GenomeNet

Database: RefSeq
Entry: NC_018237
LinkDB: NC_018237
Original site: NC_018237 
LOCUS       NC_018237             558170 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 10.
ACCESSION   NC_018237
VERSION     NC_018237.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 558170)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 558170)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799597.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..558170
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="10"
     gene            <9298..>12111
                     /locus_tag="LDBPK_100020"
                     /db_xref="GeneID:13389490"
     mRNA            <9298..>12111
                     /locus_tag="LDBPK_100020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858794.1"
                     /db_xref="GeneID:13389490"
     CDS             9298..12111
                     /locus_tag="LDBPK_100020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858842.1"
                     /db_xref="GeneID:13389490"
                     /db_xref="InterPro:IPR012880"
                     /db_xref="UniProtKB/TrEMBL:E9BA50"
                     /translation="MRCDVVFAPVAESTADSNEELRDSIEKSLRSLLGSRLAGSVLQT
                     IENGVWRGIAALQSLVFDSTVAYHKGEVRRLRDRKEMLNDDSDQRRALPGLHFKIGWH
                     YLVLHNFSSARQQMLSGLRKIKTLFPLFPSFEARLCGCVFLWHFLFCISVSEGHLSSS
                     SEVYQEIRCFVDWIGTAYGGSVKDECQTVVLVLTKVMEAEWLEYLARKTENLMARQCC
                     DYLVASAQALQDCDAFFPSRKESIAIEAPSHIGEEELLGNHASALWKSFDKSALRGRI
                     ARLLAEAKAVSSSRETEVDYLAFLAGNELMDGVPDTEMIDRMLVKASSTIISRLAEMA
                     WGSARSWSALSPRLTIALLLHGCVDALGHAEQERYYLRMHELEGCLHNDVVLEYPKGR
                     LQSPFTAVAYFDEESAKVVGDSARVVVTLYSTSAACIDVDVRMLALSSGTVAGATETQ
                     VPFSPARCVKLSASCPQELAVDVPLSHSGEYVCSSLTADVHVGGICATTRWRFAVGPS
                     SVAGRSAAGTRAVLSAKIYRQVLQVLNPPTTFRVECPSLLEAVEGECAECDIVISCAL
                     LGVRNGYMTLPHEPKLFRAVCWASANEPLPVTETGGQARYAVPDLAADESVRLLVSIA
                     CIRSAEFRLPIAFEYSTDRYGGVSCCRTLHISVDPPFNAEHSMIGGSLWGDAAAAMSV
                     PSTSSSYAQYDKSVLVKAADIFSSPLVTNWKDDCALYFFTKETTAKEFVFQRGDTVTL
                     SSTFRCTAKRGITVLHAEVVAGDDVDVLSFCCGEESSFLEEGECVTMVTRFQAKRLGR
                     FNPGFIRIFFAPQRTAARLYSDVCIPTVYIEDFGVQVSAKYPLVTPYGSPLELDVSIY
                     NAAGVPFIGELLLDPQTDDFVCAATTRRSLQIGPTEGSVTRYVLTPLRAGELKLPRFH
                     VRCDATSRLVASADESYVVHVLP"
     gene            <12969..>15728
                     /locus_tag="LDBPK_040020"
                     /old_locus_tag="LDBPK_100030"
                     /db_xref="GeneID:13389261"
     mRNA            <12969..>15728
                     /locus_tag="LDBPK_040020"
                     /old_locus_tag="LDBPK_100030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_024473450.1"
                     /db_xref="GeneID:13389261"
     mRNA            <12969..>15728
                     /locus_tag="LDBPK_040020"
                     /old_locus_tag="LDBPK_100030"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858795.1"
                     /db_xref="GeneID:13389261"
     CDS             12969..15728
                     /locus_tag="LDBPK_040020"
                     /old_locus_tag="LDBPK_100030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_024329222.1"
                     /db_xref="GeneID:13389261"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BA51"
                     /translation="MREHLCTPEKVQPAMRLLASVAAGRAGLSRTDIRLLFVFFAEKL
                     AQQELQTTALSSLALLISYIREQHECDEEWFKIVGTPFTEYVRVQQLPLHSRKQCFCI
                     MSFLFTEKTMDLCDGNILAALLELIDGESDPELVLLTFDLHVVAATRSTREAFATVVD
                     DYFESVSSYFPVVFSQPPGCKVTKTDLRTGLKRCLCLAVYKELCIPFMQSKLTSPSTS
                     VKEDVLDVLLTCFDTYSSQDLVPHCRSLVLHMKSEVIKLSSFADRASNATLTKCLLMS
                     CEVLGRVSKQCSAKTQSEALEIFGPVVEGVLAALSADPPTCSAYGTMVVHVLTGSWNC
                     CLFVASYLFSMLAMSIEGAERPANAFILLAALASGMLDGLDAFPGETHKEQLRTSIER
                     TTPMVVETVTGCSQRWRAAGDETCIDDFTLMCGCEFLVCVLKLSAAIEPWMPAATASE
                     GVDALVWVALHHTAEVSAKVCRLLREYAAVDALQVQEALSRLLCNPSAPPEQALNIAC
                     ELARTSLAALLLVFGDGFFSTTCEWIRGMAAGQRAAALQKALQHFGRALQDGAADRMT
                     ALLGRDDVSPEFFECACLVASNLSGDTCGQQLSTEGALSLLGIAAVVSGRTHLHCVLY
                     NWANTAAQFVGLTTSDHQAWRRVGMEGITGMLMNKVFPEDTQALLTRVSRGHLNVGVA
                     ILWGKLLADRADGGEAAAPPPGELVSSFLYQHLGVATSASCCDRAAVQEAFSYVPFLA
                     TQVGGRPSLLQLLLGSEMSHSERPNHALCSALHCLVDKETEERVQACLVDLLAMVRKL
                     TSSGADNERALARALLFSVDAKCGGSVALARSVLFNDSSVQALLEGTKDASLTVRCRS
                     LHLIRSLARGALLLMGNCSQEEKAELARARDHILLVTKRSLGDHKRRVRQASVACRHE
                     WFKVK"
     CDS             12969..15728
                     /locus_tag="LDBPK_040020"
                     /old_locus_tag="LDBPK_100030"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858843.1"
                     /db_xref="GeneID:13389261"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BA51"
                     /translation="MREHLCTPEKVQPAMRLLASVAAGRAGLSRTDIRLLFVFFAEKL
                     AQQELQTTALSSLALLISYIREQHECDEEWFKIVGTPFTEYVRVQQLPLHSRKQCFCI
                     MSFLFTEKTMDLCDGNILAALLELIDGESDPELVLLTFDLHVVAATRSTREAFATVVD
                     DYFESVSSYFPVVFSQPPGCKVTKTDLRTGLKRCLCLAVYKELCIPFMQSKLTSPSTS
                     VKEDVLDVLLTCFDTYSSQDLVPHCRSLVLHMKSEVIKLSSFADRASNATLTKCLLMS
                     CEVLGRVSKQCSAKTQSEALEIFGPVVEGVLAALSADPPTCSAYGTMVVHVLTGSWNC
                     CLFVASYLFSMLAMSIEGAERPANAFILLAALASGMLDGLDAFPGETHKEQLRTSIER
                     TTPMVVETVTGCSQRWRAAGDETCIDDFTLMCGCEFLVCVLKLSAAIEPWMPAATASE
                     GVDALVWVALHHTAEVSAKVCRLLREYAAVDALQVQEALSRLLCNPSAPPEQALNIAC
                     ELARTSLAALLLVFGDGFFSTTCEWIRGMAAGQRAAALQKALQHFGRALQDGAADRMT
                     ALLGRDDVSPEFFECACLVASNLSGDTCGQQLSTEGALSLLGIAAVVSGRTHLHCVLY
                     NWANTAAQFVGLTTSDHQAWRRVGMEGITGMLMNKVFPEDTQALLTRVSRGHLNVGVA
                     ILWGKLLADRADGGEAAAPPPGELVSSFLYQHLGVATSASCCDRAAVQEAFSYVPFLA
                     TQVGGRPSLLQLLLGSEMSHSERPNHALCSALHCLVDKETEERVQACLVDLLAMVRKL
                     TSSGADNERALARALLFSVDAKCGGSVALARSVLFNDSSVQALLEGTKDASLTVRCRS
                     LHLIRSLARGALLLMGNCSQEEKAELARARDHILLVTKRSLGDHKRRVRQASVACRHE
                     WFKVK"
     gene            <16551..>17642
                     /locus_tag="LDBPK_100040"
                     /db_xref="GeneID:13389265"
     mRNA            <16551..>17642
                     /locus_tag="LDBPK_100040"
                     /product="thymidylate kinase-like protein"
                     /transcript_id="XM_003858797.1"
                     /db_xref="GeneID:13389265"
     CDS             16551..17642
                     /locus_tag="LDBPK_100040"
                     /codon_start=1
                     /product="thymidylate kinase-like protein"
                     /protein_id="XP_003858845.1"
                     /db_xref="GeneID:13389265"
                     /db_xref="GOA:E9BA53"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BA53"
                     /translation="MRAVVFSDVSSAELGEHIRAIASTSYAEVVYVDVSESSEADLAT
                     AWHTRYGGASHAPPAARDELDDLKNTFVCYLTEQKTLEDSDVVYAVFVAEVPTLVLTP
                     SVTLTPLMHTTADGSVSARKAAIESLFSVAPSSSSAEVIVIEGGDGAGKETQTGLLVR
                     RVHAAGDEVHALDFPNEKGLYGGLVRAVLSGRKGSISELNPQLFSFLYSLNRFGCARQ
                     LHFWLRRGSSVVLDRYYTANFGHQASKLPPEEREAFISDLEFMEVEWLGLPRATYVLY
                     LDLPPAAALEAMRRDSTRKQLDIHETAGSDYKERVRQTYRWCCEHLPGWHHIECFDDD
                     GRRLTREEVHASITSHLRDAGSRAIGAPS"
     gene            <20434..>21465
                     /locus_tag="LDBPK_100060"
                     /db_xref="GeneID:13389267"
     mRNA            <20434..>21465
                     /locus_tag="LDBPK_100060"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858798.1"
                     /db_xref="GeneID:13389267"
     CDS             20434..21465
                     /locus_tag="LDBPK_100060"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858846.1"
                     /db_xref="GeneID:13389267"
                     /db_xref="UniProtKB/TrEMBL:E9BA54"
                     /translation="MLKECDFFSDSYGCIITKSIGYQAPFPLVRLSNGWSTKTPDGAC
                     VQGACFVSFGADDTGSRGRLLTMDVSARASSISFLQLLSSSCPPLALEPEVEYVSKIE
                     TTETASAVVTRSGGNRWSTSVYVQGEDVPGTAYSRRAHFRRASAASLFGSSLWLMEAT
                     KDDHGAQAVHRYSLATALTGGVSESTLVSGNLGRPLDIIALSEDTALVLGTNGVAMAD
                     RRQRASDILFFSDLLNGGATGDRQLLTFGEDYTLRAYDLRDVSAPLCQATSATYLRIK
                     SEIGTRASLLVASDMTGVFDVLHVTTVASLQHSGDTVLDAAVLPSGHNGVRVCTSTGS
                     GMIYDWTVA"
     gene            <25536..>26774
                     /locus_tag="LDBPK_100070"
                     /db_xref="GeneID:13392191"
     mRNA            <25536..>26774
                     /locus_tag="LDBPK_100070"
                     /product="dehydrogenase-like protein"
                     /transcript_id="XM_003858799.1"
                     /db_xref="GeneID:13392191"
     CDS             25536..26774
                     /locus_tag="LDBPK_100070"
                     /codon_start=1
                     /product="dehydrogenase-like protein"
                     /protein_id="XP_003858847.1"
                     /db_xref="GeneID:13392191"
                     /db_xref="GOA:E9BA55"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BA55"
                     /translation="MIHVGNCYIPWEVFTLAELRAVSCQIVLLAIWGAVVGPLCRRGV
                     AGVAFLACYTVGMFFFQRRLASGLPVRFLSLRAWRSSPENFRKTSAFLKALKSKTPAA
                     GVSAEGFGARPVVVMTGGERGIGEEVVHQLLREGVDVILCCPFEAEALRTIARLKACV
                     SNSRVHFAKLDLNDEESVRGCAAEVLGMTPRIDVLINNAGLVSPFAYRLNKRGYEVVL
                     SINFLGHVLFTELLLERVKASGPSRIVNVASLMHLDACVPGPCKTALDVMAANCDPTS
                     PHHTHNYSLSKLLLVCYTRDLARHLRGTDTAVVALHPGVVLTDIYAFGAIFMKAFLRT
                     VFKFPGEGAEVVLYCALADNIRSGSFYADCAEYNSLLSPLAVDDAHNERLRRVLLRYF
                     ALDGSKPTGKLLADVVQSTP"
     gene            <28020..>28793
                     /locus_tag="LDBPK_100080"
                     /db_xref="GeneID:13392192"
     mRNA            <28020..>28793
                     /locus_tag="LDBPK_100080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858800.1"
                     /db_xref="GeneID:13392192"
     CDS             28020..28793
                     /locus_tag="LDBPK_100080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858848.1"
                     /db_xref="GeneID:13392192"
                     /db_xref="InterPro:IPR007718"
                     /db_xref="UniProtKB/TrEMBL:E9BA56"
                     /translation="MSRAVDHLVAEYLAEEHPRVARALRKDAPSTAPPLRSPFGKKSL
                     QEVVMAYRVQKTTPAAVGNGASSEDDEAQRASQKTAKTSSPSPIPKPTARKVPIADSD
                     SDDESVTRPAAKKTPPKYAPKKAAVYSDSSDEDEPVPKNSSASKMPAPRAEDVPAQKA
                     VRTESEGAARRTPHHLNEDGTFRRFQRIDPAKVTFDADALRDNRPGREHLVLRQNQEM
                     MRTKGKGFNKLKQKNKGKFYGAGVDLSVRAYQFPDSDDD"
     gene            <29849..>31036
                     /locus_tag="LDBPK_100090"
                     /db_xref="GeneID:13392193"
     mRNA            <29849..>31036
                     /locus_tag="LDBPK_100090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858801.1"
                     /db_xref="GeneID:13392193"
     CDS             29849..31036
                     /locus_tag="LDBPK_100090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858849.1"
                     /db_xref="GeneID:13392193"
                     /db_xref="GOA:E9BA57"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028608"
                     /db_xref="UniProtKB/TrEMBL:E9BA57"
                     /translation="MEGSRTSDGTALATAPPLLLPSSAPQGVQVRRTAALRGHKDRVW
                     CVRWCPTAPVLASCSGDTTVKFWGRSRSAENGCEAWTCLGTLEGEHSRTIRHISWSPS
                     GEYISCASFDHTATVWRRNGGDDGYGFEIEGVLDGHESEVKCVEWATDSMLVTSARDR
                     TAWIWERVDEGEYECGGVLTGHAQDVKHCQFVLPHNDGDVPLVVTCGYDDTIKVWSEG
                     HHHDDWQCVQTMAAHEATVWATALQKLEVPMELVRASHASHAPLPQPLLCSCSDDLSI
                     IFWKRDAEGRFVEAARISGFAERSLFDVDWAPHNAPVVACASGDNSFSLLGVYEDETG
                     VHTCTLARVADAHLADVNSVSFASQGTLTACNAEGEKTGILLATAGDDNVIHLWTVSA
                     ETE"
     gene            <32416..>33504
                     /locus_tag="LDBPK_100100"
                     /db_xref="GeneID:13392194"
     mRNA            <32416..>33504
                     /locus_tag="LDBPK_100100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858802.1"
                     /db_xref="GeneID:13392194"
     CDS             32416..33504
                     /locus_tag="LDBPK_100100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858850.1"
                     /db_xref="GeneID:13392194"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:E9BA58"
                     /translation="MNQMHELSHGVSAMKSSKTKRHNPYASKVLAPEDSVEFNSMLNS
                     PLSARQSPLNWEARAFDPTFMYSNVSTPYLTQSLASMSMDLQVRRPLFGDSPAVLTGK
                     SPSDASTDLGAGRAPVVVAPVMRSSVTAPPKKALGKVYVGGRPVVVPRHDNEVTVQLR
                     HSEATFVIPDIYSLMALEEETRDVVGLPVIVEGDRGEDFGVISGMAKMEAATVTAAPS
                     PTTEEETAAKGSPNCAAKPLLKVLRVASALEVQNSEALPQREAEALEYCQTCLQEVQL
                     SVPITIEGVVFQFDRKKLTVRYTSDAYVDFNDLTRMLHKKYNCRIWMDQLNRDTVNGA
                     EKRGRRGEHGGKKSNPHNRGAAKRREQQ"
     gene            <39300..>41516
                     /locus_tag="LDBPK_100110"
                     /db_xref="GeneID:13392195"
     mRNA            <39300..>41516
                     /locus_tag="LDBPK_100110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858803.1"
                     /db_xref="GeneID:13392195"
     CDS             39300..41516
                     /locus_tag="LDBPK_100110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858851.1"
                     /db_xref="GeneID:13392195"
                     /db_xref="UniProtKB/TrEMBL:E9BA59"
                     /translation="MPRETHVLRFKVLTVECAALPNGQQYTVMYHRGNTNRSTPCYTA
                     QGGVINFASMPEGAAVVHFKAGHGGGRFAPKYIRFMIEEYTRGMPRRLVGETEADCTQ
                     VLKDYGASGSGILTVVFRLYGTTAKMRIAVLVYPEHAPPLSFDGLIDPSEVAAPLPPQ
                     ALKVMNRGEAMMILMGLETLLERRRTMKAEGQSLPQSREEKKLAELEKRRKALVGSEG
                     LATEVIKTRCEEVVAVQYTALARKHRNNFIGQTAAYLREMAMRAGEDFIDDDGNSSGN
                     TVMEQLNRVNRSIEEVEMQVKKLEEEQTALGRIQHKVDVMAELSANLDKVAALQQKMQ
                     VLKESRTALTEAMKKQAARKNTPLAREVAAINARIAALNAEQQQMAPRIQHMVTVAAS
                     HVVKWARSKNPPELDIKSRIDTSRETGGNGRNAVDDLFSDDDKPKRSKEQPVMDDVQR
                     KQVVEALKGLKTPTAPVPTRSPTSPTSASSSSGHRTPRDLFADAGLPTMGDFSNTKKK
                     EEEAATKRKDDTSIKPVHEDPLKPSGLGVDMFSAKPAPAAASNVPAGLPSMNDFMRSS
                     ASSRQQDAQPTFDFGSILQASSVSPQMGGGFVLEPQQSEAAASSFAAAAPSAVRDAYN
                     KRDDPYYDEMDDFTVPPDAADNKNYGAVEITGGIFGFQDDTNSPAYVASRPTFDFGPS
                     GGGDDGPSGVGVTAPPAETFSFGGGTADEPSTNNRRNSSDDPYTGITNLPTYNFSS"
     gene            <43331..>45673
                     /locus_tag="LDBPK_100120"
                     /db_xref="GeneID:13389268"
     mRNA            <43331..>45673
                     /locus_tag="LDBPK_100120"
                     /product="DEAD/DEAH box helicase, putative"
                     /transcript_id="XM_003858804.1"
                     /db_xref="GeneID:13389268"
     CDS             43331..45673
                     /locus_tag="LDBPK_100120"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase, putative"
                     /protein_id="XP_003858852.1"
                     /db_xref="GeneID:13389268"
                     /db_xref="GOA:E9BA60"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BA60"
                     /translation="MRTRAQRCLHAALQSPWPASTRAARGTQRRGFLGTLIADDSAVS
                     GITTSNVLPQGSSATDDPALSEADSSYTHPLEVSGTSFKLYGESTTYAKEDAGHIFAS
                     AKVLSYNPAILFNDLQLQEGHQGLLNPTGGLGAGRSGDSPLAANDPEMATRAAEEEES
                     DAVMRSGRNKQGAAGAAAMAAAMLDSRRAAEGIAMVPGHPLPVVFPRSDGLSPAPRVK
                     KLGFGGLNETHAGKQARQTRQSNEEDVDAIMCGEVMESERRVESHSLQHSITWRVQVL
                     DEHCKPIPIKHFQHFREAMDVLPARVMQGLSESGLTRPTLFQSAAIPQLMRGRDVVGI
                     APDGSGTTVAYAVLSMAVLVKVKAAEEQKRLAKVVEEGTSSAPLPPELSEAPSSSSGD
                     VVARPIVVVLCTNRQTVLRTAAMYSSLSAEDVRLVAAYQSVDGDDEEGQRSVIRRKKG
                     CDVIVATPARLTALVREGHVALSRVHVLVVDRANHLLAADPSPNGRTALPHVEDIMHA
                     VKVNGVAHQFSLWCTELEPSIESLVRKYMSPLTVTVMATREEHTNVNVRQILYPLPSR
                     DDRIKAIQQLYDQGTILKRDQVLVYCAYRETAEEVRRELIKALSAPSSMVQCVHSGLC
                     SRKRNELLKAFQHGDIRILVVTDVATKRLDAEELGHVIHYDLPAFTEVYMQRVSQVDR
                     SGRQGTSHTFLTPGDTRVPPIARFVEKQTDHALNGEIRKMIADIEAADSEDSWVIPVL
                     RMHGHALSNTKWRVRGRREIRQQVETLSGLVSESDKKPVG"
     gene            <49259..>50368
                     /locus_tag="LDBPK_100130"
                     /db_xref="GeneID:13389269"
     mRNA            <49259..>50368
                     /locus_tag="LDBPK_100130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858805.1"
                     /db_xref="GeneID:13389269"
     CDS             49259..50368
                     /locus_tag="LDBPK_100130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858853.1"
                     /db_xref="GeneID:13389269"
                     /db_xref="UniProtKB/TrEMBL:E9BA61"
                     /translation="MSDMNMDMRIHNMKYTSGLESGPFTSEGVLSTNADPAHDYEASA
                     TALGAHSTLFHALAAVEEDDDGENSNDVLLRLLNEVRAVESDGDDDEVEVIDKGSDEN
                     AAGALALRHGEEPAKPYMPPYTAVPRGGGAIIAGGFTVEGNASYSSAASLPPPPPPPP
                     PPPPAYSTPSMAPRSPYANCYSGIPHLSTTPGSKPPPPSFAEAMATAHGTPASLLGRS
                     VPSQECSPMLANYVPPMPAAPQETVLLRNSNGVFLLQPISKPTPPYTPPAGSTSPPVS
                     PLPRYSLPPAAASTLNTAAANGFLGSSMVQAGARASSITEPLHYAPFGPAGGSPYLSA
                     TVPYSHDVGSVRGTPSLGTAPPPYACGAPRGPATR"
     gene            <55157..>56674
                     /locus_tag="LDBPK_100140"
                     /db_xref="GeneID:13389270"
     mRNA            <55157..>56674
                     /locus_tag="LDBPK_100140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858806.1"
                     /db_xref="GeneID:13389270"
     CDS             55157..56674
                     /locus_tag="LDBPK_100140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858854.1"
                     /db_xref="GeneID:13389270"
                     /db_xref="UniProtKB/TrEMBL:E9BA62"
                     /translation="MTTEGYSASMSGPPPLYDFEAEAHQLTREQLEERVLQMRAANVV
                     LQTSVLRLRESLATLQEGMRANYADLERRQESIANMLLRRLEATKRRRSKLVAHLCSV
                     EAEKASQETKLRNTTQNIKELSKHLKQEEQEIANRLQRRLERLHAQRKQLDHALEEQT
                     NSLQQLEQLVQEVEEMDQSDSAETSAGCLATQSATATPALPAAPASSATATTSGICVP
                     VHERSSSRMSAASSTTATTTADVAYDPTAMIRYLEEEIAAAESLRTEALSKAEKYVAT
                     RERLERRLAREKQKRAEQHSRTQELRQQLQDASTAVNEKEAAQALTMEMEVDRHLSSS
                     RFGGDLISSASSTCATPQLRTVSAVASRGNSASPGVSRPCPGPAVQDVDGRPQDPFML
                     PASSACGAQASSTSHPGHFRGASGVSASMSGCTSLGDAPAAAPAIEALNRLSSSTPLN
                     APASRDETTISSEGSQHARLLLQDTSCVAAPRPAMPAESTLPSASSMPDAQGPML"
     gap             59523..59621
                     /estimated_length=99
     gap             60663..60761
                     /estimated_length=99
     gene            <61297..>63330
                     /locus_tag="LDBPK_100150"
                     /db_xref="GeneID:13389271"
     mRNA            <61297..>63330
                     /locus_tag="LDBPK_100150"
                     /product="nucleoside phosphatase, putative"
                     /transcript_id="XM_003858807.1"
                     /db_xref="GeneID:13389271"
     CDS             61297..63330
                     /locus_tag="LDBPK_100150"
                     /codon_start=1
                     /product="nucleoside phosphatase, putative"
                     /protein_id="XP_003858855.1"
                     /db_xref="GeneID:13389271"
                     /db_xref="GOA:E9BA63"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:E9BA63"
                     /translation="MSRVFVAFFAAVLFVVFLTAYDVGVGTANPLQSRHMQLTQNAVK
                     KSEANLVNCREVNADLKSGGGVNAAQAIAEMRRQREELMNIVALERERVVSARSLLQV
                     CEDELASDLSVLFGVADHNFTARIRSLEEKRKHLEGLHSMLNTTPFGAVELRRSSEIR
                     ALQAALLHEMRASKKKAENGVANGEACTKTSDKYSVVFDIGSTGNRVHVYKYRVAPAT
                     HTAAAAGSELSDIDLVEELFELNHKALSELDNPVQDAPEALWELFMKAKYFVPAELHA
                     CTAVEFKATAGLRMLGMEKATEILDGIRARYRNETFWLRGNAPVRILDACEEGPMAWL
                     TVNYLLGVFSRGTKATASTVAVIDLGGGSTQIVFEPGESAFHGMRTDLRYSATLGSRS
                     VSAYQHSYEGYGLHAATKELLFHIQGKSQEKPGGGTTTSTATTTTTTTPANSGDKALP
                     VWNVLGNLGADGSSERDGIVTKRAPPMPPPPLPDAEAVEAFPCFAVGYEDPLGVKNIK
                     KNNAGEPAMPPNFQACANLFRDRLLKPVGLTCEAANCGIAGVMQPPLTNFTGEIYVFS
                     FIFDLLALANSSLVPAGAAVSREKFEVKLPDLATIAEGHCAAFSLTRIAEATAKEGLG
                     SLKPEYECMYYSYVYALLRYGYEVPEDRVLHVVKKIRGYETAWSLGASLLSLT"
     gene            <65182..>65898
                     /locus_tag="LDBPK_100160"
                     /db_xref="GeneID:13392196"
     mRNA            <65182..>65898
                     /locus_tag="LDBPK_100160"
                     /product="leucine-rich repeat protein, putative"
                     /transcript_id="XM_003858808.1"
                     /db_xref="GeneID:13392196"
     CDS             65182..65898
                     /locus_tag="LDBPK_100160"
                     /codon_start=1
                     /product="leucine-rich repeat protein, putative"
                     /protein_id="XP_003858856.1"
                     /db_xref="GeneID:13392196"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:E9BA64"
                     /translation="MAMVHTTYPQCLSLVEADTAEVEVQQALEDGANTLYFSHHFNHT
                     DVPPSIAALREQLEVLHIDNNYPFTAISPRVTALTNLRWLNASYCSLRSVDSSISRLS
                     KLERLTLNNNLLTWLPLDVWQLKALEELHLDNNQLNVLPGGLLFLPRLRVLTLENNPL
                     YTPEEVHGAAAATYIPAQRSVDCSACCIRSRNYKVFVTFHTIVGHRDVPFVHFVCSDE
                     CAVHVRTRLEAYDRAHLNQQ"
     gene            67183..67359
                     /locus_tag="LDBPK_100170"
                     /pseudo
                     /db_xref="GeneID:13392197"
     misc_feature    67183..67359
                     /locus_tag="LDBPK_100170"
                     /pseudo
                     /db_xref="GeneID:13392197"
                     /db_xref="PSEUDO:CBZ32138.1"
     gene            <68025..>70031
                     /locus_tag="LDBPK_100180"
                     /db_xref="GeneID:13392198"
     mRNA            <68025..>70031
                     /locus_tag="LDBPK_100180"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858809.1"
                     /db_xref="GeneID:13392198"
     CDS             68025..70031
                     /locus_tag="LDBPK_100180"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858857.1"
                     /db_xref="GeneID:13392198"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:E9BA66"
                     /translation="MSAPLTEHNLFSALREYASRLEVQYMIEEEVKKFQEKVLPRVLS
                     EAFATASHAAAAESTASGDAAGAASRTVSSSPPSKTAAPSHATATPNSDWVRTFLKAH
                     VDDVLSRQLPPMIVREVQQQLRNANGSALAPSSSSGSPPCGESSVPAAAARARAGLPP
                     LPPSPRSSRSPPCETTPVPAGRITPEHRGGGNRDLTLLASAADDEGRRQRKQILNAIA
                     DIEHQLQGVQRELDEVVHQQRLSRCRFEYLCETLHGTGLSSAAESTPSSLCVALEQAL
                     DDRKADVVRARLAAMLQGLLPPPAEPHSGKGAEIRNEAALTRGSSPSLAPQDGGLLSA
                     SLASAKSYAVPSSGHNTPPQLLDRSPSCLRGDAQSSPLVTTGAVEAPPAQPPYSSGMP
                     PVNSAPASARTLTYARHGDASAAVAGAVRPAAAALSRAHRSITTRGTAASAAAAKVAS
                     PPPPPPPSVVTTNETAPPPLPVLRQKSRARPDADGVVSRPAPLPQACADPSMRERAAR
                     DTHATTSMRMADSCATGATTTAPTANCTDPSNACFRSSLYHSVASSSITSVASPREAA
                     AAGGAPRAMVLGIDAVDIPPGVLPGALGRQGAVRVESVTPLQLAERAGVCRGDVLLSV
                     ANRPVGSCEQMRAALAAVRATQTPVTLEVYRHTIQEIVFITLQM"
     gene            <70937..>71602
                     /locus_tag="LDBPK_100190"
                     /db_xref="GeneID:13392199"
     mRNA            <70937..>71602
                     /locus_tag="LDBPK_100190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858810.1"
                     /db_xref="GeneID:13392199"
     CDS             70937..71602
                     /locus_tag="LDBPK_100190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858858.1"
                     /db_xref="GeneID:13392199"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9BA67"
                     /translation="MPAKKKEVKVDEPLFVDEEGSYVHEAEGARYKGGIRRYAPPGGT
                     DAGGTAAPPAKNSRSRSTSSPGKGGATPPPSAAAGTAASMAVVSDAPVFRHGRGVYTC
                     PSFTYAGDWVEDEMHGSGQLAFVESGNIYEGEFSHGCFSGHGTYQWRDGALYCGQWRS
                     NRMHGEGIYTDVQGHVWKGRYYNGTGPGLIRLYPTLERVDDASPSSPGLDSTNASATA
                     ADS"
     gene            <72954..>74177
                     /locus_tag="LDBPK_100200"
                     /db_xref="GeneID:13389272"
     mRNA            <72954..>74177
                     /locus_tag="LDBPK_100200"
                     /product="mitogen-activated protein kinase, putative"
                     /transcript_id="XM_003858811.1"
                     /db_xref="GeneID:13389272"
     CDS             72954..74177
                     /locus_tag="LDBPK_100200"
                     /codon_start=1
                     /product="mitogen-activated protein kinase, putative"
                     /protein_id="XP_003858859.1"
                     /db_xref="GeneID:13389272"
                     /db_xref="GOA:E9BA68"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BA68"
                     /translation="MQAKGEAAMRDLIAELHAMQSPYTVQRFISSGSYGAVCAGVDSE
                     GIPVAIKRVFNTVSDGRTVNILSDSFLCKRVLREIRLLNHFHHPNILGLRDIFVHFEE
                     PAMHKLYLVTELMRTDLAQVIHDQRIVISPQHIQYFMYHILLGLHVLHEAGVVHRDLH
                     PGNILLADNNDITICDFNLAREDTADANKTHYVTHRWYRAPELVMQFKGFTKLVDMWS
                     AGCVMAEMFNRKALFRGSTFYNQLNKIVEVVGTPKLEDVVMFSSPSARDYLRNSLSNV
                     PARAWTAVVPTADPVALDLIAKMLEFNPQRRISTEQALRHPYFESLFDPLDLTEGLSE
                     RFHFDESVTDVWDMHKIFTAEVERFNDLRERREEVARERAMAAQQQGEQVLGTDHMPR
                     THSLMELAGNAPAPS"
     gap             79134..79553
                     /estimated_length=420
     gene            <80613..>82034
                     /locus_tag="LDBPK_100210"
                     /db_xref="GeneID:13392200"
     mRNA            <80613..>82034
                     /locus_tag="LDBPK_100210"
                     /product="nucleolar protein, putative"
                     /transcript_id="XM_003858812.1"
                     /db_xref="GeneID:13392200"
     CDS             80613..82034
                     /locus_tag="LDBPK_100210"
                     /codon_start=1
                     /product="nucleolar protein, putative"
                     /protein_id="XP_003858860.1"
                     /db_xref="GeneID:13392200"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:E9BA69"
                     /translation="MSRTLYTLYEAPTGYAIFKVRTTEEIGAEDVALQKELQSFSTFS
                     PWVKLVSFAPFESPENALEDAVCISENLISTFLNNFLTAAFAKKVAKNEANWELGVQD
                     PKLGSAIHDELNIPVLCNETVAEISRCIRLHAEKLLPEHNEGDVPRAQCGLGHAFSRN
                     KVKFNVHRSDNMIIQASALMEHMDKGVNLLGMRVKEWYGWHFPELAKEVPEPLKYANV
                     ALLIGNRNSLEAVPEEDVKAQLGDILEGDEALAARVYEKAVTSMGGDMAEVDWDCIRT
                     FAKRVASLGQYRVALAQYLVDKMMLVAPNLTQLMGQTIGAKLISKAGSLTNLAKSPAS
                     TIQILGAEKALFRALKKKKGNTPKYGLIFHSSFIQRASKENRGKISRYLANKAALACR
                     IDCFMDAPPTVFGEKLREQVEARLNFFDTGNKPPSNKAAMAEALEQYQRILRKRDRKQ
                     ADEDAEETPKKKSRKVVAASESE"
     gene            <83271..>85418
                     /locus_tag="LDBPK_100220"
                     /db_xref="GeneID:13392201"
     mRNA            <83271..>85418
                     /locus_tag="LDBPK_100220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858813.1"
                     /db_xref="GeneID:13392201"
     CDS             83271..85418
                     /locus_tag="LDBPK_100220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858861.1"
                     /db_xref="GeneID:13392201"
                     /db_xref="UniProtKB/TrEMBL:E9BA70"
                     /translation="MLRTSYLLRPTRRDGADGAAAAAPTEHLSDVYLCASSPPVIEEW
                     VGWPDAPCVLAGSIRYFIDTRGALSPCAPAESSASRAGGTKALCIAEAKPSPNPPPEL
                     PSAVPLDGLCRAYEAADGRSGSAFLQVYSVGAHGLLSPEAKAVITGCAMAALRSRLSH
                     LLGLLPHERLNEAGSALGMSAVAVLNRYCRASAALPPPSPSLMRPRCGTDKDGGGMRG
                     GGWVVTWALELVLCVAASLIAAGPPLATACPPLCVSDCGEVIMASLHFGLGVRLQRDA
                     VAHHDERTAASSMPLTSAAERRPRYAALSVQITECTPASSHPLDVRRAVDVTRVIYVD
                     HIRSAQAYAEDGTDAFQRLARCAGRFSDPLSLATARDAWAEALQSYQASATASQGGVL
                     FVLTHDLSAQSGPAALLPLMVREERSRSHAAEMSHDVVFPPALRDHVLASVRVRSAPA
                     YFNHILLCQAWSSDDVVTEAYARHWADKLAYDSALAPARVAVQWRASLLVPSAKEGAA
                     VTSGAGEGQTLAPTPLQWVLYTARRQLVVAVANRSQAVLTGRRLGLDRAAAPATTEVA
                     PFSPSALRALAEQCVKALPVARGLLGWHCPWPVPSCLQSTGTRIAIPSAAAVEEVLWA
                     LRMLGKLRWRAAQLYEAAGDSAEQHQQLRALRADVQRWSSRRRARALAADGATLASEA
                     AAWTPTVEDVVCHVDDGDWGALTKELSSMLPPA"
     gene            <86185..>87021
                     /locus_tag="LDBPK_100230"
                     /db_xref="GeneID:13392202"
     mRNA            <86185..>87021
                     /locus_tag="LDBPK_100230"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858814.1"
                     /db_xref="GeneID:13392202"
     CDS             86185..87021
                     /locus_tag="LDBPK_100230"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858862.1"
                     /db_xref="GeneID:13392202"
                     /db_xref="UniProtKB/TrEMBL:E9BA71"
                     /translation="MPTIRKLTAVAAVVAATVLLVATSATAQADQMCSDPANPLASID
                     YSDAAVQACVVARCTTTLNVTPTITADGFCDGVATSESSAPCNKLEMGYNAYYACLVH
                     ALQGTNTTGLAEFGAAAKEFFSTPGFPYRLSLLGCYACNHYRLTVFPSLDSKCSNWTC
                     ATVSSQSPSAPAYGQPDEGYNHRLCSTGCITGIIMIPFTVVTCAIFFACGCCWPSPSL
                     KTTYEAMLQEERRKYRRHPAADDDDSHDLDNGCYSLAHEPAPVSDQKSHPEVAGQHSV
                     GN"
     gene            <90628..>92100
                     /locus_tag="LDBPK_100240"
                     /db_xref="GeneID:13392203"
     mRNA            <90628..>92100
                     /locus_tag="LDBPK_100240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858815.1"
                     /db_xref="GeneID:13392203"
     CDS             90628..92100
                     /locus_tag="LDBPK_100240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858863.1"
                     /db_xref="GeneID:13392203"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BA72"
                     /translation="MSYRARQSELPKWFPQEEGVATNRISAPVTDDDLRRDFDSEVLE
                     LEHDKSVSRKERAARKKELLKRQAVVEEERERRAIAALETRLPRPDWYSSDDEAEFIQ
                     DGVEAEKISELRTQPEGGVGLVFCVVYTALSAVAFVFHFTSSCPIPWMRSESGRKYGV
                     WRATGGGQPDLKVSDIHDCSYEMQFWQAAAAMSVLATFASLGAMISGVLLCVNKGHMG
                     ASFILSFYSFSFSLVSWALVVALYHSFRCGKGTFAGGVAHLDTGVALTLIGWVTHIAA
                     LTVLGVHFVKYWTRSINSGKTRAVRFIYVAVGVATIFLYSVGQAYTMWGKAFPQVEAS
                     VSLWHVRIYDRKTRLSTFLSRGAYKCAAITHRMKAAAALMIMSIIWLFFAVVLGTGAC
                     YKSQYIKISIVFGYASCIFALTAWITLLVTWNGRLCTGVTPSGQSSWTDMGYNGIPSG
                     IQNAQINFSGYSLREGFGLIVGGWAISTVALIFNTVLWDI"
     gene            <95987..>97243
                     /locus_tag="LDBPK_100250"
                     /db_xref="GeneID:13392204"
     mRNA            <95987..>97243
                     /locus_tag="LDBPK_100250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858816.1"
                     /db_xref="GeneID:13392204"
     CDS             95987..97243
                     /locus_tag="LDBPK_100250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858864.1"
                     /db_xref="GeneID:13392204"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BA73"
                     /translation="MAASYHREDRAETELVDQQPIEHFNPDLNNVSLTSSQADAKALE
                     EAAGVDLRAVPEEHSGKCVMISWILFSSVSFIFMLAASLPVPWLKDGQGRKWTVWKDV
                     NGTPWSKIECDHKRQLFQAMEAFTIVGCLLSLGSLVAGALQMMGRGHLGVMMLFGFLT
                     VMVSLTDWALIVNQYHKHNCAGDQVYAAGINRLDAGFGLVFISFALMLFGIIALARWM
                     SESLSLSELHRTKYHSSALMSSFISGCVLTIATVGTAQNMWEHYDRKTSLKITYWGVE
                     IYHRNEGLSENWPLSSYHCPQFTLHMRAGAVFSIISDAFLFFTFLFSVAAVYSRPCKW
                     VTVGFGAVSWILLLVCSAITIAARYKTFCPSGVVPPSTAIYGAPLDTIEQRVNFKGFV
                     ITDGLGMIISAWCITTANLIYLVIKG"
     gene            <99180..>101390
                     /locus_tag="LDBPK_100260"
                     /db_xref="GeneID:13392205"
     mRNA            <99180..>101390
                     /locus_tag="LDBPK_100260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858817.1"
                     /db_xref="GeneID:13392205"
     CDS             99180..101390
                     /locus_tag="LDBPK_100260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858865.1"
                     /db_xref="GeneID:13392205"
                     /db_xref="UniProtKB/TrEMBL:E9BA74"
                     /translation="MTSLTGVTGPAAAVAPFSEENAIVLDKWLYDVCGVDGLQFPSHR
                     RAQFARYVERLPLVAKTKRFVANTFNYPSRSGTREVLVLQKMLEALALHTQAVARETE
                     QVQNNVLQVRRVLEERTMGASAIVDGEKADAVSGAAAAVERRKGKGAAAASSAAQAPS
                     YASSPQGQGYVPLDSAAAAGDNGAATPARSAEATPKPQQAGDEAVSEDGDASATQQPF
                     SAAARAARRADYDKKKALSLRYISAIQTKTQDMSRQRVEMEQRHARLLADKEQLGKEY
                     EALQTTEELVVARHQEAESRKNEETLLLSEEAAMYAAEEAAFDMAWAECAAMLNEQPA
                     AACSTGEPAGRAEGPPSTSPRPHVPSLSPPSYLGSASSHPLPAPSSSSRSLSSEDPVD
                     VAAAAPPNTVPATVAAANQEDSAGKHPGTLSGRNPSGGSSSTAQPPLHQQTLEALRHR
                     LSEIGARTTNYRRQLLNEGHMHLQRFLQSQQRLKDWQGMAAQLRRTHHQLRGQVDVIH
                     TVLSDTARRLEKSDATAQRAGYGEQLTRLNALLKERSYETLQYYVGSREDAEMDMLLD
                     ASADEELRKLQRPSPASTLAGGDLTPARAGSASASSLTTPTRQSAAASPSHSSDRALP
                     PSGSWRTPVRQPASNGTVAAATPSSGTDIRSSVDSAHRHRSRYELVRHLQRWEAVLLA
                     ERLAILKAAHMVPGPNSGTGANTKQADGFSARNAYEELRALLLQQRDRVASSSS"
     gene            <102525..>103304
                     /locus_tag="LDBPK_100270"
                     /db_xref="GeneID:13389273"
     mRNA            <102525..>103304
                     /locus_tag="LDBPK_100270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858818.1"
                     /db_xref="GeneID:13389273"
     CDS             102525..103304
                     /locus_tag="LDBPK_100270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858866.1"
                     /db_xref="GeneID:13389273"
                     /db_xref="GOA:E9BA75"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:E9BA75"
                     /translation="MRQRSSFSTVSSAAMFENTLTTQRAQKGDYGFNVFHNSNPQHGG
                     SYARHERRMREDEVEDFLKSVKHWRPVYEDVADGDLVGDAQSSSSTSASAAEPPMPRL
                     ARMGEEAIMRTFHFETFREAYLFMGRVWAFCYGSDKYPHVTWEGTAITVYLYSPSFRG
                     LSKREARVAAFLNDQYNMLRKSKWQQRRIVDGIVRQTAVEELLGEEVAAHLARREALR
                     TAPLQEVKDGPRSWRSAIGSPLRSPNSGSDGAGSSMGVRDS"
     gene            <104081..>104470
                     /locus_tag="LDBPK_100280"
                     /db_xref="GeneID:13392206"
     mRNA            <104081..>104470
                     /locus_tag="LDBPK_100280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858819.1"
                     /db_xref="GeneID:13392206"
     CDS             104081..104470
                     /locus_tag="LDBPK_100280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858867.1"
                     /db_xref="GeneID:13392206"
                     /db_xref="InterPro:IPR013714"
                     /db_xref="UniProtKB/TrEMBL:E9BA76"
                     /translation="MSRPNFDDLLHSPPIPFTLKILGILGAFGCGTYVLFLFIMHQYY
                     SIRSFAALLYLLTFSIIIPSAESGLLNYTMLAVFARFLVSPIGRAFLYVFMGGVILGN
                     GIGGWVVGAYLFVVAILNVIAGCLLYA"
     gene            <106428..>109217
                     /locus_tag="LDBPK_100290"
                     /db_xref="GeneID:13392207"
     mRNA            <106428..>109217
                     /locus_tag="LDBPK_100290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858820.1"
                     /db_xref="GeneID:13392207"
     CDS             106428..109217
                     /locus_tag="LDBPK_100290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858868.1"
                     /db_xref="GeneID:13392207"
                     /db_xref="GOA:E9BA77"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:E9BA77"
                     /translation="MRRASSPPATPTIAGATSSALTINVKKKRRHKKARQDEDAAREA
                     ARLPPQLPQLCQPHLLHGAPAAPSLLQQRFSEVELQFQLEQDRAQRSALAPRDIANLI
                     LWSVPAPVPIIESPRIFFIKNKSKVRNTVVIYVNGWSYDEMLCTGVGLPRARGEVERG
                     GAPREQAAPSHSTDAMGNATGHAAASAAPAANAAGDGPAAHWNTALCSAMLGPVREGR
                     CWARPGRGTGGAGGVQYCPLSIPSTRNELEKDLWWRNDAPRRPGPSSAASSSALNRWR
                     PNRSCGGEDGDRGVADLHLTSPAVKGARGVGSMFQQAMQVHATGSGAGDGAASAERSP
                     KAASAPAADSPIIASDAFQQHQHLWQNRTLLQRYALHLPEHTVEMQELGFTVSPPQES
                     TAAVRADGGSAEEDDKETALPKGNEERGEQDVWVSFAAPSTTATADGTASATPSVKVV
                     ALDCEMVEVEGGESALARATLIDVLTGNVVLDLLVKPRQRITDYRTRFSGIDAATLAP
                     VSTTLADCQHALQRIVDSQTFVVGHSLENDFKACKCIPNCYVLDTTWLFPHPAGLPYK
                     NALRFLAQRYLQRRIQHGSHDSAIDALVSAELTQLKLINGPSFGMRARVSVLGLITEA
                     AGSAADGVRAGEGPEKTTEAGFDVQLHLFDDAVTLASLLPAPQKYDAASATQAGASGG
                     TVSGAPRSSSASSARIDAVPVRHDEDGMRKAVRALQRRASQQAREAAVAANDTDGETA
                     TTQRPNFSLFWVQLAQAKVDVVLPPAQPPTASAAVAAEEESETAERAAYAGHGGSRGT
                     GSAHTVAQFRRVHDTNRRVLRIIEACPDETLIVVLTGRCDGEAGGNHFSRAQGTCFAF
                     VKDSSAPGPRPEELTKLTDGSSVSALPRMSAAGTAVDNIPLQNTSALATAAVPHSLDR
                     EAAMVVHTPLACQQQ"
     gene            <111318..>117254
                     /locus_tag="LDBPK_100300"
                     /db_xref="GeneID:13389274"
     mRNA            <111318..>117254
                     /locus_tag="LDBPK_100300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858821.1"
                     /db_xref="GeneID:13389274"
     CDS             111318..117254
                     /locus_tag="LDBPK_100300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858869.1"
                     /db_xref="GeneID:13389274"
                     /db_xref="UniProtKB/TrEMBL:E9BA78"
                     /translation="MTASMQGAGCVITPTHQMTMEDAYAVGYDLVLAHNMDHLLVDFF
                     TNEFVSSVGRWRNDVRSKAAVGNYMSLRSVLLGGLDTAALQRLIWDDRIDDTGVLELL
                     GAQSLSTQGGAQRYGAATRHLLQQQGTAAEVEAPAKRHGSGASHSSRGGSGESDADLA
                     QSVNESILVTGVPRLRKRPTSVAHFGVRLPAQQCATHEPLSSFSTKRDVFSSVMAQPT
                     GARQLHRRRHCQVSGAEDLECDADSNEDALKHQQRLLQGALETELGRLLAENEGKQAY
                     IDAMQAEVERLQRTVAVLRRHQRGAPSASGDGSNANQISELSESGSMIHLSKQQQIFI
                     LKERLEAANGRIVALLRGGRPSGGPPSPRRRGGGRGGGLSRRSRGSSASGGPRSPTQT
                     PSPTAYSAFLTKVTVQEAEQMAALDSDANVSLDQLQLHRQEVIAAANDTAGQAAAGQK
                     QRREREAVNQVIHSLQLELQQLQGRLDDTRPGSSRAEAEGCEGLQARMASRLQSALEV
                     MEAQKVRIRHLEELRQMDQLLHTTFSREGLKGRKKGAGRSTRSTSGVSGGSDEADHEH
                     GSSSFSADEEGDAFASARGTASGRRARQARTKGKKAAKSRFGVELVPAGKKGATGGGG
                     GGVAPSKDATKGGLDAAEDADSDSTQKMDMEEVAARRTEAAVHDAVTSLQRTHRRQLA
                     ALVQTCKMQLARVALKLQKPSTSAYTALLQEELSCAQREQRAAWMRLQFTLRNLGPDQ
                     YDATLAERASSSAAATPPLISLRVTPTPEPDATDSGAALGASDDTNMVPLGAVTDPNV
                     RSTAANIAREYAAYGLRIAYVSSELQRVEQSMMDSPRHLPEFAPAATPAVADTPPEQQ
                     LFSVYQAAKARVQETVDTCGPIQEYLEAVQAELAIEQQFRPWCDVNSAQLFSAANTAL
                     VPSTLCIGASMSGSAAAYDHTLHNPHSSTVSATTDQLVLLADVDASMRDVADVYATML
                     RALTPKGSGAAMSISTTSSGSISRHHASPPARASKKRDSKKGRQSAVSPTQPKPAASQ
                     RRFVAKAADKRSSGSPDESESLLPLRGSAGFTVEEALDALPIQPDDVASYQGQLGSIY
                     ISEGVHSAAQQRLYEFILRAYQQHYIHPVHMAAVESALSLPLPGHRGSASGISNDVSR
                     ESSVSASEALVDLMSAQAGAAHAQHREVMALLELIAPTMTQALRTLTKGLQRVQHLLD
                     REDDGAAFAEACSGTGPPCTSPVFLTAVDAAVLGCVVDELRWREWRHSLLPSKKDGTE
                     SSDPAPLPTAGAAPSELLTALILARRGRSGGGRSATPTTDGGADLEDARTIGHYAAFC
                     AARERAARNAHSSQGSPVPGPAESPSSEAEDLFHLTDAPPMLLVPSDASGISALAATG
                     GDNADVGLTVAHELAALFSKRRRQDAHGDDDKAAALLEEIYLDDGEYGGAGVLGGDSN
                     TEAMRSIRRELEYLQAAKQQRMWELMMRFELHKERCAGKTDGSGRLEPKFGTAGARGA
                     DDRASLPSVDPDRLGFEVKSGSAAWYGMEAAKRVHNILRRRARPDQIIVGGGPHGGSV
                     GIELSRRTAQPGSSTAGSSKSGNIGGAGAAPGSGVLGQEDEDEGYAHSSAEEEALFTL
                     GPYASHQRSARSTGRATPSTVRLPPLRQHLLSRAQQGRDGLAGHGGNTALMAGVGYLS
                     PRDVLSLNAYGRMAPGGAYDYSGATEPLHAAGSLTEQVLAYREALMRSAGRVVPMPFT
                     TYANGDPYCLPLSTWPASSGKTGAAGSDRYDPLGRQLPSPVPLPDLTAWVYGVPEGYA
                     SSLLQQQTTGSHQPQNMALFMPRYDCSPLAKVEGRQRACMTSAMPQSLSRGRSFPAGA
                     STYSTPAALAAQRLQAMLSVSMCDPSVATVPAAMEATTAGSRGALPTTRGRAYPVHLG
                     RSGGAAIAQPCSPAPPLTKRALASASAVDADAAPSSETDLRTAGEGEVSESNYESFVF
                     DEKDLNPLAETLGPAKGSSS"
     gene            <118381..>119688
                     /locus_tag="LDBPK_100310"
                     /db_xref="GeneID:13392208"
     mRNA            <118381..>119688
                     /locus_tag="LDBPK_100310"
                     /product="isocitrate dehydrogenase [NADP], mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003858822.1"
                     /db_xref="GeneID:13392208"
     CDS             118381..119688
                     /locus_tag="LDBPK_100310"
                     /codon_start=1
                     /product="isocitrate dehydrogenase [NADP], mitochondrial
                     precursor, putative"
                     /protein_id="XP_003858870.1"
                     /db_xref="GeneID:13392208"
                     /db_xref="GOA:E9BA79"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:E9BA79"
                     /translation="MFRRVSAASASSLVAARSFSSTNVYLDKRIKVKNEVVDMDGDEM
                     TRIIWSFIKEKLILPYVDVPINYFDLSVTNRDATNDKVTVEAAEAIKKCNVGIKCATI
                     TPDEARVKEFNLKKMWKSPNGTIRNILGGTVFREPIIVSNIPRIVPQWHNPIVVGRHA
                     FGDQYKATDAVLKPGKLQLVHTPADGSAPTTLDVYDFKGEGVGLAMYNTKESIEGFAK
                     SCFQYALMRKYPLVLTTKNTILKKYDGMFLQTFQRMYDEQYKADFEKAGITYNHRLID
                     DQVAQMIKGEGGFVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMCPDGKTIEAEAAHG
                     TVTRHYRQHQQGKETSTNSVASIYAWTRGLAHRGKLDGNSDLVKFSETLERVVVKAIE
                     DGHMTKDLALCVYGSSGVKREHYETTEQFLDSVDAALKKAMSA"
     gene            <122945..>125242
                     /locus_tag="LDBPK_100320"
                     /db_xref="GeneID:13392209"
     mRNA            <122945..>125242
                     /locus_tag="LDBPK_100320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858823.1"
                     /db_xref="GeneID:13392209"
     CDS             122945..125242
                     /locus_tag="LDBPK_100320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858871.1"
                     /db_xref="GeneID:13392209"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:E9BA80"
                     /translation="MSTNAQELVRQLTENPEVLESMQHMISLLRANPPRISGSSNGGG
                     LGSVETNGPERGAQQCVRPPRSEYGTDADYGHHRPTTRRKLHSSDGTGHSATSLSASS
                     LTQEAHSFYSDDRVGARTTVSGHNAATGGASSPTPTFVATGSRAAPQVVAAASRLAPR
                     RSSLLSTPHEHRPATAPDEQLMATANRLTEAQRRIAELEKELQRTTQRVDQLSDVVQR
                     QKDELQATKDRHALEMEETRHAYNAVIHRKDEVQEEALRQLLKSRQLMVSAAKYEAVV
                     AAKKFHAQQLEKENNTGADDGTGSAKGLAGVQASSNPNEHGTHPGLAPSQTSVNARHS
                     STLGHGSGATAKYNSALKRDRQNDEEDFVDGAGVATGAQEPGEARYGEATHQRPPMKR
                     TALDTSHLQGSADRAVEGRRGVVATKAETSPAYITTPTPVGKASTALVDPRTQSRSAR
                     KRRTPRTPSRTNAERLAGSMAENRIRSQQRLPGTASLKIESPTPVVSTAWTADRSLTG
                     SCTPPPSSAGMYTVSEAVTKHHQLHPQQHVQQAPSTRPPLMQRAAGRLPPAPHRTAAA
                     PTAVPNTRSGTSSIASGGPTRSPSPVNPKRGAMLPRRFIFTGLKDHEPQRLVSAIAAV
                     GDDAAALASDLDEPPPSSTTHVVLRGTPRSVKALCGVVSGKWLVSPEYVYNSQQSGFW
                     LDELEEGGLRIFPPPLKCQRFLLTVEHPSIRAKLAQVIEYGGGEVLPSGSDKRGPSAG
                     DNVAQDVIVITSGDDLLRYATQDRV"
     gene            <128002..>130413
                     /locus_tag="LDBPK_100330"
                     /db_xref="GeneID:13392210"
     mRNA            <128002..>130413
                     /locus_tag="LDBPK_100330"
                     /product="protein transport protein Sec23, putative"
                     /transcript_id="XM_003858824.1"
                     /db_xref="GeneID:13392210"
     CDS             128002..130413
                     /locus_tag="LDBPK_100330"
                     /codon_start=1
                     /product="protein transport protein Sec23, putative"
                     /protein_id="XP_003858872.1"
                     /db_xref="GeneID:13392210"
                     /db_xref="GOA:E9BA81"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:E9BA81"
                     /translation="MVIPMSCMYTPLHLIEPSHLVLGAAIDELCCANCGAFCSMHSQR
                     EMGKYWVCVSCKRRNSFQSNTAITEQHPALMYETVEFVLANPPTPVVAPPQPQPAPAF
                     IFVVDTCIPSGEMASLRTSLLESLQYLPRNALVGLISFGATVSVWELGASSGVAISKC
                     YLLRGNTANPPDSLQSMLQVSENHPVRGRLLAPLCDVEAALTSLIEELEEDGAAVPSS
                     KRPLRATSTAVEAATYLMEALAPPQMTAQQQYVLYGKHVKAATAPGGNVKMGKILLFT
                     GGPCTRGPGAVVSTDKADMMRFHRDIIEGDTPYYEAAFNFYNALEPRMIAANTCLDVF
                     AQSLDQVGVMEMRRCIDNTGGTLIVEDETTDIMFLESLKRYWQRCDLRAGTERALAAA
                     QEGMSSSGVDGSYSSEDHRAHCGFAVHMEVNTSVGTLLRGALGPCNVDVEANKRGPTR
                     LTSPLEVGAGGTTRWCVSYLDKGMTLSFLFDTATASSQQSGAESAHEKRFIQFVTRYT
                     TPRGEQRVRVTSVVQPVAPPTAPPDYYTKAAAFDQTCAATIVARMAVSILEKHPGKWD
                     DAKRWLDTLLVRFVRRYSTFSPGQPNTLRLDPCLSLFPSFMYNLRRSEYFMVLNISPD
                     ETTFKRHWLLRESVDNCVLMIQPTLDSYDLASPFATPMQLDSSSLRHDNIVLMDAYFN
                     VHIMWGSIIYQWIEAAYHENPEYANFAELLEAAERDAQMILSSRYPYPRFSRTDADGS
                     EARHVKTRVNPATNYHNSGMQYGAGPNGAVEQADVIYTDDASIMTFMTSLKKAVVTSD
                     GKEEA"
     gene            <133569..>133787
                     /locus_tag="LDBPK_100340"
                     /db_xref="GeneID:13392211"
     mRNA            <133569..>133787
                     /locus_tag="LDBPK_100340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858825.1"
                     /db_xref="GeneID:13392211"
     CDS             133569..133787
                     /locus_tag="LDBPK_100340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858873.1"
                     /db_xref="GeneID:13392211"
                     /db_xref="UniProtKB/TrEMBL:E9BA82"
                     /translation="MARRRRLSSWAASLVLPCTAQPLLRDHGPTWCDGTAPLLGVHER
                     IANLAQRCWWRRCLASFPPFRECCASSY"
     gene            <140201..>141508
                     /locus_tag="LDBPK_100350"
                     /db_xref="GeneID:13392212"
     mRNA            <140201..>141508
                     /locus_tag="LDBPK_100350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858826.1"
                     /db_xref="GeneID:13392212"
     CDS             140201..141508
                     /locus_tag="LDBPK_100350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858874.1"
                     /db_xref="GeneID:13392212"
                     /db_xref="UniProtKB/TrEMBL:E9BA83"
                     /translation="MGTTKASGPADTSTCGAESGGRGITTTLCASFELPLRLQSTDGV
                     AVAVAPSGDAAFLQNILRDKTDWPAAQKHREQLSAVMPEMDVVGCYVVCAGSRWTSTR
                     HQSGGDDRDGSRLSVGGAVKKAKGEAMAGADSIAAIANCVQQQLRNTSILPSTATGFV
                     LLVVYDKEVTSAAGDTDTAVPNPPHSPAAARLPFDCLYVPATTDSDALPTEEVTVGPA
                     DMEWIALANEAMMPAYHQNSATTSSAAVKPGLLRRLCSAAYLTSEAPDSREPASTQTS
                     RMASSQNCRAAEELVGSLRLIMRMLVEMTASTPSPTATAPDDVELLRTVATCLRNVPV
                     SRPSQPPGGPRVPSALPAEEVLSAVLALEVQCALRMRSLSKAQQQLLSSRRSAMTALH
                     SKACSPKAANPPPPPPPTAEGWSTHERDKRSGVNTAVPGHVWE"
     gene            <142927..>145164
                     /locus_tag="LDBPK_100360"
                     /db_xref="GeneID:13392213"
     mRNA            <142927..>145164
                     /locus_tag="LDBPK_100360"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858827.1"
                     /db_xref="GeneID:13392213"
     CDS             142927..145164
                     /locus_tag="LDBPK_100360"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858875.1"
                     /db_xref="GeneID:13392213"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BA84"
                     /translation="MAEFHGSAGREKDGGDGAAEVGSLCSGVPGPMVSGEQKPPITQG
                     SHRTKADGAIVHPQAESLFAACPWVRLVPVIGDALEGYGPRLIASVCLAYFLCKGVAD
                     QMIGFSRQPMLMRRYGLDATRYQRLAAVWGAGWSVKAFIAALTDTFAFMGYTKRWYML
                     LSCVMGAGFSLGYALLPAQPSSGAPAAVFIFLTTLGKSSVDILSEGHYSRLMRRNPRP
                     GPALVSCVWLSIFTGALIASVMQGPLSESGKVHVGVMISAALQFVAGILFVFNWYGEK
                     TNRAERLQDLRDAKAALAKACAKTRLNSPSLDVKAAALGEDLHLEGQNSSPPPQTLGK
                     HTHQLQRSFLALDDDMLDLSTCDGVKGTHEQQRVSALRSDVVAAEESDNDETVGEDLR
                     IPSCLFGVFEINTEVVQYNWRAVLYSTVMTCSVVTLVCVTILGTAWELMYMSIAISIV
                     CCAFAFFALPPVIAKAQVFFYLNSLLYLQLPGALDSFYLADASCVPGGPHFSYVFYNT
                     ISAVISNIGGVVGIVLFTNIFSKMSYQVTMCITVSLMAVASIFDIIMVERWNVYMGIP
                     DHAMYLCGDAIIYNICSMLSTMPCTILMSRLCPRGSESMVYALMSGLSNFGQTVSTAV
                     GSLLMETRWPLDTNSVPCDFSNVRWLVVTGHLCCPLLIVPLSFLLLPRSRICDDIDVN
                     GHAIHAPLRAELVRVGLSEQRISTDKDCFNSNANAPDAHLTDARASDPHQLTDVNGAV
                     RRVVK"
     gap             146641..147276
                     /estimated_length=636
     gene            <149726..>151801
                     /locus_tag="LDBPK_100370"
                     /db_xref="GeneID:13392214"
     mRNA            <149726..>151801
                     /locus_tag="LDBPK_100370"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858828.1"
                     /db_xref="GeneID:13392214"
     CDS             149726..151801
                     /locus_tag="LDBPK_100370"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858876.1"
                     /db_xref="GeneID:13392214"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BA85"
                     /translation="MAKGQCEGQASPEEMSADPYRNDAAVKPKRFVHPEAAALFSKWP
                     WVRRVPMFGEAVEGYGLKVIVALGATNLLCRGVADRILTGQTYAMMIDRYGIDVARYQ
                     RLSTIATMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKEASA
                     DVAAAFIFLSTWGKANVDILSEGHYSRLMRQNPKPGPSMVSWVWFWIMVGAIIATVMN
                     GPLADAGKPQISIFVSAALQLITCVFFLFNWYGEKKNRVLRSEDALFILEETRKERDR
                     FRLPAHDEPVTGVPQHGGAAKGKRSPQRSHSDEDVEAVAVEQVNRDDVHVPRELAQLP
                     YEGDDDADADAAAEVYYGKPPVPCLFGLFEMNREVITDNWKIFVYSVVMTCAVIAMLC
                     ANILADTLGLLIACVVVSTICCCSSFWALPLVIAKANVFGYLQQAVYINIASPLMTFY
                     LNSYNCEENFPNFSYSFYNTVAGVIGNFAGLAGVSAFNCIFSKRSYRLTFCVTTFAQV
                     LGGMTDIVIVKRWNLYIGIPDHAMYIWGAAVVSEVCYMLGYMPMVVLLSRLCPRGSES
                     VVYALMAGFASLGRSTSASLGAIIMEYGLPVFKTRDDGYRCGVENLAWLLFVCNVCAP
                     PLVLPLTLLLPKARICDDIDIDGKALRRKVDAELMAGEAGDLPSLPSSAENPRATKAQ
                     DDEATREKV"
     gene            <156011..>156517
                     /locus_tag="LDBPK_100380"
                     /db_xref="GeneID:13389275"
     mRNA            <156011..>156517
                     /locus_tag="LDBPK_100380"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858829.1"
                     /db_xref="GeneID:13389275"
     CDS             156011..>156517
                     /locus_tag="LDBPK_100380"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858877.1"
                     /db_xref="GeneID:13389275"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="UniProtKB/TrEMBL:E9BA86"
                     /translation="MTRSQNQARTHEPSHDAGKAQNSAQGSQVTQKYYVHPQAAALFS
                     KWPWVRRVPIFGEAVEGYGPKVIVALGTSYLLCKGVADQILTGQTYAMMIDRYGISVP
                     RYQRLSPISSMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKE
                     ASADVAAAF"
     gap             156518..156616
                     /estimated_length=99
     gap             157365..157461
                     /estimated_length=97
     gene            <162754..>163668
                     /locus_tag="LDBPK_100390"
                     /db_xref="GeneID:13389276"
     mRNA            <162754..>163668
                     /locus_tag="LDBPK_100390"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858830.1"
                     /db_xref="GeneID:13389276"
     CDS             162754..>163668
                     /locus_tag="LDBPK_100390"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858878.1"
                     /db_xref="GeneID:13389276"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BA87"
                     /translation="MSHNEAAPKREKDAAGAAAVPEAAAAGNDGKYIHPEAASLFARC
                     PWVRRVPVFGEAVEGYGPKVIIALGGCYLLCKGVADQILRGQTYAMMMDRYGIDVARY
                     QRLSPISSMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKEAS
                     ANVACAFIFLSCWGKANVDILSQGHYSRLMRQNPKPGPSMVSWIWFWIMTGSLIATVM
                     NGPLADAGKPQISIFVSAALQLITCVFYLFNWYGEKKNRVLRSEDALFILEETRKERE
                     RLGTELMDDGTAGAQHGGAAKGKRSPQRS"
     gap             163669..163709
                     /estimated_length=41
     gene            <170745..>171935
                     /locus_tag="LDBPK_100400"
                     /db_xref="GeneID:13392215"
     mRNA            <170745..>171935
                     /locus_tag="LDBPK_100400"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858831.1"
                     /db_xref="GeneID:13392215"
     CDS             170745..>171935
                     /locus_tag="LDBPK_100400"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858879.1"
                     /db_xref="GeneID:13392215"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BA88"
                     /translation="MSYKEAAPKREKDAAGAAAVPEAAAAGNDGKYIHPEAASLFARC
                     PWVRRVPVFGEAVEGYGLKFIVALGASNLLCKGVADQILYGQTYAMMIDRYGIDVARY
                     QRLSSISTMGWSIKAFTAMLCDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKEAS
                     ANVACAFIFLSSWGKANVDILSQGHYSRLMRQNPKPGPALVSWMWFCIMIGSLIATVM
                     NGPLADAGKPQISIFVSAALQAITCVFYLFNWYGEKKNRVLRSEDALFILEETRKERE
                     RLGLEGVNNGTAGAQHGGAAKGKRSPQRSHSDEGVEGAVRDALNDGQRDNGELVQDVY
                     DDAYDDGEEVAEGEVYYGKPPVPCLFGLFEANTEVISKNWKIFVYSVVMTCAVIAMLC
                     CNILA"
     gap             171938..172036
                     /estimated_length=99
     gap             173032..173130
                     /estimated_length=99
     gap             176267..176365
                     /estimated_length=99
     gap             177538..177636
                     /estimated_length=99
     gene            <178404..>179465
                     /locus_tag="LDBPK_100410"
                     /db_xref="GeneID:13392216"
     mRNA            <178404..>179465
                     /locus_tag="LDBPK_100410"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858832.1"
                     /db_xref="GeneID:13392216"
     CDS             178404..>179465
                     /locus_tag="LDBPK_100410"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858880.1"
                     /db_xref="GeneID:13392216"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BA89"
                     /translation="MSYKEAAPKREKDAAGAAAVPEAAAAGNDGKYIHPEAASLFARC
                     PWVRRVPVFGEAVEGYGPKVIVALGASNLLCKGVADQILYGQTYAMMIDRYGIDVARY
                     QRLSSISTMGWSIKALTAMLCDGFAFLGYTKRWYMFISCVGGGAFALIYGLLPAKEAS
                     ANVACAFIFLSSWGKANVDILSQGHYSRLMRQNPKPGPSMVSWIWFWIMTGSLIATVM
                     NGPLADAGKPQISIFVSAALQLITCVFYLFNWYGEKKNRVLRSEDALFILEETRKERE
                     RLGLEGVNNGTAGAQHGGAAKGKRSPQRSHSDEDVEGAVRDALNDGQRDNGELVQDVY
                     DDAYDDGEEVAEGEVYYGKP"
     gap             179467..179565
                     /estimated_length=99
     gap             180113..180282
                     /estimated_length=170
     gap             180627..180725
                     /estimated_length=99
     gene            <183158..>185134
                     /locus_tag="LDBPK_100420"
                     /db_xref="GeneID:13392217"
     mRNA            <183158..>185134
                     /locus_tag="LDBPK_100420"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858833.1"
                     /db_xref="GeneID:13392217"
     CDS             183158..185134
                     /locus_tag="LDBPK_100420"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858881.1"
                     /db_xref="GeneID:13392217"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BA90"
                     /translation="MRHVPIFSEAAEGYGPKVVVSLGMCYFLCKGIADQLISYSRQPM
                     FMSRYGIDGQRYQRLAGISTMGWSIKALTAMLCDGFAFLGYTKRWYMFVSCLGGAVFA
                     LLYGLLPARPASADIAAAFVFLCSYGKANVDILSEGHYSRLMRFNPRPGPALVSWIWL
                     FIMVGAIVAAAIQGPLSDQGKQQVGVFISAVLQCVTGVFFLFNWYGERKNRVERAADA
                     ALLYEDLRKERVALGLLPAQDSRHVRSGKDDVVALVNGAPSGAAVGTKKNLHPENHLS
                     DEEGVPELEQRQREALEEEMRSDALVVGEEEDEELADDEYLPYEVPHPVPCLFGLFEM
                     NKEVIIRNWKIFVYSIVMTCSVVAMTCGSILADTLGLLIICVVISTICCATSFWAMPL
                     VIAKANVFGYLQMTVYLQLPGALDSFYLANAECLPDGPHFTYTFYNTVAAVIGNVGGL
                     IGVTAFNYIFSKHSYRLTFCITTVVQIIASVFDIIMVKRWNVYIGIPDHAMYICGDAV
                     VYQVCYMLAWMPMIVLLSRLCPRGSESVVYALMAGFSNLGQTTSSSLGAIIMEYGWSI
                     TTTPPCNFSNVPWLLLVGHIMLPLLVIPLTLLIPNARICDDLDVDGKAVKSAVSHQVA
                     LDAAQAEDGFEENTSSVEAADVAKKDLQAERKRA"
     gap             186520..186708
                     /estimated_length=189
     gene            <187184..>188953
                     /locus_tag="LDBPK_100430"
                     /db_xref="GeneID:13389277"
     mRNA            <187184..>188953
                     /locus_tag="LDBPK_100430"
                     /product="dihydroxyacetone kinase 1-like protein"
                     /transcript_id="XM_003858834.1"
                     /db_xref="GeneID:13389277"
     CDS             187184..188953
                     /locus_tag="LDBPK_100430"
                     /codon_start=1
                     /product="dihydroxyacetone kinase 1-like protein"
                     /protein_id="XP_003858882.1"
                     /db_xref="GeneID:13389277"
                     /db_xref="GOA:E9BA91"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="UniProtKB/TrEMBL:E9BA91"
                     /translation="MSAVVPKFIDEPSSVVAVAVDGLCELNNRVKKIENTNVVVSCCL
                     DPTKVLLLCGGGSGHEPAHSGFVAKGWLSAAVCGSVFASPPTAHVRAGIEYLAKLQGP
                     DGPGILVIIKNYAGDILNFEYAVRQARAEGIQVETVLAADDAVFGTKDVQKRRGVAGC
                     CLLYKILGAAAERGLSLTQLKALADRVSRNMRSIGASLSSCSLPGNPASSVMPSGTVE
                     VGLGIHGEKGLFQIPFQGAASLVHFLIGILMGKGEVGAPGKTTAIHAGVKALLLVNNL
                     GGTTDLEMSTLAHHALRELAAAQLTVVGVHSGRHMTSLDMHGFSLTLLVVEDERDLEF
                     MLNTNALQKPLMNFHAPQLSGATVPGPLTALQLARQEAEAAGRAAATPTGSPLCAAVQ
                     RVFEKLMTMETYFNGLDAEVGDGDLGSGVHRSAMAVLEMLPYLPWEADVRRTFTLISK
                     AVADAFAGTSGPLYGALLIGGGNAAAQALKSGGAVEAVRAALAHGSHDVQELSGARQG
                     DRTMVDVLEGMRVCPAVAAAATMPELLKACHEAARAAADATALLPAQLGRSRYMEGKE
                     VGKKDPGAELVVAWVEALAWESS"
     gene            <190928..>192370
                     /locus_tag="LDBPK_100440"
                     /db_xref="GeneID:13389278"
     mRNA            <190928..>192370
                     /locus_tag="LDBPK_100440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858835.1"
                     /db_xref="GeneID:13389278"
     CDS             190928..192370
                     /locus_tag="LDBPK_100440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858883.1"
                     /db_xref="GeneID:13389278"
                     /db_xref="UniProtKB/TrEMBL:E9BA92"
                     /translation="MRRVCTPPHGLGEGIQEPVPHKKANRNAVVPLDVVTSPPPAQAE
                     GQEHSSPSSVMLSCSSNDAELFCFPHLNGDAAPTSPPSQPPLTQERLLALQQSASDRN
                     LVALAPATTTALSTSERRTGTTVLGATHLGGDTDQVIRQRQERVMSWLAGSSTAPNPP
                     LDNADDGAIDAALRGSGVPDGSHTPPRLVAASVLAPDVASAEPLLPSYAGSAGVVLRS
                     PTCIERSSHSAVVPVWCAHDTRAQACYSAAERVEEGDDKTSSAARSAPLRQTRLLESS
                     RSCSGACCTPPRSSPHPWSPSALHTCDAQGAPVTASDWPTVSIARDSPRHTPTPLASV
                     LLPFPTSPTPRRLSVVCESTKDCFAPSPALSGALRDARNRVARREPPLALSVQEAVTA
                     ASAPRATSSHGDGEDPTALRVCALSGRTLRVTADRRSSVAVLAQRVVQYLKLRGAQVQ
                     LKYAQTGLVFDAGTSDISGVETCDGEHATL"
     gene            <194063..>194548
                     /locus_tag="LDBPK_100450"
                     /db_xref="GeneID:13389279"
     mRNA            <194063..>194548
                     /locus_tag="LDBPK_100450"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858836.1"
                     /db_xref="GeneID:13389279"
     CDS             194063..194548
                     /locus_tag="LDBPK_100450"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858884.1"
                     /db_xref="GeneID:13389279"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BA93"
                     /translation="MPCPPGSGLAVALAISFGTIVFLGGSFLYEWYTQRSEGGQAKEA
                     ETGYYRLPPPKDCAAACANAIEEDLLEQRLEFGGGLRRQDEYSSGRRSRRGMCVCCFE
                     RRQRFMFVLCRHICLCEPCLMQAARTYEETVLFGAFDGPVKMPCLVCRKVSYIVKIFA
                     S"
     gene            <197827..>198324
                     /locus_tag="LDBPK_100460"
                     /db_xref="GeneID:13389280"
     mRNA            <197827..>198324
                     /locus_tag="LDBPK_100460"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858837.1"
                     /db_xref="GeneID:13389280"
     CDS             197827..198324
                     /locus_tag="LDBPK_100460"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858885.1"
                     /db_xref="GeneID:13389280"
                     /db_xref="GOA:E9BA94"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BA94"
                     /translation="MALAFSAGALVFAGASALYSWYAQEKAQRDQGYYCLPPRDGDIA
                     VETGAAVAFKSSFLAASAAADGARETAAKDAPSHSPDALSEGCGVALSGEADGGHPCV
                     CCLERHQSFMFVQCRHICLCEPCLIQLGRAYEDNKLRAHFDGPVRMPCPVCRTVGYIV
                     KTYAS"
     gap             199141..199239
                     /estimated_length=99
     gene            <205475..>205726
                     /locus_tag="LDBPK_100480"
                     /db_xref="GeneID:13389281"
     mRNA            <205475..>205726
                     /locus_tag="LDBPK_100480"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858838.1"
                     /db_xref="GeneID:13389281"
     CDS             205475..205726
                     /locus_tag="LDBPK_100480"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858886.1"
                     /db_xref="GeneID:13389281"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="InterPro:IPR026939"
                     /db_xref="UniProtKB/TrEMBL:E9BA95"
                     /translation="MPSGNGCRANQRREREMKKAQSAGVKHTSEDMKKHEQSKNAIQC
                     KVCLQGFPRTVRRPELEQHFEKHAKIGKCFEEVFPDFTE"
     gap             206109..206207
                     /estimated_length=99
     gap             207240..207338
                     /estimated_length=99
     gap             209548..211061
                     /estimated_length=1514
     gap             211669..211767
                     /estimated_length=99
     gene            <213241..>213495
                     /locus_tag="LDBPK_100510"
                     /db_xref="GeneID:13389282"
     mRNA            <213241..>213495
                     /locus_tag="LDBPK_100510"
                     /product="GP63, leishmanolysin"
                     /transcript_id="XM_003858839.1"
                     /db_xref="GeneID:13389282"
     CDS             213241..>213495
                     /locus_tag="LDBPK_100510"
                     /codon_start=1
                     /product="GP63, leishmanolysin"
                     /protein_id="XP_003858887.1"
                     /db_xref="GeneID:13389282"
                     /db_xref="GOA:E9BA96"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:E9BA96"
                     /translation="MSVDSSSTHRHRSVAARLVRLAAAGAAVIAAVGTAAAWAHAGAV
                     QHRCIHDAMQARVRQSVARHHTAPGAVSAVGLPYVTLDTAA"
     gap             213496..213540
                     /estimated_length=45
     gap             214704..214802
                     /estimated_length=99
     gap             215906..218104
                     /estimated_length=2199
     gene            <220588..>220848
                     /locus_tag="LDBPK_100520"
                     /db_xref="GeneID:13389283"
     mRNA            <220588..>220848
                     /locus_tag="LDBPK_100520"
                     /product="GP63, leishmanolysin"
                     /transcript_id="XM_003858840.1"
                     /db_xref="GeneID:13389283"
     CDS             220588..220848
                     /locus_tag="LDBPK_100520"
                     /codon_start=1
                     /product="GP63, leishmanolysin"
                     /protein_id="XP_003858888.1"
                     /db_xref="GeneID:13389283"
                     /db_xref="UniProtKB/TrEMBL:E9BA97"
                     /translation="MKTAGTQRVSAAAAVALEHTRARARKPIGHITVCLCVCPCTGIP
                     PSQRRGCCRLTEPHTHLPPTQLHIPSVSRPFSCSTLHTHSGA"
     gap             221193..221319
                     /estimated_length=127
     gap             222921..223197
                     /estimated_length=277
     gene            <224849..>225082
                     /locus_tag="LDBPK_100521"
                     /db_xref="GeneID:13389284"
     mRNA            <224849..>225082
                     /locus_tag="LDBPK_100521"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858841.1"
                     /db_xref="GeneID:13389284"
     CDS             224849..225082
                     /locus_tag="LDBPK_100521"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858889.1"
                     /db_xref="GeneID:13389284"
                     /db_xref="UniProtKB/TrEMBL:E9BA98"
                     /translation="MRDGVHRFGPRGLARCVDCVEGGGRQCSAQTRTQSKARSHSRLE
                     RRPSRHPSAVAVRVAVGPLAPRCAAHAITPAAV"
     gap             226579..226677
                     /estimated_length=99
     gene            <234712..>235878
                     /locus_tag="LDBPK_100540"
                     /db_xref="GeneID:13389285"
     mRNA            <234712..>235878
                     /locus_tag="LDBPK_100540"
                     /product="mitogen-activated protein kinase 3, putative"
                     /transcript_id="XM_003858842.1"
                     /db_xref="GeneID:13389285"
     CDS             234712..235878
                     /locus_tag="LDBPK_100540"
                     /codon_start=1
                     /product="mitogen-activated protein kinase 3, putative"
                     /protein_id="XP_003858890.1"
                     /db_xref="GeneID:13389285"
                     /db_xref="GOA:E9BA99"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PDB:4O2Z"
                     /db_xref="UniProtKB/TrEMBL:E9BA99"
                     /translation="MHKSNQELSVPKIVGDFKVYNVSGSPFEVPSKYTLLKILGMGAY
                     GIACSCLDGDTGEKVSIKKCRDVFRDVEDGKRVLREIDMMRFFHHENLLNVVNILPPL
                     KREYHSFEDVYVVTPLMDVDMNVVLRSRQVLEESHMQYFVYQILRGLKYLHSANVAHR
                     DLKPANLVTNISCELKIIDFGLSRSVDVPYSELTDYVITRWYRPPELLLENTNYSTAV
                     DIWSVGCIFAEMYNRKPVFPGRNTMDQLRMIAQHIGKPPASIVEHREALEKLNELPDG
                     SLNIPKLVPGLAGNTEGIDFLSKMWTLDPSKRPTAADMLAHPYLAHLHDEEDEPTCPC
                     PFLWAHESTPMGVSELRRAFWADIVDYNPSLEQATPPVTTAGGSSSKNGSGHHH"
     gene            <240719..>261115
                     /locus_tag="LDBPK_100550"
                     /db_xref="GeneID:13392218"
     mRNA            <240719..>261115
                     /locus_tag="LDBPK_100550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858843.1"
                     /db_xref="GeneID:13392218"
     CDS             240719..261115
                     /locus_tag="LDBPK_100550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858891.1"
                     /db_xref="GeneID:13392218"
                     /db_xref="UniProtKB/TrEMBL:E9BAA0"
                     /translation="MALAFDGRRARWRRNGRLLSLLLACLCAALAVVAPACVAITFSM
                     ANVQQPSVYQTIQITLESNPLAQDPSITTSDLVFFVPSDDIKKCVYSSTPTESTPGYH
                     AVKATGSGGFTGQLILAVTSTEFTTGTTYYPCYLSRSEKSATIVRRGYVSPGSDDTLA
                     VLPPIYTSFSMSPTSANGGEGPVSLTIVQAEHSDRPINQGLSGGHTILLVPCGSISVS
                     GSTVESNCDDLNTLVTPCATVGAASETPTGVVALSGLQGQSTGKVSGNFTVPYKPNTS
                     GYYMCVPYCYSASAGCGESTTAMSFTVVASASAESSSYVLTFGGANPGVYSRTPVLPQ
                     ARENGLMYFTGAGLSASDAVKVIRAHDMCTSTTAALLPNLEVGALQLTAETDGMTTAQ
                     VLFVAPDLVATQVVGRVCYQRAASGLWSTAYLSALNAEADFTIDILQPTEFELTSSST
                     SPAVGETLTLAFRGDGLDGSVDKAYLSSSSDGNPCNRDASGSSSSSSSSSGSETYKRN
                     MYFTCKMSGSSTTTSTCTVMVDPEDTNAAMTLSVCYLKGGSSGQTNFAQVHGTVALQA
                     RNPTYAVTPYPMFAGQSVKLAFTGVSLHADDEVRLIAPSGTCDDSSSILATATIHSVE
                     EIVQNVVYQYTLVGSAETCIMVCYRHLGSDMWVVARGADGRPAVSSVCAASNVYISAF
                     PVRYRITNLGTGGSDGSTAGTLLTVGETATVRFTITSAQRFSSTTTPTTIKVVQAADT
                     CVTTPCGTENVAACARAQRAADYTDSITKTSSAAFTASIQVNGADVNYIVCVETSSSS
                     GAYVPVLPTSETSSTSTAFGFITTQQNPTLVSHTPNTWRVAMSTLYTTFRGSNLDAKT
                     NVVYAVAASALLAFYTASEGTVVAVCPPVPQTPETVLVSAMVTNSSSSSNLAMVTYTR
                     ADRLHDGQYVYLCYAWSAGSGDSHITMAGRVSVAAAIPSSSAWQAPTETSNLRAGQPI
                     QLSFTSNLTSLSAMKDAVYFYSYVQSSNPNPNCYCDPTACATGMRIAYTSNITFTSAT
                     TSIKDDTTIYTAPLGFSNYDYGAIYIICYATFGQAADTYMGRVTVDLANPTYYTVSSV
                     AAPLNRVGAPITITAIRRCMTAACALTLQDSLRLIPSSVQCSQLSSDSSSGSSSAAEE
                     ASVQAIRDPVLNPGAVSLTRTFVVDAEGTYRVCYRLASGTTYSDVVFSTSYKRSLLTA
                     VTANPQKATPVPSVPSAGQFVIMNLSCTMVSLCSTCTMLRLVPGVRASCWEKVSGTYS
                     SDSCLTTTSVQYPDLYLVEGSYTVCYGSNYTTSHRVPGTLTVTSANPSSYTPTESSGY
                     AVYTNQATDYTLGITGTGLATADTAFLLPDMGYTCHDLRTGEVQSQGKLASWLQPSVK
                     PYPLQLTSAGVSWVVSNQSKRFGGGLLNDADLCPGNGAPCLLKLCYMRSGTSWAPVTL
                     LASSSSSSTSSSLSSTPSGIELFASNPSSVELDRYPLAIGMYVMATVQGAGLLSTDMV
                     TINAGDCSGAAATVSVAGAVYVNDAGKQWYGVLRVKSAASSYAVCYWRSGSATEVAAI
                     TFADATDVSTILILSTPLYYVLSPSNFTSMHTPLTRYEELIVSASFMDQGTLGTALSY
                     VQLITADASVSECNYGPFQSVASGVTPFPVSLTLSSVPGSGASGSLTLYQGRLTVETG
                     AYALCMNTTIGLFRVFKAPPSAAYTTEGSSEVLVYDAVPIAYTAVPKSVMLGQVVALT
                     FSSMSASSSDSEIDQAPAKLEAGDSVQIIDGTLYECGFPNATVLAAGVVSASGSSMGS
                     TTVSLALPSAYKLDGVGVSAGGKNYTVCYRKQKSTFATSPRIGSAVDRNFRIMAEVPT
                     KWTTQPQQAQVNAPLNITFYGDLEEDDFLTAADVAFLVSVPDGAEPDFSLCHVTADSS
                     SSGSSSASAGRIVISQGAMTKPDNVNTQWSIPANVLLESTYVVCYTAKNNGQPVYVSS
                     PATLVVYPTQSPSGAYLARSATSIVNDLTALQGERVFLLFNTTVALDVVLDNGQSSSS
                     SSTPSLENYDAVRITADSACSAPLGAGVIDPIPTDFGYAPPGIVDETTGLTVPYLNLR
                     IRAEVGSYYVCMRRRNRESWQAYYEFEVVGGLYVGPAVLSISAAAVLTFTTTPTTPRA
                     WVPHTEVQANYNADFSMANVVQFFFVAYTGTGSVTDSDEINGDSCYRPASSSEAASAS
                     VTLVNRTLQVYLVDPMFTQHSFGMAGTYLLCYQITGHNIASIYPTALTVADPSPTAYI
                     VPSLLSVQHAFTMSIVAMDAIFATGASNVAQIYTATDATVMPNCTEASVPSGGTTRFT
                     KFTQTNASYASVEPTLLAPGYYFLCFLTDGQKKDFVVPNAAGGYVFSVGLVGAQKYTV
                     TPSPAYLGQLLDIKITGSQLSSSDHVKLLRVSHDELSSSGSTTSSGGSYVAQCTPNSE
                     NADASEAAGAAGSTVQSSSGTVAHYHPRVNETGTFILCYQSSLLSNAWVWVMDIHQFT
                     VGLAHPTHYSLSVATPYETQVLLLYIHDSGDDGSGTAGRLQDTDQLKLVERGSGANGF
                     DCAAGATNSSVIGLISYVSAQSNSSVHVYQICGSAVASVTVCYALSGATAASPGWAEV
                     PLQSPPPTYIFEGVSIEANPFVGPLRSSSSSASGTATGWVAPRPYEPFSFYFTTEAAG
                     LEAQRVAFAQSPVTLCALDVSYVAPLLYQKDPEQASEFTVSLPYAGNYAVYIGPYAAV
                     TAPNITHGTPLLVGQCDPCNFTPSYALVGTYVLLSFPSSVGDSLGDADEVRLFPVSQG
                     LKGRPCEATTGAYAGVTLTPDSALSTSSMTVFNVTTGAEAEAKYLGEYYVCYRKVSAS
                     SASAGSSTATFAVVSKNDGAASIFSVYPADLLTATVCPASSMYALETAVFNVTARDTA
                     LYPNVAFSSSDVFVVVPSDVLSSTVGGGCGSITDVDALVEASGGRAQLAKLDTYGNGY
                     SNWYLTFATQMTTVYYSWCFKMQYDTLFRNISSSLQTVLMENPYKVITTPPVILPTSS
                     PVLIDIKGSEMLPTDQVYIVPANQSCSETCSLPLKPTEWPDVAHTAQHVNSTTALVTF
                     SKPIDVTVSLGVCYRRTGRYLTRLANITVMESNPTSYTVNFVPRVGTRPTLVFTGEDL
                     TGTDTIMIVKPGVTCLEGNAVATGTFVSVSEDATTSQFLLALVGNAVLAQNYIVCYEV
                     STVGAYVEVSPVLQVLEGGPSSVLSSNTPMRGRATVLTVADPQVGDEMYIACVGCSCF
                     DEVEAAVPYGSVRATAHVLEGSTSSASDVVSISLRVGFNDTKSYPVCYRRSDSGYAQI
                     GGTAYFVTPVPNSPSAVAQLPALAQYQGQRLYYNFSDYTAAVPLGSGDLVMLVQAART
                     CWDNVEMNASGVVVQTSELTGTVESLSIGRWEAHVPSLGPDVPSNAPALFPLSYLLCY
                     REVAQLEYVSVPLEMQTTVIKAADPATFETNPKTVEKGMLDVNMMFSYTDTGKEGDEA
                     YVVQFTSLTNTVCDDARSTLVSARGRAHPVYILNMSGGAVVGNDNTAVCYTRAGATVA
                     EVPQLLTVAESNPSGYLTNVTTGSVARGRQYIEFVIVGSGLNVMSDEVVFTDVPCAMA
                     PRPFKSSGHLARLGDAAANGTTYSVVTQFVSLMSPIDVYVCYQHNAVWREVGAALTLN
                     APQPLTVLVISADGTQTTPRAGQHLHLQLIDGMPTVPIGAVVLSAETTGEGTWCHNFT
                     AANVQEPALDILSEAILDVSVWQVSGHARLCVRYDDGTPWADVATSVDATSIYINPAN
                     PSAMDVFPSPPRVGQSVTLTFHLLVPSNAGDMVKITAPTYEACEMAASINGFPPVMPV
                     TVKDSATTTLTLVDSTDPLLYRSFNATGTYRVCYYSAAELSWGVVGGTLAAGSVTVEE
                     LVPQSWVIASGHTEIGYEFALAFHDELSILKPSSGNDLVWAAPSSVSCGANPYMCRGC
                     IIFEWNASLSNSSMAVTAANATVSVDYMNLCYRLAEATAALVAGSLNITTGPIQCVEE
                     DSFISGQQQLITFRLDAGTDVTDDSWRLSFYATTALHCNDRYLEGFIPGSARLQEVTS
                     TSATYLVLWPVGLGVTTREYTICYTHNNLVGPVCTCGQIDANTGECYITGSPGSPQSF
                     TPSPHPTYVGQSITLNFTVNASMTAYPPTAIKFVTYVDELTGCDGAPAFTPVGATLTK
                     ISALLYMYVFKHNYTLGTATLLVCALTDLSTSYGRVASVVVPSSPTTNNTLWIRPYLG
                     LTTFPSEADYLRSMQTLNLTFTMASRQEDDVVSKHDRITVVGDPNNCIESYISAQDPL
                     TLMSMFYLPDTAFLALPATVLSVSVSLFLTRSLATFAASTASQGTHYFCYKLGDGTWA
                     PILPKLTIQEALIGSCSVTGALSPSNGDNGESSGSTTNNGGSLRAMYYAPTQILGTAL
                     FERLASPSADAVRVVPQSEWCTNDAAAVFTIAVASGSSSSLSSGSGSIEAVFFAPLQG
                     AYKVCYRFGTSTNWSPACTDLSVTDPSPTGATTGCWNVGQTMNMTATHVIRDYVFTAS
                     DHLRLVQGALPCRHSNGSLTVSSETVTVGDAVQPAYGILLSDVVAGQTTYMMPPAFFR
                     TGTRDVRLCYTDASGNQFTVPLDFVGDPGKSLFPVQARQPSSIVFPQRYIQVGQRMFM
                     NFTSASSSVTPPLHPYAALPQLYTPGPAFNGTFDGATLLAVSSSTAYIDGRCAAALRA
                     GTLTNTSFLGVYGSAAQSGESYVPYTIGNYDPTVAQHYIACYQLATCGVVDSGDPFRV
                     HNVNPSSVYTDVSTPRRGQLIEVVFTRDTAPSAVALSPGSDRGIKQTDLASCWTLTDI
                     SGQLVQGTSDLTHFTSIFYAQAPELASTTATRSCYKLSEGSWSEVPNGVTSVLAANPK
                     NFATHPASARVNQVNYIQFYGTGLGSNDRVKLITRSLNCSEDSVPPSSLAAYKATEPN
                     SATAGTSEGWKVTEVSSDGLTARLNFTSSSTGTLSVCYRLDADTVWTLVYGDLIIYER
                     NPPVVTRTPVTTLEGELFTLNFTGSTEGISDLSSDDRVVLYYGSAVNCVAPTTDETAP
                     SVTASPSRTDMLPQSIAYQLDMGTRGNYTLCYKVSASNVPGGYVVVWGYDVVVVAPNP
                     QNMTLYPVRAPSVHRPNELLTHVFAGWALAATTEKMDSVKLIEASASGSTTDTMCQKN
                     SAAAAITYYSLYANGTHAEQVWRASPAGMHVPFSVCYKLYGGQYHVIGDTLTITGTAS
                     PSGATSAKLSGSSTTISSGESMSWTLVGADAQSCADNEALIFFSANGCHNAPYYVNMS
                     AILSSSASIAITFPAGAVVVSNCSGMTQLRVPWTYPFDAGSVSAAASSRTALLSLCYW
                     STGNDAVSVLSSDAITLSQGVPPPLDMTLSVTAQEVFSFDLSVSPATTDWVVLVADPS
                     SCVGVSAPADDADFTDLNFSETTGVATVTAAVPGAGMYYVCYSHQVGVCGASTGRECA
                     RVVAQVEARAASPQRWSGQPTPVYVSSSLAITLDFASNGDASAQGTTASAWLAVMAAE
                     KLPHTMRDVWVACVQSQTMKSLRYGLTYSSASGMWNTDHILVRSGPYALCYTAQSTVE
                     AALHLFGPVSNAGPVVLASTVAGVDLPPSMAVTNVNTVVLTGGGLSTTDVVMAVALPS
                     SSESGSASAATEVPSDICTNEAYKPRVNSTNPSPAKSTGMTSMLRELVFTTTGDYVLC
                     YTATYGLTTSDSDASSDSESVTGTPVLITPKAFTVSPSVISMTVTSLVLEVGVELHIV
                     FTGSGLMVSDMAALAYVGSIEGSPTVPTVCLGTSVIYENMVSVNADGTNANYKTTPVK
                     QGVHMVCFRKSLSTTPILIPTRLCVGVRTAVQAVFTVQPGGCTALLVCTVQPTITLLN
                     ASGLATSAPHSSVNMLLYLSDGTTPAPAGQLSGGTVYSHVNFTNFTFWALRVSTAGSY
                     VMKASVTLPGGDTLAATSSALKVAGGGEPVVDVAEVSCLPVGILDRTVGSTTDTVDCL
                     ITALTSDAPNNFTVLVNAGMVSMVTRNGTTSSGLSTYNFTVTAPATSSSATGIVNYMS
                     ILVTPIPPYETLPVQNSPLTVRLATSPSALTAIGCSAGTSQLPLSNMVRVGGTLMCYV
                     QGIAKIHGQAREIVARPEDLKVSNYYNGDVSTSAAVSLGAYPLDVNGRYNFTVAPTTG
                     LNISVAGTVFAKDDADSPSSGATSAWAAMANSPQSFVLIGVPTAAASRLMCTSTRTGS
                     MTWYTPTEPLQCTATLANAQGPVNGLQSEYSVLLPDGGSVSGFDELAWGVSLVWKLAA
                     PPPPPSSSSSLVSSMKSVQQQQQQAYAARAVIDTLAAAVRRGFSVQVRYTPSIKVIAT
                     YAGDLVYVTSFVKTVPRLKQGATVSVTFAGIGLVTMHRYTLGAISNCSSVLSEASSME
                     GGAAGQLVLTFEVPSSVFIICFSPQDARTALQPLLATQWTPESGDPSSSRWTRDDLVL
                     LIVGVVVLFILVVLLVILLWCIFCGREEDSEDNIVDEEHLIMHHAPARMTTIACKAGG
                     SGQNVYMPPRANNRYVLRISNESLPAALPSPVPLPIVTSSTSPPPPPQQQQQPSPPVA
                     PPQQQHPQQHPSSNTQIRINIHDGDGAGNASPRAPRSQATTPAAATSVTYAGGSDSAP
                     PPATMRKRHHHRSRRSSSASSDHRSHQQHRSNFKYADVDRAAPRPRPPSDSSSFTGTS
                     ATEIRQSVPPLPPPPLSSVTTPSTTVPAPSANSGLVESPRQAVSTPTADSVPKNLPPL
                     PPPPPPTISLASAMAAQAPSPGLYEHLHHTTSGMTVPGTVDAFGTGLGSLGPCRSDNG
                     ATEVLEPIIVPGHTSKPMVRSASSPR"
     gene            <263083..>264186
                     /locus_tag="LDBPK_100560"
                     /db_xref="GeneID:13392219"
     mRNA            <263083..>264186
                     /locus_tag="LDBPK_100560"
                     /product="glycerol-3-phosphate dehydrogenase [NAD+],
                     glycosomal"
                     /transcript_id="XM_003858844.1"
                     /db_xref="GeneID:13392219"
     CDS             263083..264186
                     /locus_tag="LDBPK_100560"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase [NAD+],
                     glycosomal"
                     /protein_id="XP_003858892.1"
                     /db_xref="GeneID:13392219"
                     /db_xref="GOA:E9BAA1"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BAA1"
                     /translation="MISAKRHIDTNELLHLNKAVVFGSGAFGTALAMVLSKKCREVCV
                     WHIKEEEARLVNEKRENDLYLQGVQLASNITFTSDVEEAYKGAEIILFVIPTQFLRGF
                     FQKSGSNLIAYAKKNQVPVLVCTKGIERSTLKFPAQIVGEFFPGSLLSVLAGPSFAIE
                     VATGVFTCVSVASADINVARRLQRIMTTSDRSFVCWATTDTVGCEVASAVKNVLAIGS
                     GVANGLGMGLNARAALITRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRN
                     FTVGKKLGKGLSIEEIQRTSKAVAEGVATAEPLMRLAQQLKVTMPLCQQIYEIVYKKK
                     SPRAAIADLLSCGLQDEGLPPLFKKSAATPSKL"
     gap             264919..265017
                     /estimated_length=99
     gap             265940..266038
                     /estimated_length=99
     gap             267390..267488
                     /estimated_length=99
     gene            complement(<269433..>272153)
                     /locus_tag="LDBPK_100570"
                     /db_xref="GeneID:13392220"
     mRNA            complement(<269433..>272153)
                     /locus_tag="LDBPK_100570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858845.1"
                     /db_xref="GeneID:13392220"
     CDS             complement(269433..272153)
                     /locus_tag="LDBPK_100570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858893.1"
                     /db_xref="GeneID:13392220"
                     /db_xref="UniProtKB/TrEMBL:E9BAA2"
                     /translation="MLRIILQRLAVQRRIAEQLEAVPLDEVLRRMQSSSLTNPARSLE
                     AHFVLATESRDHERAAPTAASPCAETLREPSDDLLRDALSERLLAEVRRDLSSPTITL
                     DDGGLMLANCLRHGLSPLATQQVFALWQRRMQHATIGASSAAAPRTSISMLGMGKSKT
                     AFARAGGGAAGVSDLAQFQSLVRVMEACLDAHDKQQREFGRSRKRTSSAAAADARKLQ
                     SKSSIAFTLDDLAALVDTVEQHWKLFIDHGTSTTGLLVQFTALALVLTGCASSAAAEA
                     EPGSKFVNSLRRLSHLQTDRALLQQRIFSLCDRAIVSLCSQEEAAATGDGGIPSRRES
                     PWWYRPQELVRLSQAMRLIEVYEAEQQRGSRYSSGTGSPVEHSFHGEGDGPRRPGSSA
                     ARTSRRDAGKTMSSSSNPVRGTPPNRAQTAPALPKARWLLRLPTTWWPASSTSLHGAP
                     AGHRKTEAAVRARWRLGAYVTHHALQYTSTVTPPPVPSYAVSPTLASISLADVEDIFA
                     VVCATASSVASTEAVTAFSWWVRDVFFQPHRHRSLHDVQEMAGLLGIAEVCVAYPDGT
                     QTVLAEVLKCLQRSALVLWCVGDTAVTSGPDTPGMLWSRACEVVGDALALTTVRAEAQ
                     RTLRALAHTVSQHASSCIVTRKSSSELARRHQRYGLLVLACLQLQSPGGTITPALKRM
                     ILELVLSAPFRRDDADHGGPAAVARALFLFTRPEPALREPASTQGVPRWERVIPHLLN
                     ELTRLVSPAAAALDDGATAAVKDGGGSAQLLQQLTSAERQMLRSALQEVRLQTQHEMK
                     ERPLWEPVVAPSGSEACPGQAARTASLQLPLSLPVTAQVGVVSSADASTSSSDRQAGA
                     VDAKSGLSRLRTESHERTPRHRMRASEEHLLIQSEIDTLTRYLRQRRSPG"
     gene            complement(<272975..>276442)
                     /locus_tag="LDBPK_100580"
                     /db_xref="GeneID:13392221"
     mRNA            complement(<272975..>276442)
                     /locus_tag="LDBPK_100580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858846.1"
                     /db_xref="GeneID:13392221"
     CDS             complement(272975..276442)
                     /locus_tag="LDBPK_100580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858894.1"
                     /db_xref="GeneID:13392221"
                     /db_xref="UniProtKB/TrEMBL:E9BAA3"
                     /translation="MQHTSASPATTPQASPSPAHSSAAIEELLRENTALKARLQLSDE
                     QRVTQEVLREQLHRFFECVEAHEQASQRVLTDQRQDDGEKSNAPDDGAGVARPSFMSA
                     AVSEVLRRMQEEKQQAEAALAQLQSDTVAPLHAQLEAMEKEKQQLVARVAELEMSMSS
                     TPAPPLMAELRQLRETEALLRQQLQECQASTAATVGTFRSTVENGLLAARQVPELIHA
                     METIKENVRTNQTMQAAQRVLLEEMERRHAIEREIEETYRREETKVLRERIASLKDEV
                     SAAAEREAAFASERGAMEAQLAAAQDSIRQLTQQHSEEQVALAQKRQRAEQDASSNPT
                     SIRGELTKFWYEGRDRIRELERQLQTMHTAEANLRVSQGRVAQLEQRKAALLGNLAAL
                     AAEVDRRREEEKKLRAQCAGVEAERDRLLMSVAKTTGSHISETELRDCCRTIREAATR
                     VAAASATVVADPQAIEEALRRAQKLKSEVAQLQRQKDQLQRFLELHEDRVRALLEQEA
                     LLLVRDSKGGPATATSPQMGSNTAIKGAPESASTTAFSLPQFLEHIRQGANDVFLQNE
                     DAAVRAVRPGGKRGSNRHANASGEVSHDSSVTPHRDSFLSLHQQFVQSQERLLASHRD
                     LLEARNENRRIQAELDSTRSEHAAAAATEEKARRSLEAANAALTHRTTSLTNELQELQ
                     RHYTSAVTMVRTTLEGLSNVLQLYHQSELHAEKLREMVQQERRDMSDMLRREAASWSV
                     GTGTDGHTNAQEAQHSAAAERITAALRDMGAYIAEAVAETTRQATQDQTSYIGKLVKA
                     IQQQEERVQAAKAAFEASAQAQARSLADRISAAQQQWESEWKAKYQAMEAERMQSVMQ
                     QHASVVLQRALEQAVTTPAAASSAASPNSTASVPPEVEESAVHMADTLQVIRNFLAHA
                     RQRQAQQQEQLQKLEQLKLLQQQQLQQQQKQTVSAPISPATVQTAAAATSVAPAGAPA
                     PPASTATSLATDAQPPQSLTPPSIIATAKISNAGAELRTVSSSTVKENDGAETSTSSP
                     QLLSAPAVSAPATDSDALAAEHATREAPAENEEAEASTQEAEISGDSGPSAPWDEEHP
                     TSHPATPDAQLDETDVQAEPQESMEDATAGASQRGAEEENEEALPSPPSSGSEEGDEQ
                     EEKNSEEDA"
     gene            complement(<277712..>280978)
                     /locus_tag="LDBPK_100590"
                     /db_xref="GeneID:13392222"
     mRNA            complement(<277712..>280978)
                     /locus_tag="LDBPK_100590"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858847.1"
                     /db_xref="GeneID:13392222"
     CDS             complement(277712..280978)
                     /locus_tag="LDBPK_100590"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858895.1"
                     /db_xref="GeneID:13392222"
                     /db_xref="UniProtKB/TrEMBL:E9BAA4"
                     /translation="MFPPPRLWLVVLWIFVAAGHCACMAAEGKLQPPYTKPVIQTRHD
                     DAVHPESGAYASVLPVSLNATVADPFLTPATLMEGVRSTGKAITPQHIFTNAALRLVF
                     DVPNPGLDFVINLTSAQYPLLQDPNGTLWRSVLPSKIEVVKQSSKYTYDVGNLNLRSY
                     QSQSESVEVVAGAPAADAECFTLKACCAVNSSYYQKYELVDSPVPPYVCTGVPIPYLL
                     RHFTFGVDSTVKFREAAEGASCEMKANRWTEESATCTANLNAVLAGVTASPPHRLPSR
                     AFSLCRQGDNLTNSESGSSPIPVVITAFCSESRCIGYTPANYRSDRSTCLNYPLGFYT
                     SADENNTNQFSSFEDNAAAFWPYLFNDCKWIDDVTMSSPTTIQDISLQCDVPASTGWS
                     LSYENFSAHLTDTIAPLFPIGRPTRVAGQYASPTDKDTILFELEYVSFSSFKAGRWTF
                     RICTTRQCATSTVPVAGDTGHYPNVMRVNVSASKLGLSASPHEPAVGVEVYSATTPTT
                     SPFRTLLAPSVVYVDKAATPLSQDTVNMTLARDPPERVPSPYDASTSGRTTSRVLCEG
                     DYRFSTVTNNCQPLTDEDCATKYRGRRSKFDPVARACAYPVPPLNGPLVFKPLAEPKP
                     PRTYSPEELRAILKTVKLPQFLRTMEKSYEDYERQMARWEGRSVRFPPGRAAAAEDTD
                     VVAVAAADESAVTYINESPMPGARGLSVTCIAATCVLWTVALLRDVLEKLFGLGPWHD
                     QRRCAFFAGAVNCWHWLSGACAEGHNEARPRQRRATSNTTATPTTAQPSAPRSATQSG
                     QSGQHANPALQKRKGKGATFTADTPLQSTRKSPHGAPREPVTSAPFQPRDPTATPQRE
                     KQDGGQKRHLPRTHNSRDAEREHRQSVSAGTTGPASSWGDARHYVSAAHPPAYDVFGF
                     SEAPHAPFGSGAGFAAPGDMPFLGGDYTGQRVWLSDEGVGLGYVPAAFARPHSTSSHR
                     CHSCPSSPYPTSSPPSPEWHPFEDVYPTVPSPCYAPYDAPLPEFSLNPSSTSYPGFAR
                     AAPPSPFAGFDAFPPVSSVRQSSRVEVLSSDTDGAHGDNRAAEAPSPAGRTRRPNSMV
                     "
     gene            complement(<281806..>283101)
                     /locus_tag="LDBPK_100600"
                     /db_xref="GeneID:13392223"
     mRNA            complement(<281806..>283101)
                     /locus_tag="LDBPK_100600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858848.1"
                     /db_xref="GeneID:13392223"
     CDS             complement(281806..283101)
                     /locus_tag="LDBPK_100600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858896.1"
                     /db_xref="GeneID:13392223"
                     /db_xref="UniProtKB/TrEMBL:E9BAA5"
                     /translation="MPRNRLVVACNASTAGRPAQSLALSVSLSTTLRSSTALALTKSL
                     VNITTHRGSRHSLLHTAVRRYTNVLYRLPPTQTIPTHSPSGEEVDTELFVRQVQNFFE
                     VLRRSQLIERFYEMKSCPYYECLFTNDLFFQHHDLIIPMPKHGREHRSAEISETIRYM
                     RGWGATGDVNHVLQDVKGGRASGGDFISTTHGMLMGYGTSRTNKLSMMTLTGAIAPSE
                     AAAEQARALCVEPIEMLPDSPPLSDVIAFAGQRTFVISDTEHGHNAAQQAVKRIQKVP
                     WQIIKLEPGCSFFSHLGGVNYVYDVLCDQDFPLSMERLGESGMNPFPVEWSEPRKLGI
                     TMRSICMTARFTRGTMNAGGYANSRGHAASSFNYNSRDISKNSRLFVGGSRKHGDQMA
                     PLAAQLEADEIQKPVHQPIPRYAAPMHRRGTVVPTEPSA"
     gene            complement(<283716..>284831)
                     /locus_tag="LDBPK_100610"
                     /db_xref="GeneID:13392224"
     mRNA            complement(<283716..>284831)
                     /locus_tag="LDBPK_100610"
                     /product="zinc binding dehydrogenase-like protein"
                     /transcript_id="XM_003858849.1"
                     /db_xref="GeneID:13392224"
     CDS             complement(283716..284831)
                     /locus_tag="LDBPK_100610"
                     /codon_start=1
                     /product="zinc binding dehydrogenase-like protein"
                     /protein_id="XP_003858897.1"
                     /db_xref="GeneID:13392224"
                     /db_xref="GOA:E9BAA6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BAA6"
                     /translation="MSGQAGKQVAPVKCKGWSVEKPALQWSTDAVRLSDVTVPAPGPT
                     QIRVRVYAASINPVDWKRVMFPASGSGPGVAGSALKGFKGMHHKPPNYPYPYVVGVDG
                     AGEVESVGGKVTGLKAGDRVMFHSSLTNAHGGSLCEYAVMEESVAVPIPADGARPFSY
                     EEAAAIPCATWTAYVALFDKLRIEPGRSIFVDGASGAVGSCAVQLAHHMGLYVFASCS
                     PSNADYVRSIGADQVLNYHDGIEMIDQILDATEGYGVDYYLAVTNTQDAESFTDALRF
                     GGAVCLLSGVLIPNSNVLFRRQLSVHYVFLNGLHGHPLTRPQLRYIGDQVAKLYQSGA
                     FRLDVEVLPFAEAAKALDRSATGNVNHKKLIVQVASP"
     gene            complement(<285636..>287072)
                     /locus_tag="LDBPK_100620"
                     /db_xref="GeneID:13392225"
     mRNA            complement(<285636..>287072)
                     /locus_tag="LDBPK_100620"
                     /product="zinc-binding dehydrogenase-like protein"
                     /transcript_id="XM_003858850.1"
                     /db_xref="GeneID:13392225"
     CDS             complement(285636..287072)
                     /locus_tag="LDBPK_100620"
                     /codon_start=1
                     /product="zinc-binding dehydrogenase-like protein"
                     /protein_id="XP_003858898.1"
                     /db_xref="GeneID:13392225"
                     /db_xref="GOA:E9BAA7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BAA7"
                     /translation="MGHKNSSNISSAPVPPPFYVLPAVPVPSLKPSNLDFSETSGKPI
                     LCAGWIAPHGNRSWSRRNVVYSSEIEVPVPQPCQVRVKIYAAGVNPVDAHRTAVLTSF
                     PEVGTSGKSRCASRHPRPPFKFPYVVGIEGAGVVESVGWAAASSGERDGSAGAPASAN
                     ARDIRVGDRVAFLADFTQGSGGTFCQYAVVDSDVLWKLPEVVCAPPPSTDGLVPGRLI
                     DFVEAASLPAAAATAYIALFDKLRIETQRAIFISGASGGVGSAAVQLAHYFGLYVIAS
                     CSTPNMRYVQSLGADYVVDYTRADVVKEILTYTDNYGVDYLLECAGASMAEAHSETVR
                     FGGALCVLTGLLSPRSDMVFRRQLSVHYVCLGMQHQDPLARTQLQPLGELVMQLYIQG
                     AFSVNAEQVPFVQAADALDVVALGHGRGKIVLTNFHTNEDKEERLRRRHVQLYEKAQR
                     QYQLEETQKAAGAAAAAAASDAASREAG"
     gene            complement(<288055..>290367)
                     /locus_tag="LDBPK_100630"
                     /db_xref="GeneID:13389286"
     mRNA            complement(<288055..>290367)
                     /locus_tag="LDBPK_100630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858851.1"
                     /db_xref="GeneID:13389286"
     CDS             complement(288055..290367)
                     /locus_tag="LDBPK_100630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858899.1"
                     /db_xref="GeneID:13389286"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:E9BAA8"
                     /translation="MDAITELLKNIDPSRIDEALALLQSLKSNAAPQQPSNSHVPASS
                     SSEACRSSPEPEPQQLAENGGQITELLTESWAEGASGTAEEENDMPLASFGHLLSPEK
                     KKKARDDRRAEREAEKEARRRMKEEDAALIKSELDARKVICDEEKESRRILKDTERDA
                     RKAEREAEREARNKAREAEKAALKVPKEAPNSLTLFGFLSSTVKAESNKNRLFSPFVQ
                     DKRVAPAALQFWRRPEDKISRNEETSVVNLSSHAMNGGARRDPGKSKSHMVDEESSLL
                     HPPMYCDGGAPSKAKVCVRDFNAMIEASNAQEVPVRDLLRQCGCAFHAAVSDPYASFD
                     NEVVFVGFFAIGYDPCQSRPPYFGTYNHLQEGNLNEAELLQMGRFPLRCGIPRLSNID
                     YEYDSGDDWDVMEGDEDIAASSSSDSDKDTALDSLDSSDLEFIDDSDSDCDTQRKIME
                     ARQRRLHRLRNKSKLVPSYSGPFVGIPTDEHPLRGFDELERFAPLNAAYFSQLLEKEL
                     NAFTSGSAGIPASEDEGLSAEEMEAKRQRALMEAALKNRREMTDTELKALHTIVASNS
                     KVSTKMILAAFKQQQLCVGVARAEIERTIRRFYERRHRSLVLRGEPWSPTDERLFARV
                     SSSKKPKSPGDGGTGVVTGDGEGRNSDENEDADDGTDIDDVAETTVERAAEIADDAFA
                     KASEVGDRTASAPVTPSETVEEAGHPKPSPHSSGEAKVETWLAKTTQITLTKLSPKES
                     ASASFNMAKRPREEEQAEDQNDSATTATSD"
     gene            complement(<290725..>291528)
                     /locus_tag="LDBPK_100640"
                     /db_xref="GeneID:13389287"
     mRNA            complement(<290725..>291528)
                     /locus_tag="LDBPK_100640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858852.1"
                     /db_xref="GeneID:13389287"
     CDS             complement(290725..291528)
                     /locus_tag="LDBPK_100640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858900.1"
                     /db_xref="GeneID:13389287"
                     /db_xref="UniProtKB/TrEMBL:E9BAA9"
                     /translation="MPSLAKPSQKGRGKKKGGKKPAKIVPDPDGAYRQQLDETLYIPK
                     VVRRKVLDTYGKAADSAIMANTVDALPSQLDAHRERPISFIKVPSIFRSLGLCLTDDQ
                     IDQIKAMIAQNSQHVSQENSAANQMQQVQRPGTFADREKLRTLLVELLHTHVLAYDPQ
                     VLTCPHPRFPDRVSSVVYSSTEADIRSCFDKIWEVTGKQMVMTADGTNIRCVAVEQLE
                     ELLVRAQTEEVATKALTEKELQDFYFLVKDVNDDVVREDAFLNCFIHAQ"
     gene            complement(<291829..>293616)
                     /locus_tag="LDBPK_100650"
                     /db_xref="GeneID:13389288"
     mRNA            complement(<291829..>293616)
                     /locus_tag="LDBPK_100650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858853.1"
                     /db_xref="GeneID:13389288"
     CDS             complement(291829..293616)
                     /locus_tag="LDBPK_100650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858901.1"
                     /db_xref="GeneID:13389288"
                     /db_xref="GOA:E9BAB0"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BAB0"
                     /translation="MSAAELQRRATALSRRQVRIFGAVATGCGSLGLYVCYKKFFLPE
                     RLREDQCRRVLMPVRRTKPYVVGTSMGNGLLPEVRSMPKVVFFFYVAYRIALLFVGSV
                     PVLWYGFLTYSLRLCPERIFYEKILAFLSSMGPSYIKLGQWMATRPDFFPDQMCKTLE
                     KLYDSTEPHKWSHTERLLRSEFTDGPCKGHSALRYISEIEKVPIKSGSIAQIHRAKLR
                     ESIDGIPAGTELALKVTHPYIREQVSADLAAMRLFVWVGNRIIPGLRYFNLDSSINEF
                     SSLVQSQLDLLVEGDNLMQFRYNFRSFNGVIFPTPLLSLSTEDVLFETFEEGEPLQDV
                     VYSEEHKDVAELGCHMFLKMLFEDNFVHSDLHPGNILLRTNKTDGLRQYYPDGKRKLR
                     FEVVVLDTGLVTTLSKDERNNFISLFAAVACGDGELGADLMIDRLPHSMRNSQDAANR
                     ERFKKKIKEVFDMVAPGTAGFRLSKVQIGSILGKVMDAVRENHIPLDGNFASLVLSVI
                     VGEGLGRKLLPDFNIFAEAAPYLMAFLEDGELYFLANKLQSTYGTTALLRDSVDIVKP
                     EKAGTYVEMAVKKGENMLRKLFASDRAHG"
     gap             299450..299548
                     /estimated_length=99
     gene            complement(<300318..>301841)
                     /locus_tag="LDBPK_100660"
                     /db_xref="GeneID:13392226"
     mRNA            complement(<300318..>301841)
                     /locus_tag="LDBPK_100660"
                     /product="endonuclease G, putative"
                     /transcript_id="XM_003858854.1"
                     /db_xref="GeneID:13392226"
     CDS             complement(300318..301841)
                     /locus_tag="LDBPK_100660"
                     /codon_start=1
                     /product="endonuclease G, putative"
                     /protein_id="XP_003858902.1"
                     /db_xref="GeneID:13392226"
                     /db_xref="GOA:E9BAB1"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:E9BAB1"
                     /translation="MSASAAIARLLGAASLALFGVTAYWAYSTQASKRTQLVVQPGRS
                     LVTTANATPSIVSAGSDSSSQGSVRGDAALAFPVVLPPHTPPAQASTLTADFLQQCNE
                     AAAHGLPSTAEVRCYGGYLASLNYERRIPNWVMEVVDYRKLHSGRRPSSPAAAAANRD
                     DDAAQAADDEGSDGSRGGGDVSRNRSNFYADDTVPAAFRVGPNSYTSRGMSRGHLAAA
                     QLHKASQAEMDATFNMNANIVPQDMTLNAVDWLRLEGLTRKLSKEVSVGLQQQQPGRV
                     RQRGDSPPAGNTAKAEDAGSSGKLYVVTGPAFVPRLMRVEHRSDGTEVHAPLSSADAN
                     AAPWKSAAPVKLMMTYELTGHPARGTPVAVPSHLFKVFLAEENGGRSHSVAAFMMPNG
                     PIIEELPLTAYQVPIERLQRITGLQFFPGMDATRLPDLCKTHKCDARPSALFQRYRQV
                     AQLRAADSVPQLRQTYAALQASAAGGKLDEAVVHEFQNRMEELVAAAVGLIDQAERR"
     gene            complement(<303640..>305910)
                     /locus_tag="LDBPK_100670"
                     /db_xref="GeneID:13392227"
     mRNA            complement(<303640..>305910)
                     /locus_tag="LDBPK_100670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858855.1"
                     /db_xref="GeneID:13392227"
     CDS             complement(303640..305910)
                     /locus_tag="LDBPK_100670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858903.1"
                     /db_xref="GeneID:13392227"
                     /db_xref="UniProtKB/TrEMBL:E9BAB2"
                     /translation="MGRCIRRVSSAAAAALLIALAAAAAVATTTARAYDHAGITVAGA
                     LLVGQNLQGKAGASRILNPFAICADFDTADVEDTTLLIGGASYFFSFNRYSTYLGFWY
                     GQGSMNLNSGPIDKVRLTGVFGCVTLRPNSSNGLVTSTVYYVQNDGMLYWVSNSVVYL
                     TQVKHGISFVDVTVHDNNVYLLSTQNGIYQCGIGAGGAVVGSACTQITLTGSTEFHQL
                     IPISSDFRGFAVSSSGIFITPTSDLYWFNLSGAFIAKSVGVTFVDTKFTSSRDTANRG
                     TSVLMAASTSAVYTVTTSDATISYALVSGKEVKSCNPALNNVDSDTSPTFCGIARIYP
                     LSTDMVYMTTGGASVVRAIIVSNTTISDTITRTPFPVYFLDNSSIMPLILDGMNYELV
                     SNSNIPFPYVAINHSTPKVDDSTWDTIFSVDVSNRFFSTVSRAAVIGTPFMSSLHGLQ
                     AYYNRTNHILFGDPNVLPMCNLTKMQMIERAVAADARAALQYPYIYTSKAQNFTVNAH
                     PNLTLLKLLMPYPFGEILNESGFFENTTTPASLANVHFNTTMLAAVRNAYTPDFVYDC
                     IFAGNAFPFHILTAAQQQLVRWIIYTAIQEQLAKCAENSPSYTGSGSSSSDSHDDMVP
                     GCVPRVGIDNLTELVMPGMPYSNYNITVFIPESLHYNFSISRCLDGTDWTNVTDYLQN
                     ATTTRTRKCGTGCIVSIAVVSAVVAAILVVAIVIATSKRRRLATVVAPALTVEPKFAS
                     TLDMGSEEGSRNPLNG"
     gene            complement(<308067..>309860)
                     /locus_tag="LDBPK_100680"
                     /db_xref="GeneID:13392228"
     mRNA            complement(<308067..>309860)
                     /locus_tag="LDBPK_100680"
                     /product="flagellar glycoprotein-like protein"
                     /transcript_id="XM_003858856.1"
                     /db_xref="GeneID:13392228"
     CDS             complement(308067..309860)
                     /locus_tag="LDBPK_100680"
                     /codon_start=1
                     /product="flagellar glycoprotein-like protein"
                     /protein_id="XP_003858904.1"
                     /db_xref="GeneID:13392228"
                     /db_xref="GOA:E9BAB3"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="UniProtKB/TrEMBL:E9BAB3"
                     /translation="MSRCAAVTTRRWPVRRARGPSPHQLFAAALAVLCILLHRPAAAQ
                     GSSSSDYYDGTYYYHVIFRSAPGGGDSTDGPSGVGIYGVVGYGGAMVGGGVVFSDMGG
                     SGSAIRLISKAGYLSTIAGNNRKRGDQDGPSPDALFGGIPTGDSRANSLAYGNGGFYL
                     ADTLNNALRFTNATTNVTTTILNANTLNTPNSLAVSIISGKTSVFISNTGYHSVLYIP
                     SLGSPVGQVNFTSDPYFVPGAITVLSHLSRAFIVNATLQMYCWSYIQPSSKSWKVSTP
                     LAADFGRILQASKDGTQVLYVTANGSTIAGLDATASSATSPSLVPQKMIDLDTSLIGG
                     KIQLFFERTSDSWYILTTTQFLIVSATPIHPEESSSSGSSSSSSSSSSSSSSSSSSGS
                     SSSSSSSEGILSGRHKGIAAFPTAAFPTNDSCLMTQVYNWMRIDATEAYNTDDFLNEF
                     VVPPTNITTLVDGDVNVSTWCGNITTDRSNDGTISILIFWGPRGHDLLYTQDRLVKSP
                     WKRTRAFLNSLNSSGWNLGPFCFYNCTTACKTITAPKCPAYNIGSACDDVCKGAIASS
                     VVLAAAGVVLLILMIVSPSNIFTAVVMVPII"
     gene            complement(<311426..>312157)
                     /locus_tag="LDBPK_100690"
                     /db_xref="GeneID:13392229"
     mRNA            complement(<311426..>312157)
                     /locus_tag="LDBPK_100690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858857.1"
                     /db_xref="GeneID:13392229"
     CDS             complement(311426..312157)
                     /locus_tag="LDBPK_100690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858905.1"
                     /db_xref="GeneID:13392229"
                     /db_xref="GOA:E9BAB4"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BAB4"
                     /translation="MSTTAYKEAVEAPATAARRRKAGRVNYLIENATPAMLCLVRAAE
                     PKPYTALSPEALYEAVQPHDHTLRPSPFIAHQALMDFYKVCDGYYGVDREEVDVQQLT
                     SFEHKKPHGGASSGNNSGSNSGATLSSLLSGSASATPSSSLSAAAGAPPLPPLPSPDD
                     PNLAEKLNDYRIAQLRRNAQHVDNTVYHAHNSSNGSITSNVANAGISGVCHFYRTPEG
                     CQRGAACPFTHLDKHGQPVNRVPKS"
     gene            complement(<313105..>314232)
                     /locus_tag="LDBPK_100700"
                     /db_xref="GeneID:13392230"
     mRNA            complement(<313105..>314232)
                     /locus_tag="LDBPK_100700"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858858.1"
                     /db_xref="GeneID:13392230"
     CDS             complement(313105..314232)
                     /locus_tag="LDBPK_100700"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858906.1"
                     /db_xref="GeneID:13392230"
                     /db_xref="UniProtKB/TrEMBL:E9BAB5"
                     /translation="MLNHKRMIVPAEHPFLIPRALFAPRAAKAAAEDGRSATGACDVG
                     DCVVAAEGAASRPLHCYGDRPVLLLDCTGALLQRRQRRQRRQELQSRASQLVAARADL
                     LRTKNLWSMRRIRARRQNKELSAPVSAVGDAGGDAGRGSGDSTARAPSGAAEGGDSTS
                     HLLSELSRQRKAITHEMKEIRRELLTLLQEKRKQAATRDGCVLMLPSPETGEVQLFPG
                     HHYRTVCFVGDELREVLPSDADVATAHHWQHRTPPLRKLASEGVARELSGNDERGAEG
                     EHTSAKMAERPLWAMAELLGYVLYLRQCRRNPHYRSRRGATFDDDSIECQEGREGRVD
                     FDKIAASISYDMVDQYLALPACEMAMYREWAIDKFKLLPPQ"
     gap             315618..318148
                     /estimated_length=2531
     gene            complement(<318399..>323435)
                     /locus_tag="LDBPK_100710"
                     /db_xref="GeneID:13392231"
     mRNA            complement(<318399..>323435)
                     /locus_tag="LDBPK_100710"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858859.1"
                     /db_xref="GeneID:13392231"
     CDS             complement(318399..323435)
                     /locus_tag="LDBPK_100710"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858907.1"
                     /db_xref="GeneID:13392231"
                     /db_xref="UniProtKB/TrEMBL:E9BAB6"
                     /translation="MPRDSTSFVSLAVSSLRPSVTRAISTATTEATALPSNTDRHYIL
                     MRRDSPFLAGRDDTPGEAAMEDVQQSRWLLSRHPRQRVSSGNADAVVDEVGAGAHGEV
                     GTRERLQQQLQRTVERQRQLELLTFDFNGGLGDARGPQQRAAEHMFLSPDASDAHRSA
                     SEGPRRRRAAAAAAPYLFRGTGADDDADEIRADSVVVARGLSLAWAQARSRGSTSPSP
                     QQHDLPLWWRRGQAARGRRPQPDAAQQGQSDDHRLSPSPAAAVGEDAHPRHTESAPQR
                     TSAASSSAPASSVVVSRSAAPRATSTSTCAAQMLLSPSVRVDRRERSASLHVPLSFAT
                     AGVVDIDDTIVTSSCAVLPSPIPADHLRRPSLPTAALTDVVPSSRVPSEEVYRAEGAL
                     CLGDSSRRVSAFAHPRNSVSCCNSPAVDAMHADAVTAAAMASTVGHRAWKLGSRCSPC
                     PSAGATGRTAASELSSRDDFHFERSTLKPHQDGVFEEDAGAVDEETPFVRRTSPGTSD
                     GTGKESCSQRSSGSPGAAEPQGEILKPSASAGGRGDDCVRGRCSRRDPQLPPLSRAAS
                     LSSSSSSSPAPWHVRTDTKAGGIDVDAAVEEADEAGGSANAPALAATTSPMVYLSDML
                     RLSFSPDNGADDSRTVCAEIDEACGEPDVRAVRLAAQKAQRAGTARVGGAHDRYTCRP
                     DNRRRHSRTVLADDGDDSSLCRSAASTSSSPPSQSRTAIRRLMDMEDEVVSDGNLSAS
                     PLSPLDVTRGRCGTAASMTTTGPSTCTPHRVAGRLALSADERRLHASAASTAAWGRAN
                     VGEHSHRGAAATVVTATPEESSARSSILSIFSTPAQTRLQSLLQASTWSTATPYSHEQ
                     GNSSHSSRRSFHRHPQVAPATSTGGRTSPRATRDDSEDVENEIKIGTADRNPYGRLPT
                     AAATASARSMMPCDQAKRKCGNGGLRHSPGKGHEPQHLVRQGEQGGDDVHVRGSSNSS
                     SSMTPTRLSGVYASPPAARASATVIVTPSRTAVAEAAPAAASTLHSSPFRGSGSFLQV
                     YHGWRGSTSTAAPSGANWLSLSQEADIQLLARRTRLTHARGGSTTGAMTPKVCDLARS
                     PQQPQPSPLSSPSRRSTGSLSFFLAAAAASPGSGGGTRTSGGGGFTEDDEGRGVRAAG
                     STVYGSAVARRRSWAPRKQQQKHRRRQQSHSSMGMHSPSVSVRGISRTDSSGSRFSEA
                     FGVAPQRLTFGSAIASVSVANSNTDSVERWPTAYSTPAALALSHPRQQRQHRAPPPPY
                     AFSPGDARRRGDGVEEAAESSRHSLLLSSEQRTASPRQSWALSTSSPLSLSPFAPRTP
                     SGRLSLPSTELNQAPLRHGETRDGFSARSPPSTSIASAAEQRTQHVRGSSCRSRSLGS
                     GRIRGSLRDIGGRRRANRALSFSTLRSSPSALATPTVWAGLEYALGAATPLGGRMDAP
                     SPSPLNSGRQRRTSSDSSMTRSMESFHIASSGRSRASASLMLQLQPVQPRTFSTAPQP
                     TLADELRLFASPVLTTAPIEPLVSSPSSATAPLPLATFIASPPRRTGPPTSTIAPPSM
                     PSLVHSPRQRPSLPPELLALMQMRTSASAAAAETHRDPGDAPSSTSAQTAEIGAVAPP
                     CAFASSGKPVQRRGCSERRDVNVEPGQGSPSSSHRTGASPTAVRRGWGEQGEGFAVGG
                     SGEVHPGATG"
     gene            complement(<327103..>328077)
                     /locus_tag="LDBPK_100720"
                     /db_xref="GeneID:13392232"
     mRNA            complement(<327103..>328077)
                     /locus_tag="LDBPK_100720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858860.1"
                     /db_xref="GeneID:13392232"
     CDS             complement(327103..328077)
                     /locus_tag="LDBPK_100720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858908.1"
                     /db_xref="GeneID:13392232"
                     /db_xref="UniProtKB/TrEMBL:E9BAB7"
                     /translation="MALAATWNPQRQFRFPSVNLRTSPVSCGATPTPTFLRRARLSTP
                     SLLSQNVIQYRWMRAKNQQQQDRNAEETGKEGEESNSKTEGGDQGSDQQSGSSAKGSK
                     NKKGVKGQAKKKSLMDHVRGLRDDYANFPHIYNSVNAINFVVFTVFCLCSTGSNTEER
                     WWLEKWGVDNSVRPWTWLLHSFLTNNFLAMTYAMMLLHTMCHHVLPTLGSRGLMMYCG
                     GTAVFSGAIMWLSNYLYYGSAAAPEKQFGPWDVIAALFVMEYLYYGVTPMSILSSFSG
                     WIKYACWVGGVCILYFDWQPTLIGTLVGLAFCKGVPRWQAVRPTTTAA"
     gene            complement(<329135..>330652)
                     /locus_tag="LDBPK_100730"
                     /db_xref="GeneID:13389289"
     mRNA            complement(<329135..>330652)
                     /locus_tag="LDBPK_100730"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858861.1"
                     /db_xref="GeneID:13389289"
     CDS             complement(329135..330652)
                     /locus_tag="LDBPK_100730"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858909.1"
                     /db_xref="GeneID:13389289"
                     /db_xref="UniProtKB/TrEMBL:E9BAB8"
                     /translation="MRKSDARLALPTAALLQSRKYQPSQRPLQLPRPPPRLSLEHLHH
                     DILHCASNVKRLMENEHELRRVVRDVLLERLGMEGSHVEPPLRLCTEDNAEVTASPFC
                     AVASASAPLSSSVESTEQLRCTHDAGPRSMRASNVDDDAGSSQPTWFMPWLKHLRMEQ
                     EKQLRQMREMLVVVRRSLSPDSSDEDARASSLMRTTEEARDGTRTAEPPHALLWQRHR
                     CLLPPDRPEAVEACSTLLAMQEMLQTQSTQLVRLEKLLQETLIPDTARRTSHGAGALP
                     LPSPSAHQVEAAAAARAHHTVHRSRSNDTVLPTLTYTAASPEKNGRRAVPSCSGYNAD
                     VPAAAAAAATSSRVSTCVSAPSPPPVCTPKNVRPAAAFTDGHTHTRSHQQNQPQLDAI
                     QREIDDLCHFLRETLTQQQAQPTPQPHNPLNKTGSDVRVNGQPSASMRETNSQYASAH
                     ALQWQPQHEADPYLQEARRRQQHPSRDVSRSHTASGYPPSFSMHTDDSIWRTKRK"
     gene            complement(<331754..>336781)
                     /locus_tag="LDBPK_100740"
                     /db_xref="GeneID:13389290"
     mRNA            complement(<331754..>336781)
                     /locus_tag="LDBPK_100740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858862.1"
                     /db_xref="GeneID:13389290"
     CDS             complement(331754..336781)
                     /locus_tag="LDBPK_100740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858910.1"
                     /db_xref="GeneID:13389290"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:E9BAB9"
                     /translation="MENRVVALAVLENLIHWPLPNRSGYAALARGSGEDAEDGSATAA
                     LVSAGDAEDLSREPRQRKQDRYRAVLLLPHLCHRLGSRWAETEIVPYLVRCAEEDDPQ
                     LALVTGMALLGVTLPRRTPLGPTISASSSSSPDASSTFSGATGNNFGAFLSVEDVQPV
                     CSLLAASSAEETRQFAAQVVLPHLFFGVALERDITLESWDLKYVPLSVLQADMTTTAT
                     SMEANEAAEYLESEDNNPSWAAGAVDKRDTDGGASSTARLMAAVRKQLLRKHRLTMKA
                     RAAAARASSTVSGKDSHTSSSATEVTDPHTPTEEDVRKRCYDLALEDESVQFLWSGGY
                     AALTGPWLFDGSGRLASLWNDVSDACGRCSSGSSASACRLMASFRCFRRHRRRVDNGQ
                     TLRGEPLAACLPLSGADLDLYGAAYASDADSGSGDDFFSVNVRARALVAGLVRWMGAL
                     APRAAAATATSPSADAGTSRSARLHADGSLSLFDYLCCNERRDVLRCRWRSLIKILQG
                     FLESPYPGPVAAAVETVSGLLHAIQAALWEAEQQQQQRAKSSSAGSCADPLRNKATSI
                     DAGAEVDAWSGIRVPAEPLLTTAELQTFMHRMTRRHVAYCIAAAVSARTVSMPTSPTA
                     TSMKVLTDSMGRLMRSALAAAQELLADLLLRHHVLMKLDVCSATASTTTSESPHHRLS
                     LGASCMMLQVGVGPSESRLASYSAWDVSFASVSTTAGAVSAATPNMPDDATFLMTTTP
                     AADGRAEKGSAKWLPGTLNAISAFRLHRLVRRALLRALPLCVDFPCIFYSCASTRALS
                     SASTSGTSASAASVFSLSAVCPMLLQVLVPPSALSPLLNVLRVTVELQHQAEKDHAAD
                     EKHAGEAAAPTPSTRHVDPAGSTMMAPALWAAMTAAGSVLQLDTAAAEAPSAVEESPA
                     SVDFALLEAALDAVQRLMAEAAVQLSAAPQIGSLRSASAPVIVAGAPPSHILDAVCAQ
                     LFILLAACLRWVPRYPNWKARWLIAQRLPRLTATFGLLIVRMSSLAEGADVSAARGPT
                     AHQLRAQTWLTHTLHLLASLWTCDAQFGTAPLHDLVDDEEVEVRCIAARCAARCFGGA
                     TEAVLRLSFSAGAGDEKARTKARFTSQQSSLLPSLCEPLLQLLDVIAQCVLVAASDGD
                     TRVLCRSAEALAGLSRTLSLLVVADPSSATRSASSTSTRNEEESPVWARYLHSNTDTL
                     LRLMTDNRPTVQLALVSQLADLLLMHMRKPPHEKRQGQSRNGRAQSQLMGDESDASFI
                     CGPDEDGEEGSENDADAPHRSPDEVQYDALLQCLRQLSQHELWRLREQYALLLAHLCG
                     CLLLTAAAAPAPAPHGRHADAQRISSMDFSAVNAGRVSGEGGTDETTRCSVTDAAVMA
                     QQGGADAALWAHTHPLYQLARTELLTLLVAVLFDKVKAVRDAALDAVERMCVQLAVAS
                     SRSAASTSVGGSGGARQGSVGKRFGAGYETEGVDTSADAVAAASGSLNANTFVDDVLW
                     PRIYAHAPAWETYLSRSALLRIAMRLRVDKTSAFIPLLDQLARDPVLNVRLVVAKTIL
                     EVLLVSAPEVHAMTTPALFLEAKDGEVASSRTSTPTPMSSYKPELPSGTIAYSILMNK
                     PVTLLLAGSGSGNGRAAAVADVVLPPLQFDEVERAGVILQILRQLLKDPSADVRDEAA
                     KALKVCF"
     gene            complement(<337647..>340505)
                     /locus_tag="LDBPK_100750"
                     /db_xref="GeneID:13389291"
     mRNA            complement(<337647..>340505)
                     /locus_tag="LDBPK_100750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858863.1"
                     /db_xref="GeneID:13389291"
     CDS             complement(337647..340505)
                     /locus_tag="LDBPK_100750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858911.1"
                     /db_xref="GeneID:13389291"
                     /db_xref="GOA:E9BAC0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BAC0"
                     /translation="MSRVRILNLPNDCTEEQLKQHLLRTAPREAPLLEITDVQFIRRP
                     ATAADRDHHHKHQKQRQGSGGAVAAARAPKMILRMAFVGFRTSAAGHFVAQYFNSSFF
                     RSSRLKVELAKGLNEVGITLNQLRKQQQQQEETSDRKNSSKSGAGAADGAHASGLTSS
                     TTSREQATTRKRVRDDDREDGQKDSDTGATLADGLARRQREFVELRSKATEGPTWAAE
                     VLLAPDTSPTAAAGEDEQKNSAMDKKTQQHRRRQQAERHTADGGDTNDDDEAEQERRA
                     LLRQQALGEVSDMDFLSGLAVPPTHSAVDAEVTAQREDGADDVASLRDNDVDGDIPAT
                     AMNAANVTNPGTKGVDHDAAAMAQEAQEEIARASHRIRLGNIPYIATEEHLKQFAASL
                     VGPVEAVHIPLTKDTRQNKGAAFVRFSSAEDAVRALQLCRGAILMGRLLRVSAAEEDP
                     HSKRVMEREAALASTAAAQAADGALSRMNLAGSSQFKKQREADRRDKGGGGGQMTWNT
                     MYMNSHAAVETVAQRLGVRSEDVVGVGAKGAAVRAAIAEAYLTSEVQQVLSDEGIAFD
                     LLEGATQNFLKSRSNTTILVKNLQLKDGNDAAELTKLFVRFGVLEASAFPSAGMFALF
                     RYTHPQDARIAFTRLSYKLFKTAPLFLEWAPVGALMEDSEGGSAPAVAASDLGLTAGP
                     SADGDPDADTGGSVAAAVAKAMVYTLFLTNIPFQTTEDELHAFLLDACPRLARAPEAL
                     IKRLVLQQEQGRAFLTVADQSTLAYCVSKLNGKPLAGRTLSCVVSKQTAQLQQQARVA
                     DTTATPQGTTRRCAGTDADDDNDDESDPTKTAVLARRRAGGANPDNGGSGAISNPASV
                     LKVPPGSDPQKLIVKNLPFEATEKDVRELFSAFSEIRTVRVPRKSHTFSSHRENNHRG
                     FAFVEFLSEAEAARALETLKATHLYGRHLVLQYAKLGG"
     gene            complement(<341915..>343381)
                     /locus_tag="LDBPK_100760"
                     /old_locus_tag="LDBPK_100770"
                     /db_xref="GeneID:13389292"
     mRNA            complement(<341915..>343381)
                     /locus_tag="LDBPK_100760"
                     /old_locus_tag="LDBPK_100770"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_024473451.1"
                     /db_xref="GeneID:13389292"
     mRNA            complement(<341915..>343381)
                     /locus_tag="LDBPK_100760"
                     /old_locus_tag="LDBPK_100770"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_003858864.1"
                     /db_xref="GeneID:13389292"
     CDS             complement(341915..343381)
                     /locus_tag="LDBPK_100760"
                     /old_locus_tag="LDBPK_100770"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_024329223.1"
                     /db_xref="GeneID:13389292"
                     /db_xref="GOA:E9BAC1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BAC1"
                     /translation="MSRLPSTASDNEPAHLTQMEDERYRKTLIEGFMSVPEVEGDEGA
                     SNGDPSCQQKDQKAQEYVEMDDDDDMTVVRLAAGELKENTNIYKSAFHVFKANVGTGV
                     FLLPTFYPDAGYVVSVILGVLIGAAVVDCTRLLMDVKIKINRSDVTTYSQVCRYVCGA
                     GLGWFLFVAMCLAQFGFCLMYTQLFGDTMVELANFKGSKYLWVSVVFFLCFPMTCFSD
                     NLSLLAIASIIATVSVFYSLICCFVMSLVQLSQDGVHPGCDVAGNRIPVGWFNNLANN
                     MMVLEGIAIILPVHAACTQKRLVPKMATLVITGVIAWYILFGLTGYLAYGNSMTTSLV
                     AKMAHSPWGTSVRVFFALNLVFTYPVQFMSAMQLIDQTVRCKPRSWMGIGLRLLINLV
                     IWALAMGMPTSAVNTVVAFVGALPSVCMVMIIPSILAMHVKYAVEHPDADRNTLQYWK
                     KIFVTAPCFTFKRIRCYVYLVVAVLIMVIGTYSIAETL"
     CDS             complement(341915..343381)
                     /locus_tag="LDBPK_100760"
                     /old_locus_tag="LDBPK_100770"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_003858912.1"
                     /db_xref="GeneID:13389292"
                     /db_xref="GOA:E9BAC1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BAC1"
                     /translation="MSRLPSTASDNEPAHLTQMEDERYRKTLIEGFMSVPEVEGDEGA
                     SNGDPSCQQKDQKAQEYVEMDDDDDMTVVRLAAGELKENTNIYKSAFHVFKANVGTGV
                     FLLPTFYPDAGYVVSVILGVLIGAAVVDCTRLLMDVKIKINRSDVTTYSQVCRYVCGA
                     GLGWFLFVAMCLAQFGFCLMYTQLFGDTMVELANFKGSKYLWVSVVFFLCFPMTCFSD
                     NLSLLAIASIIATVSVFYSLICCFVMSLVQLSQDGVHPGCDVAGNRIPVGWFNNLANN
                     MMVLEGIAIILPVHAACTQKRLVPKMATLVITGVIAWYILFGLTGYLAYGNSMTTSLV
                     AKMAHSPWGTSVRVFFALNLVFTYPVQFMSAMQLIDQTVRCKPRSWMGIGLRLLINLV
                     IWALAMGMPTSAVNTVVAFVGALPSVCMVMIIPSILAMHVKYAVEHPDADRNTLQYWK
                     KIFVTAPCFTFKRIRCYVYLVVAVLIMVIGTYSIAETL"
     gene            complement(<345486..>346331)
                     /locus_tag="LDBPK_100780"
                     /db_xref="GeneID:13389294"
     mRNA            complement(<345486..>346331)
                     /locus_tag="LDBPK_100780"
                     /product="deaminase, putative"
                     /transcript_id="XM_003858866.1"
                     /db_xref="GeneID:13389294"
     CDS             complement(345486..346331)
                     /locus_tag="LDBPK_100780"
                     /codon_start=1
                     /product="deaminase, putative"
                     /protein_id="XP_003858914.1"
                     /db_xref="GeneID:13389294"
                     /db_xref="GOA:E9BAC3"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:E9BAC3"
                     /translation="MSVHYVDAFMRAALREAELALEEGEVPVGCALVRTDANETVYAK
                     LALQSSDAVTNAPPHAASSLRCDQLVESCIAARGRNQTNLQHHALAHAEFIAVQKLID
                     DATRGGDGSAGASSSKAGAGEGEKELVEDGKQNGLTSSPTTPPLSGLADYVLYVTVEP
                     CVMCGAMLLYNRIAHVFFGCRNPRFGGNGTVLALHASPFPQQRLRRQPSQPDQPAAST
                     PRFAGMSKGSPSVDEGGIVCSGEWWPGYVSEGGHTEAEAISLLQRFYERENPNAPGHK
                     RRRKA"
     gene            complement(<348451..>348828)
                     /locus_tag="LDBPK_100790"
                     /db_xref="GeneID:13389295"
     mRNA            complement(<348451..>348828)
                     /locus_tag="LDBPK_100790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858867.1"
                     /db_xref="GeneID:13389295"
     CDS             complement(348451..348828)
                     /locus_tag="LDBPK_100790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858915.1"
                     /db_xref="GeneID:13389295"
                     /db_xref="UniProtKB/TrEMBL:E9BAC4"
                     /translation="MSGHHHTSDPNLTQNQGNMLGDRPCVRQSRLYREGCSGNVMKEI
                     LGQSELSWKTDQTEGCYGGGHVYDHNTEDHRAVPTQQPQQKQHQPPPPQPQQQTVSAS
                     TGRGLRPGAGYANRQTYNIFSGQ"
     gene            complement(<351906..>357872)
                     /locus_tag="LDBPK_100800"
                     /db_xref="GeneID:13389296"
     mRNA            complement(<351906..>357872)
                     /locus_tag="LDBPK_100800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858868.1"
                     /db_xref="GeneID:13389296"
     CDS             complement(351906..357872)
                     /locus_tag="LDBPK_100800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858916.1"
                     /db_xref="GeneID:13389296"
                     /db_xref="UniProtKB/TrEMBL:E9BAC5"
                     /translation="MNRAFLSDLAWHISLHPSCRAELRRHWPAPHYHKTPHDIDEAEE
                     QPRCQATGASPPAAAVAGQDESKKSGGGGSGAFNPYETFSLRLKRKRREPVKAGCRSR
                     CGEAALPEQQHQQTRTGASQAKAKRRISSNSASLNSTSSAARVVGARLTTSSASSLTR
                     ASKLSSSLVVTAKPAAAVEAKAKRATLLTHAAGATTAAVNNSKSTSAPAASSSALVSG
                     RVKAVAADHPSPSPLASAAAKSASLPHARAAAAAATVKKAAVGTPKKEPDEAPTSVVD
                     DSASAAPATSKRNKNKAKSVHVDANDTKLKTVRSSAAATATGGPSSGPAATKKKKTTG
                     NSISTIGSNAADSDNGSEKAGYIRDPLNIRLPHSPPYRGRQAAGRNGHRPVHVTIRWS
                     GARQRRRRFFAQYPALAQPENAMYLQQLMRHARPSPSLDVREVAVEAAVYEEKRYSTA
                     QEKVPHQGFAPPLVPRSVNFSDAATTVGRSAPRQPSTVASAFLSGSTPRADAPLQKQQ
                     KLCPSDREAGHTTNATAATGRRASLSSTGGRADARSHARMHGQGEDEEVASHVVASNA
                     SINDSSSGALPVRPFARYPPLKGTTILSQSTNTAARTLALSISGSEMPTPSSADNFSA
                     TLHSVVRRPNSLFIVRTPLQDNADEAAAYDSYYYSRQVGVAGNSSRPLGAMGPVGSHS
                     LRGSSAGVASASGPNRLRVTYVTANTCSTARTWSTHHHSLNHSTDRGSSPYQPSSLAP
                     ANPSASQSMTSALSCATLSPHVPQQQQQQKGSGPRDVADIQRPYPLSTSGPSFSDPRP
                     SVKAWINLDSPTLVNSAFSALQSPMPSVPSTPLYASAAAGPKIVMRSATIKGAAAANA
                     GGGKDTPPLLNVKTVMVQRHRSFLLRRQQQQERSSPAPVGDSAPVAAECDSGPLRHFP
                     RENSSTSVAAGTAASNPPCSDSQPRHRKLQQSSIISAPSPPRAPVPLGVAPGGVQPLA
                     GKRATSAQHRARTGEGAVDEPGSSGGVCSRDTDGTPCHRTSVHAQRQSSHFSFTNLAE
                     IGRTGELLKLPQQHSHTDVAATNQLSAESSLHLFATGEGGADCSNASSVQLTQQYLAS
                     SLQPMPCPMAPHTRRDSERDLQAPSLWHPVYTETRLYAASESTAWLENNSFATVTATP
                     AMSTVLGHSTPTGPHAGYLGNSNNFTFSEPATPLCWTQQRNSSGLVPSHQRLSSCSLA
                     STPLLSHPHLHTPSFGNMGGALPQGARRTPSGLPRSPSLATSTATPTAAAPQVFCKYQ
                     RPERQRRRRRFPPPLPGTRCPGMAGRLAFDAHRAAVRSGAIAEAEECSYYLSHERCSS
                     ASAMPGTSLTTSLHRSTARQSSPSPSPPPSGSPLCVVSLADCRAKFSHDAASASAAGD
                     ERNAKARWDEEQEESDEMGDEHEETTFGTPRFLFHIPLCCDDPYHRDEEALEMLSITT
                     TSSCAFGAGLDGLRWQDWMPSSPLEAGEVMLRTVEQAAATATEAAASTHARDSNRLST
                     IADSNNRRIQDALGSGQAETVAGARAAHAVDSFVTGSATAAGLGAPNSSVATSSRQTL
                     GVFADGGKVVSTDIAAPRNSEDLVCVTCRAMDSASVGGVGEGATDLHDSLTGTSFDFS
                     NSLNAPGSGKRPFIAEWIVSKLQKRMEKKKQKMQRKQLEREAAAAETVGMGNPLQFRF
                     EGGSESLPSPAGAPRAHSRTSSMSDYSDAGPPCGGYFSQAFKGYGSRCLLCSSPMMPT
                     GAQAAQQHRQGLAYLAAAYQTELVIHEQKRREAEENRRGLEALVRRCRAKMTPAAAAA
                     GYYYEAHVVTSPNILRPHAQPHKEPFTTLSLKPTTTNAAAAAAAKAAYTVSEGSSNGV
                     NPSGSSSYSIGSEEHAGDAAVQAHLAMSFWSPRIPEQGGATPPPPPLTRTSKAGKGRS
                     NTMSQQPNDTTVGARAKTTAATSSSEATKLKTSGAAAPERQPPSKREHRDSKALAMAS
                     MVEAERMRVALDTVKTKKQAIESWIFGLRL"
     gene            complement(<359869..>361794)
                     /locus_tag="LDBPK_100810"
                     /db_xref="GeneID:13389297"
     mRNA            complement(<359869..>361794)
                     /locus_tag="LDBPK_100810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858869.1"
                     /db_xref="GeneID:13389297"
     CDS             complement(359869..361794)
                     /locus_tag="LDBPK_100810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858917.1"
                     /db_xref="GeneID:13389297"
                     /db_xref="UniProtKB/TrEMBL:E9BAC6"
                     /translation="MASTPPLWRRLQPLQPTLPLFADRNHRARTIATEHAAAAPRHMS
                     YSFVVVPPPVPAAMPAFEAHISTLLRHVPHPTFITCTSYSPYFTSAAAESLAADADTA
                     GESANAMEASATQQALSYLHQCVAADVGLVLTVTATRATRHAESVQSAQGGDHDSQQH
                     PKQHTSSSPASMEPPTTTTLTGASRGGTAAVLSDFIGRTATAPATDLDAAKSQEATRH
                     RSRGLMVLRGDDGGYTRQRMIAAQKGGASASPPSPSPSPYVDFADGADLLRFIHSTLR
                     GRDGEAMCEIASDEPAGAAVCLCIGGYPQGHVLDRQWGVGQVGADAATAAAVPSAQSP
                     STCQTLASLRFLEEVDTVFADTEAQLRRAQGTHSDPRPPSLESCVEAAEALFARLGAV
                     RRLWTTPSYYPPSVRAACTRRTVADKVFLRPPGTRQCIADGVWDGCGSAGARVVVTQI
                     ITSATEFFDYVEDIRSALRSSAPPARGVPCDRDRDGAAAAEARGAGVPCLQLKAASAL
                     PSSLPSLVVVPGLMAPLRGEQFLRSALQLKVIPSAPFRRALREYEGALHSAVETLRSA
                     VSSNAVDVYEEAKERAEACFQERMVAITVDIVRDLRARGYTHVNFSAFQYGCGDAVGR
                     AVAALAAEGGEEVVEQS"
     gene            complement(<362439..>364421)
                     /locus_tag="LDBPK_100820"
                     /db_xref="GeneID:13392233"
     mRNA            complement(<362439..>364421)
                     /locus_tag="LDBPK_100820"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858870.1"
                     /db_xref="GeneID:13392233"
     CDS             complement(362439..364421)
                     /locus_tag="LDBPK_100820"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858918.1"
                     /db_xref="GeneID:13392233"
                     /db_xref="UniProtKB/TrEMBL:E9BAC7"
                     /translation="MSTEELIACLLGLPSSSPASPPPRMQQRWLAFVHLCDSLVRRTA
                     SPSKRGVAFATTSTSVGAPRHSLVGVIVPCKEVYFSDRHLKASAARTAPPTLASASLA
                     ASSFAEDMSTTQAALFLFHHHWRVPVTLAINTTVPNSAPSATESRGCTHPRSPGEQAA
                     AHAAATPDGIDAVVTDFVFAQGGRRLLLVRGDSPPDVRLCLSEGSPNGPLSGALGTGI
                     AEEASPMQQAHRALRTGAELVHHVSTLRDQQLEGHKPCDGGTRASALELCVAGYPQGH
                     PLDRTWGATSAAYSASAEAAATGSVVTGDSSVAAARQRSLEFLREFEKDFDAAEHAFT
                     AAVCVAKRRACVVSTEKRSGEPRERARHLCRPQVAMPELKELCRTLGRLGAVRRLWTS
                     FSIYAPHVRAACIHRMLHEKVLLRSPSELQHRRIGSCSFHGGAAAPVIVTQMITTAKE
                     FTDYVEEIQRGLRAWAATAAGGEQREPAGDGPQQQRPVHEAAPTALTPISVIPGVLLP
                     HPTDAHVLLRSLYYTKVIPSARMQKALEVYASELMTAWRQLADEHPRRKREPARQDDT
                     FLQALTEGNNSAATLEISEDRVAQVEARVREVRRCAACRLTSAWLSETVDLLHDLQRH
                     GQARVHLFTMFNDKVDVRVAQLLAAYDAQRGASAEQ"
     gene            complement(<366306..>367565)
                     /locus_tag="LDBPK_100830"
                     /db_xref="GeneID:13392234"
     mRNA            complement(<366306..>367565)
                     /locus_tag="LDBPK_100830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858871.1"
                     /db_xref="GeneID:13392234"
     CDS             complement(366306..367565)
                     /locus_tag="LDBPK_100830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858919.1"
                     /db_xref="GeneID:13392234"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BAC8"
                     /translation="MKLRCFLLRYYPPGITLEYETSAGQVGQKTIGLLSLTPTTPLEP
                     LVDKIIAEEPLLNGKYRDQIFTYLQRLVEKLIAGNNPNQTFTLFKSLRAHMLPLTNCA
                     FNKNGAKFVTGSYDRTCKVWETATGNELVSLEGHRNVVYCVGFNNPYGNRVATGSFDK
                     TCKIWDAESGQCLHTLTGHVTEIVCMSFNPQSTLIGTGSMDNTAKVWDVETGQELHTL
                     MDHTAEIVALNFNTYGDLIVTGSFDHTAKLWDVRTGTVVHTLREHRGEISSVQFNYAS
                     NLVVTGSIDRTCKLWDVASGHCVSTLRGHTDEVLDVAFSVSGNMVASASADTTARVYN
                     TATCHCIASLNDHEGEISKLEFNPQGTKIITASGDKRCNLWSVETGQVLQSLVGHTDE
                     IFSCSFNYEGDTILTGSKDNTCRIWKS"
     gene            complement(<369529..>370194)
                     /locus_tag="LDBPK_100840"
                     /db_xref="GeneID:13392235"
     mRNA            complement(<369529..>370194)
                     /locus_tag="LDBPK_100840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858872.1"
                     /db_xref="GeneID:13392235"
     CDS             complement(369529..370194)
                     /locus_tag="LDBPK_100840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858920.1"
                     /db_xref="GeneID:13392235"
                     /db_xref="UniProtKB/TrEMBL:E9BAC9"
                     /translation="MGKAEQKKKEKIVEDKTFGLKNKNRSAKVQAYVQQVKQSVDQRN
                     PQDRKSQAELAARRAAKEEKRAREAELAKLFNDVDQQQRKKRDAEAAETAEGDDQYMC
                     HPEEYLFRPEDFDEVEQDDERLEEKLEAEREKLKDRTDLTPVTEASFQAWKQRKREEA
                     AEKEAARVRRAKSGDGKLRGWDLWQMDQELFVDDENADEFYEREELEGLDAGEDEAAF
                     DLS"
     gene            complement(<371150..>374974)
                     /locus_tag="LDBPK_100850"
                     /db_xref="GeneID:13389298"
     mRNA            complement(<371150..>374974)
                     /locus_tag="LDBPK_100850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858873.1"
                     /db_xref="GeneID:13389298"
     CDS             complement(371150..374974)
                     /locus_tag="LDBPK_100850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858921.1"
                     /db_xref="GeneID:13389298"
                     /db_xref="UniProtKB/TrEMBL:E9BAD0"
                     /translation="MLRRGLLQAAAAAAATAAVISVRYSSSSSKNGQLWITVCCGTST
                     AFLSHPSGGRAMIRVPLELAQGMILPGGTNTRAASTGGCGSYHPSALHASRVLLALRS
                     TPPHSSSSAVLSSALASAGATHHIVNSHTAEDERGPFEVTIDEVLLHSHDHHRNGAAA
                     AVDTVADLVRLLVDPDLEVGGGAVEAVSLRDFAAMTRKRKLRAVGGDAECLEVLLNSE
                     RYQSEKDARELRLRGVATLGQWKEQPDRVQLSAYTRGVLETAYSRLARHRHRSQTDEV
                     MAWLTRAIQRAVADELMAPKRLTDGAAMADPSAPPYLVDVKASAVRDAEAAMASTAAE
                     QGNDNEGPAAVAGPSGDSSRNEVGDESVAARRRGPRQRPVVSGVMPKASKVAALEEDG
                     VAESEEVADMLDENAEEVLEEGEEMVPIMEEERPARRSAASRSPQPSPAAAATSAGRH
                     GSKRAPAAAPTAPRQQQRQPPPSQDVEAEVEAADVDEDDEELVEEVEEEVEEAEEEEA
                     AATTAAPSSTAPAQPSSPLAPATAPAPPAAAATAAVGATAAERRERLVRLAELMMKQF
                     NTADGYLHPTNKAEREAQEQQGDILVLDEDTAQVDPLAMFSTYHAATITDADPVGVRA
                     LKTIWTSYNKHQMALEEATDDAAVEFYKRESVNALLYGSVLMRALAREEQVVVLEGTP
                     LPPYGFPLVSSDTRPFAVFAAAGASSSSSATAVTDMTPGKVLTAVQAYKMFFNSKEKR
                     YSPFRPAIDQSAGCSVVRLSGTTLHLYYTSTKDHIIEEDVRLPFAEVMLGVLHLLRHK
                     VLPRVNVVHYHLIATKMADPSDSTDFMLRSTATIDLTNPFTKEELARLRALATPLGMA
                     DEMDEYRCIDDLVMDIEDSSGASVVHSLLHNREDLEATLTATLAQLLPEDGDRAAGAA
                     EAAEDAEEKDEEDVEVAAPPPPSRKARGAAAAPASSPSHGHTSRRRAVPEDDEEDTVR
                     VADEQAAEAVPARTSRGKHRQSAGTPLPTAAAAAHASRNREQEEAVLEEAIYNQWQQQ
                     RGTSKTGAAAATTPKSMAVAQHSDDDRASAEEAEEDFDEEYEEVEELQELEEAEKELP
                     PARASARSSLPSASAAAGAGARARGPGAASPAPPASQAQGSSRAVAAVHAAAAYEEEY
                     EEDGVEKEEEEDEEMEVVVAPTIPRAPAGRRAVPVAAAPARPSPPPTPPSPEVRRAPQ
                     KLDDDEKALQVRTRRGARRSTARARALPPAAHEDVEETAATAVEDSPEVSAEDADEDQ
                     WFKKRPKRRYFQ"
     gene            complement(<376577..>382792)
                     /locus_tag="LDBPK_100860"
                     /db_xref="GeneID:13392236"
     mRNA            complement(<376577..>382792)
                     /locus_tag="LDBPK_100860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858874.1"
                     /db_xref="GeneID:13392236"
     CDS             complement(376577..382792)
                     /locus_tag="LDBPK_100860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858922.1"
                     /db_xref="GeneID:13392236"
                     /db_xref="UniProtKB/TrEMBL:E9BAD1"
                     /translation="MRPVLALLSHPPTLHPRYWQMLRRRIATSFFVGVAGAHPCKNGN
                     SHSNSARCLSCSTSLRAGGVLAARAPLLYVYKPPGSSEPSRLPWYQHVSSAPSGSTET
                     SATTAAAASAIGSSSVTAMRSASQSPASPLHSQNISAILQAADAAATAAAASVSQRAS
                     TSPVLTSSKSGVGNVPSPAAATPSAATTGSSATAPAFLSSSIAAATQGAFGAAAAAAA
                     AAASASAALHRQDGALRPTPTRRMAAVSGPTLDARVEDIVKVEETLASELTLPKVVQL
                     LIDPQAEGVERITMSEFVAMQPKRQLLALGGRKEWQQWMEQSTYYQQAARLAAESPAQ
                     DLAALQQAGIQSLQQWLEHPQLVKVSARTRSALDTAVAQSVEAYMAEVVKVVNTSNQV
                     EDILSHWVSDVMGKFVLDSLQIPIDRASQAMWAKRKEWMPADVVHNRGGVPPPMASAS
                     SVSSPSSAAVFGNDVTGRSPLQSVESRMLGEMLSGCGGGVAAPVSVANASQRQQQQST
                     LRPGEACTLDHYLRFVQKVISSVRQDYVANHAAMGAAPGGRGDDQAEREITERSYGVI
                     AAAFTQLLEQAVVHQLPPELQALQQNGYLALDRVPGLLKRAGSLLELRSVPVRYFVFH
                     SSVDEAAAVAATTSHGRSSPADASLSGGAVSGLAVQAPPHYASGTFLTGSNRLDVTLG
                     EWSGQPDPPSSTARESGGIVDDATEQEYLSMLHRLRRRVETLAVTSLYEVIAQPERFG
                     GNGFSAAEAIGLDQLFGPVKLLEDRLTTLLHYPPAAADKPIHFIEAGPLSGKTALLEQ
                     LAERTTRPGDKVVLVRYGGSATPYLPDLDDHPVAFAARFWFRVALASCPYLIRTEELY
                     SRAPRSVYWWGHENNWSWERYQSLLQSARNAGTGHRQYQQQQQCGASSATVAAPAQLA
                     SILVDDVDRALSAMQVKWGNAATLSSVMTTSAAGGSGGMRGGALGHLAHSSSAAAASR
                     KACSGAGVDEDAADGTGEDDADDGDDAEAPARATAAAAHSPSLEQQRQQVMSLWLSTG
                     KSVEEHLYSCFTQISAAVGQVNFVFAGTAATPLLLAYCPAPCRRYYLPLSGGVGLQSR
                     LRVLPLLSTLHALHLTHRLDMPGLLYEVLKNAPALAGKALELFWSHRVSLMDLRTGLP
                     RLTMGNGSAHPQLLHSYVPRELFAELPVYITLLQDPRRTRRRLVELLQRQLSSPTGYL
                     STELDTTPQDVKDGLVLPHNHTSSQVHPFALFAIFSRQDAIDERVYNSEGQLLEGSEL
                     QRDGDAEDEDGVKDGGDGGGANARPKAAEASAAAARLRSSTGVGSNERKVVRAWAEVW
                     AEYRSVVSALSTTPARKRDAMRILLHGALLLRSAAVAGAQLELNLKVPSFGFPLLASE
                     TRVRGSSVHHLRGTAAAAGESLIRSATPETVRRAVSAYKMFFSNAAPSHFPFRPMVGL
                     NGGCDVVFVCGSTLALYNIVATTAQLRHMVARFAEALLGVLHVLMRQVLPADKVRAVQ
                     YVSVVSLDEAQPGVEASLIGNGSGGGHANVYARRRGSVVGGGVSVDVFNPVAAPTVPY
                     CLDYDAVFEDHVIDRLRELQQSLGITKDFRTLSELIDEIEHTHRVRVLQNVVSTPEEV
                     ESLFSPTLLQLVPDSTVLPAYTSAVVSATDLMVQAMSRGAGGRKASGVAADVDDDDDA
                     DYVNIGEEDIVPGAELDDLASEARLLRDAVAGKSTAGGISPSEDLNAADGDYVHESAA
                     LLEAMMNDELDSMTNWTAQLHRQREETARDLQRDLVMEDRINYNAPPPSIGASAAGAA
                     VTGVAPSKPSRAPGQTTAEDAEVDALAWLHDVITPESLIAGLKGSNPGAQASAPSSSS
                     SATAAPGAAASPQGPASPMAGIPPAAAGGGLASHASFAGSIASVTGPWTPNPIPPPVA
                     APDGAGGRWSSVAAGTPTATTQEGERGAGAAPAGGTAATGESGDGEDDSGEEDEDEEE
                     LDVVKPRGAEGSRRKGGSKEGSKMATVASRRPRRESHSSSGKRSSAASRQKRSASTSR
                     SGDRATARSAPQSTSQTKRRKSSTFAAASASSKKGKAAPSYSSSSRKKSSSSRRR"
     gene            complement(<384346..>385548)
                     /locus_tag="LDBPK_100870"
                     /db_xref="GeneID:13392237"
     mRNA            complement(<384346..>385548)
                     /locus_tag="LDBPK_100870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858875.1"
                     /db_xref="GeneID:13392237"
     CDS             complement(384346..385548)
                     /locus_tag="LDBPK_100870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858923.1"
                     /db_xref="GeneID:13392237"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BAD2"
                     /translation="MTTPGASPGGVEYSKKRQDDAEASELRRRMVQRATDAQRAGQEP
                     LERQEGLSESDKWWPPENQNWSGRMFGTPFDMNKKKMDGMFVPELKEVFSPEKPLELS
                     YEGDNFFINPDFHMADETFEETRRFVPPPSFDPAIDEIDDDGFTDSKVMFDIQAALEE
                     DKKRLEAFGNPMTVEDQVDHLLAPQRDGQENIQQRQEFNGFVHWGLLHGAHMVLEENQ
                     DTKRAHEFVNRYMRDIDLFEKWLEHPKVRGHIQKKFGIDMSAKFDKLMALTMAMYTRS
                     KIQVYEDDPAGALKSLTASMSFITEGADLKKERHRKALGAVLVARGMIHCKLKSFHRA
                     DDDLTRALAFVKANRSATLYQLRAEAREALGRIDEARADEERAAQIWEEAEVITPGMD
                     GAPRKFVT"
     gene            complement(<386551..>391812)
                     /locus_tag="LDBPK_100880"
                     /db_xref="GeneID:13392238"
     mRNA            complement(<386551..>391812)
                     /locus_tag="LDBPK_100880"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858876.1"
                     /db_xref="GeneID:13392238"
     CDS             complement(386551..391812)
                     /locus_tag="LDBPK_100880"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858924.1"
                     /db_xref="GeneID:13392238"
                     /db_xref="GOA:E9BAD3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BAD3"
                     /translation="MPPKKRKAVGSKRDATTATAAAAATAAKTRQRKTAGTKTAAASK
                     KSTFKPAPKKRAAQLPCTSPAARMASKAATRKANIVKVTAASATKTKAAPAQKPSSSS
                     SSHTSIRAESQQAANTPERGPTAEKIAVSSSERRKSSPSPQPPVAAEAAAATAPAPAA
                     RAHRKGATVKHPPRTDEELDDGGGIASSAAEEKTERTYRKDAHGNATAAPSTLTARTS
                     TATRSSRPIVVVANNEDESEQEGNDGEDTIFFGSDVVDATRSDGDARQSQLDAPPPPH
                     PSLAASTAAAVEQHLVTSPEVLPTHPLRLLHGGAGGRGGSSSSSSSSATLDLRGCPTP
                     PPPLLQPAVRGTRKQTSDGNNNGADSPSRQSAESSPEALMADSESKPSSHRWQRQLLA
                     GGTPATQRLREKDALQDGGHRQVGSPPAHAAETVKQLFTEPVRSISATSTPADDSPNG
                     TLIMSHGSEEDGVEEADAPGLHRRQRQHHQHLPPPLDVSSIATHSDSESRWSVGRATE
                     GPPLPPGSATAVTPPPLPSLVPRASSAGGAQLFHRHHRHNSGGVTDDLCRGTSTRLLS
                     TQSSALKDDEASPSLQHKAMASAAQSIPAPAGRLRMGGNTSRQSSPSSSYVWLKRTAG
                     GDAVEASHPAAPTSSAASTLFPAHPPFQQQQQQQQWSSYACPHLSFTSPSSSQLSRLA
                     DIDVITEADADAEGGHAATTTTPQRLRLREPPVWRSPQITQLPKSLSVSPVSLRGDSR
                     KGGVKGDAASSLPQPLSQTQPAAHSVSAASSSTGEATQTLAQASANAAGGLQASLHVV
                     PSGPTAAPAVSRPSTQLITKAAATRPIASPGTMWICLDDDDCAGDDSDSEGEGVVGEA
                     KTAAPLHNGSDVPLISVKMEIDAETDAVYTPPEHTAAAAASPSPSGSSHKGGVAVGGE
                     EQTEAPGRLRSRRPSPSKADSGGAGVRVDQSNIPVLSPAQARRRPPAEKSHPIAEILS
                     PTFRPRRRPPDTSADPSHSLGAGSATHQRLASWPASHCYINLDDDTEDEDAEESPPRQ
                     RARNAHALDGAVYSAQPMSSASVADVLPALLRASTVTGADARSQLSLPLIIDDDDDEG
                     VPEVGSETHTKESGDQEVRCEGLSPKPPKPKRGTCVEGANEVVANEEDDDGLLKSPQK
                     PHVKDFIFPNRLDPELRPSSPLYRSIHAYQQQYQQQQQRAQGKEEEEHAARHAAAAAS
                     PLQEGVNADCRHLPQSAAIPVVIGNTKGASPDDVAAAGQAGHKRSRAKDAKTGAAAPA
                     LPDWGRPADTLLRDFFPTKFTKKSFMEAAKNVMSPMHFLEAGDFWAAFASAEFVGEGS
                     FGLVWRCLTVDGDLVAVKSCPIILRTKANIEDSFSTIREIATMRFLSEMQVPYVLPLH
                     SAFFVHAQEALPPLAQEALEWRQRLRKRAEEAALEVEVRLLARGGNRRASHTGAEEDI
                     EDAPLTLEQQVAVQMERLTAAEGPEEQATRARLQSVRLPRFLSITHDDLTQSDATVFL
                     VMELCDGDVEGISRSDGVAKGMVYCVSSALAAMHELGLLHLDLKPSNILFAYEHGPSQ
                     QRLQRFSASGPATDAVKFYLSDFGNCRLVGPDPMDEVQDSYGTFEYMDLRALRDAVCG
                     RPTDAFSLGATLYELLYGRRLYPKCVDPRCRGEEDHSRECFVEAASQPVVLPTVGPPT
                     TAAMVTPVTTIGLNAAAAGHARGPHANGGTGSTSGLICSGPALTPLQYLTLALLRKPW
                     AERMTAEECRRYLVQTFHITQTEDSSP"
     gene            complement(<393550..>395748)
                     /locus_tag="LDBPK_100890"
                     /db_xref="GeneID:13392239"
     mRNA            complement(<393550..>395748)
                     /locus_tag="LDBPK_100890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858877.1"
                     /db_xref="GeneID:13392239"
     CDS             complement(393550..395748)
                     /locus_tag="LDBPK_100890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858925.1"
                     /db_xref="GeneID:13392239"
                     /db_xref="UniProtKB/TrEMBL:E9BAD4"
                     /translation="MDRLYRTTVEPVLLRERQQCGEEAEVADLASVLHRAPKLDFHCH
                     LNGSVSASLLAHLERLLIHDGAPVNGADGDSGRAGDAEAGHILFFDSQEKRRQNVLTV
                     TPADSADRAAVAAAATPTERMHYCFTVFDAIYKVMTNLAFTRLAVQDMLFTSAEENII
                     VMEIRTSMRDGLRRTFRRDAADEEVTKQMYVDTVIETVEHILSGGLVDLATGELLTAS
                     ASAQVLAWGAASVTQRGAAEDEAGEQAAAAPWWQLYERVYGSLLQPPCESSCVQERRR
                     YFLEHIFRNLTERMHVRLLLSVNRGATAAAAWEAARLTTKTQQRQAMEFHSWCTAHMR
                     ERNGEEARRGTANNDSSSPGSPTSATPSSSSPSSCLHRRLRKTCWVTGMDLSGNCYKG
                     KYAELEPALAAARRGEAEAQDSSGIRVTPSITIHAGEKQDPQELHEMVLFAPERWGHL
                     VFTDPANLSAILAAQQGIELCLTSNMLTGGHSHVVDHHLGDLLQLWESMPESRRRRGS
                     DTEGRSAFPCYAATEAVRLAHRQARAMRRCGNLTAVTDPSGAADADSSDAASTFVLPN
                     ISFHTDDRGVFGTTLSKELLLASQHPAIRQLCNRLTANAAGATSGDAAAETPSTAALA
                     HFFWLFERLSLAQLFELPLPVQLLAAALYEHYSCASESVAAHKGGALEVLQGAETGDW
                     RDWPSFVRVCNSVAASPVEATATLSATPLPSRLSRWEWAWLTKCFDRYYD"
     gene            complement(<396471..>396845)
                     /locus_tag="LDBPK_100900"
                     /db_xref="GeneID:13392240"
     mRNA            complement(<396471..>396845)
                     /locus_tag="LDBPK_100900"
                     /product="nuclear transport factor 2, putative"
                     /transcript_id="XM_003858878.1"
                     /db_xref="GeneID:13392240"
     CDS             complement(396471..396845)
                     /locus_tag="LDBPK_100900"
                     /codon_start=1
                     /product="nuclear transport factor 2, putative"
                     /protein_id="XP_003858926.1"
                     /db_xref="GeneID:13392240"
                     /db_xref="GOA:E9BAD5"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:E9BAD5"
                     /translation="MSFEDVGVGFVQHYYNFFANQRDQLAGIYRPNTLLTWQKEQVQG
                     VDAIMARFANLGFTEAAFKQDSIDCQPSMSGGVIVIVNGEVKLRGEDHSLKFNDFFHL
                     AQDNGQWYVSNQVFNLVGGGGQ"
     gene            complement(<397992..>398582)
                     /locus_tag="LDBPK_100910"
                     /db_xref="GeneID:13392241"
     mRNA            complement(<397992..>398582)
                     /locus_tag="LDBPK_100910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858879.1"
                     /db_xref="GeneID:13392241"
     CDS             complement(397992..398582)
                     /locus_tag="LDBPK_100910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858927.1"
                     /db_xref="GeneID:13392241"
                     /db_xref="InterPro:IPR019002"
                     /db_xref="UniProtKB/TrEMBL:E9BAD6"
                     /translation="MGRVKVTPKGKVKKNIPITRVGKKQYLKRRFAHVRAVDVAGANN
                     RFTQKYFEGNNTAEQTFTRLGLAIDPSAPKSVTEKRKAKVRPQTRRVFEEQNELAEHE
                     KMVKATKIGRPVSEQEGSTIANLIERYGTDLKRMTLDRKLNPFQLNMRQLQRQIVNYL
                     KWEKAAFPKQFAEAEEKGWFSVEQFADPHLRSGQRA"
     gene            complement(<399556..>399948)
                     /locus_tag="LDBPK_100920"
                     /db_xref="GeneID:13389299"
     mRNA            complement(<399556..>399948)
                     /locus_tag="LDBPK_100920"
                     /product="histone H3"
                     /transcript_id="XM_003858880.1"
                     /db_xref="GeneID:13389299"
     CDS             complement(399556..399948)
                     /locus_tag="LDBPK_100920"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_003858928.1"
                     /db_xref="GeneID:13389299"
                     /db_xref="GOA:E9BAD7"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BAD7"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAASGVKKSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYVVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<400695..>404204)
                     /locus_tag="LDBPK_100930"
                     /db_xref="GeneID:13389300"
     mRNA            complement(<400695..>404204)
                     /locus_tag="LDBPK_100930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858881.1"
                     /db_xref="GeneID:13389300"
     CDS             complement(400695..404204)
                     /locus_tag="LDBPK_100930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858929.1"
                     /db_xref="GeneID:13389300"
                     /db_xref="UniProtKB/TrEMBL:E9BAD8"
                     /translation="MMRIAPHTPPPHPAGLNRSEHIEAGLPARLQGSSGAPKPTMSNM
                     APPDPRLGHVADTTNGGSSISGIPHEEPVRRSSEVAASSTAGRYEAEQKPFVGMSAIA
                     LQPPPPFSMRHSTAAPFSSSSVQLSPLGDRAGGGTNNHSSSSSSSSSSHSASHTSSHY
                     LVAIQRDLESIVRLQQLQLRERRVSLPSEASTTGSVPRVWIGSEKVVAAPSATGAHYH
                     ITASVDNADSAMHLQSIDHAMRSSFEGEAAAHAPPRQQQSQQPLPLSYHPRLTVAPAG
                     AHAAKASDAAPQLSLGPWQSSLQGDNDMLLSPPPHVASGASISAGAGGFVMHQQQQQQ
                     PPPPPPSSSPIPASLVEYQRYLMQLEHQQRQHREVLRRHRKQRKEEMMAAAQRGAAMI
                     TVPVSMTTPPRQRTGVGAATEDRRDRSPPLAMMMQTLRQRRGDGRGIYSVDTLYGDTS
                     SSASSKTAPSAKQQRGRHSQKQRHPTTPSPTPAAEAQLRDRSGGQRASSRRGRGRGAE
                     GAGPSATRRAGIPAVALRDAPARSGHRQSTPKQEQRRKSNVRNSPANSRSRYVSPQRL
                     ATAVGKGRDVQHLLLHTPPLITGSLPRSSLLASGPTDATPVREYAETATLAHPQSSSP
                     VEAFADALLMDVNGAPGTVGDGASAVGSLPAPPPHLMATHSFAGTAITRETTPYTAVG
                     GTATAPAPIVFAIAPSGAVLMPPGDVADDHRSAAEMAPAAEQKSRHHGSRDQHQGTSG
                     ESDLTTMTTTTPASSTESSPSREMGAHTARAEGGARMHVKGGAATPAAMRPSAAIAAI
                     LQHPDATATAHSRRQQRSRSADPILVHGNNGFNWRLTRRRIRGAGATTTGAETHHNYP
                     DVHRKTRHHLHNGHHHRSMEGISSTTPEHGTGTPRSSRYRYNSSSTTRQRKQSRQLSK
                     HTPHSASGADTRSDGHDGGIKHPVDAAKQRPASPGGGGKAHGRAMPGNGNRNAITAAA
                     TPSYSCPAGGDAVSRLAHSRPLPPSRKAAAIWQDVKLMWTPAPASQAPFAAVYRYHPH
                     THPPASFHAQQQQSLVYRDVSPSAYAGRTAEIARGHTTGRASAAAVRDRVASRALTGA
                     AGASPSAPSPPPVALPHTQQQMASAGAPLLCMTDSLIGAALRDVLPVCRARQREVARE
                     VTRRRYQILPAGVGCATASATVL"
     gene            complement(<405131..>405610)
                     /locus_tag="LDBPK_100940"
                     /db_xref="GeneID:13389301"
     mRNA            complement(<405131..>405610)
                     /locus_tag="LDBPK_100940"
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase,
                     putative"
                     /transcript_id="XM_003858882.1"
                     /db_xref="GeneID:13389301"
     CDS             complement(405131..405610)
                     /locus_tag="LDBPK_100940"
                     /codon_start=1
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase,
                     putative"
                     /protein_id="XP_003858930.1"
                     /db_xref="GeneID:13389301"
                     /db_xref="GOA:E9BAD9"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:E9BAD9"
                     /translation="MRKKMNAVDQAFMASLDAKSNVHQLASGMRFKIVKKVTDTASTK
                     SPNVSDPCSVHYHGSLTNGKVFDSSMDRGHPATFSPSQVIKGWTEALQYMVEGEEWEV
                     YLPPDLAYGTRGAGGVIPPNAALVFKIRLLKVMQGGKPGEDGHRKLEQALSKAYAEL"
     gap             407837..407935
                     /estimated_length=99
     gene            complement(<407936..>411265)
                     /locus_tag="LDBPK_100950"
                     /db_xref="GeneID:13389240"
     mRNA            complement(<407936..>411265)
                     /locus_tag="LDBPK_100950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858883.1"
                     /db_xref="GeneID:13389240"
     CDS             complement(<407936..411265)
                     /locus_tag="LDBPK_100950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858931.1"
                     /db_xref="GeneID:13389240"
                     /db_xref="UniProtKB/TrEMBL:E9BAE0"
                     /translation="MQPLQRHSAASPCLASSARVPLAPRYHAQPPRQQPSAQSNLGLV
                     QSAYAVLHDVHARATQLVDEAEAYLTGAYGATLTATPRARAQPSKDTASKHDNAASAA
                     AESLLQRCLEMQALLQPEGGNAAVSPSLATHLASALSLLAECLPSDWKALLVVQPEEA
                     RAGGVGVGAASAQEASATAPTQEEDASGADSNGVSGEGTSASSTKRGASKPAVASFTV
                     CPSDLVRLGLLLRRQWTLQRDLGLLVVALRDICAVFAAGKAAANSVDNLRASATEDVP
                     PPLMTVAVTLAMLQLPRTPAMLEVHGERMRAERLPVGGGADATPTYPYPCVVTVLPVW
                     LSHASYAAKWRCGEGANVPSASRTTAAPVKAVVSALASALQKTKQLFKWEAHLARYVS
                     IVLEAPPAGSLQPQPQQGNAPSGVGSLSAAGAAPPPHASDKDFLCDVQADMSLERGAC
                     NEVQLLWLTAAAAVVAAAAEADAFCGGALDMGSGALASPGVRKRCDKVERTLRAICST
                     SAVARALLPGVLLLLGCSAARRRSGPEKPTSDAQSRGLHCWMEAYSLGQQVLGSAHPV
                     VAAAAALLPNSAVAASGERQAPPSAPASRTAAHLRAFTAAPSNARNSVMARISGEDAP
                     LPLHPLSPQQQQQRMPTGTLTRLPPLPPLTLSGPEPSRLAPAPSSPALSWSLKSVPTS
                     TATARSSKSGPPLPLGRTLTLPFTISSTAAAADGVARPFRRPSPQSSLSASRLLCSRS
                     LRHCYRLQRPADAFTLRSDVKDAVWLADDKESAKKKNAARRRRERKDQLQSPTAALLL
                     SAISPKSAGAAGTLASGVDADGSTRRQTKRDRNFLPAPGAPTSPPDAAVSPTLPQPKV
                     ELESQQQDQAGVQEPQQGELSEGAPLNLGATVKGVQTVETEAEQQHDSGDGGGSAADA
                     EAGGAPAPPTANSAFTAYQHRGFICTSRLSGSSQMQLRGDGGALHTHVVDTAGAVEEN
                     AKEEEEEEEEEETLPERNARFQREIIKYYAELNERRARAAMTLQRAWRSSKARQILYA
                     YRQALYQYVYAIQKAAALAIEGLLSCAVEQRRRQEALHARAVADARRRDQEQREVSAA
                     QQLTRAARQWLQRQRERRRLRK"
     gene            complement(<413159..>413785)
                     /locus_tag="LDBPK_100960"
                     /db_xref="GeneID:13389302"
     mRNA            complement(<413159..>413785)
                     /locus_tag="LDBPK_100960"
                     /product="small GTP-binding protein Rab11, putative"
                     /transcript_id="XM_003858884.1"
                     /db_xref="GeneID:13389302"
     CDS             complement(413159..413785)
                     /locus_tag="LDBPK_100960"
                     /codon_start=1
                     /product="small GTP-binding protein Rab11, putative"
                     /protein_id="XP_003858932.1"
                     /db_xref="GeneID:13389302"
                     /db_xref="GOA:E9BAE1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BAE1"
                     /translation="MEETNLSFKIVLIGDSGVGKSNLMTRYTTNEFNQETPSTIGVEF
                     MTKSVKIQSRDAKIQIWDTAGQERFRAISRSIYHGAKGAMLVYDITNQTSFDSIPTWL
                     QELRVFVPATCCIFLIGNKCDLEHLRVVKKEAADRFARENGLSFLETSALERTNVDKA
                     FEWLAKSVYEVVVTPQTREADRTAPKQGRTVNMNPSESPETKKTSGCC"
     gene            complement(<415942..>416541)
                     /locus_tag="LDBPK_100980"
                     /db_xref="GeneID:13389241"
     mRNA            complement(<415942..>416541)
                     /locus_tag="LDBPK_100980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858885.1"
                     /db_xref="GeneID:13389241"
     CDS             complement(415942..416541)
                     /locus_tag="LDBPK_100980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858933.1"
                     /db_xref="GeneID:13389241"
                     /db_xref="UniProtKB/TrEMBL:E9BAE2"
                     /translation="MACASVCDAILTFLRKFFSLILAIAMAFFTMMYVIGAGVVTTQA
                     KSFSKSGFAHFLGIVFSIVSVIGYLILHFVPRKAYRLLYAITFLMLTTMFLVAHSMGL
                     AAPVVADCNAAGSLHFTGNYTGIGSIGSILDDNNENVTIGRLGEPVAQCKSNALLFAA
                     SFINMFLYVIALFDVQTVLLARVKSKTYGERFVEMGISN"
     gene            complement(<417325..>418380)
                     /locus_tag="LDBPK_100990"
                     /db_xref="GeneID:13389303"
     mRNA            complement(<417325..>418380)
                     /locus_tag="LDBPK_100990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858886.1"
                     /db_xref="GeneID:13389303"
     CDS             complement(417325..418380)
                     /locus_tag="LDBPK_100990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858934.1"
                     /db_xref="GeneID:13389303"
                     /db_xref="UniProtKB/TrEMBL:E9BAE3"
                     /translation="MAAVLPRPSQHVALQKRNHRSVGRPRPRHISREKSAAPKQRERT
                     RTEALQVRPASDPLHCPSQLPPARRRRRCRCIGTDLRLRTACAAATRRAHPQRAGRSV
                     SGVAHPLQSLLSALGLLWLSHAQPLQAEDSRFGAPPPALALASRGISTPSRRLSHFSY
                     VCVPAVLELSDQRRAIFIAASSASAVRDVTGERPTSGTQFRHGSADRRRRWWLSGRTP
                     PPTGALCGRRQPGVRPQRHLRNSPSLHSQVHSVAPADPLGQQFRCLCPLRERLKELHW
                     EHCEQLTAVQHYIDCEINETVWRDGYDNAITDEYAVRELCGMGFKNNCTVVVGQGTVR
                     LEGCDAAAVSEDAMQRW"
     gene            complement(420010..421197)
                     /locus_tag="LDBPK_101000"
                     /pseudo
                     /db_xref="GeneID:13389304"
     misc_feature    complement(420010..421197)
                     /locus_tag="LDBPK_101000"
                     /pseudo
                     /db_xref="GeneID:13389304"
                     /db_xref="PSEUDO:CBZ32217.1"
     gap             423040..423138
                     /estimated_length=99
     gene            complement(<423236..>427240)
                     /locus_tag="LDBPK_101010"
                     /db_xref="GeneID:13389305"
     mRNA            complement(<423236..>427240)
                     /locus_tag="LDBPK_101010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858887.1"
                     /db_xref="GeneID:13389305"
     CDS             complement(423236..427240)
                     /locus_tag="LDBPK_101010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858935.1"
                     /db_xref="GeneID:13389305"
                     /db_xref="UniProtKB/TrEMBL:E9BAE5"
                     /translation="MDQGSADRRISFRSSSPSSPANVSSSTPVSNKQLSPPTGSLRAR
                     RFPSQRVVCADGNHHTYSHNNSIGSAGGGIVAIARLESQELFGTYPAMPTLQHRHPSD
                     SIVPLLGRPSLDSMCELLSNTSPSLQAAVPTFSFYAAKDNAAVQDCCTLANHHSVPKS
                     VTVIYSQPSSPSDAYLRGADHVSARGISVTEDDANEDRVKVRVEGYYENNGVGVLIPN
                     DLPPSTLLYVLTASDGRDLMFKLIQYSLQLTICFLKTPSLFSPEAQMLMGPMAERLYR
                     NYNTIRHGRSLFKMGRGLLNLFTLQTVCERMWMKYKSGISRTTCTVMLPVVSCLEKGL
                     MSMGASPLWGRYLSCRLLRWTQAAQVTPGQGRSEEPEDSVVPDWRIQQRAHEQPSAPS
                     AKDTLLTDGVYTTSGVEKAERSVTAAQAASGSVAGLKSLKGNIGFALRKVDGCPGGGG
                     VGGGGAGSSQPTPPCAMVDSQTSTSRIQSEQPSPTTGDGAASKGMGKLSLLPRAPSGG
                     LSAEGWGGRASKIATASPTPNAESKREPSDPGALPCVPSGPAAGSASTTSSGEEGTAA
                     PRAKPPHVTDTLLFGLEIGHQQHQRHGLTPSTTANATASTFSLATAATAPILSAHYTA
                     DWVDNAGRKTLLHPLKQSSSINTPTPTANSSITGDDVGDHLHEGVENSIIHNGTPMMP
                     AARSPSYGSITSQLMPELASGGGLTPADGPLSVPNNWRIACAPTVPPSCSDELVVDST
                     LPCSSVELLKPLKSTEALSTVASPSEEMTKVDGTTNSSFTANSADTRTPPPQLLSVAG
                     VSTSMQAATASSVDNTGTAIYDIERNGRHASPLRDRCTVSARSPQLPVTAVLPASELP
                     VMTPTRAASALDDDPPLPAATDGKESDISLISSSTSSCLQERQGSHAGALSTYLRELQ
                     PASAALPARWRKGVLQFNPVLMTLLGIRNLAAACRRFLRDITLVSTERFGTLRFVEVH
                     RHAITHIINRCWLVVSIIDLLLNTARLLQPGWVKYATARQNIHCRCGCYGDNDSSDKV
                     WRTHGFIARRKTDLFFPPLDLDYGAPFVSSLSYVEAADPAQLMAACRRCGCLYREVLS
                     DSDQEGDEAEAADASGGVSMSPSRTLAAMPKAAAAAATAASFSEDGHHRGENHRSATR
                     KPLSTPGLAEREKPRWVQLYNEEVMSGESQQQRLRSPGTRQEEQSPSSGEPQDSPVAQ
                     LEKPRSNGTLKSSAGDGQPADEIRQRRKSGAARERPAESSAGILFVPWIMRKFFDYVW
                     LLRVHPNLTSTVLLEARCIAELYLAYKYCFGNFETFMSDAPLSAILNPYGALAGIVSA
                     SVGLLRVVESAPSS"
     gene            complement(<428708..>429031)
                     /locus_tag="LDBPK_101020"
                     /db_xref="GeneID:13389242"
     mRNA            complement(<428708..>429031)
                     /locus_tag="LDBPK_101020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858888.1"
                     /db_xref="GeneID:13389242"
     CDS             complement(428708..429031)
                     /locus_tag="LDBPK_101020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858936.1"
                     /db_xref="GeneID:13389242"
                     /db_xref="UniProtKB/TrEMBL:E9BAE6"
                     /translation="MLFVQGGSVRDGGESAARRLWGFAKSYVKHVGHAYLEFLGPLLL
                     LVAVNMAVETHDSERFGLGWLYCTSLKDDRVREEKFPSYEPSSAAQRRRSEAASAVEY
                     AAATV"
     gene            complement(<429989..>431590)
                     /locus_tag="LDBPK_101030"
                     /db_xref="GeneID:13389306"
     mRNA            complement(<429989..>431590)
                     /locus_tag="LDBPK_101030"
                     /product="translation initiation factor eif-2b beta
                     subunit, putative"
                     /transcript_id="XM_003858889.1"
                     /db_xref="GeneID:13389306"
     CDS             complement(429989..431590)
                     /locus_tag="LDBPK_101030"
                     /codon_start=1
                     /product="translation initiation factor eif-2b beta
                     subunit, putative"
                     /protein_id="XP_003858937.1"
                     /db_xref="GeneID:13389306"
                     /db_xref="GOA:E9BAE7"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:E9BAE7"
                     /translation="MLSNVPEESEKLVREVSDLAEAFITNLKRGKLAAARSGEESLST
                     AAAVEMADVMSTIVRLFQNAEKDPHSTTIQLLKAGYPAAEVASMQVSRLLILVARTGD
                     AMLRAQFATLFLMNVTRRVLSIVRESAANSKATDAELEDEAKTILNDLASDDEAAVVE
                     TPADTSSSSSNRYGMDDSADPANPSLSAKGMKPALKRDTLVSQPLPRRGLSVRFAGTS
                     NSSEEASGGHMRQLQQHSTSVASDFGGPLLQHTGSIVATEIPGRQLLKRAPSRCEQVL
                     EAGGGEIEFPVRMEIFYQDALDAIDEFKRELEGMTEELCRRSTRQLHSSDTIITLGCS
                     HTIRRYLLEAAQAGHHFKVFILEGAPLPAQATQEFAEALCSRGITAQLLPDSSAYVVM
                     SMCTKVLVGAENVLANGGMLASIGTHVLCAAARHFAVPVLVATTTLKMSPYYPSDQLC
                     TRLVRIARSGAQEMPWSTYGSPEDVWPSPFGVSVSDSGRRLTIHAPVTEYVPPELITL
                     FLTNDSELLPSQIHRIVRANYSDAD"
     gene            complement(<432979..>435399)
                     /locus_tag="LDBPK_101040"
                     /db_xref="GeneID:13389307"
     mRNA            complement(<432979..>435399)
                     /locus_tag="LDBPK_101040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858890.1"
                     /db_xref="GeneID:13389307"
     CDS             complement(432979..435399)
                     /locus_tag="LDBPK_101040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858938.1"
                     /db_xref="GeneID:13389307"
                     /db_xref="UniProtKB/TrEMBL:E9BAE8"
                     /translation="MPPGKMAVSRHKLRPASVASFRKNTSGDMASICQQLHDALQQQS
                     RLELQRQQQLVQYRRQLRTLCDDNATLRNIIQAGERRKRDAEVAAAAGLVMSTGARAH
                     TNGAPNEPATVTEAEMEALSQRINLARRRRNKVLHEIKVDEAALDAEAKLQESLAEQA
                     QIALDPAKLLMGANRPVYLRIMRLEQLINKVLSKQRVAGVVLANYRHHLGILSTEAAQ
                     YDAQQTLLEKEYADRHRDHLKLLQLYDTARAAYATAVEVLQVVQRNASRMRTAKEKAL
                     QQKRREVDKDLVATQQQERRAVDWQQQLEEETQMLESAENTKAQLEQQRMNSHAALTV
                     LQVTSASREDGTGEPSTGTDERVAAYEVAFRDMMRVAKVNTLDALVEAYQAEIEQQYR
                     LQNNLTYVREAQGALEQELQHLRERVKQTKYCVGAATRLATESTVFDAASAIVGTAPS
                     PLMERELQTFVREEKESLAIHVGANEANQALVMEVAERVNHLAELVADYRADVRVPWI
                     QCTAALAKRSSTLPLHVAVLAQKLLALAADAAGEADLGPSSTLSSPVKDAGHGEGAVH
                     DDKDSTSAAAVVSSVQIVIPANNRRVPLAYEGAGGGAGGPGPSGRRGRTAADVAGISS
                     SAARALLHPHGAGPGGREGGALGASMNQRRRRSSAAAGAGFIESTEDEDDVRLAVVAA
                     LPPPGGRVLDFDGASTDTSELHSGILNGSDAGGGARSGGDGAGGDSGSSHRAAAVTRG
                     RRHFSKLPRHMATAGAAGAHQANVQSLARAVEDDQEDPLRREEVKRMSELIRTRQKLE
                     AEKDLRRL"
     gene            complement(<436480..>436947)
                     /locus_tag="LDBPK_101050"
                     /db_xref="GeneID:13389308"
     mRNA            complement(<436480..>436947)
                     /locus_tag="LDBPK_101050"
                     /product="histone H3"
                     /transcript_id="XM_003858891.1"
                     /db_xref="GeneID:13389308"
     CDS             complement(436480..436947)
                     /locus_tag="LDBPK_101050"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_003858939.1"
                     /db_xref="GeneID:13389308"
                     /db_xref="UniProtKB/TrEMBL:E9BAE9"
                     /translation="MVSPESSEGCVCVCWLYAVGCRAERARTKRPMQRPEGERNGGDT
                     PVSSLLSSPPPVFASASWFLLFPPCSPPHTTTYAHTHPSLLSGEALRPLSPLLCARDA
                     SIESFLCCFPSTALYRAPFISFLYLCVCVCVSSFRVQKQACVSVWGRGVGAAK"
     gene            complement(<439203..>441053)
                     /locus_tag="LDBPK_101060"
                     /db_xref="GeneID:13389309"
     mRNA            complement(<439203..>441053)
                     /locus_tag="LDBPK_101060"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858892.1"
                     /db_xref="GeneID:13389309"
     CDS             complement(439203..441053)
                     /locus_tag="LDBPK_101060"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858940.1"
                     /db_xref="GeneID:13389309"
                     /db_xref="UniProtKB/TrEMBL:E9BAF0"
                     /translation="MNGHGPSCSAIKNGVEHRYAHVKWFHEVNSQAALLEAAQAIDQM
                     FYDKREGGVRGSEAKINHGMLADKNARGNGGGGRGNVAVAHGFSNAPACTAIGIEADI
                     QWHPTLETAIMRRDPLPSAVADVFSGDGDGNKDRNAHNDRSPAAKTTADAAEDGTLPL
                     EAFLQTLAEAVKGWRQRAAFLATAPARSPAAAPPLRVIVRLHFEALPAAQQLLTHAEA
                     HTWAGLEELCWQPHSEGSAAAAVSGTARQHASLSVIDHSADASATPCEAQRQPSMPVA
                     SHPPAAVAIELWWSADVVAQSGVTPHPLSFAAAPASVVQGLMARTAQVLGPRVPLGFS
                     LGWVLCPRAVPAEVLAMTKATAASSTTASATTVMPQPRYVFYSLLEDAAAMKSFLDGL
                     WKELDSSVHRHSNGAAVEPGGGTALSGIVGSEGMEKRSDQAVVSASAPPPASRLVRLI
                     TFTMMFESVFADVYTAKERQQAFEWSVAATASLNAAARKADETRRVAVAVLEHTTKLF
                     SASHVTTSATMKTRMSSTASKVVETEQLEEESLKHAAVPTAATMTPSGDPRAFPTFRK
                     AIRPPSPASLAVVSPVAQPMSSTKIDDDGAFQLNVDRAARVFFPCCSIDT"
     gene            complement(<442337..>442477)
                     /locus_tag="LDBPK_101070"
                     /db_xref="GeneID:13389310"
     mRNA            complement(<442337..>442477)
                     /locus_tag="LDBPK_101070"
                     /product="histone H3"
                     /transcript_id="XM_003858893.1"
                     /db_xref="GeneID:13389310"
     CDS             complement(442337..442477)
                     /locus_tag="LDBPK_101070"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_003858941.1"
                     /db_xref="GeneID:13389310"
                     /db_xref="GOA:E9BAF1"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BAF1"
                     /translation="MALQEATEAYVVSLMADTNLACIHAKRVTIQPKDIQLALRLRGE
                     RH"
     gap             442673..442771
                     /estimated_length=99
     gene            complement(<443181..>444383)
                     /locus_tag="LDBPK_101080"
                     /db_xref="GeneID:13389311"
     mRNA            complement(<443181..>444383)
                     /locus_tag="LDBPK_101080"
                     /product="ARP2/3 complex subunit, putative"
                     /transcript_id="XM_003858894.1"
                     /db_xref="GeneID:13389311"
     CDS             complement(443181..444383)
                     /locus_tag="LDBPK_101080"
                     /codon_start=1
                     /product="ARP2/3 complex subunit, putative"
                     /protein_id="XP_003858942.1"
                     /db_xref="GeneID:13389311"
                     /db_xref="UniProtKB/TrEMBL:E9BAF2"
                     /translation="MAALKLFECKPDTVASAGPAPPHRLYTFGGCTYELSSLPEGHTS
                     KGAGEPLSQPPVSCSTTAPTTGAAAPRSGSGSGMEGGTHARVPCAEAGIASSCAEDGT
                     RLRSSTSYPSIIIQFVCPIPHAQLNRYNNLDHALSTALQQVAPHCTYGLPSPCPAEAA
                     SAAATSLSSIALCIPAEVTPQERCAAAAFAADLSLHALRPVLEGLLQHSGATMQKECL
                     LLLPRTETTTSTAASQPVVDSASIFSAKALFITATPTPAALVSHGTSASAKTAPACFY
                     SGTVSLTVCVGTDDKGEAVLMRRYLDAFADVKRAPVLLLVRESAEPPPEVAAEAGWAM
                     TTEHLYAWWCTFVLAPHQMTSAASVERLLRWARELRPTVLFHVHQERMAMHSLLRQQL
                     STYAAHFD"
     gene            complement(<445728..>446753)
                     /locus_tag="LDBPK_101090"
                     /db_xref="GeneID:13389243"
     mRNA            complement(<445728..>446753)
                     /locus_tag="LDBPK_101090"
                     /product="nucleoside phosphorylase-like protein"
                     /transcript_id="XM_003858895.1"
                     /db_xref="GeneID:13389243"
     CDS             complement(445728..446753)
                     /locus_tag="LDBPK_101090"
                     /codon_start=1
                     /product="nucleoside phosphorylase-like protein"
                     /protein_id="XP_003858943.1"
                     /db_xref="GeneID:13389243"
                     /db_xref="GOA:E9BAF3"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR018017"
                     /db_xref="UniProtKB/TrEMBL:E9BAF3"
                     /translation="MSGSGCGFLGNVDPDLPLTPDGVTYHVACSSERLADRIILVGDP
                     GRVKMVSTYLDTGSIVYEASHREIKVVTGAYHGVPVTVLSTGMGTDNIEIVMNEVHIL
                     KEYDTQKRRWRARVGDDTPADPLETPFDPSRVKLIRVGTCGTPNDEVQIGCLAITRYA
                     VGMDNTCQYYDPPAVNHTADVKEVLAKVQATSLGKVQVYATKAAPAITQGLVDACTAL
                     NRKAGVSEQQPYYVGTTCSGSGFYGCQGRSVGRFRGHLTVPHLTEELGDLRFNVSEGE
                     QRVANIEMENSALCYLSNLLGYQAGTVCVVIARRSRTNRTFATPEQLAKGLSRAITIA
                     LETLIKE"
     gene            complement(<448087..>449274)
                     /locus_tag="LDBPK_101100"
                     /db_xref="GeneID:13389312"
     mRNA            complement(<448087..>449274)
                     /locus_tag="LDBPK_101100"
                     /product="carrier protein, putative"
                     /transcript_id="XM_003858896.1"
                     /db_xref="GeneID:13389312"
     CDS             complement(448087..449274)
                     /locus_tag="LDBPK_101100"
                     /codon_start=1
                     /product="carrier protein, putative"
                     /protein_id="XP_003858944.1"
                     /db_xref="GeneID:13389312"
                     /db_xref="GOA:E9BAF4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BAF4"
                     /translation="MLTESSLMEADGAVYEPSAAHGSTSVHAPHHHHNSHHHTHTHQA
                     HQQHSSASHPHSSPLGFLTHDVEEDPPLHEHTTSVNRSYSDLHQGAFLCYAFGLCALR
                     TALQHPMNLALARKQTSAAANTMTTWGVLSHIFAHEGRWRGLLQGIGSLSMGCALSEV
                     IYLCIFEWGREQVPIDGTATRDAISGYAADVMCRSVHIPLSIIAYRQMTASPSRRMNS
                     WRTLQHMYSERGLRTVFAGFGTTLVVGCQWTAIWWAMYGRLKSFLYDTSGPHLQRLSE
                     KSKASQRGGDAADSGWRLPSWCISSDDNVLINGAASVTTSAATAVLFNPYLVVRTNLQ
                     VTPGATLWSVTRQLHRRRGFRGFYSGLLLSVNACVVDGVLASTSYEYAKLWADRTRDG
                     HAR"
     gene            complement(<451139..>452287)
                     /locus_tag="LDBPK_101110"
                     /db_xref="GeneID:13389244"
     mRNA            complement(<451139..>452287)
                     /locus_tag="LDBPK_101110"
                     /product="RNA-binding protein-like protein"
                     /transcript_id="XM_003858897.1"
                     /db_xref="GeneID:13389244"
     CDS             complement(451139..452287)
                     /locus_tag="LDBPK_101110"
                     /codon_start=1
                     /product="RNA-binding protein-like protein"
                     /protein_id="XP_003858945.1"
                     /db_xref="GeneID:13389244"
                     /db_xref="GOA:E9BAF5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BAF5"
                     /translation="MPPKSTVKKADSAAATGKRKKLSFAESTVKAAAAAIHTTNVNVP
                     VKAAAKHAPLGAAPRRKGQNAKKTTVNTSSAAKQRAATDLKRSGIVKAKRTEEEVAAP
                     PAPSDEENSSDDEDDMLNGGAAVDSDADDLSDMADRAPSDDEDDELGAGKQASSSASR
                     QRDSNGTVEPYRAVRLSFLPPEFQEPQLYKFLNQFGATVLNCFCVRSKRTHRSRGIAY
                     VEFDKESAIPLVVEECNGMALGGKAVRARAVTMRRRMPSRQMVSRRRALAYAYKTQGA
                     PLKKHDVRRKDPVGLLIKAVRTEKDNNNYLESLGIDFKTDFFQSQLATLPPGLLKKKR
                     SRSKKSENNTVAAAGMAKAFIKTTDIVTSAPKSSPKRATRRAPATKTK"
     gene            complement(<453446..>457117)
                     /locus_tag="LDBPK_101120"
                     /db_xref="GeneID:13389245"
     mRNA            complement(<453446..>457117)
                     /locus_tag="LDBPK_101120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858898.1"
                     /db_xref="GeneID:13389245"
     CDS             complement(453446..457117)
                     /locus_tag="LDBPK_101120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858946.1"
                     /db_xref="GeneID:13389245"
                     /db_xref="InterPro:IPR010441"
                     /db_xref="UniProtKB/TrEMBL:E9BAF6"
                     /translation="MTQTSSSEVVSVGRRSTAIGKESSLAAPSLSTAATPFSLRTGAA
                     LPREILAWLQSLQLGGSVKYPKRDLANGYVIAHICARYWSHVPLHSFENKASAASKQG
                     NWFVLRKVLRQKGVDVSAAMVDGMMNGADDCASAFLQQLYTVLTGKHADTEAVPLEDA
                     LPDVPASKVPVYVPTSTGGAAARTRHVGGTNGPGLSAKVDSRSDFAGGGNKAASLFGA
                     AAADVSILDGTSGKDVRNAPPVLLPPLQSSLPVPTHTQPAASPSSGLTEEAAAASKPL
                     LNVAVRAAGEVSTVLSAQQASASAADDATGAPMPAQVSSLAGSWFCMKVREAVPVDAL
                     EALMEGDEAASAPRPSLSATLRWLSAFPSGDGDVEGEMKAALWSTDGDGHKVQQALLR
                     TGAWQAILGAVPELAQIIVHHGGHGLDALVDCLFASVMSVQSRIGGGGEGDAGGGAPF
                     VFVRNAVHFSAVLLATLSDLNVHHAIACFETYFAASPTFAQALRGLRWSLATDYATLI
                     TAVLPANRRLAATVLSSLWGTIEYAVRDSAAEETVLAGEAAAGNGEINSVGAEDMAEV
                     CLLVLLRALLTSLQPSSAGASSHTPLEAPISSHAQIDASGRTMTSTVRRTAPRSSRST
                     AITASTSQDAVSKALVQLAEKRSVAVLQQSAMGCASATGVGIDEALVAAATEKEAAAV
                     ALAVQVLRMELHPSLMAACVAGGRFFDVYNALFPSSDSAAKPIPPNASSPTLSVLRAR
                     WLRWCLQRRFELGLYSPSPVTSAVATVSLSPLSQQRQRVSHAVASFGVRDEGGHRATT
                     TTLAQEHDFSVDSAEMRALLTGVQILCRELSSSTESLKPADAQSRVLVACALAESLPF
                     LPAKYKTESTGVDGGDGQPSAEAVESPHDRDGGSAFAEDAAEAALKVLMHEATPAQMR
                     SILACTSELRAGAAVQKGEELEDEAQWMVHRYVGPLKPSGLLVVKSDALLLVKAALSV
                     VSSGGGHTGNSGGSGLSRSFSVAGDKDVKLTGGTGGARRLAARAAVMAREGQVDEKIA
                     ERVRWLASLLVEGRACVRSGAPPLFPWRSTGDSGAARRSPSSLREDTATVASAASEAE
                     VLQWQAVLSHCYEDLVLVIQAASSRLRQRGGAGASGNPNAAETHFSEVVGKELLMLAQ
                     KAEGVVCILWRELAPILAVSAALGSKSESERRFIGAATPSVVASSAFIGSSLFSFLED
                     VSHEEVATAVSWICAVAGV"
     gene            complement(<457668..>458495)
                     /locus_tag="LDBPK_101130"
                     /db_xref="GeneID:13389246"
     mRNA            complement(<457668..>458495)
                     /locus_tag="LDBPK_101130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858899.1"
                     /db_xref="GeneID:13389246"
     CDS             complement(457668..458495)
                     /locus_tag="LDBPK_101130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858947.1"
                     /db_xref="GeneID:13389246"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BAF7"
                     /translation="MGEKEAVTCVCVCVRFCDSATRVDMLRHCPLHRCLPISVACRVL
                     GFQAPPTSKHDLRKRFVQLTKECHPDLHAENEKAATAKMVQLTEAYTCLKKLLEHRVQ
                     YHQGAGLGPRPSSASASGEGSAAARPHEDVWAEVTASFRAPGSSISLRGFTLPWQRTT
                     SNSVISSLEAKMREANVSFSDFVRYARHLEKDRQTKENRIRADAAMADGTHGFTAEYF
                     ESVNKNSAFRRATERRRLPMTHLMTLGAFYYGRRLRNGIEQAPRGAWRTLRYVVLGH"
     gene            complement(<459155..>460123)
                     /locus_tag="LDBPK_101140"
                     /db_xref="GeneID:13389247"
     mRNA            complement(<459155..>460123)
                     /locus_tag="LDBPK_101140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858900.1"
                     /db_xref="GeneID:13389247"
     CDS             complement(459155..460123)
                     /locus_tag="LDBPK_101140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858948.1"
                     /db_xref="GeneID:13389247"
                     /db_xref="UniProtKB/TrEMBL:E9BAF8"
                     /translation="MKFHLHVVDGSAPARGGAAPFSSPPTAAEATQATALMLFAHMTL
                     RCGHLSDVLAVSASTTPALARAAALQPQQNQLHSGAAQLGNADTSVSEDTQVLQMAGK
                     LLSGVIDNDAAAGLPYMDMDGGDARITPYAYFNSSFSEAEQSLRRAVCILAEGGTAAP
                     PPYFDLIATTDMATFDYIIEYYQQQRVRHGGAVTKGRGTKPVGVMHIVADDPSRAALV
                     LQRVVELMLKRSGWTFSVDARAAAEEEALAAQTEEDDDGDDEDGGGGDAGTAGGRGSV
                     VSAGTGGGGVQAGARSGSVDSWVNHIDEAVHLFAQLFGVDVLVTLV"
     gene            complement(<460760..>462538)
                     /locus_tag="LDBPK_101150"
                     /db_xref="GeneID:13389248"
     mRNA            complement(<460760..>462538)
                     /locus_tag="LDBPK_101150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858901.1"
                     /db_xref="GeneID:13389248"
     CDS             complement(460760..462538)
                     /locus_tag="LDBPK_101150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858949.1"
                     /db_xref="GeneID:13389248"
                     /db_xref="UniProtKB/TrEMBL:E9BAF9"
                     /translation="MWHVPPHKSAHDSISSSVAASSSAVAPSALSEDLARLLAWGRHA
                     LLAQRQQRRASSTSLACADQDSMSPRPPRLSSSAAPVSTPVAPGTDERSWELHAQGLK
                     ASASTSDFSRTTADAPYTVEQARKRLAQLEELEAANTRVFESRWALLSLGRERLLRLH
                     RKQREGEAPSPHTRHLQRLTVAVQAIVEGEASLKEALRDMLRGLAELYQRHQLHHGQT
                     EEYAAHSASAREKKATLLESVHGGGSCDSEEDAGAKESAPDSLRSLADAVVRRTRLLL
                     DSHCELQRARAEQRRAATARLQRRAESEQALQHRLERLKAAVAEATKEEAHERRRLAE
                     LRAQCAAAERAAALQNASALREQATKEALQRLQQLHQHAAFQDAIARQELAASEARYH
                     EAKAAYDMAISDHHAAEEALAAAQQAYRDSKRRREDAEDDLERVRQALKSVSDKYDEV
                     HAQRAQAAADCAAVDEALYQKRRARDGRLSGEKGDDSSEVAAAFCLGGSSAANGAAER
                     YTVLQRELPRLERHLQRSVEEVVALERTEAELRGTLERERSALDLLRRQKTALEAHLA
                     SLESCVDGALGVVAREKAGSQGPAVW"
     gene            complement(<465380..>467575)
                     /locus_tag="LDBPK_101160"
                     /db_xref="GeneID:13389249"
     mRNA            complement(<465380..>467575)
                     /locus_tag="LDBPK_101160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858902.1"
                     /db_xref="GeneID:13389249"
     CDS             complement(<465380..467575)
                     /locus_tag="LDBPK_101160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858950.1"
                     /db_xref="GeneID:13389249"
                     /db_xref="GOA:E9BAG0"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BAG0"
                     /translation="MNKNYPGRITSAPLAQQARGMSLRPGAPASFLDRAQPGGAGTGI
                     GAQQPHHHSSLPRAPRAKLPTQLQAPAPAPPPPKEEAEEERSGAAEVVPSEVSYPEDH
                     IYDVEDFIKLRKCQAPVPSEVMEYARAMWKEMPENMDDMENNSLRDNLFREQNASTMS
                     KVMTDRKINNEVLGILGKVTASNLEKMKKELTDLPIRQSTKEEIDEVIKVFFNKSTKP
                     EDSCYTHLYVQLIAHLISSIGEREEAGRMIRNEVLRQCRSTFMNSGAEAVELEKRMAT
                     MSPEDAEMERIQFSGKQKANIQFLGLMFTSRLVRQKVVHAVLDSLLYGPGHRRHIPTD
                     YSLIHFMELLQVCGPHLDAAFYEDPLPRYRETITELSNSHPQKRIQFLLQNFLETMNN
                     NWVPLHGPGARRTEGGGSAAQGNTNNNGSGTLLNNNGRGGSLPTMPLAPMPIQEAQPR
                     IPDYEEFSKVMDDFFMSSSVDEIVSIMSSIPPEVVVVYCTKWLGRYINTYKYTAERTR
                     LGELFETLMKKGALTTEQAQEALLQHVQKSAEEELFTDIPKYFVHWASLIKHGHSVFP
                     YSLHTKVLNMLVDHHVSMEVIANMVRDVEADTKPDQLKDLKPQDRFRVLQALLRYTPP
                     MFVHEADDDQQPKQTVLDLVGTIDPEVTYFNELCTSYDDDNFHASPALSDMQKQSPFL
                     CASAFFTFVRYDVNFLCTQYKELLRKIFTARPADTLLVEVYLQWKCLGCS"
     gene            complement(<470701..>470937)
                     /locus_tag="LDBPK_101170"
                     /db_xref="GeneID:13389250"
     mRNA            complement(<470701..>470937)
                     /locus_tag="LDBPK_101170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858903.1"
                     /db_xref="GeneID:13389250"
     CDS             complement(470701..470937)
                     /locus_tag="LDBPK_101170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858951.1"
                     /db_xref="GeneID:13389250"
                     /db_xref="UniProtKB/TrEMBL:E9BAG1"
                     /translation="MPHFVHAFFLFTAIAVMGQARRADVMVRNVGTETTNGTLLELSN
                     VICNARCISLPRLFQTPPGPVLPSPPHTYKHRSA"
     gene            complement(<471701..>472234)
                     /locus_tag="LDBPK_101180"
                     /db_xref="GeneID:13389313"
     mRNA            complement(<471701..>472234)
                     /locus_tag="LDBPK_101180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858904.1"
                     /db_xref="GeneID:13389313"
     CDS             complement(471701..472234)
                     /locus_tag="LDBPK_101180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858952.1"
                     /db_xref="GeneID:13389313"
                     /db_xref="UniProtKB/TrEMBL:E9BAG2"
                     /translation="MQAVLTHIHKANVKALVLSRMNIAMVVLDGIAMLMLIVTWALSV
                     KREQGGVLARYAAGIIGFVLLAITMMLSILVQRLQPRLSILYAHQVMAVLTLILSSLS
                     MGMNDVVVDLCNRGKQVDKTQCGSHIAETIAEVIIALTMVFGFGSSQQRIVTFIDKGI
                     LDGIKGRSNAGGLTQLP"
     gene            complement(<473876..>475150)
                     /locus_tag="LDBPK_101190"
                     /db_xref="GeneID:13389314"
     mRNA            complement(<473876..>475150)
                     /locus_tag="LDBPK_101190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858905.1"
                     /db_xref="GeneID:13389314"
     CDS             complement(473876..475150)
                     /locus_tag="LDBPK_101190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858953.1"
                     /db_xref="GeneID:13389314"
                     /db_xref="UniProtKB/TrEMBL:E9BAG3"
                     /translation="MSESRRFLKGLKDKPHHVTIALEDWHAAVRGRVKPLSHLYGVSD
                     REVRREIQRGNVENRTFRIRHIVPLFVSKEELLCTENLRRIAKERNLDLGALKRSRHC
                     KPAQAYDAGVRSVPPALPLDIGGALAQVLTTRLTTCFGLHLIVTVQNEDAEQKSAPSL
                     LMDAAVRAHLERLPLPVLHRLISDLCEVRAAWKRDLLAPSAAAAVQEQALLGRESINA
                     LLYHVCLWQRRYPLELLSAVLSFYDEHKHLFSPATSERCSAPAQLESLLEEVHCLQYP
                     DLSDVPGLIRCDVFMTYPHMPLEEQRQLMHKIAAAAVHREAAGSLQRQSSSMGAEEEY
                     ATDNLLRHSRTPPDPRLLLRSFVADGAPTIPERFCTDMPTQTYHEMRAAFERHKHDGV
                     RRLAAQDYGRAATGLTPPPPPPQPAAFPVPPS"
     gene            complement(<477615..>479186)
                     /locus_tag="LDBPK_101200"
                     /db_xref="GeneID:13389315"
     mRNA            complement(<477615..>479186)
                     /locus_tag="LDBPK_101200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858906.1"
                     /db_xref="GeneID:13389315"
     CDS             complement(477615..479186)
                     /locus_tag="LDBPK_101200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858954.1"
                     /db_xref="GeneID:13389315"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:E9BAG4"
                     /translation="MIGPNESSNADRLEYLYLNLVGQTVLIHTVDGALCEGLFVSRTD
                     ADVAADEAGVFISFPRNLPSKVHSALDASELSDETRLFRYEDIIMMEAKNMKLRTETP
                     GAGHVHSYRGEHDLKTLDWAAEGADELLEADSHVTGQWDQFKANERFGVASTYREELY
                     TTKLDESKLSKEQIAYAERTAKEIEGSGTRNLQHRLERADVTTEYVDEGAMFSDVARD
                     ARGSKRSAQATRKEAAATTSAAPAAPAATPAAITATAGRGAVRQAAPAPAPPPLPEEP
                     VTLPPPPAPEVSSAQQKTVYSPNPSATPFVPPLKSFLANVASLVANNDNCYACPTDWP
                     GDIDFYDRDVSHYSRPQTLVQPNMHHKYNQPVMNPMPGRGAPMNHHQHHAMNPHPAVY
                     NAGGPMGGHMGNPHVQQQHPQYMDPSNNNGMMPPQGPGAIPGPSPARMQQQQRASKAS
                     QPQQPVHTAAQTIPPPQQQQPHQQQQVSAIDSSGPQQDRAAPGTKKLRRGGMATAARQ
                     DGGEGAQGGGKKGGK"
     gene            complement(<480282..>480701)
                     /locus_tag="LDBPK_101210"
                     /db_xref="GeneID:13389251"
     mRNA            complement(<480282..>480701)
                     /locus_tag="LDBPK_101210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858907.1"
                     /db_xref="GeneID:13389251"
     CDS             complement(480282..480701)
                     /locus_tag="LDBPK_101210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858955.1"
                     /db_xref="GeneID:13389251"
                     /db_xref="UniProtKB/TrEMBL:E9BAG5"
                     /translation="MHDANRFGGRTAYLREIGPIDHKKKGRLFKRDLPTLQFNVDVWC
                     AQQTLRKQWKGRDWDVVEMPFEMAPKELQRVVPEKYTDVPMMADPARHDYMNIRRKVF
                     DREDMQDALFASGGADQPPYPAIQRVDKAAMTLDKYL"
     gene            complement(<481829..>486412)
                     /locus_tag="LDBPK_101220"
                     /db_xref="GeneID:13389252"
     mRNA            complement(<481829..>486412)
                     /locus_tag="LDBPK_101220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858908.1"
                     /db_xref="GeneID:13389252"
     CDS             complement(481829..486412)
                     /locus_tag="LDBPK_101220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858956.1"
                     /db_xref="GeneID:13389252"
                     /db_xref="UniProtKB/TrEMBL:E9BAG6"
                     /translation="MSSGAPAAVETQGYDEAGPRKMSHRTKHRKEVKRYHQRQQNKHL
                     REEAKARDAQLFLFETTELPARGAEQTRDDAHYAPVETARASSALTTVAQKGAAVAFI
                     AAGSQPPRPTSEQHPNQQILLAPASTTSAAATAAAVTSAHALTSASPSSWDFEFLLRA
                     SPASTSAASSPAECGGVDSCATGAVALSTIEDATACRSLSVLEPLQSHAVVRAVQRGR
                     VALPDAASRDLQISATAASGDRLLPESCAPQHSNARPSANWDRISVLPIYSGASSTIT
                     KLLNSTHVQRVEGVKAIPMQAPLAPGTDMNRPPRNYLTLDPVHNVHQHAPGFLRNQRV
                     ALQHMLASAVMEWKDMQQNALIVSSAEAMRTIFEQVYVPERPLALRVQRIGPTLVIDS
                     RASEPSEVHEMRQQALFGKALYLMKETHGQATVEADEAAAGAAGQLALALPERRLSST
                     AASDVHFGANLHRYSQVLRWRMDATEVLIGIDAPIVMDQRTNTEQLVRMKEKVPVGPA
                     DAEQRETLRCWFDAMMANVSQVGTYVHHDGIVQSHQVKKTMDILDSVEARMAAAALSF
                     TSRALQWLVKQCRRDGGTYAVVRDYPLEYVELYELPDLDDSAAFVEETDKYFGCAAAA
                     AFASADRGAAERVADGEAYVESEVPATTSSGYGIGGPPTASQLNRFNWNFGKTCFNIG
                     QHLFRSGDLSRAGDALPLLHRSLRIFLPSCREDLAARETVAELVRMVPVLVVRKLHAD
                     AAQTAAAVASNSTAGRPKNAAASCAAGLCSPPEVYRDALLLCGRFEIPLRHMLVEAGK
                     WEGGQLMRAFFARCLVVCSAAACAVVALSLEAYYCGCHHLRALRMARNEAKAKEGKAA
                     LRGAEHREEVMAAISSCTQDLLQVVVEGLVRLEEASELVGPLHSAAAATAAVAEAPTG
                     TCATDESTSVNGATPVSKEGKSSKEEFCPATSPTGSSRASLTEHSSQQLPSATSPTHT
                     SEPSGLKKCSRGADMVAVSASCSAVVDPRTQVDITPLRSALCELYGDVAVAAMSEAAS
                     GFSIRVLRELGRRMEARLQQRGLKLPTTLVWLTTLKADVVSLSFTALRFYGRIGTHTR
                     RHLVKLALVYYLVGKENHRTARYTKALEALHRAKSLLHASHKAAEDAVFGAVFGSHGM
                     LQWADVMQLLGDVYRSVVERKLDGALGVAAATLAQPLLVGPLHELPEDADSFFTQALS
                     AYTQGGSDKACRYAKAYTLLLYASVLMERLAVSGVPATHAASQRIAQLIREAEELAPS
                     TFVQEREWQTLRLFTVTSAATQDTALARTVEEILLRTTTTTSAAASSSRARQNPPAAM
                     TGGGDDASEASVARKESHSADANVAECGGCRRERLVTLPPWPMLMELQQALVCCAMVE
                     REAPQSQSRPREATKVASTEAKYRGLLRWVGRAAGYLTSVLEYCKTRSGELQGAAARH
                     QWQSVLRSWREQEPGLLMHRMVSMIALRLLGAAQALLPSAKQQEARGAVKQIVCALDH
                     AATVKAGDAEGHAAAVQQLLRDLNALLAPFVEW"
     gene            complement(<488576..>489658)
                     /locus_tag="LDBPK_101230"
                     /db_xref="GeneID:13389253"
     mRNA            complement(<488576..>489658)
                     /locus_tag="LDBPK_101230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858909.1"
                     /db_xref="GeneID:13389253"
     CDS             complement(488576..489658)
                     /locus_tag="LDBPK_101230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858957.1"
                     /db_xref="GeneID:13389253"
                     /db_xref="GOA:E9BAG7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BAG7"
                     /translation="MGNRTSHEQPTATGITDIELRLAPHNFYLVFGKPSIQFARDRVR
                     GPLIYDVEVEYDDDENLVERATMLDLTCAVPRRQKIELISAPLASPQAVGASKGLALT
                     FQIAATQPPERVRVYAGASVEYRARDGVRLKTSGGVAAGSVCILDTTETDGLTTVVTN
                     PLVLPQLLQPLKYEETASTLATSTVQRVSYAPLAIEVLVGATEDPINKTQQCAPADKA
                     AHEATPPRSQPLQPSKREIVQYTFLEAPEEASPQPASSLGGSEARAVHRFTCKVAKQL
                     LQVGNEVYDLEDVFDDGREDAVRDPGADEESEEGLCVICLTNQKDTTILPCRHMCLCN
                     ECAAHLRLSDNRCPLCRGYIDRVMTL"
     gene            complement(<490683..>492125)
                     /locus_tag="LDBPK_101240"
                     /db_xref="GeneID:13389254"
     mRNA            complement(<490683..>492125)
                     /locus_tag="LDBPK_101240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858910.1"
                     /db_xref="GeneID:13389254"
     CDS             complement(490683..492125)
                     /locus_tag="LDBPK_101240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858958.1"
                     /db_xref="GeneID:13389254"
                     /db_xref="UniProtKB/TrEMBL:E9BAG8"
                     /translation="MSFFINKTCDVFPPRRRGQSDGALRKELNARGAPRDSAIITKTE
                     LDIIRGMIDGRFPGSLSGTAATAVAPRTHTEAAEEHRRRMQEFDAERARNGVAPRTAE
                     EIEQAQLRQVNLEKARLMLDEECDEVKAMNRIIMEAKCVATREAQRLEKQKRIEEETV
                     YNRQMDALMAQEAETAQQVYLERERQRMEEQRRNAAMIKAQLHERYVERVRRLERHQQ
                     EQDAMSRHIERLQVEEKAEKLRRIDAARRLMEEAAIANAEQIALKQREREMELEEDRK
                     MAEYIKQKEARDEAYAEEQARLRREKDMEIARLRANQQRVQDKQAELEELRVRRVQEA
                     YIREERRKEKEAAERESAMHADLQQARLAQVEERNRQKALEKVQEQEELDRMLAVQKI
                     SREQELERQARTRRLQEENSLALLKQMMDVEERRRRQRQEEIEEGNQLRKAARERQAA
                     LEAIRDRKLGELEELDVPEQYRRALLKVGK"
     gap             493189..493289
                     /estimated_length=101
     gene            complement(<494652..>495302)
                     /locus_tag="LDBPK_101250"
                     /db_xref="GeneID:13389316"
     mRNA            complement(<494652..>495302)
                     /locus_tag="LDBPK_101250"
                     /product="rab1 small GTP-binding protein, putative"
                     /transcript_id="XM_003858911.1"
                     /db_xref="GeneID:13389316"
     CDS             complement(494652..495302)
                     /locus_tag="LDBPK_101250"
                     /codon_start=1
                     /product="rab1 small GTP-binding protein, putative"
                     /protein_id="XP_003858959.1"
                     /db_xref="GeneID:13389316"
                     /db_xref="GOA:E9BAG9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BAG9"
                     /translation="MANPNTPGGDCDYIFKIIVIGDSGVGKSSLTVRLSEDVFYKDYA
                     STIAIDFRMHQMNYMDKRVRLQIWDTAGQERFQSVATAFYRGANGVLLCFDLTHRPSF
                     IHLEQWMERVKQQALPGIPCLLVGCKSDEARSSRQVTREEAVAWAQQHNMAFIETSAK
                     EKENVQTAFQQITKFIFEDMKERNGKTPTAGDNAAGRSQSVNFDRQRSNRKESKCC"
     gene            complement(<497072..>497743)
                     /locus_tag="LDBPK_101260"
                     /db_xref="GeneID:13389317"
     mRNA            complement(<497072..>497743)
                     /locus_tag="LDBPK_101260"
                     /product="small GTP-binding protein Rab7, putative"
                     /transcript_id="XM_003858912.1"
                     /db_xref="GeneID:13389317"
     CDS             complement(497072..497743)
                     /locus_tag="LDBPK_101260"
                     /codon_start=1
                     /product="small GTP-binding protein Rab7, putative"
                     /protein_id="XP_003858960.1"
                     /db_xref="GeneID:13389317"
                     /db_xref="GOA:E9BAH0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BAH0"
                     /translation="MEEDLAYKIIVIGSVSVGKSNITSRFCDGAFYPDLVPTLGMDFK
                     YSSCNTLEKRPRCVRLQVWDTSGQDDFVTLTTAFYRNCQGALLCFDLTNRQSFEDLDQ
                     WYERLERYSPVVPPLILVGCKLDLVESHLDEQGEGIVLGSHRQIAKSEADAWARYHSC
                     LCYLETSAKENTNVSQAFQQLATYIASVANPGAKHAGRILGPGGRLLVEEEEEKQKKR
                     QCCAN"
     gene            complement(<499706..>500128)
                     /locus_tag="LDBPK_101270"
                     /db_xref="GeneID:13389318"
     mRNA            complement(<499706..>500128)
                     /locus_tag="LDBPK_101270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858913.1"
                     /db_xref="GeneID:13389318"
     CDS             complement(499706..500128)
                     /locus_tag="LDBPK_101270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858961.1"
                     /db_xref="GeneID:13389318"
                     /db_xref="UniProtKB/TrEMBL:E9BAH1"
                     /translation="MILGVGAGTFAVLVTVGVAILIALVGSYLAPQSALFIILGCTVL
                     PFIVYGCILTSPHGPAANTTAVVPATYYRERQLPSNTDVIDKFLPVRVVVFIVMALGL
                     FAGVAFHILTLVNSPPYKAPRVHCLRQKLEEAHPTWYR"
     gene            complement(<502140..>503333)
                     /locus_tag="LDBPK_101280"
                     /db_xref="GeneID:13389477"
     mRNA            complement(<502140..>503333)
                     /locus_tag="LDBPK_101280"
                     /product="flagellar protofilament ribbon protein-like
                     protein"
                     /transcript_id="XM_003858914.1"
                     /db_xref="GeneID:13389477"
     CDS             complement(502140..503333)
                     /locus_tag="LDBPK_101280"
                     /codon_start=1
                     /product="flagellar protofilament ribbon protein-like
                     protein"
                     /protein_id="XP_003858962.1"
                     /db_xref="GeneID:13389477"
                     /db_xref="GOA:E9BAH2"
                     /db_xref="InterPro:IPR008805"
                     /db_xref="UniProtKB/TrEMBL:E9BAH2"
                     /translation="MGSAVEEQNLFSAANGRGIAAASSVDNAASASNQMNTKTKKQLF
                     MLQRAERLKDPKVRKMGIDREALDAQVREKEALRRLEKERNDYYDRQALLMDRHACAL
                     QQEVNSIRAAREKELQDYRQTFQKKEMGREWDLNDPEARRKELPARIGDDDPRNGPSS
                     LQKFEGEDLDYAARRAAQQRQQRQWAQQQVNEKLAKKWMEQERDRAFDDRNEEVNHRL
                     YEVEQKVAEQRRLMEKNGADFNRALAEQQRREAVRAKEEDTRLGLQEMAYQMDSDFLN
                     ERETVVSELGGSVMAERYKGMSEKQKTLLRAGQDEQLRELRRRRLLEVEEQRQWSLQE
                     NMQLRMANALDRQRERERRAEREQLAETHKMQAQAAAKRKAQLDELYKNAVDEDYFKY
                     WDRCL"
     gene            complement(<504570..>505139)
                     /locus_tag="LDBPK_101290"
                     /db_xref="GeneID:13389478"
     mRNA            complement(<504570..>505139)
                     /locus_tag="LDBPK_101290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858915.1"
                     /db_xref="GeneID:13389478"
     CDS             complement(504570..505139)
                     /locus_tag="LDBPK_101290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858963.1"
                     /db_xref="GeneID:13389478"
                     /db_xref="GOA:E9BAH3"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9BAH3"
                     /translation="MLRCHGGLGARFLRRPCGAAAAAVVYPATSGAVAGMAMTSSKTC
                     TYVRSFSTATPLCLARRLAGNHRRKRSREPTKGDWLCQCGEVNYQSKRECYKCGAPAP
                     PLPPGVRRPSLPGEDPHDWACPCGQMNFRGAVVCHKCQQPKPVPPPLPGKETTLWTCP
                     KCKGVNRNNRRFCFKCSAPSPLVEFKPQQ"
     gene            complement(<506475..>509663)
                     /locus_tag="LDBPK_101300"
                     /db_xref="GeneID:13389479"
     mRNA            complement(<506475..>509663)
                     /locus_tag="LDBPK_101300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858916.1"
                     /db_xref="GeneID:13389479"
     CDS             complement(506475..509663)
                     /locus_tag="LDBPK_101300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858964.1"
                     /db_xref="GeneID:13389479"
                     /db_xref="UniProtKB/TrEMBL:E9BAH4"
                     /translation="MAVLQQSTSAYSIIFVSRAASECLETLFVDADELTQFTLSVYEL
                     LCVRDAGLNAAAKLALRQLVCVAVQRGYHYSHTLAQMPSSVCASCSSSIQAGDQGDRL
                     RVGCEVLTDLVITLSERRMTTFATDVSIAKSFRDDHLLSVFRLAVRVVKEVQPSSRTV
                     VAAGLRLAQHVLEFDFACDTMQTEAEENPVTRTYPDSWAADLLDLQLMDRLWFLYRIP
                     DLEPDVAHTLLEVLTSLVSLRKSFFTDVELRPRWYAVVLLQTHLVMERFLHLEDEETL
                     SAFARLLNRMKPNCDLRELMQLTEFSPWLRSLCSFTRQCLANWKHASTSLLSLLSVWG
                     RLIEAKSYATQDTAEMLHCGLQVVGCYLECLHSRVQTFTMELAKFMSSDSAAMRQANS
                     NSMPVEYILDDDEEGVRLEVEFLLKVVIGCGEEGWTMLEANSERVSQSVLAHVRPNAS
                     AVSVDHIVLMEEAAWSLHLLSAALHSDGAIDSGAARVLAMLLHSLILLQRFSTHVVFL
                     DSVPGSVRGHIAAATTRVLAAILSKTVSVYVVSNRKTSAFVEQLSSQLRQCGEMDTAG
                     TFGAYFLNVAVHALWTILSATNMPDEVRVAALQLLDEWTSTSSVLRVLKETRSYTYLM
                     NLHNESIPAPLQRPVALKARYLFIRCVAQVRFLDASALTDSVVNTLMEPVLARISQAV
                     YGAATGGSSAESTDRLTLALCDMRGILSCTERRPYRVVMDMIEPFLYPVADAVLQESS
                     CGEETVTQLLELVNEMALNKNQRIAFGAQSAKPVHIFRYVSRVVVRSARLVHLILGGS
                     VTGPSAQTPSPPLVEWGWKVMRLGLLAAYHILQGGWCNLGVLQLYEDTALTSLLSSVW
                     GLLCRLPVHEYIVRSKVCTAVIKVVNVLAARFFHDFWAKQPPREVFTVVGFVESLAFP
                     ASINAVEAAQQNDALQAMDRLVNCCWVRTAYPIEDLQQAAVMKSTLLRADAMVFHRLV
                     TCALERSVAVDNHGMRKLLLPLFYVEGSAVGEVAQYFCSRATTPAAAHALQVQFSDIQ
                     RHVTESGDITSKTMDELANALHTLMSTLKESL"
     gene            complement(<511267..>512970)
                     /locus_tag="LDBPK_101310"
                     /db_xref="GeneID:13389480"
     mRNA            complement(<511267..>512970)
                     /locus_tag="LDBPK_101310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858917.1"
                     /db_xref="GeneID:13389480"
     CDS             complement(511267..512970)
                     /locus_tag="LDBPK_101310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858965.1"
                     /db_xref="GeneID:13389480"
                     /db_xref="UniProtKB/TrEMBL:E9BAH5"
                     /translation="MRGSTSANAFSDASVQAAVLEEWKKRSAKHKEAAISLREKVRQL
                     KSDAEAGRRAAQWMQERDALNCEQEACEAALGAIEKSLGDVVSDADGERHQLELSALK
                     VLLSQQLTEVGALWHTSNARQLQTSSSGAASVDRVVDIREWIAEELRKCEANIEALAT
                     PSAGFEHQQKAVVECRAAARQAQLTFAALCDSYHPAHQLRVTFEAALKSAEEDTLARI
                     EGARAPRAAATPPDILRTVGLIVRMGQSARQFDISAATMTALAERVSAVYPGMPSAQV
                     HVAVEESIALRKARALSQAAVSDFQRTNIFLLSSCESAFLVAQQSEKQRQEKAEAARQ
                     RVEAQNRRHAHLTEERAAYEAVLRQRQSVKERMQAAAVAKEKALQAKRAIEFQERLRL
                     FEAYEVQQSALRQKERELAELQAQAMEEEKAARMRRNEERVEYRRQRDEQRQSEKKKR
                     EQELLALRAKKQDALQRFFASVDKQIGVEADPQRFLKATSSSAQTERYTTLAQTVMPS
                     ITGYSDEQIMKDPRVRLYHALLAAGLHTTPYGREVATRGYRVSAAQQSSEGNPLRREF
                     S"
     gene            complement(<513556..>513771)
                     /locus_tag="LDBPK_101320"
                     /db_xref="GeneID:13389481"
     mRNA            complement(<513556..>513771)
                     /locus_tag="LDBPK_101320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858918.1"
                     /db_xref="GeneID:13389481"
     CDS             complement(513556..513771)
                     /locus_tag="LDBPK_101320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858966.1"
                     /db_xref="GeneID:13389481"
                     /db_xref="UniProtKB/TrEMBL:E9BAH6"
                     /translation="MVMRSECERSLRHANDMLHQALLFTPIVFFVSFQISRSRVVASI
                     SLFLHPPPWVTERGDTQVYLFVRSVTR"
     gene            complement(<514066..>514986)
                     /locus_tag="LDBPK_101330"
                     /db_xref="GeneID:13389255"
     mRNA            complement(<514066..>514986)
                     /locus_tag="LDBPK_101330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858919.1"
                     /db_xref="GeneID:13389255"
     CDS             complement(514066..514986)
                     /locus_tag="LDBPK_101330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858967.1"
                     /db_xref="GeneID:13389255"
                     /db_xref="InterPro:IPR019156"
                     /db_xref="UniProtKB/TrEMBL:E9BAH7"
                     /translation="MAVASKGRIADVNQEELTKIGPKIDDVLSICLASFDSLRDMAFK
                     FQYEQAAEKAAYQSGETKPDPMTQLMHVLQRMVDLTLGTAKAVYDQTLLEWRRRKGEG
                     DADSPASQLASSQSMTSPEVLRNSSVEDFAAGSLAWIERGSHLSLLSLEVLSSVLLAH
                     HYLRKDLQKYMLDFNALDYLEKVFSMERDHELCYFPEGFKTECMRLIANLTHNNVDVN
                     AALAERDTFLFNILSATQIDEENPGMVEWAEFAIRNICESSAAAREKIRKLAPQGVTD
                     QSRGMLAGRCSYSFSSSGKVQLHTQKPPLD"
     gene            complement(515644..516321)
                     /locus_tag="LDBPK_101340"
                     /pseudo
                     /db_xref="GeneID:13389256"
     misc_feature    complement(515644..516321)
                     /locus_tag="LDBPK_101340"
                     /pseudo
                     /db_xref="GeneID:13389256"
     gene            complement(<518497..>519234)
                     /locus_tag="LDBPK_101350"
                     /db_xref="GeneID:13389257"
     mRNA            complement(<518497..>519234)
                     /locus_tag="LDBPK_101350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858920.1"
                     /db_xref="GeneID:13389257"
     CDS             complement(518497..519234)
                     /locus_tag="LDBPK_101350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858968.1"
                     /db_xref="GeneID:13389257"
                     /db_xref="UniProtKB/TrEMBL:E9BAH8"
                     /translation="MVLRHYRWLPLELEPDYKDGYTCDHCHQEFLEAPFYHEEATGTD
                     YCLECGNAAGYTPFSGLVASLLFSSQDNVLRDSDSNSIALFAYRVDSQSAGICFANGS
                     NLVVHLQMNGNIRDAIFYTVKEGSIESKLRVSSTDLSRRFSWLSSGLLKPFDVEVQLH
                     TLPVVPVPLDDFCVLAYGATDDLIEIHLNEAYSQLLDVRDGKEIVTRAEMPVCAFSSH
                     ETVGCSKSEVMDLLRLLRTKAEALKRS"
     gene            519824..519896
                     /locus_tag="LDBPK_10tRNA1"
                     /db_xref="GeneID:13389258"
     tRNA            519824..519896
                     /locus_tag="LDBPK_10tRNA1"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:13389258"
     gene            complement(519965..520035)
                     /locus_tag="LDBPK_10tRNA2"
                     /db_xref="GeneID:13389482"
     tRNA            complement(519965..520035)
                     /locus_tag="LDBPK_10tRNA2"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:13389482"
     gene            complement(520095..520167)
                     /locus_tag="LDBPK_10tRNA3"
                     /db_xref="GeneID:13389262"
     tRNA            complement(520095..520167)
                     /locus_tag="LDBPK_10tRNA3"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:13389262"
     gene            520477..521577
                     /locus_tag="LDBPK_101360"
                     /pseudo
                     /db_xref="GeneID:13389263"
     misc_feature    520477..521577
                     /locus_tag="LDBPK_101360"
                     /pseudo
                     /db_xref="GeneID:13389263"
     gene            <521942..>522928
                     /locus_tag="LDBPK_101370"
                     /db_xref="GeneID:13389264"
     mRNA            <521942..>522928
                     /locus_tag="LDBPK_101370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858921.1"
                     /db_xref="GeneID:13389264"
     CDS             521942..522928
                     /locus_tag="LDBPK_101370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858969.1"
                     /db_xref="GeneID:13389264"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAH9"
                     /translation="MGSNASHTEPQVPKECAMVAKRKEFERTKVIQEATFLTFKGLDT
                     HDVYNCCVPFKINGTYHIFGRAERRSEWVNSHVRLFRKTGHDEYTLVEHAMQYQLEDP
                     FLVKINEEALFGGVRVTKDHGKVSGYVCDFYRGKIDDLHYFTSGPKNMKDIRLVGLAD
                     GKIGVFSHHKTSKTCITGFIIIDSLDDLCSQVIDSAKPIDHTLFGDAWGGVNQPYLLS
                     TGKIGCISHHGYLDTDANGEIINVYCITSFVYKPSTNKCYDYKILGTKNCFPDYPAKA
                     PKLIDCAFVSGIVMREDGKCDLYSGVGDTREGRMVIDYPFEGHGTIADNVDF"
     gene            <524646..>525611
                     /locus_tag="LDBPK_101380"
                     /db_xref="GeneID:13389483"
     mRNA            <524646..>525611
                     /locus_tag="LDBPK_101380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858922.1"
                     /db_xref="GeneID:13389483"
     CDS             524646..525611
                     /locus_tag="LDBPK_101380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858970.1"
                     /db_xref="GeneID:13389483"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAI0"
                     /translation="MGLLNTKPCSLIPAKEAFEREKKIYGKAILSFDGVNGYDVYNCS
                     VPFTYDGKTYIFGRVEKKDEWVHSNSILFEKVGENRYRRHPTSITYNLEDPFVVKIHG
                     EMVFGGTHVTKNGGKVSDYRCEFYHGTPLNLKYFASGPSKMKDIRLVELADGKIGIFT
                     HFRTEGSCLTGFATIDKIEDLTVEVINSAKLINHRPFGDAWGGPSQVYLLSSGLLGCI
                     SHHGYLLDQKDDIQLRIYACTSFVFDPATYDVYNFKIIGTKGCFPPCEPKLPHLADCA
                     FVSGIEMRDDGKCNLYSGIGDVAEGYIVIDYPFEGYGNIVSDVAF"
     gene            <527395..>528351
                     /locus_tag="LDBPK_101390"
                     /db_xref="GeneID:13389259"
     mRNA            <527395..>528351
                     /locus_tag="LDBPK_101390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858923.1"
                     /db_xref="GeneID:13389259"
     CDS             527395..528351
                     /locus_tag="LDBPK_101390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858971.1"
                     /db_xref="GeneID:13389259"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAI1"
                     /translation="MSTFEKVKEEKLEFEKNCDQHIYEKALLTFKGVDGMDVYNCSAP
                     FKYEGRTHIFGRVEKRSEWANSYVRLFVETNKDEFTLVPGNMVWQLEDPFVSNIDNEM
                     LLGGTHIRKTNNRVFTYYCDFFRGTAENLSYFTTGPDNMKDIRLVELANNKIGVFSRP
                     KTAAHAFIGFTVINNVMELTPTLVEEAPPLNVIHTGAWGGVNQAYLLSSDKVGCISHY
                     SYIDKDEDGNEITVYTNYSFVLNPYLREVEDARIIGTKGCYPKCSPKVDKLLDCAFSS
                     GIVMREDGLCDLYSGLGDAYEGRITINYPFEGHGTLIDNLHF"
     gene            <532711..>533658
                     /locus_tag="LDBPK_101400"
                     /db_xref="GeneID:13389484"
     mRNA            <532711..>533658
                     /locus_tag="LDBPK_101400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858924.1"
                     /db_xref="GeneID:13389484"
     CDS             532711..533658
                     /locus_tag="LDBPK_101400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858972.1"
                     /db_xref="GeneID:13389484"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAI2"
                     /translation="MKQVKAAFEANKRVYESVLLTFKGVDGYDVYNCSVPFSYKGKTH
                     IYGRVEKRDIWAASHVRLFEETGKDEFTVVPGFYFQLEDPHIAKINNEMIFGGTHVRK
                     DKQEISAYYGYFYRGTPDELKYFTTGPDCMKDIRVLQLQDGRLGVFSRPRVGHKASIG
                     FVILNSIDELGAEVIAKAPPLDILPENAWGGVNQAYLLSSGKVGCIGHYSYEDTNEKQ
                     QPQSVYVNYSFVLDPQSRAIADAKIIGTKSCYPPCEPKVPLLADCVFASGIVMRSDGR
                     VDLYSGVGDSREGRITIDYPFKGHGTIIGDFHFPTASSL"
     gene            <534866..>535807
                     /locus_tag="LDBPK_101410"
                     /db_xref="GeneID:13389485"
     mRNA            <534866..>535807
                     /locus_tag="LDBPK_101410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858925.1"
                     /db_xref="GeneID:13389485"
     CDS             534866..535807
                     /locus_tag="LDBPK_101410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858973.1"
                     /db_xref="GeneID:13389485"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAI3"
                     /translation="MSFKEMRLAFEVSKNIYESSLLTFKGVDGYDVYNCSLLFQYKGK
                     HHLFGRFERREKSSDSRVRLFVETGKDEYTVVPDQLTYQLEDPFVSKVQGSLFFGGTQ
                     VIKSGGNVTGYFCDFYHGMPQLLTYYTTGPDLMRSIRIVQLADGTIGIFSHHKTESSC
                     LIGFTTVNSLNEVTREVIAEAKPINNAPFLDAWGGVNQAYLLSSGNIGCICHHSYLDK
                     DANGEQRNVCCITSFVYDPKTNDTHGFQLIGTRGCFPDCPSKSPSVADRAFASGIVMR
                     NDGKCDLYSGLGDTCEGRITIDYPFEGYGTVVNDLVF"
     gene            <536817..>537767
                     /locus_tag="LDBPK_101420"
                     /db_xref="GeneID:13389486"
     mRNA            <536817..>537767
                     /locus_tag="LDBPK_101420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858926.1"
                     /db_xref="GeneID:13389486"
     CDS             536817..537767
                     /locus_tag="LDBPK_101420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858974.1"
                     /db_xref="GeneID:13389486"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAI4"
                     /translation="MSSPQVVREAKKAFEANKRVYESVLLTFKGVDGYDVYNCSVPFS
                     YKGKTHIYGRVEKRDIWAASHVRLFEETGKDEFTAVPDGMTWLLEDPFVSRVKGEALF
                     GGTRVRKVSDRLLSYYCDFFRGGIEQGLYFTTGPDNMKDIRCVELANGSIGVFSRPKT
                     DVYTCIGFTIIDDLSELTQKVINEAEPLNVLHAGAWGGVNQAYLLTSGKVGCIAHYSY
                     NSKDDKDRPTSVYLNYSFVLDPETKQAEMERIIGTRSCYPDYPVKTEKLIDCAFSSGI
                     VMREDGKCDLYSGLGDTCEGRITIDYPFEGCGAVVDQLSF"
     gene            <540116..>541051
                     /locus_tag="LDBPK_101430"
                     /db_xref="GeneID:13389487"
     mRNA            <540116..>541051
                     /locus_tag="LDBPK_101430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858927.1"
                     /db_xref="GeneID:13389487"
     CDS             540116..541051
                     /locus_tag="LDBPK_101430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858975.1"
                     /db_xref="GeneID:13389487"
                     /db_xref="InterPro:IPR015045"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BAI5"
                     /translation="MSLKALKASFEANKRVYESVLLTFKGVDGYDVYNCSVPFSYKGK
                     THIYGRVEKRDIWAASHVRLFEETGKDEFTAVPELSWELEDPYIQNVKGEMIFGGTRV
                     RKNGNEILSYYGYFYRGTPVELNYFTTGPDYMKDIRVVLLQDGRLGVFSRVRTKAEVY
                     VGFSTVDTIDHLTTEVIAAAKAIDFIKPGTWGGVNQAYLLSSGKIGCIGHFAYNDTKP
                     SGEPLTVYINISFIFDAETRQLETEHVIGTKSCYPPCPAKLPTLEDCVFASGIVMRND
                     GKCDLYSGLGDTHEGRITIDYPFDGYGNIVGRMIF"
     gap             543438..543538
                     /estimated_length=101
     gene            <543542..>545023
                     /locus_tag="LDBPK_101440"
                     /db_xref="GeneID:13389488"
     mRNA            <543542..>545023
                     /locus_tag="LDBPK_101440"
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /transcript_id="XM_003858928.1"
                     /db_xref="GeneID:13389488"
     CDS             543542..545023
                     /locus_tag="LDBPK_101440"
                     /codon_start=1
                     /product="phosphate-Repressible Phosphate Permease-like
                     protein"
                     /protein_id="XP_003858976.1"
                     /db_xref="GeneID:13389488"
                     /db_xref="GOA:E9BAI6"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:E9BAI6"
                     /translation="MANVNPYLWIVIVGGFVSFLTGAGVGMNDLANAFGTTYGARILT
                     LTQIVIVASVCEFGGAVTLGGEVTSTISSGVADPKDFAKQPYVFMYGMLCACGAAFCW
                     LAIATWLRLPVSSTHSICGGVIGFALVYGGGGAVSWAKRKDDFPFFSGVAPIVASWFI
                     SPVLTGAVSAIIYSLVRFLVLRPKNCVKRAMYTLPVVVAIAFFLESFFVLFKGASKRL
                     KWSVGKAAWVAACIGAGAGVLSCAFIPLLKRLVARDEAHAFAASDERPSTTEGSTQRK
                     PLNNEDVHKAREVTGDVVSQSEASDSEQSEERQVTGASGLQVQQYEWRAERVFRYLQV
                     FTAICASFAHGASDVSNAVGPLAAIYQVYQTGGVEKSSSVPIWVLCLGGAGLVLGLST
                     FGIRLMRLMGEDLTVITPSRGFSAELSAALVVSFASGYGIPVSSTHCITGGVIAVSIV
                     DVGFLNIRWLMVLKMYGGWVFTLVITAIISAMFFAQGASAPAM"
     gene            <547063..>548361
                     /locus_tag="LDBPK_101450"
                     /db_xref="GeneID:13389489"
     mRNA            <547063..>548361
                     /locus_tag="LDBPK_101450"
                     /product="pteridine transporter, putative"
                     /transcript_id="XM_003858929.1"
                     /db_xref="GeneID:13389489"
     CDS             547063..>548361
                     /locus_tag="LDBPK_101450"
                     /codon_start=1
                     /product="pteridine transporter, putative"
                     /protein_id="XP_003858977.1"
                     /db_xref="GeneID:13389489"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BAI7"
                     /translation="MTVGQQTGNVASGADVPYASPPQEQLTEEGKGYVHPDTAALFDA
                     SPFMRYIPIFGTAVVPFGPKCVMSLGIVYILSKGLARTLLNSSRYAMFMKKYGVTTAV
                     YQRISGIGSLGFSIKPLTAILSDTFAFFGYTKRWYMALSCIAGAVCAIVYGVLPFKPS
                     SAGIAGAMIFISVFCIANIDVLSEGHYSRLIKRHPIPGADLISWIWALIMVGAILASA
                     IQGPLSDSGRPTIGIFLSAGLQAFCVFFFIFNWYGEKKNLIERKEDYIFLLKQEAQMQ
                     ETDSEPIKEGVGVHDITMGKSKTKPTVLYHEPSLQNSNTELVNFGELDDDVAEYDFVE
                     TRCMCGIFGVNKEIVSRNISVAVYGVIMTAGVIALTVLNIMGTTYQLLYGCVGISVIL
                     CATGFLCIPMTIMKANFFGWFQQVSYILISGGTDNFYMSDS"
     gap             548362..548457
                     /estimated_length=96
     gap             549302..549430
                     /estimated_length=129
     gene            <552900..>554084
                     /locus_tag="LDBPK_101460"
                     /db_xref="GeneID:13389260"
     mRNA            <552900..>554084
                     /locus_tag="LDBPK_101460"
                     /product="fatty acid desaturase, putative"
                     /transcript_id="XM_003858930.1"
                     /db_xref="GeneID:13389260"
     CDS             552900..554084
                     /locus_tag="LDBPK_101460"
                     /codon_start=1
                     /product="fatty acid desaturase, putative"
                     /protein_id="XP_003858978.1"
                     /db_xref="GeneID:13389260"
                     /db_xref="GOA:E9BAI8"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:E9BAI8"
                     /translation="MKSVLKAGREKDVDVVVPPKELTIKQIQDQIPAKYFERSAVWGM
                     CYVFRDIFQVLALYFIMYRAVMPVLSAFGGIVYGVAGANIVSWTVVGAVKFAAWTVFG
                     IAQGLNGFAIFVLAHECGHQAFSSYRLLNNAVGLLLDSAILVPYHSWRISHGSHHKHT
                     NHLTKDTVFVPRKEQRVIDLVEETPLVMLWNMLVIFTFGWPAYLIANIASQDYGRRTN
                     HFEPSSPLFNKDDGPDIVLSNIGIVAALFILGLCTYQYGAYNVFCWYVVPYLWTNFWL
                     LYVTYLQHSDLRIPHYTHAHWTFVRGAIATVDRDYGFIINEWLHYINNSHVVHHLFSQ
                     MPFYHAIEVTRHHIKDIIGDAYVTDSRSLVEMLCETWRECRYVIPSEGISVFYSFTGK
                     GA"
     gap             557202..557302
                     /estimated_length=101
CONTIG      join(FR799597.2:1..558170)
//
DBGET integrated database retrieval system