK
                     GSGGGFQSSNSKSHSSGGGKA"
     gene            complement(<564168..>564563)
                     /locus_tag="LDBPK_091530"
                     /db_xref="GeneID:13392144"
     mRNA            complement(<564168..>564563)
                     /locus_tag="LDBPK_091530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858782.1"
                     /db_xref="GeneID:13392144"
     CDS             complement(564168..564563)
                     /locus_tag="LDBPK_091530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858830.1"
                     /db_xref="GeneID:13392144"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BA38"
                     /translation="MSLPEFTHAFNVYEAQAVVRALQAGSANGVYLLDVREEFEVQAV
                     RPLPHALVIYFRDFYDAMQMRESAFQRKYGVRKPHKKDRILVYALNQVRASSAATYLA
                     ARGYKSVVFLDAKMSEYLDSTQNKLDEDL"
     gene            complement(<565216..>565668)
                     /locus_tag="LDBPK_091540"
                     /db_xref="GeneID:13392172"
     mRNA            complement(<565216..>565668)
                     /locus_tag="LDBPK_091540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858783.1"
                     /db_xref="GeneID:13392172"
     CDS             complement(565216..565668)
                     /locus_tag="LDBPK_091540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858831.1"
                     /db_xref="GeneID:13392172"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BA39"
                     /translation="MIRRTWCLCRCLSIDQVAKIVKAKQSCSDAVRNIQLIDVRSTAE
                     VAATGMIPSAINVPLPVLRDVLSQDGILEDDEFEFFFGGARPVQGVTQMVLYCAHGVR
                     SAIACEIAEELGFENVGNFSGSWAQWYHAYGTPSTSAAAPESLHTPLK"
     gene            complement(<566619..>566978)
                     /locus_tag="LDBPK_091550"
                     /db_xref="GeneID:13392173"
     mRNA            complement(<566619..>566978)
                     /locus_tag="LDBPK_091550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858784.1"
                     /db_xref="GeneID:13392173"
     CDS             complement(566619..566978)
                     /locus_tag="LDBPK_091550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858832.1"
                     /db_xref="GeneID:13392173"
                     /db_xref="GOA:E9BA40"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BA40"
                     /translation="MQRLTYAAMKALVAKKLSGDLHMCILDVRNADEVAEGAIPASVH
                     VPLDQLETALQLTADEFKKKYSAPKPEVSDHVVTYCLRGMRAERAAAALHSSGYTNVD
                     VYPGSWAEWSEQEKCAA"
     gene            complement(<568550..>570994)
                     /locus_tag="LDBPK_091560"
                     /db_xref="GeneID:13392174"
     mRNA            complement(<568550..>570994)
                     /locus_tag="LDBPK_091560"
                     /product="DNA J-binding protein, putative"
                     /transcript_id="XM_003858785.1"
                     /db_xref="GeneID:13392174"
     CDS             complement(568550..570994)
                     /locus_tag="LDBPK_091560"
                     /codon_start=1
                     /product="DNA J-binding protein, putative"
                     /protein_id="XP_003858833.1"
                     /db_xref="GeneID:13392174"
                     /db_xref="InterPro:IPR024779"
                     /db_xref="UniProtKB/TrEMBL:E9BA41"
                     /translation="MEPDPKKVKLDIFDFPTARETRTPEEVAESYAEAVKSHPFYDNV
                     HSAIDFYDSGTIKDGRGQIIGVVLREALPKYAASMASELLASAAVRTSLRSMMFGGES
                     PLSGIAGYFDYRGSPVELKSRKTSFTYEHEAAWPAVFPVVDYVSELYRHVAPERWKAQ
                     NDAIPDVVRIHGTPFSTLTINSRFRTASHTDVGDFDGGYSCIACLDGQFKGLALAFDD
                     FGINVLMQPRDVMIFDSHHFHSNTEVELSFSGEDWKRLTCVFYYRAALGEPASYAEYR
                     RRLEKSKQDTSFTPVVSNVRVKENGTNLNRPSPVYPIFLSPFWVPMVAHCLQHCASEA
                     QCVHDAMTADGSRLAEVMFGEPLSTSDGIPLRGEEEKLKANSDSASRPLSRLGGFSET
                     NLMVSTAVEKKKYLNSEFLSHFISAQLLDMWKQARGKWLELVGREWTHMLALNPERKD
                     FLWKNQSEMNSAFFDLCEVGKQVMLGLLGKEAALPKEEQAFWTMYAVHLNAACAEELN
                     MPHVAMSLRKLNVKLKDFNFGGTRYFKDMPPEEQKRRMERKQRIEEARRHGMSSGAHE
                     KRANWLTNDSFDYQTEDCVVDYAQHKWVPPALHAKEITKNVRSGELPTREGVVRVLVV
                     LPDPQSKVDCVDCKLEVSETVRCSCEWERLMSSPAVHRVLAAAQRNLQLPDSVTHDNI
                     EIRFAFHSRLPTDMCDFVVLQHVLSCIPDDVLASAYIRRSAALCSGCVFVVETDVQCR
                     QYYTLKCSVRCDYDAVAPLFFQQLHRVSYGTKAARVRTKGELESLIPTVCCARYKLQG
                     SPLNTTVHVVAPAPPR"
     gene            complement(<572123..>572476)
                     /locus_tag="LDBPK_091570"
                     /db_xref="GeneID:13392175"
     mRNA            complement(<572123..>572476)
                     /locus_tag="LDBPK_091570"
                     /product="cytochrome b5-like, putative"
                     /transcript_id="XM_003858786.1"
                     /db_xref="GeneID:13392175"
     CDS             complement(572123..572476)
                     /locus_tag="LDBPK_091570"
                     /codon_start=1
                     /product="cytochrome b5-like, putative"
                     /protein_id="XP_003858834.1"
                     /db_xref="GeneID:13392175"
                     /db_xref="GOA:E9BA42"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BA42"
                     /translation="MTSNYIHLSEVEKHITENDLWFIKDLKVYDITKFVDQHPGGVDT
                     LLSVAGKDGTSDFNAVGHSESAVEELAQYYIGDVHPDDAEKVQQASIKAANNYFGIAV
                     VLALVAICSFFIFRP"
     gene            complement(<573700..>574119)
                     /locus_tag="LDBPK_091580"
                     /db_xref="GeneID:13392176"
     mRNA            complement(<573700..>574119)
                     /locus_tag="LDBPK_091580"
                     /product="cytochrome b5-like protein"
                     /transcript_id="XM_003858787.1"
                     /db_xref="GeneID:13392176"
     CDS             complement(573700..574119)
                     /locus_tag="LDBPK_091580"
                     /codon_start=1
                     /product="cytochrome b5-like protein"
                     /protein_id="XP_003858835.1"
                     /db_xref="GeneID:13392176"
                     /db_xref="GOA:E9BA43"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BA43"
                     /translation="MSTKCFRFVYIEKHKLDDLWFIVDCHVYNVTSFAEGHPVGPRIL
                     LTVAGRDASNGFKSVGDSDSAKEMEKHCIGNFHPDDVWQLKESLQGHNAASPGSSSSL
                     SLSASASAVSFGLCCNTVEETLVERLAKGEPTALACS"
     gene            complement(<574595..>574960)
                     /locus_tag="LDBPK_091590"
                     /db_xref="GeneID:13392177"
     mRNA            complement(<574595..>574960)
                     /locus_tag="LDBPK_091590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858788.1"
                     /db_xref="GeneID:13392177"
     CDS             complement(574595..574960)
                     /locus_tag="LDBPK_091590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858836.1"
                     /db_xref="GeneID:13392177"
                     /db_xref="UniProtKB/TrEMBL:E9BA44"
                     /translation="MKLVRRARKSIRERRMKACINDLNSNLSKVEMRVFRKQKKERDA
                     KRQASGISELVPKDVLNGRMNPDLYAVECRLHEEAGLPKPLPYQGYKEDLLRSRATTH
                     CVGFVGFRTILQAIRARNR"
     gene            complement(<575841..>580475)
                     /locus_tag="LDBPK_091600"
                     /db_xref="GeneID:13392178"
     mRNA            complement(<575841..>580475)
                     /locus_tag="LDBPK_091600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858789.1"
                     /db_xref="GeneID:13392178"
     CDS             complement(575841..580475)
                     /locus_tag="LDBPK_091600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858837.1"
                     /db_xref="GeneID:13392178"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:E9BA45"
                     /translation="MQCVQRRENITLVHRGVHVEAHLEPILVAFLQAVRSSAEYGMQV
                     AADEIAKEKQMQRLLQMNVNAVEVDATEARGIKVHERDIARQGGGSVQLSKELRKKIA
                     KLRQEYHYVHPADRQAAAVNRYGLITAAHNDLLKPPHIDSSLLMPQAFAASPPANRAT
                     RASMATSLMAAKNARSHTAIFNQLQRRNTAGLLSELREQESGGDCEPIRGNGWGDKIT
                     LYTFDGVSSVMALPGIPNFDEVVRELALDFWLRTDLKPVDGKRVLIQIMEGQREDVGQ
                     LFQLSLNWYEDMPDSVRVIIRDSANRVLEAVASVAKAGLTDGTNFHHLMLRVHSLEEG
                     QLSCEVDGRFIDIQLIQQEHPIAFNPWSHRLFVGGYLDEVNAPALVFRGAIAELRFWS
                     GVFPSHPIVRWPLFAVENGTLQEVTRTIPADHHETLLNLRAVEEPSPRSAPSFDGNLV
                     MNVGTLPLFGPLMHNWRIELCFRTDVSSRMMTLLGVTDSNFQMQEFGIVLNSEPVITK
                     ERLRYHELHTTFYVVDAFGACCSALLRGTERQNLMDGEWHKLVWRCIDSEANKFSVKV
                     DDVLQDLLFVSREGPTRFVSYDNWIAVGGHNVRNWKIQRPFTGQIDHFYLSLRGYPYV
                     TLEMNEGPGAYVLQDRSHHHNHGLLINSATNVVRRNDVVWIPGPADKSQDLDHGALPD
                     MRIFKSNDVSVAAVVFTCTFDEENIARETLYDVLSGKFRELERTPHILPEHTETQWRS
                     WYGLSAECYHAFDSVTRLEESINTVLRATAPRGHLLITVRIGDCLASVLHIREPERPA
                     DAVYDCNMLRWHYPYMVEGMRGRRELMLNRMIEGAESVLLSDTLKPYVTAKLGPLNSG
                     PRSVLTDDIIRSLQNSGRPWFLPAVLHAHLLNAEFGSTLHLIQRVRPHMSANEAAAVS
                     LFNKKLFDGVRENAALLIQRNWRGCLGKREAARRSEQRSLNDRKVEEIRTLRVNAAVK
                     TKGSLCALLITLHHPRCPGVPAIDGDTRPLEEALRQQGYEVTTLEDPDMATMLRAVSQ
                     TDTTKSNFIYVSGYGGALGLRQPPVFGLESLAVYIEEQAQRATLESGESGAFRQLMAQ
                     MEEEKARVPAKKPKKKAKKASATARPKKKTAEEVELEQREFESALRSHCQQMEQEESC
                     ARDNLVGEWETMNQLLSRELRCAVAVTREYEERYKAKGPEGGAQSYVYPCESHMIEPF
                     ATTVVDVEDVIGAALHRQAPPLGLQCVVAVDLQPVTPYSCGMACLASSTGNTFRVPYR
                     PQQRELLSLILVKAFNGQLPKVSATFKYAILSGGIETAANERDWKSFASYVVGKLQRY
                     CSPECCRPLRDELDRHVPFVAELVPVRDIVMDAEARDRRRRERETQKVKAQVTFGVGS
                     AKVQSDMFSLFRDFLEGVTVSDLVFANTICILLTHHNKGIDGIQVEDVTDALEKCRPS
                     ACTLAFEVRVTAGGVEVQFKASDAGDRLLLSQWLNALSLRSLTWQFRQRPLFGTSRLE
                     VDYIEHLYDAKIACSARRYRQLCKQFDAFPVPKPYVRFVRTRVSKSPKQN"
     gene            complement(<581393..>582409)
                     /locus_tag="LDBPK_091610"
                     /db_xref="GeneID:13392179"
     mRNA            complement(<581393..>582409)
                     /locus_tag="LDBPK_091610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858790.1"
                     /db_xref="GeneID:13392179"
     CDS             complement(581393..582409)
                     /locus_tag="LDBPK_091610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858838.1"
                     /db_xref="GeneID:13392179"
                     /db_xref="UniProtKB/TrEMBL:E9BA46"
                     /translation="MPPKQGKKDAKASAPVITVAQELHVDTDLRRLHEACGVLGEPFA
                     PFARRLKAELTRVKDGDQEGVPQVPLFVHGEVAPGDLKTLCSVALRPYPFLRVIQLHH
                     AELGDDGILILCEFLSQYQPLPDRNPFGIQRLELPGCAIGPRGCRYLGSYLRSNATVT
                     TLVLDFNPLEDAGVRELCTALQWNSSLTSLSLQYCGVSSDGAGYIASRIVKESNVSVL
                     SLRGNAIGDKGVEEVAKAICVSSKLEDVDLADTAFTGDVNAVLALCEAMECGTALRVV
                     DLNMCTITPSATECLLKSLQASRHVTTLRVSERTDPVVYKQIVVISATRSQAGKKKKG
                     KKKM"
     gene            complement(<582906..>583391)
                     /locus_tag="LDBPK_091620"
                     /db_xref="GeneID:13392180"
     mRNA            complement(<582906..>583391)
                     /locus_tag="LDBPK_091620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858791.1"
                     /db_xref="GeneID:13392180"
     CDS             complement(582906..583391)
                     /locus_tag="LDBPK_091620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858839.1"
                     /db_xref="GeneID:13392180"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:E9BA47"
                     /translation="MNAMYSADQINVPPELGTIMKQYTKAVMRDKPTDLYKYSANFFA
                     ILSGYAAPFDSEGQLMENGTQEASSRSADPISFGSEKDEKAGSQDPIDILLRRYDRTG
                     TGYMDPAELPRLLAELRTNLSVDEKDVISEEDILAVLPSAQNQIDLLELRSLLLEGMG
                     D"
     gene            complement(<583875..>585698)
                     /locus_tag="LDBPK_091630"
                     /db_xref="GeneID:13392181"
     mRNA            complement(<583875..>585698)
                     /locus_tag="LDBPK_091630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858792.1"
                     /db_xref="GeneID:13392181"
     CDS             complement(583875..585698)
                     /locus_tag="LDBPK_091630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858840.1"
                     /db_xref="GeneID:13392181"
                     /db_xref="UniProtKB/TrEMBL:E9BA48"
                     /translation="MRAKSYADVRELTSQYEQTIKQKNAELENLRHPSGSRSEVGDAS
                     KRCKVLEKQLAAANSEKSVACMERADLQAKLRKMQALLKCRKEEVVKVKGSLEESNVE
                     RSSTIAALKMTVETLSQECDRLSSELAEQAKLQRVERTSTGTVCELHRSESESQTSPI
                     ERMSQSCQVCTLQDALPTAGEDAEAPHSLAILFEEKTRECDQLRGALEDLSAMQRDAL
                     AMLEVTKNQLSTEAERRRIAVDDVENLSVQLRALQQRCSDQTAAERAMADKIRLLGEE
                     RQKMLVEKSQIERDRDHWEEQLRQYEADVAQLSATKNHSNRQLSTLANENENLRAEIQ
                     QLCEREAQAVYAVKAKDMEVQEILSAYQKAAQENESLLESQRFLERELDNVRAGLASK
                     EETVAYLQEQLRSMHLREQQLTLDIQSLEYENENHHQRLARGDHQAAELEAKCSELAQ
                     LLQTKERCIEELHQSLSELSKQVIVKDNESLLLRQRCDTLLADMALLQASFSKEKTRV
                     QDLEASNARLVAREVLSLNDAADRREQAQALEDERATLKAVIDENERIAVSCEQLVES
                     NKVLESRVAELEKSLQESIEAKERLHRIVLEQNKALSRLSE"
     gene            complement(<586341..>586886)
                     /locus_tag="LDBPK_091640"
                     /db_xref="GeneID:13392182"
     mRNA            complement(<586341..>586886)
                     /locus_tag="LDBPK_091640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858793.1"
                     /db_xref="GeneID:13392182"
     CDS             complement(586341..586886)
                     /locus_tag="LDBPK_091640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858841.1"
                     /db_xref="GeneID:13392182"
                     /db_xref="UniProtKB/TrEMBL:E9BA49"
                     /translation="MGGSSSKVETMPAASVPHYEDSPPESTNIGDLVVSGRYKVASPE
                     TVELMKQIQAPRDASKMYPDSDVKDLKQYIIEQEGLEIGQARRRALAQQWRFFLSCEP
                     MQRGLDAGIILGSVSAFIAFRKPRNRIPAKISLIFVGGFCVGMVSVPLMVVATDAYNS
                     QRIKKLEQELFEKQRSEFYKR"
CONTIG      join(FR799596.2:1..588727)
//
DBGET integrated database retrieval system