GenomeNet

Database: RefSeq
Entry: NC_018239
LinkDB: NC_018239
Original site: NC_018239 
LOCUS       NC_018239             569561 bp    DNA     linear   CON 30-MAR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 12.
ACCESSION   NC_018239
VERSION     NC_018239.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 569561)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 569561)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799599.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..569561
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="12"
     gene            <2832..>3737
                     /locus_tag="LDBPK_120010"
                     /db_xref="GeneID:13390426"
     mRNA            <2832..>3737
                     /locus_tag="LDBPK_120010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859063.1"
                     /db_xref="GeneID:13390426"
     CDS             2832..3737
                     /locus_tag="LDBPK_120010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859111.1"
                     /db_xref="GeneID:13390426"
                     /db_xref="GOA:E9BAX4"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:E9BAX4"
                     /translation="MDVPSEDYDVSIMIQAIHEVQDVLTSRQFATFSEVDTEIGKTLK
                     RYEAFGDGFERFHVNLTKDALQSNDLQKSLKDMDKRCQDRLRDCASSQKDQINDILPF
                     IRNTSSILVHGSGNLLALTIACSIQEHEGVRFYICEGRPARKGYPHGSGEQLLEKVLA
                     TPEGMRLKDKLHNYCRIVPDSGVSSVMNNVDFVIMGAYCVTEHGGLVHSTGSLQIAIV
                     AAFRNVPCYVLCETFKFAHIFPLSTDDLKQPEDGAGEVVPLVEFVPPSMITLIFSEQG
                     IMPPSAVADEMFRFHTAPSAPGKRR"
     gene            <3923..>4789
                     /locus_tag="LDBPK_120020"
                     /db_xref="GeneID:13390441"
     mRNA            <3923..>4789
                     /locus_tag="LDBPK_120020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859064.1"
                     /db_xref="GeneID:13390441"
     CDS             3923..4789
                     /locus_tag="LDBPK_120020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859112.1"
                     /db_xref="GeneID:13390441"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:E9BAX5"
                     /translation="MGYLREDLRVFVYLEKEWALTCMLRFEYVSTSPFLSAFAFCHCC
                     VRENHALKGKVHRALKRRKTTQIYDQGDIMPCNCRQGTALHSHVGDQLASEGVFGLGV
                     PINDAVDLSAIQLWNSRNTPAEAGRLFDVSKSANQDPISSDDDQELLISAPLSSVCRI
                     KGVSFVAPANETAPSRVKIFVNLVNVAGFSSVQRLVPQEQLQLAGGGSEERIVYRVSA
                     AKFSSVSSLTFFFDESFNGAETKVLRIELFGENTGKTTQQQVATNIVYEGRGNPADHQ
                     SSEEKKLLFEVR"
     gene            <5190..>6041
                     /locus_tag="LDBPK_120030"
                     /db_xref="GeneID:13390442"
     mRNA            <5190..>6041
                     /locus_tag="LDBPK_120030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859065.1"
                     /db_xref="GeneID:13390442"
     CDS             5190..6041
                     /locus_tag="LDBPK_120030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859113.1"
                     /db_xref="GeneID:13390442"
                     /db_xref="GOA:E9BAX6"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BAX6"
                     /translation="MLQRPDHTLLQDPSYPKDIEQKLTENGPAQAGKQLFQPDLAVID
                     PQLSEAVSLGTTILAVSYKGGVVLAADSRTSSGTYVVNRASNKLTKLTEKIYCCRSGS
                     AADTQALAERVSNYLGSYQTDIGADVNVATAANLFHKMCYVNRWNISAGIIVAGYDPI
                     NGGSVYSIPSGGSCVKLDYALGGSGSIFLYSFFDANYKPGMSKSECVAFCQRAVAHAY
                     SRDGSSGGLIRTITLDAEEAEDLTVPWKRSPYCMEKDPKYQVQAVQNPPFSSSAKVTG
                     NRMSSTG"
     gene            <6578..>8074
                     /locus_tag="LDBPK_120040"
                     /db_xref="GeneID:13390185"
     mRNA            <6578..>8074
                     /locus_tag="LDBPK_120040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859066.1"
                     /db_xref="GeneID:13390185"
     CDS             6578..8074
                     /locus_tag="LDBPK_120040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859114.1"
                     /db_xref="GeneID:13390185"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BAX7"
                     /translation="MRGQLVQKGAAALYAGPKIASYTDACEAPVAMWEGAIPLKHERV
                     LNSGVVTRVVKKTYSHPPEIHPTNLSFNDIDSMYCLGNDELIKYFPEGVGGKMMQLMP
                     PGHPRGFLYRKQSHLLNCFIDKLPFWQSKERALRSLTNGRPGFIMDGPTGCGKSALLC
                     QAVHYARSRDIITLYIANAKAWTHGEWCWPSTILPGFFDAPDAAREFLRTVAEANRSL
                     LQAWELRVTPQDLPLEQGEKQPRSLYDLCEWGHRAVSPASIDRQSVCIKFFFDEIRAE
                     KTKPIVIAVDGWNLFSHETHFRYPHPDFLRTLTTLNDGSTDVDLYPQELPRIPASRLS
                     FVRGLNKLILSKQDPNKFFITCTTRDFKPFDGVSGFADVENDRFKNSLDEYAPYDPEK
                     DSFFHPMQVDNFTEYEYRAFLRFAINSGELAGLGWGPMWHYSSDFERKLYKIDFMSDR
                     NPQRVVDHYHQELVWRYEYKRTRQKQYLLARRKMWQGAEVSNPLRNGK"
     gene            <8670..>8993
                     /locus_tag="LDBPK_120041"
                     /db_xref="GeneID:13390186"
     mRNA            <8670..>8993
                     /locus_tag="LDBPK_120041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859067.1"
                     /db_xref="GeneID:13390186"
     CDS             8670..8993
                     /locus_tag="LDBPK_120041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859115.1"
                     /db_xref="GeneID:13390186"
                     /db_xref="UniProtKB/TrEMBL:E9BAX8"
                     /translation="MAKRDKRRTALVQQNFDSLKRFYAISPFAAAERATLPPVYSGVY
                     SRRAAMNSYHVVGSSRDQIVLEAMRTFTPSTCTKEVLDLYLEVAALVSLYFDTKEQLL
                     ALPDV"
     gene            <9347..>10618
                     /locus_tag="LDBPK_120050"
                     /db_xref="GeneID:13390187"
     mRNA            <9347..>10618
                     /locus_tag="LDBPK_120050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859068.1"
                     /db_xref="GeneID:13390187"
     CDS             9347..10618
                     /locus_tag="LDBPK_120050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859116.1"
                     /db_xref="GeneID:13390187"
                     /db_xref="GOA:E9BAX9"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BAX9"
                     /translation="MAQPQDSASISSDELVVWRAAERVRQGASLQLSRVARCIASATK
                     LLKVEAKVMERVCGDTIVFGPIRGHAADFANILLTKVLPNRCVKNIVFLGNYIDGAHQ
                     SLGVLFLIAALIVCSRFHIVPLIGKHEMMYPIQPETFGSLRNEMLLCCTRRRQPLEQY
                     ESIMKEFFSVLPIACVVENRFFCVAGGPSSKFRTLEEIELITLTQDASKEFALNKPMD
                     EDEERIADGSAFVASQENELAFRYTFNAACNFLSRNKLAMLIVGMEYHMSLPDYDSFA
                     RPNHYKESIYFPGYMLGRIHPETQLPAVLSMFSAPSFCGVNRNNACIAEIADNRLVVQ
                     ELGVYAKRPLVSPGTQDHAFSWAQPMLERAVVVIARDIIRGVVKEDAATDDDAHRKRL
                     EEVAVSKMRRMCMLLRAHDLPLPDVPKLAFN"
     gene            <11420..>11998
                     /locus_tag="LDBPK_120060"
                     /db_xref="GeneID:13390425"
     mRNA            <11420..>11998
                     /locus_tag="LDBPK_120060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859069.1"
                     /db_xref="GeneID:13390425"
     CDS             11420..11998
                     /locus_tag="LDBPK_120060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859117.1"
                     /db_xref="GeneID:13390425"
                     /db_xref="GOA:E9BAY0"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:E9BAY0"
                     /translation="MSRLMPHYSKGKTAFLCVDLQEAFSKRIENFANCVFVANRLARL
                     HEVVPENTKYIVTEHYPKGLGRIVPEITLPKTAHLIEKTRFSCVVPQVEELLEDVDNA
                     VVFGIEGHACILQTVADLLDMNKRVFLPKDGLGSQKKTDFKAAIKLMSSWGPNCEITT
                     SESILLQMTKDAMDPNFKRISKLLKEEPPIPL"
     gene            <12754..>14619
                     /locus_tag="LDBPK_120070"
                     /db_xref="GeneID:13390109"
     mRNA            <12754..>14619
                     /locus_tag="LDBPK_120070"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859070.1"
                     /db_xref="GeneID:13390109"
     CDS             12754..14619
                     /locus_tag="LDBPK_120070"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859118.1"
                     /db_xref="GeneID:13390109"
                     /db_xref="UniProtKB/TrEMBL:E9BAY1"
                     /translation="MHTRFSLAFLHSPSHLFLFLFLSPPITRDLAHRCAGRLHQPEVL
                     RMSGEFSLLQHLGVTVDKCDSSADLAPPTHSSKATFRVWAPSQHPPSKCCTAEETCQV
                     LEKKRKGAHPSYADPTGEVLLRRKNGVEVQYIVYNSKIPSVYGINKRLAEKKAERERE
                     ENSPLFKYGLALIEGEAGQKEARRALLQELRRCNQEQARLSKEEGLRERARRLAHERA
                     VVQHNAGEAAREEEDATRKKMMDREAVREAAVKALTLREERRADANVDARVVASGWDG
                     KDEDDRRHLAAVERTRQLAEENFRAAEQRRAERKAQEQDARERAQAERMELQRQLAQE
                     HVKDLERHRRNAEALRGAQEAARERRSRANAADAHLQVVPSESLFDAVERRQRDEAMR
                     AQQKRMEDMAVNVRLAAQKRANAQAERDRERQYAAEYAKAELESFQREVEHARQRRQQ
                     ERLELQDAAEAAAKVRQAHADAARQREQSMAPLFFWPASQSPGAEKAKIAETRRFRED
                     LRRQAEKKRDERAQEEEAERARERALIEYDTRSAQEAVERERKETREKAEHLRRILEA
                     QIAQKRKGTVGDRQACAAVDVSHVPVTKAMILYRCPVTGELLPASAYDFGVQRGR"
     gene            <15364..>15636
                     /locus_tag="LDBPK_120075"
                     /db_xref="GeneID:13390110"
     mRNA            <15364..>15636
                     /locus_tag="LDBPK_120075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859071.1"
                     /db_xref="GeneID:13390110"
     CDS             15364..15636
                     /locus_tag="LDBPK_120075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859119.1"
                     /db_xref="GeneID:13390110"
                     /db_xref="UniProtKB/TrEMBL:E9BAY2"
                     /translation="MDLCGTDVVPFQGVRLGTTPTEDFYLTTLEKKLLRMSAMEQLRA
                     CCFADPPLPTARDGGEQSLLWCVLSESVRVFLSLMLFLCLVAHLLN"
     gene            <15908..>16747
                     /locus_tag="LDBPK_120080"
                     /db_xref="GeneID:13389867"
     mRNA            <15908..>16747
                     /locus_tag="LDBPK_120080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859072.1"
                     /db_xref="GeneID:13389867"
     CDS             15908..16747
                     /locus_tag="LDBPK_120080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859120.1"
                     /db_xref="GeneID:13389867"
                     /db_xref="UniProtKB/TrEMBL:E9BAY3"
                     /translation="MCIKRCCMSSTGKRSSSDDSPPSAVWFHSCTLFFPIFSRAAFLP
                     SPLGTTRTPLGLPGRFAEPRPTLHAASSANMQSVLPYTTNPAQIVSIEKLKLINPSSA
                     AATGPYVNVRNPKLVVGGLLHNWDAEAAHALLNAPKSVQTWDLSWTEDETNWEERVHR
                     CTYPEEVEDLLPAKWIGYRVQSDVDETLARVCKLCTALVDRFVSLSQGNNANVSTAKW
                     RQRQALYDRLGAVMELLEASVGEAIPILKLKDPEFIQNCWRQMQDDERVEIMSVLGTK
                     DYD"
     gene            <17307..>18752
                     /locus_tag="LDBPK_120090"
                     /db_xref="GeneID:13390113"
     mRNA            <17307..>18752
                     /locus_tag="LDBPK_120090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859073.1"
                     /db_xref="GeneID:13390113"
     CDS             17307..18752
                     /locus_tag="LDBPK_120090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859121.1"
                     /db_xref="GeneID:13390113"
                     /db_xref="UniProtKB/TrEMBL:E9BAY4"
                     /translation="MRCFTARLQLLTFETLLCGAHGVLPPPTRLAAACARAKEEFASQ
                     CSTSAPPPTMLATAVVATHLLHNNLRDAAAVLASHPCQQQVLEGVRDYVRQHPGVFSV
                     STLTGMLEEARCVSEGAAATFLRAAVDEFLHGSSAASTEVDEATTWDAQRENLRSLVL
                     RHIRFYPACASFLLGSLCAVSRGCAGDREDVVEVMQLAMRERSMNPRDFGGVLDIVWK
                     SREPRRIAMMWAWMQHTSACWDVRAASIAIMAFSELHQMDEAVACMQKLAEADGDPTI
                     DAQVAFVRFLGARTPSLLQYATQLVLHWHPSGERLWRGEPQAVGMELVKICCACGERK
                     LAVEMLEQMVATNAGVPAELEAFMLRPGAAALGEHHSASVATNKTLQELFIDVPLHLP
                     NLGEQPALVGLLLSLGMATNRLPEVYDALEKASLTPANFQGALGYFTTGSAVKAASPI
                     AVLACVREAGARTGHKVPKEMESWLQLATEM"
     gene            <20920..>21801
                     /locus_tag="LDBPK_120100"
                     /db_xref="GeneID:13389868"
     mRNA            <20920..>21801
                     /locus_tag="LDBPK_120100"
                     /product="ornithine decarboxylase, putative"
                     /transcript_id="XM_003859074.1"
                     /db_xref="GeneID:13389868"
     CDS             20920..21801
                     /locus_tag="LDBPK_120100"
                     /codon_start=1
                     /product="ornithine decarboxylase, putative"
                     /protein_id="XP_003859122.1"
                     /db_xref="GeneID:13389868"
                     /db_xref="GOA:E9BAY5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="InterPro:IPR018144"
                     /db_xref="UniProtKB/TrEMBL:E9BAY5"
                     /translation="MSRDHAKGATGANAPPLEMLQRLQLFRSTLVNFLEWRNFSDVVH
                     GCYVRVLLEMRSTEENRRESPDNYYIALVKGAQRGPVYSGFSADAVTTEWHIVIELPP
                     CFRSTQNGNVVQLNSISNSPFRQAEYQNWVDMTNETRELSFPSLPQLQFRLGMLEEHK
                     QQALAPEPRRHRNGEDAQAAALRERVLEEKRKRITEEIMATHVKLRRIDQLKALSLED
                     LQEVEREILDLITGVRISINERSKCMLCHNRICTEICYPCKHQVLCKDCAKSIRGRCP
                     APKCKTPVQYTFEAFTS"
     gene            <23572..>26274
                     /locus_tag="LDBPK_120110"
                     /db_xref="GeneID:13390114"
     mRNA            <23572..>26274
                     /locus_tag="LDBPK_120110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859075.1"
                     /db_xref="GeneID:13390114"
     CDS             23572..26274
                     /locus_tag="LDBPK_120110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859123.1"
                     /db_xref="GeneID:13390114"
                     /db_xref="GOA:E9BAY6"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9BAY6"
                     /translation="MFRSASTFQAVPQSQWPIPSTARSCVQCGKSFGLFQAAGNCHGC
                     GRVCCPSCLTEHLVLPGQPGSQPVPVCNICSKAIKRTLEEAEMAVHRCHLLEEMLNEQ
                     AKQAEKLRNELREQQEENKLLTHEKESLKATIARMEIEAEVAAAKAAAAAAAAATTIA
                     STVTSVHSPAATSLKADPDTRANASTSAESVAAMEELLNKKKRQLDMREATLKDALKK
                     VSSDAAKIADQRAALQEQEKVMAAQLTAQFTSLFEEERQRLEDFCADAVTDIQNKYME
                     WVTQQQDGALERRRRYEQVMEERQQRAAAELAEARAERDALQRALESQRAQLAKLQES
                     ALKVGAESRSEEKRNALSSQCARKGKESLEETVAGGVALAVATKGQLHAGQAEPVSNK
                     HLREEERQTSNCAAAACAALEQKAQDSMEALVRDMRAKEEDWERAKAAAVATAESAVR
                     LAERERLVQEVEKARQQSRREVEEAVRVATQQRDSVIDALRKQHEHDKEEWLSKMQQL
                     ETSQRRKAEYQQSQDKSWREEKVALQKKCSALETRLETRKTAAWQLQQQLRDAKQELY
                     DLKANTGGKDDAAAEERRTQASAAAMTVQRWASAVLEEVQQGQQLMLEEQARALALLQ
                     DEMQKRALANYAAANARDERQREATQRLHTELESARQERDTALEQLGRMRETAADMTA
                     RMSEESAQLGTLRGALQRQQRALAELQEKHQRTVDELHATRAAVAAAATAADAAAPLA
                     ESPVRVMPAVDDTCYHVLLRLEQRWVQQQAHLQSLYSVALYAVVQQEWTQVFESMTSS
                     LATEAERQRSLRIRNAEALENTTSTIKEVQDDLRLRTQELLQRQVDVEERERRVQDKK
                     KRVDVVCRSLYTVAQELRKVHLDAAESSTLDEVMNSARVMSDSP"
     gene            <27459..>31574
                     /locus_tag="LDBPK_120120"
                     /db_xref="GeneID:13389869"
     mRNA            <27459..>31574
                     /locus_tag="LDBPK_120120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859076.1"
                     /db_xref="GeneID:13389869"
     CDS             27459..31574
                     /locus_tag="LDBPK_120120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859124.1"
                     /db_xref="GeneID:13389869"
                     /db_xref="UniProtKB/TrEMBL:E9BAY7"
                     /translation="MSSFSRSALDMLQAAEGALTQRRCYGSGVPGGASSFAYKTINTG
                     SGGYATGQWYRDPNSSALSPVENVEELQQQLGRAMRELIELRAELAAERDRRHETLIA
                     MGRQWKEDILVEVHRRGAALQSDVSAVEEKMMAQWKESNEGRLVMRRQLEEAMRAGKI
                     RDTNQFQLREEVQETARHLEERVDMALAQSSAARADCSRQLEQERATLSERLDVELLR
                     LVEMRRDDQRALQQARELMRDEGLRVRDDIRRVVQEVWETSASALVKTATEPIEQLRA
                     ELRETKAAAQAMEERVADCVRACQAECRTVTTTTTERLHALESKEAVAISSIDRAERK
                     ADSAYETARHMEATIAAAKDATERALVQVAGAAERTLKVEHALADRDSRLVAVEAQLH
                     AITTAEGLRADVEACKRQAGRLESRVEAAGALCTRVEQLADRAAQQVASFADRIESCE
                     RSTQRSVGAVQRVQDGLEACESEGHQMRTRFETSEAVLQRHTHLLAQLEQQISGQENR
                     LGLWRQQQEQHVKDQMTVQRELTERAEVTHTVASRAQQVSSDARAEVHRLERRIDDVD
                     RRLTSTSAETTTLRGCIDSQHTQALEAQRQQQQLADELQSLASKVDERMAPVKELVRN
                     SEERMKRAEAQAQGLGKKLAECEERLHEMGPRVLDHLKDAVRHHVGEALKRLFAAMNE
                     GMSRVTERVAAVEEAADLSQQRVAEMPQQLTAMQQASAKLQRHVQSLEASLQSLSGQT
                     QKLAVHADTQAGDRQRLGTVQQELMCLTAVQQRTQQDVRLLQEAMRVLQAMATVGSMR
                     DFSLSELGTSQARTASTEMAPAADAISSSPSAHQPPSSGVRTSSHALVAGEHSQPPAQ
                     RAAAVAAPPLANTSGASLQELQDRQRASSGSRSSSSKEGSEERPALHLSGVSSVRPSN
                     GQEERLHSLVEAGDVSTASADGDDTVEAFTVRPGAVARLPRTSAGTNGSASMPLFATT
                     RTETVEQLSAPAHDSTQASAVGNVSHCTAIREFTTITSSSSLSDSDSSEDDRRRVQER
                     EVPTRRGAPSEERTDDVSSDLTTAIMLTSEASTKQSNQRGSRPPPSSGQQRAAKMSTA
                     WRQCSSGSSEEGTPVARRAAWGSAPPPQSQHLIGASESESESTLQGAGALDDSDDRVQ
                     AMPRHDSDTEEVERAVAAEEAVAGVARLQPTCTSQAAATTYFARSPGNPNWNDWDDDG
                     EEDDDDEKRRGNIEEEDEALEPKPTRPYAAPHAASAASEDDTDDAVMHFKDAESSSCT
                     PGPRETDATTPAAGLAATVMHRQQDAADDLRATPRRMFVSTSDDGRGVSTQLPDSVPR
                     HGRGTTSSSSSSAERAEALGLRGARQSPPQRAATQMRQYTNFDDSTSSDDD"
     gene            <35431..>37179
                     /locus_tag="LDBPK_120130"
                     /db_xref="GeneID:13389870"
     mRNA            <35431..>37179
                     /locus_tag="LDBPK_120130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859077.1"
                     /db_xref="GeneID:13389870"
     CDS             35431..37179
                     /locus_tag="LDBPK_120130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859125.1"
                     /db_xref="GeneID:13389870"
                     /db_xref="GOA:E9BAY8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BAY8"
                     /translation="MGDHLGSRFTVIEQIGSGNYGSLYRVIDGEAATLADRIIATKKL
                     QDTINHPHVLREVSVQRHAQKCSPHIVKLLHVVPRDRVRAALVLEYVPLDLRTFLNAF
                     YCDQAKSSAPTWCATAGAGEVKSAAAPPCHIPLIYVRRMLRGLIEALHCLHARGIVHR
                     DVKPENILVEPLGLGHPLRCVCPPMGSFGPTGEAAGCWVHAPQCSDPRQEKDVTQPMQ
                     PRGTLEPCQFFCRNSVALHHELTGDELASAIHRLHCETCRPCPRARAGVGKHPLQQHR
                     DRSDMKTSNSCSQERQADAVDGEGPASVDDDEENKFTAPTPPPLMPDVKLCDFGSARH
                     IGTLRLRSAEEQREELTPGPTTPVYCAPEMMLLQRYGTSVDMWAVGAILFEMLTGEFF
                     LGVGTLRSFSGDVVVQDDYCVMHRLNRMFRHLGTPSVEEWRCIAHPHYYPDEMLAHLP
                     QVRDAALFRCLAQPIATDVSLLPESGDIKPNGDAKTADEQTDLSVRPSAETCSFAQAP
                     VNGTTDSHAARASVPPRDMASARHPLNVSDFLYQHIGKSGVDFLRSLLRYDPAKRMTS
                     AEALRHPFLSPEVANM"
     gene            <39491..>40456
                     /locus_tag="LDBPK_120140"
                     /db_xref="GeneID:13390143"
     mRNA            <39491..>40456
                     /locus_tag="LDBPK_120140"
                     /product="Alg9-like mannosyltransferase, putative"
                     /transcript_id="XM_003859078.1"
                     /db_xref="GeneID:13390143"
     CDS             39491..40456
                     /locus_tag="LDBPK_120140"
                     /codon_start=1
                     /product="Alg9-like mannosyltransferase, putative"
                     /protein_id="XP_003859126.1"
                     /db_xref="GeneID:13390143"
                     /db_xref="GOA:E9BAY9"
                     /db_xref="UniProtKB/TrEMBL:E9BAY9"
                     /translation="MCSCVQVSSLNSSMGRGHPHPRQGRQRRHADVSLECGSCVSGAG
                     VECRVAAGATAIGGAFRLQGKQTPLRVGACLLVNLSLVGAGACLLWSPPRSRRFLPAA
                     FALPDRHTFCGDSDATCVREHLPRLPLFSDFSALTMLCVVLLSLPRTASSVSVFGVGA
                     HTHTHARPYGRRHILEIGVTARVLLACRCSLAVSLCTEAVNSFALVRTRTHTHTHEYE
                     LRHFGVVRMRPLCPSRRLVRDGAPLAAHADGNEHPRLLYCLSATCDDGTDISGAALGR
                     SRGRDHGHVGGGNSLDRTECLASWNAARVPASAATWVATRLAFSA"
     gene            <43060..>47124
                     /locus_tag="LDBPK_120150"
                     /db_xref="GeneID:13390144"
     mRNA            <43060..>47124
                     /locus_tag="LDBPK_120150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859079.1"
                     /db_xref="GeneID:13390144"
     CDS             43060..47124
                     /locus_tag="LDBPK_120150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859127.1"
                     /db_xref="GeneID:13390144"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ0"
                     /translation="MRSKVAGGAVPKAQEEGVAVSAAVPSAPRSSVNKRGRLTHHGSV
                     GGALTGVQKGTAPPLSARLYEDPCTEALDRRNSSPAAPHARTSNATHARPSSSVVPGR
                     KTAAAAMRQPPPSLSAAAQPLGNAAAVEEAVACSTDEPSTGPSAVGCAVLSEAVKSRM
                     STTHPALRLPSAGVFAESPAAAAAPVRHAEVLCVALPEMPLPQTPQRVSAAGGGRLEL
                     RMRGLVALPCLHLSAAPKSPSLDARHESTTSSSVHGSGDVAAGRLHAVSFRQNAISSL
                     STQSVRAMSTSQASLIVPRSSPLQCYAHVSSLDLTHNALTSIAGIDALRCLRSLRLAF
                     NRLTSLAPLWASRYVAQLDVLDVSSNALTELLSAEDVHALKRHQIRIVTHPTQAHSAA
                     HGCPNAKCGVYKAMGLRVLYASGNKFCEVPSAIYTFTQLTDLRLSKNVIESVPDGFPV
                     RACLPQLTRLDLSMNKLPAAMVEAVTARAEEVAESPLHRRRTSTTSPSFARVKGYRRA
                     SAHRSHGATDPSAGAKTAALSSSISSALKAGEDASSEEAGSGAVHGAECSRDIQSRVP
                     GGAKENGRAAAEEGDGVSAVNGSGQRRSSASAAKVADDAESNGSRGTLLQLKADAAVS
                     PQPPTKTRHESASATASSPSTRKATASLPPTAPAIATVSAQKSQQQDAVQCVAENVYS
                     IDLSLWAAVVRRRLEEVLRRSPDSDASGAPGAASTFSMHELLVSLSDTLGGNSGGGGA
                     TALPRYRRRPAATARTMAALTQCLPSCSLSYSEEAQVRRPPLLLLTGISAAVAADESE
                     LLLYEVLALHIVHNCLCTAKSAAGGVSPPYAASTASSRALNSAELILQQACKYENSSE
                     PLLRAEAPAADRASGGELPPLRPGSPGSGRGGGTARQLNFAVPLQTVHVIACTDTAAT
                     PHSSVSALWAYLTWRQRWEAAVSCRRLPHKSDYICELGMQAADKHASHPLSSDAPSVT
                     SEANGSGTHAARHCAAVVPLYPFAANSPVPRAREEHWLHEYRPASYCVVPPAWELLYD
                     LLLRPSALEKTSLKRPHVPAVPPLLAGVGSRVQHLRGTPVSLACVLLCAVDYSGCAGA
                     SPMCASPTSPVLRWPTPGTGGPAASGAGNGTCAITASHVPCEGVIRRALQWRQHSQQL
                     WSHVEREANIVAAEQVTSCSMPLYSAEEVLQSRQAAVAALGSPGAHDTRLRCGLFGQN
                     GVSEEAVESAAASEEEASQPQCRSLALAKPLSQLLRSASNTAASCSAEPCESKTATAT
                     DTTMRSREIEGCSTPAVAVGADGGSAPAAAVDAVGGEADEHGGIEGQDGADAAARFNE
                     VRDDNTAGSAVSATATAAQTPELPAEDAWWLCEN"
     gene            <48243..>50693
                     /locus_tag="LDBPK_120145"
                     /db_xref="GeneID:13390115"
     mRNA            <48243..>50693
                     /locus_tag="LDBPK_120145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859080.1"
                     /db_xref="GeneID:13390115"
     CDS             48243..50693
                     /locus_tag="LDBPK_120145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859128.1"
                     /db_xref="GeneID:13390115"
                     /db_xref="GOA:E9BAZ1"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ1"
                     /translation="MHQRITHYLQMAAALLLLSLTHYFASCFLPISDCDETFNFVEPI
                     HYLLYGSGKQTWEMCSRFALRSWLFLWIYAWPAVLIRGAASLSSVRVYFYLRILNGCA
                     AALAELFFVCSVWLAFSGKAAGVALLLLLSNYPIHHAAVSVLPTSFAMICNFVVLGCW
                     LRTQPWTTYSPASPSRFKGGSTRNARSAAAAHVVRLSTPMPSSSSSAPPRHLCWFIGA
                     ALFFSALGIVTGWPFAVLISALVGLDLLLHFPAQALACTLGSLLVVCAATFLADARYY
                     CRWTLSSWNVVTYNLFGNSGRGAELFGVEPCFFFWKNLLLNFHLMFVAVMLAPLVLLY
                     APRRELAATSARSDAVSSGRPPGDGAAQEPNDSAVSPTNSLVRSRLRTSGTHGNAAEL
                     HSSLLANRHPGEQVLAAKTGAAVSRVSRQRELLYVMPFFVWFLFWMSIAHKEERFMSP
                     AYPFMVLAATRTLCLMFFPDAAEGQPNSAAATPKREKITPDVVAVTAADAQDTALTCQ
                     PPRRPSLPPQGCPSPAFLGWRHLAGLAFFLAFFLLSYSRAMAVYVFYSGPERMFFDWY
                     PVLQAEAQRAWEAKRQAVRRDAAVRGQASPSSLPPGTTAQQTQELRAYYTVCLGREWY
                     RFPSSFFVDHRWIRYQFLETHHFHGMLPLSFVTPPAGQESGFLRAPSSEAAAATSKSP
                     STSSSTTARGSCSCGAPGVNDLNQEIPEQYVRYPSEQCDAIFDSLSPPSHVSAAHHAT
                     ELKHLQLDTVFTRSLLNISALQAVLKAGRKTQRVGNDAYAVLDVDRTPLWCRVLYYPF
                     GVTRRCAVWRPLVLNSKP"
     gene            <52485..>53687
                     /locus_tag="LDBPK_120155"
                     /db_xref="GeneID:13390146"
     mRNA            <52485..>53687
                     /locus_tag="LDBPK_120155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859081.1"
                     /db_xref="GeneID:13390146"
     CDS             52485..53687
                     /locus_tag="LDBPK_120155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859129.1"
                     /db_xref="GeneID:13390146"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ2"
                     /translation="MCLHVMKVARTPDEPHCEDSVNPSASTTLPSATTSSSCPVEHGV
                     PDEESRFTRLYEAVVEYESALRVENYTRRRLLDECCATSDAARRASQRTCRMLRQRHP
                     ALRSLSPTIEGMRSAGADRTLAARLLADSAMPAAERLKAYLSPALFAWWCASQGPSTS
                     SAQVTAAAPLPTSAVASDVRPQPPPPLHTDESVAEVDEGAHGEGLEALYMDVVGQEGP
                     ANNREAAVNASYTREREAADRAALLRAQQATMAGRPCGFAAHGGAPSTDVLLGNASSL
                     PPEEDDISLVLQPVLGGVAPRRGRGILEHLESEPSVTTSSATVDESCLQVGRETATRT
                     CAVCELSGVFAGPHSRCINAVELQEEDELHPCGTCGALVHSYCACSGTTADTHYCCSH
                     CCQGGDTV"
     gene            <54358..>57081
                     /locus_tag="LDBPK_120160"
                     /db_xref="GeneID:13390145"
     mRNA            <54358..>57081
                     /locus_tag="LDBPK_120160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859082.1"
                     /db_xref="GeneID:13390145"
     CDS             54358..57081
                     /locus_tag="LDBPK_120160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859130.1"
                     /db_xref="GeneID:13390145"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ3"
                     /translation="MSDVLGYLNGVLHRVSATFMPTEMDDVASFLRGDAWVVATAASA
                     SAQQTAQTSSTAATDLSPGAARPTTVCYPLGATRWGHFIPLGIAGTTLVSAATSGSRA
                     VLLNFFESNGFEQVLTVSLVPTEQQQQSNVHLAAPGTMEAASSSGGAALSRDGHRHAD
                     LWRTQWHSSFSPSGTGDTAAFRKRARSNAVSSAVIDVSLDSRYGTTAEAARQACMAAA
                     RRWFEGVEERALLDADEVREGGDGGARRKHKTYLRRLLLIVRCCTDNRVAFSTRGGAT
                     GAAQASLSGTSRRHRRGEDPLYLLLHDLAALTTLYEVRLASTCCVARPAVLLLPEDDS
                     YGGSMLRQQLREEVGHRYWVELFLQSDGASSGVPARHSEAGAADAGRGARKGDGWRAT
                     LIGCSSGASVAPGGLGSVLRQRQHEQTETPLERGCRLAAQWGVLDLPAATRSEPQNKG
                     GEAFRYSVASASPSVGVLGGGSASEQTPSSIAGGPQPTGRVSAQQQEEGLRRHASCFF
                     LRPSNAPLCVFLMEALRRFPVLVRPAVLQHWQSTWTARHSLMDVLLAFHTALCPFVLS
                     SSSAGVTAACQAPPSPSWMKGGPPFPASTMLQDTVDLLDALLCAAFALAEERDAAQPL
                     SVNDFVIEQATLFLLFYEALVHQREGRLRRIPGVVRVLLGLSDRCASAAAESCAADEA
                     AACLPRGGATANEKVHHAVRHLLPFAPLNLFYERVAQLAAASRKGHDSRREVQPYPMN
                     SIALPIRRMSLAPQLQHSTLLALLPLGESLRELQGVAARVWQEELPACWQRVVAAVGT
                     RDGHPRAHPSSAALRGTNDDAGASAPTQLSVENFYHPLVPHAVRVLYLLTAHALRAPT
                     EAAKQVPLVQLQMICQLSDEQLLLVLKELQVAGLASTNLKTKSARTLLDTV"
     gene            <58061..>63001
                     /locus_tag="LDBPK_120170"
                     /db_xref="GeneID:13390116"
     mRNA            <58061..>63001
                     /locus_tag="LDBPK_120170"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003859083.1"
                     /db_xref="GeneID:13390116"
     CDS             58061..63001
                     /locus_tag="LDBPK_120170"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003859131.1"
                     /db_xref="GeneID:13390116"
                     /db_xref="GOA:E9BAZ4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ4"
                     /translation="MVKLHQKHASAVATDAQAESDATAMHQGPVPPPPPEELVPDAGP
                     SAAEVPLGDPVEFILDRVDSIERWRSTVARLNLAQLGVSLVRGVLRRGRYSTPPMRVF
                     DAAEKTAPATDAAEAEEPVQSFYPSQPVPPWLCPHTSFEIDQVATQVAEQDEAAQTLV
                     RGVASPAPGQATHRPPNHHRRAHPSMQPSVARRALVQTASRASVPLYMGMLIAFIGHG
                     VASMYNADTATGLLGASDAAAGRSVQTPAPTPGAVAGRLPTSSRHLHFTTEMTSALHE
                     VHRAAAEVICMVDHESKEMHALATAALQSAGKATAYRTDEDEQVQDMRHAQLGRSCRH
                     LSRIVANLYSLVSLLDFFAVESASLPTPTPSTAAASGAGHSNMSSANVGFLSTSSASE
                     AAAVAMEKRGAQTTTVAPYTDSSTPNATPMPSAMKKHVPNGAAPAHPYTTERFHKLFD
                     ASGHLPQSVWRVFSAVATTLSQFAVSWSLTTGDAQSRQAFNNAACVILGEDQRCLLLQ
                     LHRLCARFIVLRHRVYALHPVNSLHFKVKQMLEWSGLLNADVPDAWSYNNGDIDRCDL
                     HSDRLHSTYARGLQWSVNSSNKMALQAAVACPYTTAARDSALRRMKESSAFSPGGSAV
                     AGGGGVNTASDGGASAPLSLLTSLASAGANGGANAAFAGLLAAPLSSASAAPEQSSSV
                     AALSQRSVVPGYVGLRNNGNMCFLNSVVQLLGSAALFRDDLTARLQDAVFCNSAHADH
                     RAPAAAHAGNAHAMAAPFAKYGCRLAMALLLGEMQWRGSHRHSRLPVLPDYLIPHLPP
                     PFDDHRQHDASEFWHALMDKLDAPNQPGGAVVARWFSGRTATTMTCVTCQHTRLHTDT
                     FWDLSIPLLRATSPPSVPASVGGGAPTPPWAPVAAAGRPVSQVEVQHFARATAVTTTY
                     ASSPASDFPANASTTADASAELEAAERAEEEAAERVNNKAALNQRPIVPSSVAEPYST
                     TPLPSSMVAADEAPKTLQHLLLHVLHPTLNKELLHGSNALDCEHCGRRTDTELTTRLV
                     AEVEREAEVGVDTAAAGAPEECLGAVQEARVSSGGSAAAAAWESLVEGEPPTPCAADE
                     RASPHGESKCVEHDLALSHSLTDTAAGGGLPYYLAVQLNRFAYRRATQTYEKVTDGVP
                     LNEVIVVPVCPEITEPKDGAASPADSQEFNAQTAMPNEEDGDANTQREDDGRHGGPST
                     RTPTAPRSAAPALPVWVAYRLRSIIIHSGSTPSSGHYFVLTRRLAAVPAYANVNESSH
                     DEDGEYNASAAADVSSMRAYVKGLGAALTACLGAERHFSYAELVQPTAGAEGEGWSAC
                     ADVEGAGPKSQGRPAVASLSRGTAETVQSPALSPPPTLPTAAVSVSGDRLYENWVMLN
                     DSSVQTVEPDTMRHLLHGRGGGVYSASETPYIILYEKLPLASEGTAVRDALLEDEEAT
                     DKRVAGAALWETHHASVGASGVTSVGDTSSKPVQFAREVLQIFNARLKDEVAHNAALS
                     EAPRTADGHGFTSTKSSEASSRPTPVGTVVHQGSSATAWRTIVARSSWSRATGVGDAA
                     RAAAVKASLTDASKVIPTCFKGTGSVGRPSASHRPRRLMSTVKYAKLPRSKRYNGNLN
                     RHSTQEHRHRGGTAARSSSGSGAGSDADDEQDEPRS"
     gene            <65590..>68877
                     /locus_tag="LDBPK_120180"
                     /db_xref="GeneID:13390147"
     mRNA            <65590..>68877
                     /locus_tag="LDBPK_120180"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859084.1"
                     /db_xref="GeneID:13390147"
     CDS             65590..68877
                     /locus_tag="LDBPK_120180"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859132.1"
                     /db_xref="GeneID:13390147"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ5"
                     /translation="MPLTQSPSHTLPAAGSGGDKEDEAAKTCMAPERTSRVRACPSLR
                     SASGATADPDTSAATSEVVGGDGEAEFSDVENQIVSGTQDHALLLPRLSSSISITGSA
                     SSLLRRHLSSFFSGGGSTRTAARGDASSSMAAPDRTSSSSQEATTANSEVDGKPLERP
                     LGYSINSTAAGDSALAPSRSSVQGRSVSSVSHRLYRAYSLFWADATASLASPSTLLWG
                     PTRTASAPLPLSSSTRVGHEDAPDASIEAVVAHVEAEDCSELTRATAAASSVPRARKA
                     ARDGGTDAIPHPRIASVERNGCSTFTEVTAKQSPMLSMRGAADSSSALAFGCTPPEDV
                     FRREAVEQHVGEDESSSSNLRFFSSTATPGMHHALYAVPGAEQHRFPSESADDAGDSH
                     HSRGCSSDSKPRDASRKYVAKERRPGRYQSNDFHGAARSRSGDVECITMSSLVAHVAV
                     PPTVQAVLRNSDATKEELWMALRTACQQCEVLQRRLARAEGALGNEEEVEWTEGEVGA
                     TAEGGALAHVTAHRRRSGNAGRTSRRPWRRHADDEERMAPNAGGAVEGVSEGEKSIAS
                     EQADSGQMRSSTAPPTPTRTDRQVHPGHRARRRIAELAAASSSGAAAAVASSTPPFLV
                     SALPDGSTNAADLDPHSGRGGGTGDASSVLRHRVSEAIRRVEAKRNGPLRSPHARQSP
                     ETHTRPNSSGLDGPTSSHDADDTTQNSSDHLRLSLSPPPQPEAHGNSHSTSSSDLQAS
                     GARHVRVEDDAPPTLAPTPGLTAHDPLSPTRIESGSSSSGSDAGAAPLHASRNEVVDS
                     GGETAGPGESGILVSPTLPAITEVQAKAPVAQNSYNSAERVRLVQSPQQQLHRRHRGA
                     SLVSLYSAPAALDESVHFNGPATAAESLATLQTAAAFKPASWPSNGLQSSYSGGRSAG
                     FHSRSPLAFGSPTLPNTTQHRSGWTASTGANGASTAVIASHVTPLSGTPPSLHSSALF
                     GLPAPPRSPLRSESSMSSVEPAWLRQQQQQQQHATAKATPSRAAAAARISAEASQQGS
                     LSSTRSCSPNKAALSAASATLEMLRQLQQEDAPVPPVTGDDQKAALRQWRREAAVKKG
                     SGTAPMC"
     gene            <70610..>71845
                     /locus_tag="LDBPK_120190"
                     /db_xref="GeneID:13390148"
     mRNA            <70610..>71845
                     /locus_tag="LDBPK_120190"
                     /product="proteasome regulatory ATPase subunittcc1l8.3,
                     putative"
                     /transcript_id="XM_003859085.1"
                     /db_xref="GeneID:13390148"
     CDS             70610..71845
                     /locus_tag="LDBPK_120190"
                     /codon_start=1
                     /product="proteasome regulatory ATPase subunittcc1l8.3,
                     putative"
                     /protein_id="XP_003859133.1"
                     /db_xref="GeneID:13390148"
                     /db_xref="GOA:E9BAZ6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ6"
                     /translation="MAISSVASVSATKASALAAKKAEKDAHASRSLFEEYEQLSKDIK
                     NIQLKTMICRTETHQLMKEESAAKQEVKRIQAVPLVLGNFVEVVDSVRGIVSGTSGSQ
                     YFVRILSTLNKEHLKPNVSVGLHKSSNACVQLLPSETDATITLLNSSDRPDVTYSDVG
                     GLDMQKQEIREAVELPLTHAGLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVARHTKAS
                     FIRVVGSEFVQKFLGEGPRKVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADRE
                     VQRVLVELLTQMDGFDQTTNVKVIMATNRWDTLDPALLRPGRLDRKIEFPYPDRRQKR
                     LVFQVCTSKMNLSPEVDLEDYVTRPEKLSGADIQSICQEAGMLAVRKNRYVILPRDIE
                     NAYRTVIKKTGDETYDFYS"
     gene            <72617..>73504
                     /locus_tag="LDBPK_120200"
                     /db_xref="GeneID:13390117"
     mRNA            <72617..>73504
                     /locus_tag="LDBPK_120200"
                     /product="glyoxalase II, putative"
                     /transcript_id="XM_003859086.1"
                     /db_xref="GeneID:13390117"
     CDS             72617..73504
                     /locus_tag="LDBPK_120200"
                     /codon_start=1
                     /product="glyoxalase II, putative"
                     /protein_id="XP_003859134.1"
                     /db_xref="GeneID:13390117"
                     /db_xref="GOA:E9BAZ7"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR017782"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ7"
                     /translation="MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNA
                     DYKPILTYIEEHLKQQGNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVV
                     VVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVAL
                     FTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMT
                     FSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVA
                     KMNQGNAHALMMYLYNACD"
     gene            <74304..>74588
                     /locus_tag="LDBPK_120210"
                     /db_xref="GeneID:13390149"
     mRNA            <74304..>74588
                     /locus_tag="LDBPK_120210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859087.1"
                     /db_xref="GeneID:13390149"
     CDS             74304..74588
                     /locus_tag="LDBPK_120210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859135.1"
                     /db_xref="GeneID:13390149"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ8"
                     /translation="MHPSGRSYTVHGRGCEVTHARPRGFPFPLPSLRTSPARLASSSV
                     SSAFVDFTRSPTTSRARARRHSRHHERRSGGSPRRGAHPQMRAVVPARTE"
     gene            <79878..>81974
                     /locus_tag="LDBPK_120220"
                     /db_xref="GeneID:13390150"
     mRNA            <79878..>81974
                     /locus_tag="LDBPK_120220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859088.1"
                     /db_xref="GeneID:13390150"
     CDS             79878..81974
                     /locus_tag="LDBPK_120220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859136.1"
                     /db_xref="GeneID:13390150"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:E9BAZ9"
                     /translation="MAPMRHGAADAAPMCLADRMKQRYRCPLSPLLMCTVLFAQFLLC
                     STSLPVAADTTITPLLNITSTDKADPDEYYKILLSQDATILAGSTTVLSSDGVAYPNL
                     NMVKGLRSVPQVPGAPMAQSAPKRTNTALKAFRADVLSEFLVAMALLYLDSTDALPFA
                     RTAPIPSTYLPASYTGGASFVNPSFPTVPITLNMLLQHVSSLTETGLDLRAETAPSGA
                     VSTLSAFVSSLFSTTTTTVFSASQPGLSTSYTYSHANVAIVAYVVEQVLATSTNYSAL
                     SGIGEFVFTVVMPPLQLSNTFLLNRNGHVIEAAYPLRSGSSHDTVNHVARQVLDSRNT
                     GILDSAPREASYFSDYMLFTTSADVAKLAAEVLVPGGFYHMRLGASMLQNTVPIAVPT
                     MRYTEARTTGLFLFSANKLCSTMYAAISYSGQAPYCRYNSATVSESAPPFGLVATGGT
                     DELAIVCVPVVSNTKTFCSIAELSFSGTGCSRCSPAAAGGRAVGLAMVSLAHLTSEPM
                     PVAPAPTPQSTARTFNGWFVFLGVAVTLVVVVVASYITDYLIQPPPPAKIIAPVVAGQ
                     IGLRSGTALNGPVGGGGAVGSSEVPVDGESPEAFRENGRDHDAEDLYSGADDEEQTPY
                     LARSGDRARGSSSLRRRCRRRRRRRHNGEPNPASDGSYSSGDDGWGDDRDSVDRVSTG
                     SRRPSPKGALRFDAYI"
     gap             83318..83870
                     /estimated_length=553
     gap             84997..85074
                     /estimated_length=78
     gene            <85452..>87806
                     /locus_tag="LDBPK_120255"
                     /db_xref="GeneID:13390118"
     mRNA            <85452..>87806
                     /locus_tag="LDBPK_120255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859089.1"
                     /db_xref="GeneID:13390118"
     CDS             85452..87806
                     /locus_tag="LDBPK_120255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859137.1"
                     /db_xref="GeneID:13390118"
                     /db_xref="GOA:E9BB00"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="UniProtKB/TrEMBL:E9BB00"
                     /translation="MSANRVPTVVAGLDGANPVKRERHPAWYPPLKLDGNGLKVMNSL
                     TETLEDFAPRDGRVVRWYTCGPTVYDLSHMGHARAYLTFDIIRRVMEDYFGYSVIYQM
                     NITDIDDKIIKRARVNKLLDDFKEGELRHGDVARLMAFTAEAVTAAESGLAKRKAALF
                     EPITEGASSRAKADREEKLLEVQLKESQLVETKVKIAAAKDDFAALFAAASGVNGDLL
                     DERSGHSVSDQQIFEDHARKYERAFFEDMQRLGIREPDIVTRVTEYVPQVVEFVQKII
                     DNGFAYVGETSVFFDTEAYIRAGHDYPKLKPGGDRNTTEDEMAEGEGVLSKGIEGEKR
                     SPNDFALWKFSKPGEPRWPSPWGEGRPGWHIECSVMASDILGENMDIHSGGWDLKFPH
                     HDNECAQSEACNLHSQWVNYFLHCGHLHIKGLKMSKSLKNFITIRQALDELGVTARTM
                     RLLFLANPWNKPMNFSDQSLDEAKEKERVLRAFFGSVDIVLRTDNWKATQGANKHDRE
                     LLSKWVEAEAAVHAALQDNFDTVVALQQLMSLVAATNQYLLSGERPSATLVRKVGCYV
                     TKMFRIFGVVEGSDDVGLQKQGSGDGEARFIEVVNTLVRFRDEVRDAAKDHKVVAGFL
                     PLCDKVRDEWLVDAGVRLEDNPAGPTTWKSDEPALLHKELAERRAQQEGDRQRRLANQ
                     AETKRKLVEKWRQFTYPPSEYFRLQDEQRVEKKYAAYDDVTGLPTMTAAGEEVSEKEA
                     KKLSKEQAKYAKSYDEFIGKGGVSWLQEQEAELASMVAELKGSN"
     gene            <91189..>99972
                     /locus_tag="LDBPK_120260"
                     /db_xref="GeneID:13390151"
     mRNA            <91189..>99972
                     /locus_tag="LDBPK_120260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859090.1"
                     /db_xref="GeneID:13390151"
     CDS             91189..99972
                     /locus_tag="LDBPK_120260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859138.1"
                     /db_xref="GeneID:13390151"
                     /db_xref="GOA:E9BB01"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BB01"
                     /translation="MWGPWRTGPSISSSRTASSSRTRVVACNEIRRWSEPAVGLVPLA
                     RGRGYGNALFAASHGSSRFICGSRFSASATAFRPTSLLLCSRHCREPLASGGDSVAPP
                     ASPPSQPPSAPSAASQRKEYTAELLRSISRRGGGAVRRARHGTTTSAAVALSALLNPS
                     SISAKGEATNNGGGAPALAATSVKGAEHVAAGSPLLRVFDATHAPRSTAPSRPAEPKS
                     PSFAGPIANRRSIAEAPRTRRNANSNASVFTAGSTAGGGAPSSAPPPAPRPTPLSRAL
                     LHKLLHTIRTEKRVPWDALSRLHPELLHMPLYACRHEWCEGYCARGSATPIVSLAKAG
                     SARAPSLPAASLTTIAKPRGDRNGHRRRLPPLLLCAASTGTGKSVLIPLYALDAHWAV
                     LERRLLRTIDAYDKAAAAEATEKVRGGAHSAHDNLLSAMTAQQTAAAAAEAEAEAEAA
                     HIALQPFPLDSQESFIREFTACSRLRIVVSQPTRVACAELAAYASALLDAGRTRVGAS
                     DSTEVAPAGAGLSGGRRRDKKQCALSRRLVGKRVGFAVGGESQFCSETEIVFATPGYV
                     LNALQVSHPQSSLSPTTLVVDEAHCRDIETDALLAWMKLSRECSQGGDASTLDTSAPL
                     PVLRQYYVVSATMNLQAMDAYLCRGLQNGSNGERDAHPGPREGLARGPERTIAESDAL
                     PEDAGGTDPVSADAPLLLLSPMQLHHVRRWWQREQSLGAGGRIDGADVDSAVARAVTT
                     DQRVRAAVLQLVEVTEGYGECDDGYRDDLLLIGGAASAANGSPAASSTEHAVADFFAS
                     SAKSPTETTARVAPSRLSPPLNPSELRGADGAVIVIATQPYRVERYFVDDLDPVKGCF
                     ARSQVLFDEATRLSATAAASAAAARTPSNALQGGASGGRKGGSQPKQGDKAASSASAA
                     DATQRTSRGFPMCLTDDGAALRARLVDLHGTRAASYVMLSTRARALVELILQLLQAAR
                     LRWIDGAAAPPATPRPPRSEQSYHADDIASEPVSTTLAAADPPAAEAPITVLVFVAGI
                     SELHQIMLALERLCDTVQPSPSTALFPSTNVADSSAPSTLVLRHGSEVFSVGLLHSTA
                     VGSPQEQLTATEHSGAPLRLLLSTNVAESSLTIANTRVVVDTCLERRISTDDVTGATQ
                     VLTSFVSPSGLRQRCGRVGRTGDGVVIHLAPRRFVLPETLLQPPTTTRRAVLPTSSTA
                     GLPDSSASTLTFEALPDGVATVLLRLKFLFAKVGDALAALPSPPSAAAVRLALQQLAD
                     MDLLLLPEAAETTPPQETTRNVPDLAARTASTERRSLMEASAASASAAARGPFRPANA
                     VALYGGDGALLPLLDCSTFTPKGYFVASLPLPYEHAALVYYGLQFCCVEDALLVACAM
                     AVPSLFLTPRVSSRSAIQMGARRGTNSDYASQRWDVDRMPALSPLEQFYRHLWVQRHL
                     AGFAVQRMVRPAACPSDGGEATNSRQCIHDKSSASGTGEPAPTTAAATTSVERQAGQL
                     SEPLMLRALLRQWYAFSNVDACIGFQNTHGLNRSAMRQVDSMVAQTCGRLIRLLLQVS
                     TASEDGAAKRFVVEDAEAEVDFGAYVCQAGAVGSGATVLPSMNGMARRGSRGGGSTIG
                     RIPFLPDWPAEAREQLLRSLRRLQRVAVGRVHLRHTEVRQRYGLPQWYDSEERWIRLW
                     GRPYLRHGPTDHLASRISGRGAGKISAGVVDKERDAREAVQRHPCFRYWVDGLPALRS
                     PYPSLYRQQRTTSVAVGGAITPFSTSVPPPLSTQVTRSKVPIYRPPVPPPPIPPVVFA
                     MGRTDDRLCAAFVAAFGHRTLRGEDGGHRFHHRRLRRNMQALANDEEHVCTFHIDVQQ
                     QQDLASSSLSSSGAADQPTCTAPLSPPSNSYDLLHASGVTSKSVEQALSPYLRGAGLQ
                     QLEVFQSNRLAVAARFASDGFSGLFDSLSPSYTAVLCANGDADSNADEESDDMYDGGS
                     DAVSTQRVHAVRDGRRTAARSTRSAEAMCGVATSEAAPTNARPVSADGAHGPPSEDLL
                     KAVVLPSALRYADGGRPPPTATSPARDTSTRISHPYVQLAPFGVSLLTAATAGTGGGG
                     GGSSLGSLQRIPLSGVATAALSSPTVPAQPSSSLITVPTLHSASLVRQADSAADERRS
                     VRFVEVPLPSAAAATRPARGGAATATVTTTTCVAWSDNLGISGRSVTRAAVAALGLAD
                     LFPTAPPLSKNSSPLDSRGTPLRTNSGDGTAAASAPSSACTNLQPSNGTATPTTLTVS
                     VVPPIYVTRSITWKVLLPALVPPASSMAQATHKGSTDAAPPPAHYCMLCNYLCSSQGA
                     LDQHYRCASHLEHLYHAVQLGLRREHLETLYGWAPRTASGHQCAGTDEAHTRDHPGFS
                     ESEGSASTLHLAPPVTAALPLASLLSLQSVTRLPLAQHVYPCVVGAQSFLNCLQWSAG
                     DPAPSSSSLSSSREPKLPGAHKAEGRAAGAHRATPLAVAGSLVALQSVTDVLPPPHLR
                     KPTQPSPCRGGFGVGAAPPSSSVDAETLSAHHVWVLNLSNSGEASAAASGTTSPPMSA
                     LLVVAGYLAAASPQATVALLLNDTHTHLHAVMLYGLGVWRLPTPLPMQGYMGLLEHIG
                     RGGGWPGVLVPMTNVPSHKRHESVREEASPATHGPSDGLHWCAPEAACALSSDKHRCG
                     MSASARALNRDAIVEATLLLVLHEYLHARRNMVTLADYVERVMHKLQLSPFVVSGARA
                     VHGAEKASPAVTAADVLTAYLIHVRHGQTIQALLRDLGCVFATPPRALATLMQPARAS
                     TPARSAEEGCSAAQVGLRAPRRHEASLSPAAAALSKRLSYRTLGAEGAAVEMMFTVPP
                     ALPSRLPPVTFAAQLRQFYVDRHAHRWMPQRQASATPARTSGAAASTARAGDEELIKG
                     NSHARPARELQARDRAGRLRGPRKVDKGIEIVDDEESLPQF"
     gene            <100383..>102437
                     /locus_tag="LDBPK_120270"
                     /db_xref="GeneID:13390153"
     mRNA            <100383..>102437
                     /locus_tag="LDBPK_120270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859091.1"
                     /db_xref="GeneID:13390153"
     CDS             100383..102437
                     /locus_tag="LDBPK_120270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859139.1"
                     /db_xref="GeneID:13390153"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BB02"
                     /translation="MLLLLLLSRPNASPLLWLGRFVFLYSCCIVSLAADSWAAPSTHA
                     STGTEREGTAAAAVRLRVLVLEKCPRAATTAMLRSLRGAGHRRGARCILTRRRTASSQ
                     VIPSLPRTAQRAMSTSSRSLTASATSSASRRSKRLSYADADVVYGEKPTTAPPWGLRP
                     SPHAGSISTAMSAARHASWRIRAQQRWLTLLLALMRAPYIGAITMRVLEASAYAAYAT
                     GSVMVFTRRRAGPPVAVATEPDSSCENVDLCEAGCTAQTQVSQARCSAHLPKAGDLSA
                     SPRPSPAGRPSSSLLFSHDAPLREHALDCLYIGASSIHSRGLFTARALPRGTRIIAES
                     RRSLLLAPHFVTLLADTHDKLPDTWHYTQPTGCVVELVTQAQPHHLMNHSCAPNVCSG
                     LSHTFWEAATIAGKWQEQQQQQRSRRSGSTHGAASGRTEASHGNVREEGSRSDMIAWT
                     SSSSPLAAEAHSAGCGERLTRWPHFADANSFFLTRDVAAEEELTLDYSTRMAPLYAGD
                     SARALQSRSWLLCRCGQPCCRHYVYRPKPEVSAFLRALRTAPYGHERGPQPPGQHNVP
                     LMPDGAALSCPTDARDPVHIMAKLLELGFDDELVLLSYAAGSADVVAYLYGQPLPSLQ
                     KSSRTQSRAPFARMCPSSASAPPAVHEGIDVEVRRMTKRQLLSEYRYVFRLLNEAVPV
                     RT"
     gene            <103407..>105530
                     /locus_tag="LDBPK_120105"
                     /db_xref="GeneID:13390154"
     mRNA            <103407..>105530
                     /locus_tag="LDBPK_120105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859092.1"
                     /db_xref="GeneID:13390154"
     CDS             103407..105530
                     /locus_tag="LDBPK_120105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859140.1"
                     /db_xref="GeneID:13390154"
                     /db_xref="GOA:E9BB03"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002433"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR022644"
                     /db_xref="InterPro:IPR022653"
                     /db_xref="InterPro:IPR022657"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:E9BB03"
                     /translation="MGDHDVALCHVSRYNHANYWAFVPLPTVSDDTGCDSLHHDSASK
                     RIRMAPPASASKAGAAEERLHPYERRLLDQYQIHLQPANRNPLSRADSAAGREETAQT
                     PAQVQMVSGVAVADSTSDQHASVASSQDLVDLFFLEGSQAVDGLCFSPYPIYGWRTAE
                     ERRAAVCEVFKTYNVVTRLPASPAALAAAQRRYSRHRHSAIAPINKSAIETREQYWRR
                     LSNLYTQKGVKDAASAADAAATTATNGAVPAAPAYEPEDPFYIIDLGRVVEQMARWRH
                     ELPMVRPYFAVKSNPQPAVLEVLSALGAGFDCASKEEIHMVLGHQLVASPDDIIFANP
                     CKQLGDLREAQACGVTYVTVDNPLEMEKISRLMPSAHAIIRIKTNDSKAQCSFSTKFG
                     APLEDVEGLLEAARQFNVTVCGVSFHVGSGNDDQSAYVSAVRDAYQVFQQAVQYGFKC
                     TILDIGGGFPGTEVVEGSGNTSFEAIARTIRPVLAELFGGGDVTIISEPGRYFTAASH
                     ALLMNVFASRTLRLSDVEVSRQAFQSVVSMDEPEEYQYYVNDGLYHSFNCILFDHAHP
                     TLLLLNDGDGADGVESGTEAAAVCSEEEGETSLSGPLANDPLFMSAWDRRRSFARRPL
                     RITTIFGPTCDSMDCILKKQPFPEMKLGDWLLVPDMGSYTTAAAGFFNGFATRRLEWV
                     SSVDLCARPRPVYTREGNTLRCVSE"
     gap             106733..106770
                     /estimated_length=38
     gene            <110513..>115216
                     /locus_tag="LDBPK_120240"
                     /db_xref="GeneID:13390155"
     mRNA            <110513..>115216
                     /locus_tag="LDBPK_120240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859093.1"
                     /db_xref="GeneID:13390155"
     CDS             110513..115216
                     /locus_tag="LDBPK_120240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859141.1"
                     /db_xref="GeneID:13390155"
                     /db_xref="UniProtKB/TrEMBL:E9BB04"
                     /translation="MNDTEDDEKPKAQESVVDDADTDMARTAAEVTAAEALDSRRGAE
                     AVTAGAGGHATLWADRVETVTAYQLASAALRRLPTRTAPVDKDVWRRQRTEEGTTSRV
                     AASATHADVSASPPQPSAAPRGIIFDDADQPAACTTGPSLQTPSAEQVRVAVFTAVSP
                     SSSRFQVPPLQAAHMHAVQPSPHTSSHKGEESAVLTSSEGQSSSSANVYRHTDRQGKG
                     EAAEGANARDDADDEDDVAARVLFSLHRKDDMIRQLTHAVEALQDENALLRSLRAAAP
                     QADAVPPPPATGLALSPDRVKTPSPSWPATPVRWWGTKHKTALSDGLGPRHESSQALE
                     GSGHANVKEQPLRTSPSLSAAHAAVSTIAALQRTLADKEAELEALRSQVVTAGNKNDT
                     RDATAPAEAPPVEYSAGDSVISGARGAPSASPSAAEAAAESRIAQLEWQLQNVQQEKR
                     EDTHTLRDHIDHLTRELHRKSRDMERQQRHHKLELAALQQEVTALADQLEEQIRVSAS
                     ATAAPPRREPEAEQLMELQRELAQAKAREALLLTERAATQQRWLREMEEQKSLLDEAR
                     ADAAREEQQNECRVQQERQLAQKAAQQQQQLEEQVHQYKEALAQAKRELSDLRAVHQR
                     TEETVSEQRRQLQRISHDIATAALERAHDEQRAARAEEQVRLLHQQLSQAAATVASQE
                     AELESLRQARQDEAAAAVALQEEEHAALLKQVKGCMKGSEAVESALLAAESSRRAMAS
                     QLTRALEERNEYHRLLREASVQAQAQLLEQQQLLSEGNDLVHRRLQEAQEHLLQRTET
                     LETTQRELQAAQQRMLALKDELTRSQAAQRQLGEELHAAQARHEAQTAQLVHAKEGLK
                     DALHAQLATMGKLRRKEKQLHSQQAAAQRAMERRQEEQRALQGIVNLLWSPAVFLSPT
                     CPRASGVRPHESSRILRLPPPQVVRSAATLAPEGMPAMSRRALAMLERSATIHTRRSC
                     QIRKRRSVSMAGASAAEVAGVRADAENEDVDETVRPSRSASSVSSAAASVVMSAVSWD
                     NVPAASISDGDTALEERHRTAAAASEEGDVSANSRAAASARVPLHSRLDGGPPALERQ
                     LERSAIDHEGEGRTAATEADPSILRLLRAIRDAIEQMCAAYTAAQHELGTKRIAVRTL
                     VKERKAQQVQLEELRATLQEQRHKAERLRRDAVQSVRAASQAELEKVCHAWQEKCEAG
                     MAFQLQTYEEQHRRAVAEVLKACVEHVQAELIVFVELLPTTLSAGLARVAAASAERTR
                     DEVLREVHHQYWCSPSTTSAAHDLVCDNGRGAQARHTSTAAAAADDVSLLSLGLEVQP
                     EVQAECDAIIRDVLHMAGGWADLTSAVLVANSTAAADYPSGSVLPFSALPAPQPCTLT
                     YGAALESRASPPDAEPARRIVVNAEAALWSAEEMAELREVIHAHVTRSLSALTAAASR
                     SSLAGVTTSVSRNGASEERQGVDAHARDAPATVGGASGGTRSTNVKGRVPGEESKTAL
                     PRWMREGSASTRPASSPSRCSPVRETESTSTPPRSSAVEDAAAARVPLHHQQPRLLAL
                     LLDACVTHVHARLLA"
     gene            <115622..>121318
                     /locus_tag="LDBPK_120250"
                     /db_xref="GeneID:13390142"
     mRNA            <115622..>121318
                     /locus_tag="LDBPK_120250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859094.1"
                     /db_xref="GeneID:13390142"
     CDS             115622..121318
                     /locus_tag="LDBPK_120250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859142.1"
                     /db_xref="GeneID:13390142"
                     /db_xref="UniProtKB/TrEMBL:E9BB05"
                     /translation="MQGSPYGHHQLQPPPQQGRQSATAEAVDVPYSDANIATVLSLSP
                     FSEFCKLRDKWAAKPLIRGRYVGMCGGDPAQRERREDFEYITLSASPSASSHAFGGSA
                     HRSAMWGQVEAYSRSAAGKTIDPAQQRTPLALEKSMHFLVEHYLRVPHTPLVYTEPFR
                     IWGYLWDRFRGIRTTWGPQLPPSNVSLQGYVDSETDRTLSVEELHRESYRRVRWLEFT
                     VAALAVGGAYLCCSPEGCQRFMQDKKQFLESMSQCFTDLTVFYRAEQRHRNAEFFSVL
                     LLLYGLQQEMKVEDRSSFCRFHTVIVNGEPRLCPENASESVNLAQVYRELEKQPHMLE
                     TQPVRVALELIHFWAARQWFQFFEFCKSAPMTPLQRAVVFQSFTYGRYRAVLDLVLPN
                     YYVYPKLRVRHAILVAELADQLMMGHDHCLEFLKRMGLDAQLECKTPHQLQQQAASSF
                     YPIASPTSGPTAATVAGASASGAKAGWYLNLCHPNSDPLITADELEKRCVNKRVLFFP
                     THPAFFGFRVSHVAYERFPDAKGFPTADTEDVCDALAVAGSSSPVGRGAVRSPSGLQG
                     RVVTRSKPGTLPRRRLGLASRGDYGDGGDEDYYFDEYCHDGSNDEECERDDGSGSGDG
                     GAHRNTGDGCDSPPQQQSTVSPPSAMSPSLDKEAALLGQLGCPVNLMEVLEVYCPPYN
                     SEVAALRLSDASEELFASLPAHRAEMLLRCRHAHLRARHWQRASARDADTAAAVSEEE
                     ALYWAEKMEMESVSTASSLFDGSDHDDVDDDEREGHDVDAAAAHRAAVADVSLSSQAD
                     ALPPAVIEARQLLTAIRDNPLYAAAAADRAEAEDKARRGKQEEADARRGATTAETARS
                     DQPQRALALTETGQCTVAPLPDNGNDEAGQRCKSQNPRVAVEPPTTLPTRSLVDMIGN
                     DADAQAVTEGSSRGPRDASATHQERQQSMDQEDSATTVETHRHLQPQKPASPSPPLSM
                     PTLQPLVSTAANVFTPGKREPIVVAGTGSTTPIPTAGQREGSSGSSSGSGAPMLGYSH
                     LKPLKQTLSGDGEDNEKSAGADTEPGILSGSDGSISASAADGSEATSDSSSAEGGTSA
                     PPCPPLWGGQRPLPVPPSKATSDSFTPRFPLEARPEYSAAGAASHRTGGEAARGVASE
                     NESGEDAVVEVQARVSDGVWKHHKPETAWQRGVLVQRPSPVPIPAASVDVFARACVPL
                     IEEYLHLWVRLTHEDDATLRTAAQYVLDIREAEAEAPATQSANGGPEGGDEASCAVQT
                     RRGRLAQRRYSSALRGGGGATAAASTWWRQRRLQCTARAMALVARQLLTTAVLRGSMS
                     EYGQLMWDLSLSGWAPSKAADHDSAFGSGLRATDPIRRGVAKARAAQRHCAAYDDSDD
                     ARAARLSRGCSAAVLSASNVDAILAAAQTRSNRTLASSADGTVTAWPVAASTASTRSA
                     MPFTFTQEKAGLGYAKDTCEAALDEALNTVFSCAVGGVTLPARDSLAALLSSAVDVSL
                     DSAGACSRSRRTCTAAALQLTSIYIWVSTESYSDRECPATPAAVASTGAADAALFARL
                     FQNERERWLVSVMLPATACAAFEVFGDVDHRSDDDEQASRGQPNASRRSGKRRRSSAQ
                     HSHVGDNTRSVLWLREVGTDPHSASAFPPTPLAARLFQRDHFADVQVVRSAVMSSRHS
                     VGAAAHGSSTLPLMTRIALYGCDTHTLPRLRVRRDGGVRLAQQHSGFSTDDGHAKVEQ
                     VKASPDSTRALAMSHAHYTALLTVDIAEPGYMAKARRALAAVVASHVGYTTTASARGA
                     ATAMEWNGHWEGVPEQNCVEGIVLCLLSSPAQLAGTASIVAELEGMFSDLWHHRHGAG
                     ERRKTSIIAAASAPAVVGVEIVYGDAEGAKAAMKKGMRTLLSIYAQQAMAALDSDS"
     gene            <121704..>123659
                     /locus_tag="LDBPK_120265"
                     /db_xref="GeneID:13390152"
     mRNA            <121704..>123659
                     /locus_tag="LDBPK_120265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859095.1"
                     /db_xref="GeneID:13390152"
     CDS             121704..123659
                     /locus_tag="LDBPK_120265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859143.1"
                     /db_xref="GeneID:13390152"
                     /db_xref="UniProtKB/TrEMBL:E9BB06"
                     /translation="MYKHHVRMCTQACSSLSLFLALPLCDVMVYVRLITPALARLLDA
                     AATAPEIEQVRRDFIEERLHALVHTQSPSQLEGALWIYIVSQQQLLSRTAHDSKAPAQ
                     QQGTNCGALEAPTSSSSSSCPLPPSLLLPESLTCISDAVRWYCGELPVPAACPAADEC
                     EAASQTTPQPPQGAQQEKQPKSKTVIHIKREPCALPAEQPGARIDELLRQRQQPAPLP
                     APSQPAQRREQAAGPLATVQLALDALAQLKRVPALLQPRTIALLVRDFVSLWSLVYLC
                     KQLKRHQQCKERLLAGTVTAAIGEMDVKRGLGGDWRRRDRTRIGHSPIAHDADAEPIA
                     VCFHDYDLLLPWDLVQRVLSPPDVSMAATAAQCRAVEEARAGALSSASARTAATSPAF
                     ALILNPAVTPMDDNPDRLRKNARIDAIDKAASKYYYALLSARAHGQTSEHIRGAPSGA
                     SSASAAVHQEALRSSLTTVDIGEYGVLDPLRMRAPSYLAGANRSLSGGFGGGSSRAAS
                     ASSETAAKSYALFLRDASIGFDIQVMALTGAGVGYYLGYLRGLSSEWCTLYAVVGLVT
                     MMLVDAGLLIIRIGRQDEAVLKARARIRQQREKLNKEGEKLVRSMQAAASLSAADGAE
                     LTFASAGKAGAAAPLKMETDPHAKKNQ"
     gene            <125277..>134975
                     /locus_tag="LDBPK_120275"
                     /db_xref="GeneID:13389871"
     mRNA            <125277..>134975
                     /locus_tag="LDBPK_120275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859096.1"
                     /db_xref="GeneID:13389871"
     CDS             125277..134975
                     /locus_tag="LDBPK_120275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859144.1"
                     /db_xref="GeneID:13389871"
                     /db_xref="GOA:E9BB07"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9BB07"
                     /translation="MPTVSIVGVDAAWEPSCCPSVIADAAGAATRDSTGLLAVPEVDT
                     ETGIVILDLGRRSGDANASRGPHVYGAAHNAPNKPPCWARNDGVWARLQAAGFPCLVA
                     VLAQPLVRPAAAPPPPPPPLPPAQRTVEKGSADRGYADSAGLGSDAGAGLATASLLRP
                     ASSAGASNQTAKPLLVYLPTIVPSAATPNDAAASAGYGDASGGVGDTDSEAPSVAALP
                     SFSHSVSSRSVVGKLGKLPSPDLSPATAATTTAADLSFSVPSSIPLCRSSPPRALLPL
                     CFSSAPVAPLRHLLASAAVCVDGHRIPSAFSAAAAQAEEDAQAPLRGAGATCEAVKRE
                     HAREVDTLQQPPPPSSSAYTDASTGAVGVARVVCRAVWPIPPWSANPLPLFAPEAVPL
                     LSYSMSTDGSHRGVSVDKSATPRVAGTAAADDDNVEAAVSDLLEHLGEWNSSLVAGMF
                     LSAKVLAASTPTTQSATPSLSQQQPETTATRTRDGEAEAEAAALEKEGGSVTVASACP
                     TSMQELLALLFQYWHQRLADPPACTCAVGPPGRHQQHHEVSASLKAVAGTTATTFAAQ
                     ESVGVVPQSPSPPTQTPTLISRAFFQDPQGREHAAEAPWHKSIKQTPAQATPLSSPSP
                     LPPAAPHHYTSAFLVEQLLMSIEFSIAYLVSRKRDAAAVSGSQADTDALRDAFNEDDA
                     RAPPLTPLRVQQRLRCYRLPPVSSHTPFEVVWGLYLAQRMRMFSGSETLASAAKVRAG
                     AKAPAAARLRLSAPSKPSLEHAEAALADGEEEEQRHDACGLSCTAMDVWTLWQRAAGM
                     TWKRSPAAPTALAPIVKEAAVDATPLSPPLQLTAPLQSANALMEVSNPTASPPSLASP
                     CRTRIFSASSMERRRPSSDRQLVLPPVRSSAPQPLPSRLPTHINFTVQTVSKPCKSSH
                     SAPDVAAVAAAAIHDRSLPSPHAVLAAQAVQLQQGREPVQMSSATSVAAATAGLLQVL
                     PSFLSSRGPVPDAPSPPSLQPSTSVRNSPSPQWLHKRARASTAVTADVRAATQPAQRS
                     GKPDAWLQERRETHGVSEANAAVRHVPASQQPATGTMQGGRIDSWESIGDSSLDSADG
                     MRDKRNDGVARVAGQLTASTTVSRSIHDASTSLVAAGSQAHVQQRRSTLPATCTVEPP
                     KSVLPAAPAAESGRRKTHRTGEVGGDSDDGGRHTARATAATPLEGWKETLPPDEAHWM
                     ENRGGLDAATTVPQTSRCRRPRGGLYSAASFVAVLSAAVSQVLSEQQDPSQQHQQQQF
                     HGFPAAPPSFAPSGSVSFSSTAAAVAAQRLEQIRRGRLLPSLATLDSLNLLPQYVPVW
                     CYTYDPITGQRATRRRGDDGGGSSGHVHNRSYLQRYTPSSSGAVTRSRGGGGGGAGGG
                     IHELGRAGKAGLTATYRYVSETARTVLDAVKSSVPNKVQGARGINGNSTQPVSSGTGD
                     GGRAGFPATPATAGAPMESPVMSPVAVSAPRTSLDAPLPVMASVHAPAHGSGNATRDA
                     TKDPSLYYAMCGLYITEQDIIIRAIPTVEVERQREKARQKWRQQKGVPSAPTRGFGWA
                     KASGGGRGCLGRGGAPSVGSEAERSKCADGNNSSDEGNNVDDSDEEEVVELLILPRVS
                     LVSVTPCAVDRSAGGVFAVKHARKLYDHLERDRNFAPSSSAATTSDSTLTVPASGGSG
                     SGGGGEGGRDAAESSVPSASAGCRLSVTGTATSSTGTNARHHLPRTSAHSGQPGQTSF
                     MTSSTVVVLKLQSGQMQTVWLEFADETALNEVHQLLCAPLRPSTRPRGMAACQAGPCY
                     GNRFLSSARRLWCMVPLVLLATNVLPQGAATSPFMQALLKNVTVAAVMLNAQATAPCM
                     AAATTRSPSLLSMEASTLSLPSPLPPRGPPIMLADTWWLYDPAREFVRQGLSEEHWSM
                     TSANAEYAFCPTYPSTFVVPAAVARAMENDEVDGRHRMSRRVEAVAFYYAPTGGVLVR
                     SAQPTLATLVADVPTGQALEWTSRMTGGRLGRAAPAASSSQTQTSPLVVPLRDALRLT
                     LNAFAAAAGVTAQQIFVMDLRSARAAFANVGKGGGTMELLLYPFCGVEYAGLPNIHSV
                     QKAWRKLRASLTHDAPYQLRGDESGCLETQYVQHAGEPPYAAVVAAAELSATAKRPAS
                     GLSVASPLLASLLPRLQGCSPSAPQSARDFSSGADAEAVIKLSAGESGDSDGNGESGG
                     PRDGAAAEDYAANTTAMTSAPSRPPFSLGGVRWSAIFSAMAPVGGASVTAMMPAAQHE
                     WLAYIAMLLNTAVVVARRVCGVPTDPLYVPALQHNGPLANCFSYIVGHAFTQFRLPKA
                     TTSASAAPRSGSRRSLWTSAAATASAARSFKAPLASYEHSAHATLAHVVFLNCSDGWD
                     RTPQISILAQLLLDPYYRTVEGLCILLEREVLCFGHPTQLRSTAVRGNVDDYWDQLLR
                     DDQDAAVAAKRMSAQVPAAAATQTHATSATSEGQRLFPASNTRAIEARQRKTAPAASQ
                     SPTVLAAHTLAAGEMGNAVESEPRSDSEGGRASCNVGPLTAAAATARDDDDYDDVESD
                     ATSALLFDEGPVEAHEAAAADGLRERALHRWLQKARAALGGSGSAGDVAATEGARQSR
                     GASAATADAQSVCTSSMSSKPPKVPLWSSSEVAPILTQLLDAIRQLVVLYPACFEYTP
                     QFVCLLLDLLHSGLISTFSVNCEQQVEAQRVAEGTLSLSQWCALLLSTTTATPSALCA
                     ATPVTVQPSPLRNTLDTHSDGGGGDANTVLLLSSASNPRAPATPDSLRQQLPRSTAAA
                     LSTFHADPASEAGGAEASVGAAISADASFHRLDSAFLMGDAGLEQEESGENAVDSCRR
                     SCSDTLERKAFAVHPRSGSGEGASGSLAAGKQPRQRAAAARSLPSTRTPALPPLAQEG
                     KAVEEETATTGGRSYTPQLQAPPLARPDASLHLYDFDCTTQWGVPVASAAPPLPRSGH
                     ALPSPFSISSSVTSPRAYSARPRDEASLAGSGRQTQHPHQQAGCNASGATAADEFSRR
                     LLPISYEALYTSGYLNPNFSLRHNRVNVGPLVDFILPSQLTLWRAAYTRHSFWGVRQA
                     QLQHATGQHQQEQHRLRGAGGGIGQGASNATGEARSSFGRHGGSGSAVGVGGAHVGAE
                     AHGSGLWSAGASSTGAAASSGPIASAVPEDARWQPRNSTPHVPSFASASVTSRTGGGS
                     SAAFFMGEEDSESRSQGRPAHFTDVAAACTATSSTPGIYQFHIGSDSEDEETDDCH"
     gene            <136426..>140310
                     /locus_tag="LDBPK_120280"
                     /db_xref="GeneID:13390119"
     mRNA            <136426..>140310
                     /locus_tag="LDBPK_120280"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859097.1"
                     /db_xref="GeneID:13390119"
     CDS             136426..140310
                     /locus_tag="LDBPK_120280"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859145.1"
                     /db_xref="GeneID:13390119"
                     /db_xref="UniProtKB/TrEMBL:E9BB08"
                     /translation="MSTAVAAVTGEPPVAGGIGADGRCSRPSTFSAPLAQTAVTATAP
                     SFLQRILYSTPTSGSESPAASPVAPLPRTHGARMGRDVEVVSLLQLLALAEMPSSSDA
                     VAFPSLSSSRAKQRLFAEALEAVSISIASSSRSGGPDGSPSGNAAARPPSLISYSHAI
                     LPMRETASASLSAAAAPHTPSPASAGTWRSSGGGGDREGDFGLLFGRLKHQAVERSRT
                     VYTATSSSGSASSPTTVLSPSAPVVNAGLDAAREALDAADALRLRLRRQYRLSTAPNG
                     RLAEAQTLLVRATVCREAQLYTGTILHAVNRCCNSGKEVQGGPRHVPGPHRHRSSAAS
                     SAPLGAAPQGWAALTAAESREPLMSAIRRELAHVTQPRQQGRCAASVAHDKGGGDGGA
                     RGATEPRVSSSSSVPSSAPGATAETTLSSISASPQFMEALARWRQVVEAQQRSLRMEE
                     VHDYLAASQLFLAAAVEEQQLGGGGGGGGTREPDAPCCESPLMLATHGVTHVLRACGL
                     LLSDTLLEKEVPYPVSVVKEMATAVVSVVTTDATADELGDTRRGDRAVYCPLPNQLAL
                     PPLLARAGPHATRVWMLLVQLASFLERNAVKLPWDTKDVSTGAAASTLLADDSVRSRT
                     SSTTQLLWELSAAVLLHRPFDALQALQDVLEHASSSTTAAAKVSSLRDLFSDYMSPRR
                     ARPSSPLTSAVHASPSSSACSASRAAVAAAATSAPNTWITQVQAQPGTLPLCLLSLRR
                     AIAAAVRARHYAEALLDVEVGLHLLREQAERLDPVRSDGHKAEPAEEVSEPIRAADVA
                     VATAGGTDYRQLVYWPKAAATAQTQRLGSTSVPTTKTVASAVTYLSDGVVLTMLRVLL
                     IFITSPMASGEAVARLQQRQRGKGSWWRRDSKRRHASLSSSGTSSPSAQPERSNDDPL
                     DCAGDVVHCVAISLISALDTLDTLTAQLQLLERYVMVPQGSAAQSRAASSKTSNVSCR
                     VASTTPARQPHAEAHDRFGPSAGEEVYLLPSFPSPEHRLEHIAATALKAAKTSVTLCD
                     AHTPATNGVERGAPKERTPTTALGEGALAERLSSYAAEAGTSLRRSSRTVCTLTSSAR
                     YQQLKHAYRSRLPFHVGNTECSATPTGPGADASSTVARDADELLNDAAHVADVHPEVK
                     AEEHSGHKAEEGSRFSTQSTALVELAEVVRELWMMVGALTLPLRAASTCTTPPTAASV
                     AAATTPLAAGESWFEESTTTATAAWAPVRESWSACESGISYGEARLALPTVEPRMEKC
                     LHVLGGRDRTVLVLLRRLQSELLFPAVCRPLA"
     gene            <141754..>147771
                     /locus_tag="LDBPK_120290"
                     /db_xref="GeneID:13390156"
     mRNA            <141754..>147771
                     /locus_tag="LDBPK_120290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859098.1"
                     /db_xref="GeneID:13390156"
     CDS             141754..147771
                     /locus_tag="LDBPK_120290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859146.1"
                     /db_xref="GeneID:13390156"
                     /db_xref="UniProtKB/TrEMBL:E9BB09"
                     /translation="MPRPSPSLPSDIVAPPAAASTSLSTSQGAAFGSACGDADECSSR
                     RVGIGTSLTSATDAQQRMRGNPMVAPLPGPTTEQLRFAESHAFANAVPSDTEAGKSLN
                     SSSTLQPRGRRGHAHGDTAGASTSREAISINSVKSSRSTGCGGGRSAHPEAPQALGQV
                     SEPQNTASLTSLHTTSPPATPSAAAGASESSIINHKPARRPRINKKAAEVGVLRTGRR
                     LSCAAASTSSTTTTSTTAFCRGQNMIASLMPSAQHRQRRRLSSPASSAPSLTAQDAFA
                     VNQHEVKTGAASGRARVAPTTATTTAVPASERSCSPAAHGREVTEARRGEIAGISAAF
                     TEIASAAAGAGEKGLQSVCVEGRSLFSAEDGDPGRGDSACTRSPAASANTSVAVVAAT
                     TRQLRFLHECHASSTNASTASSAPPALPTRLRTRPLPMHFSSRCRHCAHRYADENAVA
                     LARAGGANDAQSLSLPLAPSVLCAFALPHYRHHSQVQQASSPRSEDGSPMLWRESRCG
                     FSRVEQVSAITAEETQEPCVTDHHISRQPASPATVAGASSSVVTGRLSAKGVDADAAA
                     AAWRVDSAMRTSPPAPLHASCDGFAQSSAAVPPLSAFSVAQAAPRPTAAQRRTADCSM
                     VSVQARKEASTHGKPWFSPALERQARAAAAAPIARYGDDEYCFGTQGEHAEPLIPAAK
                     FSSIDPPRASDAQPQVSTLSSLARGGGITERGAGSPVLPDAPPSVEKARAASGHPSSL
                     ELEGNGSAVIRAAAVAAEAEGGVPQSALSSSPKPQSATTMIAAPAAASVSQLSHTPAI
                     MLTTSLLGFSSRSPTPVTNSCATPFPLPWHPPHPMLPLQQLSAESTSSIYGDPGSGGG
                     VVGGVGSNINASTTRSPLPEWPRLRTLPQQPACMPATRTSGEGHRVDSLSRMNISCGG
                     GGVPPPYQSVPSLLSHSVWKSRGPGRPESPSPLGSLSEQCSGGIGGAGGDNPEGVAGA
                     VEQHQHQPPACRLTAFKGLASDSHAQVGFGSVTADSDGAMLQATSVSPPPQWQHLKSH
                     SGDIFAPTTTAARPPMTALGPVVRPWPHQRTSSNVSLLSSIAHSPLASGVGGSNGSDT
                     ATSTPPPLHMAIASLGVAPTLCTFSASSTFTGFGPAPSCILAAGPRSASISGKAYVHP
                     VTTSPPPRYRRAGSASSLSSMGAFAFNDAGTAPVMHSGVRCRVAECVPPSTGSSTPRN
                     RFGGRVDGGAENDADDVVHGDEGEDYLEDEGAGSCKATQGGNGRRWRVTSSGCGGGAR
                     CCGKPVRLKHGTAIETAIQAGAYARHPSCVYLFAGGGGGGGDASVGFSRAGVTSTAAA
                     AAQAGDDGRWSGSEDPVTWLSCAASFTASSTSASTTYASSSFGTVPCDGEHVRHGSSQ
                     HQHQQQHSSRDGGDNSLCDPSADAEEREDGLAVCTLYAAAPRHYHYRRTVDAPASCDA
                     VFLRGREKRHHRYVRVHHPRRQHRCLSNSPATGRDVVEGVEHAHAARPLPAFTTDVNS
                     TAARPILNLDPAANENVNAGVHNRRGQRPAVTALPGTCVPYSPHLSTSSLLYYDDVCS
                     DDVDDVYYQIEKRLFPVADEAGQSLCRASRSSPPPPQTPAAAPSASPTGNTREAPHDG
                     SDEPSIDALFTVLNVPLRLNLRGGFHLSDYYAPCPVCHPAMRTAAEDTASGLAATASS
                     CSCCSCRCSSVCFRSTRRSTLSSRAMSRMSGGTSPGSTQLIFSSDPSAKASASGFAMG
                     LRQTTPPPPPPVPAALAGRQPGVSSAATATQPYGVGAATSASDTLSSLLLRHGGVART
                     CDAKRRERKAAAAGTVGSHRTTAAGELAPSTLTARSSPSCASGTTDKPLSPSKLMRRF
                     PPASATQRGAKSAAAPAPAPAPATGNDIEDKVRDPKYGSRGTRGGGDPGRLPPPLVVT
                     AAHRHSRYRRQRARHPPAVVTARRRQAHHRGGGVGDGALRSQYSRFMRQRLLCVRVND
                     KITYIDPKVATCAARLLAGAALLAEKTKRKEAERERRHRAAAADGDL"
     gene            <150681..>152351
                     /locus_tag="LDBPK_120300"
                     /db_xref="GeneID:13390120"
     mRNA            <150681..>152351
                     /locus_tag="LDBPK_120300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859099.1"
                     /db_xref="GeneID:13390120"
     CDS             150681..152351
                     /locus_tag="LDBPK_120300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859147.1"
                     /db_xref="GeneID:13390120"
                     /db_xref="GOA:E9BB10"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:E9BB10"
                     /translation="MANRFNPHQHPMQQPGDGNQPQSFFYHPASTQQQQVYQGYPQGF
                     PPLHLMAPQQQMQFLQTLNEAQRRQALQQQQQQQQQQQEMKNRAGGGLAQQQQQHPGF
                     TRLSAAELLLLQQQQQQQQQQNQERELRQRLGLPEGAMLANYGGNANNATAANNFLAN
                     ITLAQMRQQQQQQQQYQPQLSQLQSQQQQQQQLAALMAAGKVGAGTAAPTAGMGGAGS
                     MMLLSSAVGPQLDPAIAAASPAMQQQPGTAAGPGNSSAVPAAATSVAPPAAGPAAAGT
                     GPAAAAAAATGKGKIEVDDEYGLKQLVKVVQPPLPMATTPYVPSADEPTDPVSGRPIS
                     QQDADELNFTFITRGVDITQIGLSVTEEGWLHTTLATLPLDSYEYYILPEFKIPDSYK
                     KPRPKSLSMKSFHQFKEETLFYIFYSMPRDVLHLAAARALYERGWRYNKRAQHWLHPV
                     KADDGSLMEKTTTGPDGQKIFTGTYTVFQPNEWKQVRTQPNHVIAAADIEEQSALVAA
                     MEEAARQQSQRARSKAAHGAGGGSSAAAAGSNGNNGGSAGNSTPSASA"
     gene            <154223..>155335
                     /locus_tag="LDBPK_120310"
                     /db_xref="GeneID:13390157"
     mRNA            <154223..>155335
                     /locus_tag="LDBPK_120310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859100.1"
                     /db_xref="GeneID:13390157"
     CDS             154223..155335
                     /locus_tag="LDBPK_120310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859148.1"
                     /db_xref="GeneID:13390157"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BB11"
                     /translation="MVVSLIGPLDSPYVQRTLLVAAYAGIQLKLVPIQIGRENETEEY
                     RLNCHPMQRVPVMKTDEGYLFESNAMIRYLARTEVMLVPVSAGIDSAGANNEKIPHPQ
                     YPIPYAMYGHSLLESTQVDSWLDFAITRIDFYTRQFFAYEHKTGPKPAADMKTLLCKS
                     LDGLERRLAYLKEACRALVQQSGSLTSRSVMTDEELVWNEEDYMASRATRDSRLSSVY
                     NVAGSIRQRHMEKERQEREKQLMLIKKTTDEALGKEEGADDPHPSSRRPSVSRDSMAI
                     SATPRASVLMSARSTMGSAASVVQRHDLLFLVGGSLTAADLVMAMSLHGVLCCQELKP
                     VLTSKYPNSFKYYKSVLMLPVAAEVRKAIRLSIIKE"
     gene            <157261..>158214
                     /locus_tag="LDBPK_120320"
                     /db_xref="GeneID:13390158"
     mRNA            <157261..>158214
                     /locus_tag="LDBPK_120320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859101.1"
                     /db_xref="GeneID:13390158"
     CDS             157261..158214
                     /locus_tag="LDBPK_120320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859149.1"
                     /db_xref="GeneID:13390158"
                     /db_xref="UniProtKB/TrEMBL:E9BB12"
                     /translation="MPANSSAAPRLSSGSLAAACESYGVDSRLLYNDIEQLSKKRFDY
                     AQRLILWSRLLSAASMVAAGAAGVAVYYQQAQIYRVWRLRNPRKVHRLVQFAVLSGSF
                     CLCNVLFLISPVGPMRLHEKELSRTKQLDVIAVAALVQEQNFRTVSAWAHAAADAGRL
                     APAPSSSTVPPSPAGAATNTIECGREEDGGIGSEPQSVWREVVLDPTQLLQLPCERKT
                     QQKRAAPVDKAKTGTDADMLAVKKQLSSQLLVNSESGSNSGRGGSEATSAAEPPTWRQ
                     QPRRVWSRTADTAELQQLKDECVVMWEGLVAEKTAIVQKVF"
     gene            <164283..>168716
                     /locus_tag="LDBPK_120330"
                     /db_xref="GeneID:13390121"
     mRNA            <164283..>168716
                     /locus_tag="LDBPK_120330"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859102.1"
                     /db_xref="GeneID:13390121"
     CDS             164283..168716
                     /locus_tag="LDBPK_120330"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859150.1"
                     /db_xref="GeneID:13390121"
                     /db_xref="GOA:E9BB13"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BB13"
                     /translation="MFAQSESEELLHLLSQVRLVADEEERNEQEQHQQEKLEQRHRPS
                     VDGEHTMPVYTSAAGATAKVLDKQISNGSSASIASGGGGSAAGRYTASSTAAVTSSWT
                     VHDNTDSTFGINTAAASNSFLADYEHHRANPFDQPPVTRTPATDVKVLLQPSDERARC
                     IEVDMASRGDGYNVFRQPKQLLFASPSAAAQVVTVQQQQQQQQRRRLEQLQQQRPLSL
                     VTHARQSMPSPHAYNVYTASVSTATRTTTPRSIDDAAPILPVAVEREGSGYRGAAADS
                     AILRDTPSPAVTSSAPSAYTKRDGKTVAEVVLEGISDFAAVIQNDGFDGDCEEEFGRT
                     SGGGGGGDRLSDVWTPARSIGTPQSALDGSNRSLRLFHLQQQQQSHQHLHQHHTTPSS
                     PSSAAEAAVAQFFRVSSSVDVMDNGGLDSAWRASVEAELAELQRGGRLSMNSAVVQGT
                     PISTVSPLPPTSTTPYHQLLSQLRHSPSQVPASGLGPANTAFTGRAAHANTPPARRPP
                     SSSSRLASMGPTPLYTTHITSIPRASSSAAAAGASTEQGRSCWPRSSLTPSEAAALWE
                     RLSPYERAAAAAAAAASSNAASVAAAAALLRTPDTVSKPVTLSSIAAHLHSGVGDLGS
                     SDEMGGAHAHADNPSRTYASPPTFTTAPMRVPRPASAAQLFPPSSPSQPNSASPATAG
                     TGVSPHHGWQQSHSNHRQGQYSQTASPRTNATTVMALPPPPPPPPASTPSLATAAAAA
                     GPYKSQQNHLQTPSMRRWSPVDAPPSTTGVGPVAGNAHNTNSPPSCSLRPSPHPRPSN
                     GSSPALRRYTITTPSSHATTATAANNSTNSGGKKHVDGSPLGVSGASVADKGTSREAR
                     PRVQLSQTSCSTGVAAAVCGGARGARGSLGASAHGAGGGASPSSPSYHHNHSNHAGHH
                     LNSPSNSAGATAGPGASMVSAAAVQALIQRLQAAAAIVLPNSPSASSAVTGGGQMSFK
                     AEEGGVASVAAVPDVASAPIILAMSHDQHGCRLLQAVIDAECSEGEAIEGGHDELAAD
                     DAAAAASRAGAERDGSAAVSPSMTAGAGAGEKKGSVNERRRRRRAEAFENSIPVRVVL
                     RAIEPKLDAVMADGYGNFLLQKVFDMAPDAERQRLLRLPSLQHHLCEVACSPHGTFAV
                     QRLVETVRNMEEERLVFVALERDLLRLLTNANGGHVLMKVMECIRRQYNALASGASSV
                     TEPSSASMAVPGESSTAPSRRLLEERVATLFQAIQQHLLYVCQHKQGCCIVQKCLDFL
                     HACAGLSPSLPSSSGAVEQMDYFERMAALLLPHVQELSTHPFGNYVVTRLVDVCYARG
                     STATIDAVAAGMQRDLVQMCTNKFASNVVEHILRHCSERRIRLICQALMMPLAHPSAP
                     AVYASASTAAATNAAIARLPLIIVVMDPYGNYVIQTLLTVAPVDELVSTRAEGGGMLP
                     VLQQLLPLLSSRNYGRKLETKTELALLRVEQHQQQQKQRRS"
     gene            <169817..>171067
                     /locus_tag="LDBPK_120340"
                     /db_xref="GeneID:13390159"
     mRNA            <169817..>171067
                     /locus_tag="LDBPK_120340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859103.1"
                     /db_xref="GeneID:13390159"
     CDS             169817..171067
                     /locus_tag="LDBPK_120340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859151.1"
                     /db_xref="GeneID:13390159"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BB14"
                     /translation="MVSMIVAGATGAIGRTVVQYAIQQPSIDRVVALTRFRNTAVSNY
                     EHLFGIIVAGEAGNTDSRGEGANSKREKGSKFPAGTVTATPAEAAKIRPITMDWEEFT
                     QLWVAKRSSTCAAASGADNRAAGAAATAITDPMERYRGIFGGHTYAAMCLGTTRKDAG
                     SAKSFTRCDYDYVMAFTEAVLAYSAPAGLSPDKTFVHHIGDGGVSKQVHVQEGMGKEV
                     DVLAAMNDNAAQSSGTLRVFCQVSSSNASSSSWFLYMKTKGIADESTVERVHRHNKLA
                     TAAAALSPVNLLLLQPGLLERHGKTRTTEKFAKLIMSSIPVETCGAAIVSACKSLPIQ
                     RSVQRAEATSAAELAKHDEVEGAQVEKESSTVAAGVRKTPLGKPYVGAKALRKAGIPS
                     NEPLPYIYEANNAVITDLASRLTA"
     gene            <172461..>173606
                     /locus_tag="LDBPK_120350"
                     /db_xref="GeneID:13390174"
     mRNA            <172461..>173606
                     /locus_tag="LDBPK_120350"
                     /product="3'-nucleotidase/nuclease, putative"
                     /transcript_id="XM_003859104.1"
                     /db_xref="GeneID:13390174"
     CDS             172461..173606
                     /locus_tag="LDBPK_120350"
                     /codon_start=1
                     /product="3'-nucleotidase/nuclease, putative"
                     /protein_id="XP_003859152.1"
                     /db_xref="GeneID:13390174"
                     /db_xref="GOA:E9BB15"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:E9BB15"
                     /translation="MAAFAFSAHALLAAVIAMLLLLALPTQAWWDKGHMCIAEIARRN
                     LKPNVQSKVQACADVLNKIGPFPKSTNIVELGPWADDLKSMGLYTMSTWHFIDTIYNP
                     QDVKVTINPVEIVNVASVIPMLISAITSPAATSDIITTSVANLIHFVGDIHMPLHSAD
                     LFSPEYPLGDLGGNKQIVIVNESAGTSMKLHAFWDSMCEGPQNNAVRPLDKDAYAELS
                     AFVDNLVKSYSFTEEQMMMTNSTIMAAESYELAVKNVYPGISDRTVLSETYKANGKIL
                     AAGRVTLAGYRLATILNTALAGVSLDTIMNGTKHMQDEVEVTHTGDTYNYYAFSGVES
                     GAAAGIFLSSFAIGCLLATAVVLAALYMRRGSSKDERAAAASASHGI"
     gap             175524..175582
                     /estimated_length=59
     gene            complement(<176011..>177243)
                     /locus_tag="LDBPK_120360"
                     /db_xref="GeneID:13390122"
     mRNA            complement(<176011..>177243)
                     /locus_tag="LDBPK_120360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859105.1"
                     /db_xref="GeneID:13390122"
     CDS             complement(176011..177243)
                     /locus_tag="LDBPK_120360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859153.1"
                     /db_xref="GeneID:13390122"
                     /db_xref="UniProtKB/TrEMBL:E9BB16"
                     /translation="MFAALSWLLDLDQGHAASSSSTSSRSSYSGSLDADAGVETNPAA
                     THTTFSDAGGQLLAELHISSVAAATLSRSASEAAAPPRGAVYSSPRHLEESFADLEAR
                     KAELFAPSPCQDPAEDAGLGMSSLAERGGTPASPLSRKIVPLGSLRAYANETVSLSPI
                     ASPAPAPVPATVATSLAPAYEDERLLLVSEGVMLSARLSSPSRGGPRAAAERAEIANN
                     NGSATGAIGAGVAAPTQRSRILEWDGEVHVRPQASPPPGLSANRGERAARSGTEAQER
                     RKQIADAEPGEARLVRGAMKAAFMVSTTPHAPTLGTAALAPAAVPLHPSNPFLGTTVG
                     ARDAAVRGYSIECIHDTPAQEDSGVVYLANGLVTVTSIDVDDLHRQAEQSSPPLTHPL
                     AAQLTTPSRTKQPQFDFS"
     gene            complement(<178893..>179378)
                     /locus_tag="LDBPK_120370"
                     /db_xref="GeneID:13390175"
     mRNA            complement(<178893..>179378)
                     /locus_tag="LDBPK_120370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859106.1"
                     /db_xref="GeneID:13390175"
     CDS             complement(178893..179378)
                     /locus_tag="LDBPK_120370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859154.1"
                     /db_xref="GeneID:13390175"
                     /db_xref="InterPro:IPR008584"
                     /db_xref="UniProtKB/TrEMBL:E9BB17"
                     /translation="MPVFHAVMSVKESEGVERIAPVKNRAWGLRFQCASCNEESAGMM
                     YVNQTEQHERDGGMHNFVSKCKLCKADITADVLPVPEGTGYYSAEEENPANVIAAFEV
                     RGGRPVELEIDNQWIVVTVGGGLFEDVDLSQEWYDYDESSQAAVSVAGVSVEFEKSKK
                     K"
     gene            complement(<181244..>181453)
                     /locus_tag="LDBPK_120380"
                     /db_xref="GeneID:13390176"
     mRNA            complement(<181244..>181453)
                     /locus_tag="LDBPK_120380"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859107.1"
                     /db_xref="GeneID:13390176"
     CDS             complement(181244..181453)
                     /locus_tag="LDBPK_120380"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859155.1"
                     /db_xref="GeneID:13390176"
                     /db_xref="UniProtKB/TrEMBL:E9BB18"
                     /translation="MTVLGDVQPNSTVASVYNGRRVLNESGCDSIIGLSGVSSRDSAP
                     CHCAGRTHTSTRNQQRHAPRRVWAP"
     gene            complement(<182295..>184298)
                     /locus_tag="LDBPK_120390"
                     /db_xref="GeneID:13390123"
     mRNA            complement(<182295..>184298)
                     /locus_tag="LDBPK_120390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859108.1"
                     /db_xref="GeneID:13390123"
     CDS             complement(182295..184298)
                     /locus_tag="LDBPK_120390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859156.1"
                     /db_xref="GeneID:13390123"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:E9BB19"
                     /translation="MIHFKDAVGMLWYALLLAQESHQEQQRQPIWSSVKCTKEDMALK
                     KGTAAAVEGHRQRSGDVGGGSGSDPKGGAGASIPAVSPSTSTTVSLSTAVQRSDCEFD
                     RWGDVDWTLLAAHVYALTRELHSARALHRVVAEDIYKGAYNGDREAMCAACALQHAEM
                     LAFYAKEVQEEEERAATVRLQTPLIISAGIAGGGSRLTGTAGVLPIDSFLAPSSSMAG
                     AHAARLPVTAGIQGPASSLHNSSSGDGSAAPALPPTRPDAGASSLPPKQWGGASTMPR
                     AAGVSHPVSPYPSGAKQTTTGETIADVRVAGLHASAGATTATRAPGSSPPPFQRDRDV
                     VGLHAAGGTGRAVSTDDGQLSVLPPHTRLGSVAGVPQHCGHAVADQSAAISGESLDTS
                     VAHKGDHTVLPSTTQPPSPFEPDLLDAPWYALWCSLPSPQARAQLQLLRYATPLPLED
                     FSSLLEQFFLVDGADDFLSPVHAATIMEFAGVRSGPYSTIVRSPLSLAEVRRYISESH
                     RQYARAAMTVHANHAEGVASVEARSRPLLGTPSPNPASALARSSALETSYAAGSGSGF
                     SATSMPTATKVEYRGLRRGGAPSASALGSDVRSLLDSAASSERRILTLAELERSIWHV
                     AANCVVFNAPESRYPRTARHFAAACVAIMTRYCEKQLASFFIA"
     gene            complement(<185352..>187307)
                     /locus_tag="LDBPK_120400"
                     /db_xref="GeneID:13390177"
     mRNA            complement(<185352..>187307)
                     /locus_tag="LDBPK_120400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859109.1"
                     /db_xref="GeneID:13390177"
     CDS             complement(185352..187307)
                     /locus_tag="LDBPK_120400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859157.1"
                     /db_xref="GeneID:13390177"
                     /db_xref="UniProtKB/TrEMBL:E9BB20"
                     /translation="MKRRVLRAHANKRCLRILSASHLIQTSSSSFLSSAASGDRGYAV
                     LCDASFLRAVLLSYWQANAPAIWREARRRKLRKAAAVTSASESTRAGVSSEIPAPLAA
                     DKIAAATAASIARLPFGDLPALSPHAFLVALLCDAFQGERGIRSVSDNSAAAVAAATP
                     PVDFTSASKFHCYCLPETVAALHRMRYHGPTSAVSATALANPCPPNSSVVDASLTRAQ
                     KKSGANSKRQRPPTPLPSTTSPRSEQHHRMTETEAWLSASFGNLATMRDSNGDGVGAR
                     RHAGPSPSSAAFPLTFQEVPAAVVNHLLSRITLIQSEEQRHRDAVAVESPEVSRSPEM
                     ADGAPLPTRNECRAIGEFMLANDSLLGRGPREGVDASACDPSALRLASMPLFRDHRVA
                     TYSPQGAAAKRRRRRRRNRTAAGGGDDVGELPSLATANAALAGPQEARGNGASATPST
                     TSRPYSPRTFFVATQSHDVRRRLAAVTPLLRLTTNPDALWIEQRGTAYQYGEEGAEAR
                     RPHIGMKGPGNCSSLSVAAAASSRGGRGSSEPGPSRSARFSHTLSSPHAATATTTVIA
                     AAPQLSRADVAFMKHLGTAAEVPLPAKPSHHPHPQEQQQLQPRASPASDNGVSDRAPA
                     DRKRRRQKGQNPLSMKKKQRREVFRAH"
     gene            complement(<188822..>192091)
                     /locus_tag="LDBPK_120410"
                     /db_xref="GeneID:13390178"
     mRNA            complement(<188822..>192091)
                     /locus_tag="LDBPK_120410"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859110.1"
                     /db_xref="GeneID:13390178"
     CDS             complement(188822..192091)
                     /locus_tag="LDBPK_120410"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859158.1"
                     /db_xref="GeneID:13390178"
                     /db_xref="UniProtKB/TrEMBL:E9BB21"
                     /translation="MSSTSVASLSSQRGKATTTTNTTTTRPAAAPAYPYDANTKALEA
                     YLPRLQAAANRASPVAPSTAQKPLPEGSAKSRYLPSSSLKVFTVAGAAEPGVRAARSR
                     NDHRTSPVRGRATLGSSQQRTNWGFETLAEERDSEDDQQARSPLRTLANLPQRTQELC
                     EDLITLDSLVEADEAFLTAQEDMEARMMALLQSWREAAAEGDSRGGSRRPSGVYALAT
                     ASTPTAAGTQLGDPVASSSGGGGGGGTQRVLQDFDEARDRITLLEKLHEELTEMEGQH
                     RELQRRYVVEGSPLSALDELCARLDDEDGEMRENGDEARCAEGSEKAGWGAHRDGRSK
                     ARQRQELDVARAGLAACRLLADRLRSRGMMIVDRLTDELLCMRSDVARHDWTALQSST
                     PLTRMDRAVPLDARDDSPISGTSISWCTSLFPPPLPVAAVSRCGKGRARLFANSSAHY
                     FVEAAGRTHGSDGDESDRSKATVTSTETPESFVLRVQVPVFASATPPALVTSLPAAVT
                     TTAEGATATTASFASRVSGDGLHSSNSAERMRRRSSGATQALSTAPPTTVSVIATPTR
                     YALVQLYECCREGLAAMLTRLCALRTRRSKEAELLQQEQSAMDVYDPAADDLAARCAA
                     LLRYVAQLDEWAGEVLQMDQVLHERVKLPLDAALQTCERVRNQLLEVLKQRLEDEEGH
                     HNERAAAAADAEEYGGEADDRGGHHLPHERVCDDNSEELHALPDEGGEGDVSDQRRMS
                     GSIGDYRAHRATQPPTRASCGAAPPTALPRASAAFIGMLETLLQDQQSAGEALRATAT
                     AFAGGTSGGERELDTGEHCGKDGEPSEEAPTPEQGSSVAEGHNEGPRALVGLETAPEA
                     EPVNTPSAAHSHRKTATVAVGKANASEAANTQADGPSEGVDAGHVAGRRRHRDDSEDE
                     SEDTPSHSVLSQTAERKHAHTLDPTSTAAPPHEVTVYISSTSCSELGEELGEDVGVRQ
                     SAVQTQGGMHRLAKMLEPEPDDSDGDDDVSDSDSGDDSRNSREGNLNPTNQRQRYALG
                     SGNGLGEGLRAFFSAVVRRAMSFDDSDDDADETEMAMPFQGRQHGGASPLPSHKRARR
                     E"
     gene            complement(<198992..>201346)
                     /locus_tag="LDBPK_120420"
                     /db_xref="GeneID:13390124"
     mRNA            complement(<198992..>201346)
                     /locus_tag="LDBPK_120420"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859111.1"
                     /db_xref="GeneID:13390124"
     CDS             complement(198992..201346)
                     /locus_tag="LDBPK_120420"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859159.1"
                     /db_xref="GeneID:13390124"
                     /db_xref="UniProtKB/TrEMBL:E9BB22"
                     /translation="MQSFNAPSAAVAGPEPASRQSSGATLPLSPFLPQSFSMESEGPL
                     AGTPAAAPGTASAMARTVTSNAPTCMSAAHAFASAAQHCAFVSLSSAATSHAASTSPT
                     LPPRRPRKLALASAHMLALPHGSHGNGSGSGEDLLSEHTATPPTPSPALDADASRLCD
                     MHSFPGDEPRPSNDPAHGGFEPHHRRMHALPRLSEGALSAPAESRTANPLPSAPRQAD
                     VGAISDAEDAAVRAYTMSVSATAATLASTRSPARRASVPPPPPAPAFETPAVSTSPPL
                     TKDNQDNLSPSYSCSVSIPSPSPAFSPFTHQPSLPLSPAIAACCPARGTEQKAVQRHQ
                     SQSAPPRTVVHKLLSAGCTAEPDMPVVLPAARRRSSYVSGSTMLGSFCLTEDGVESSD
                     GGATATVDTPLMRSNTSRATTFSGAAAAAAMTTASATPYTSPSPTAAQRFRSASALMR
                     YASTFSTKDDSSVNASATAEAALLSTPSQSPPRPPCALSTAMASEMQSGRDKDNGEVT
                     ATAPAVAVTSAMPSTYRLLTAPATGARSEDLSWLLPSFSDGNAQISLAAAPQRLHSCL
                     ATECDRAMRAMQRQELWAEQTAAGREELRRQVEGHVVAKYHNRSEGLCKDASAWRLPQ
                     EAPCPEQQLLSDKAVLVLDDGRSSARSAAAKTIAVAGDAPPSLALFPRLISTSLSCMG
                     LRRGTATQPEVHASTSTRSKPAEDEQDAVAVGSPVENEDLEDSAIFEKSGLAESQRRP
                     SGSEAAASVPLPPGAPRSRASVSFLGSSLSYEAALLSAAQEMSG"
     gene            complement(<214097..>216346)
                     /locus_tag="LDBPK_120430"
                     /db_xref="GeneID:13390179"
     mRNA            complement(<214097..>216346)
                     /locus_tag="LDBPK_120430"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859112.1"
                     /db_xref="GeneID:13390179"
     CDS             complement(214097..216346)
                     /locus_tag="LDBPK_120430"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859160.1"
                     /db_xref="GeneID:13390179"
                     /db_xref="UniProtKB/TrEMBL:E9BB23"
                     /translation="MPSCESPLSTTTPSSLVHPPAHLCDVTGGTAAAAVAGASRMMTD
                     TAGMSSSCPSATRTAAKTSGGTVQAELSQSCPHPHQHQHQQHQQPCLGGFLDPFFLTE
                     IDENVQAFNGTAATSGLRTSLSGDGASTSAKDAALCSPCMECVPPARGKTVRKSRSAC
                     ELRLECRLSTLMGSDITKDEADDSKRKRRQPSSFPSSSRRDTAGCFSSFEVMGPTAEV
                     ATAGEDIATTAATATDPEAELKSHETKRRLLLPTWVTARASTVRRAGAPSTDSGVASR
                     TVNGCLASPRSFSLSHSKPSSDNRDASEGSYVLDCETTLLPSESVAAAVSTSSSTVSS
                     YASEAQGRAAEEATNCATTGGTTVGSKVTLLVSLIMRCTPSRTGPPHSASSTEGGAAD
                     AERLPPLELYPPAVLPSSIEEVPCGVEYDASGAHHDDMYAMKDITVDVKEDADQQRGA
                     LAEEPTLQASTASRRTQHTQWTMLPSPVTAWLLGSSAMGASLSTALWKVAPRSRPAML
                     TPCSCVSARAEQHSVQVLSRALARGSAMRSWAELERASLSFLGTWSASVSAHLSAVPP
                     PLTTGSTTLRGSSVLHLMLPPLSYYASAGTESIAYITRAPSRPAAAAEEMIARQPCDV
                     WRLARCYAHFERAVEQRGDDGVWSARGISSLPTWDSVKLVAAAGVASKDAESSLNDDC
                     EDGGAWLLPSFTLDVLPDTPDTPSPASPQFTSTFPFSSVASVLRAEKEEEVFASAVMW
                     TLEVMTGVR"
     gene            complement(<224123..>225952)
                     /locus_tag="LDBPK_120440"
                     /db_xref="GeneID:13390180"
     mRNA            complement(<224123..>225952)
                     /locus_tag="LDBPK_120440"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859113.1"
                     /db_xref="GeneID:13390180"
     CDS             complement(224123..225952)
                     /locus_tag="LDBPK_120440"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859161.1"
                     /db_xref="GeneID:13390180"
                     /db_xref="UniProtKB/TrEMBL:E9BB24"
                     /translation="MPSSNRVRHRDSDVAAATSAMEEPSSPNVDSKTVGDARTPFASL
                     SASSAFSTAYSTVSGDVAHPCVDIASGAAPSDEVSPFTNALLMSGDSTPFAGSFTTKT
                     AASFLHVTSFNSSATVVTGELPSLQSEHVATTAASCFATRPRGTEALAAAAAASATNP
                     PSLLRPLGSAPIEGSGGQTQRAGEADAPVQDGTAAPPSSPPIARGSVSASFSGDSSSR
                     RSHTLRSGLSDDLQLTQTACYLSPLGSAGSREVQRSGDDIDARWAAEKESMLSAEPAR
                     PTAGNDGFAAEGSEGAMDAATQCASTDVRAAAYTVPASNISTTVAATATDAAPPLCPE
                     FEVLATVPAPLVGRVPMRIHWCCAAHWRAVQRTERGAQWAVDGAPADVYCVPTHLNAK
                     RGRRSLSASCVEAKPELERDGKGFSGAGENTAWLRDAADEGKPQHWEVRTLSSAVDAP
                     GPTLCDDSNHAAEHEEHGSLKTRSGLPQVHSHSCTDMLTCEFCGHAVETYHSEDCDGE
                     ASEASTSTTETGRACSAPPGRFQDCHGCASAEARSLSSSKLVACRSNQPSIFTPQLLL
                     SSSESAETTVDLDMSGAISSVDVPSRSDSAREEALMAAVALLQ"
     gap             230970..231068
                     /estimated_length=99
     gap             233413..233511
                     /estimated_length=99
     gap             235506..235604
                     /estimated_length=99
     gene            complement(<252300..>253253)
                     /locus_tag="LDBPK_120450"
                     /db_xref="GeneID:13390125"
     mRNA            complement(<252300..>253253)
                     /locus_tag="LDBPK_120450"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859114.1"
                     /db_xref="GeneID:13390125"
     CDS             complement(252300..253253)
                     /locus_tag="LDBPK_120450"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859162.1"
                     /db_xref="GeneID:13390125"
                     /db_xref="UniProtKB/TrEMBL:E9BB25"
                     /translation="MAYLPTNTAERLPTSSFSITEPTASSTMLPAPHSSANTRRIEGL
                     VVVPGIAKVSGSDVASQYTMPHTNNAPLLFSEPEHPAVDNSSGSNDAQLEPKDPHLGL
                     MPHCLSCTLLTSAGAQEPEDVYGRSMPSSSAVGAVTTALGCAVVPTLHASFTPGASTS
                     IMPAPTEAHSACGSRPLQQHRWGGNYDSGSQCVSFRGADRSNNVSGCGLRLVGDDVEW
                     LQGSFEDSASSPREEVQLSWGHLQRQPCTGKSSAARAVPPALHDAREGTAREKALAAH
                     YRFERAVQPQPQRQGAFLSADEENCQAAAMLWAAQQMAVFD"
     gene            complement(<258665..>263086)
                     /locus_tag="LDBPK_120460"
                     /db_xref="GeneID:13390181"
     mRNA            complement(<258665..>263086)
                     /locus_tag="LDBPK_120460"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859115.1"
                     /db_xref="GeneID:13390181"
     CDS             complement(258665..263086)
                     /locus_tag="LDBPK_120460"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859163.1"
                     /db_xref="GeneID:13390181"
                     /db_xref="UniProtKB/TrEMBL:E9BB26"
                     /translation="MSSNPSSSPPPRVHSPQRLPQGIYGGAARALAVAACPLWTRGIA
                     GDAGLPASAHSGYETNHSRSELAQAHQRHAHALPSPIKADPSTTGPPTPPQKPQRSSA
                     DLLVTVPTAAVTKSASDGPHATDHARPSTRARQQPQHLTQLSASTADEGSATAAAPPL
                     WSVLPPWAQLDFAAFDGRKFSVDTAPISGGGEGGPPWELITAQNRITKPQPIQAERTR
                     DSKARSYLRVQRQVPREQQSSSPQVRTAAGGVSIIADASSFASSPLFEWVPYDGWDDS
                     DLCQGKGGGYYRRDASGRQYRVTHRLRPGDLSGPLAAMESGATTPGQTQGPDGVGGAA
                     IPVTVNANPAVPSPQRTGEATCADLDAPQRGLQQQHRHKRRAAAPAANASPLAFRDTV
                     TTDKPRGVRRDNHAEENRGEDNGGGSGAGGAGDAVGLGHEGFTTTMVTPPPLLSSAAV
                     AQGTYALRHFQFQHAIAAAAPSSLGFPGAGAAAAAHRTSSGVAGSFFLPLEAVIRKAL
                     PVSRGGFSSRACSVYTGVRSDGTLSIIMLEEYPGYTESTPAQPPRATASSPAFLATTA
                     EGTPTVTGAREGHHSTKSPAPPTRQDWTWLPPKASAEQPVLLPSADTDASRQLLATVP
                     QSAAAGVAGATSSTNPHRQGPIGTGGVVNEGAAIRDACAGLTSGSPPRAPPTPMPPPP
                     PESGDSPYAASRDRVDLTRLGVATATVNAAAVAASPMIALRGQSGSSVPPGGGRVFQR
                     HWLPLGFCALPVAAGGDNGALAPVSSSGTPAVADVASRAAATMGAVMPESTEQTHLAG
                     CDEGARRGPVPAVARTVWTTRVTDAAATGRKPLPAPARVIPSLTLFNPTELPSKGTTS
                     ASLSVPQSAESGCGGRGHQRTKSLLPAWCHVVAEALLSPLSPPKMHRPGQRRRTSTSG
                     TTTAVTTTSNTVARDIHSRRWSAEARGGMPVGSTAKFVTAAERALAPQRAAVAASAVD
                     DRRREGGAEEQESCATPTSHYSHLPPRESAGPDVSVFGNANPTGRQIPPPAPLKTTKP
                     TPPSLVPYSSEPDGVGGGRGIVRVVAETTTVDFDAHDAPHAYAQVLMEVDTKHATTTS
                     TVLGSGDAGVAANADAAAVAAPTLERAHARKVQLSTSTTLCRFQGYHQRRRDGGDAVA
                     NPGVDDCGVGVGAPVAPVPTTTAASAKNNTDDTSWLNYGGARVGDPSASPTRFRAVGA
                     TWEKQGGHASTIARSIGTAVVSLHSDAARPHTRTCRPPVLASASAVTQLTMLAPDGTE
                     MVVQEHTNERPSQRRHVQVGCCAGTTAASSGYAARKNSPYIMGGCANTGYLRFGDVAT
                     ASPSAAVTTASGMLAKPAAAMRPSVIMRSPAVPAGLAGESEGGGDGGDVDHSSEGLVN
                     TSQNTRFKGADGLGSLSIYAETVPLFQMLPAPIEGVPMSSSSLASPLQNRPEQQQPQG
                     VSNVAKVSSVSRVPRRPLAQHLPKLGHPAGHTAECDV"
     gene            complement(<279207..>282119)
                     /locus_tag="LDBPK_120470"
                     /db_xref="GeneID:13390182"
     mRNA            complement(<279207..>282119)
                     /locus_tag="LDBPK_120470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859116.1"
                     /db_xref="GeneID:13390182"
     CDS             complement(279207..282119)
                     /locus_tag="LDBPK_120470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859164.1"
                     /db_xref="GeneID:13390182"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:E9BB27"
                     /translation="MVEYGKWLGMELPDDTPLLWIAREGLKAPLPEHWKACKSEKGEL
                     YYFNFKTGQSIWDHPSDEHYRELLKAEKAKLHAKENGKGDKEVTPAASSKAQVAHSGK
                     AAKKRRTKASDTEAHETKPKAQEAAGKTNSLKDLEPIQKKKELPESLKISTMLNDEGR
                     EDKGNIAAARMGSTELQSTASRSCSSLVSDAAKAPKIDEPDAIPLPSKVVAGGGVNGL
                     RALDKLGTSSPEKVVTSSSKNHKAKVDEQVSKDLEEYRAQQQSNLKRQKEEIDAEVAE
                     DLRRYQECANTKKQKRRAAIEKETADALKIESARLGAELESKLAALRQDYETKLTAES
                     ERLRNKLKAHLEHDKRKVEAEVAQMLETFTREKRQESEIRKEAQSQAFQEAMKSMTDL
                     KQFSSAFLHEYETALAAFAKDVQESHSVFEQIGAQRQKQMQEEMDAKLAQMREEHDRH
                     VQKAQDCASGRLETLRKDMEREAEELKQTQKQQLQRMHDEFMEQRSAHQKEQLSQDHE
                     RFMETLGEIKASQAKELEALKQQLKEKAQEELNAIMQELMKEKESRRSSLSVVRLAES
                     HEPTPRMLESRSMSATDDDGDVGKGKAPPPHLDRKLLTRTSVEESAAGAAPAAAPQPD
                     IKALVTEALREVFAGSPFILPSPQTGEFRTAPGTPAATASATITPSRSGQDFRSSNPA
                     ASLMPPALSGNPTKASGAFKLPLSFEEQRSLVEGERSRLQEGRKYVELQQQNLEERKQ
                     QLRRTRHQWKQDVLAAKREGVRSSSNRGQLLNKVRLTLEEQAQGLEHDMMILRDSQVW
                     LLSKEQRLITLEKQIEEQERLRSRNGGEASALNNCSVDTAALMTGFFKPPRHSVATHD
                     TAFHRDVMGYNALGSGSNLPMDNYAASPILSKALSRIERRLDEVTSIIHMQQQQTSSQ
                     AMTPSHGHGNSRRHSTVSPVVREAVPGYVRRTSRSHSKSDALRRDTHLDQWQAPGI"
     gap             285389..286741
                     /estimated_length=1353
     gene            <292452..>292865
                     /locus_tag="LDBPK_120480"
                     /db_xref="GeneID:13390126"
     mRNA            <292452..>292865
                     /locus_tag="LDBPK_120480"
                     /product="vacuolar ATP synthase subunit, putative"
                     /transcript_id="XM_003859117.1"
                     /db_xref="GeneID:13390126"
     CDS             292452..292865
                     /locus_tag="LDBPK_120480"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit, putative"
                     /protein_id="XP_003859165.1"
                     /db_xref="GeneID:13390126"
                     /db_xref="GOA:E9BB28"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:E9BB28"
                     /translation="MANSVRYRNGEQRIVGIIGDEDTVTGFLLAGVGDNRVMPNQREN
                     PGEGQQSGLQPNYYVVTPSTPLSEIEEAFTTMCGRKDIGIIIICQHIANDIRHLVEEY
                     NTVIPCILEIPSKGQKYDAEKDFVLEKITRALGIR"
     gene            <293414..>295231
                     /locus_tag="LDBPK_120490"
                     /db_xref="GeneID:13390183"
     mRNA            <293414..>295231
                     /locus_tag="LDBPK_120490"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_003859118.1"
                     /db_xref="GeneID:13390183"
     CDS             293414..295231
                     /locus_tag="LDBPK_120490"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_003859166.1"
                     /db_xref="GeneID:13390183"
                     /db_xref="GOA:E9BB29"
                     /db_xref="InterPro:IPR001672"
                     /db_xref="InterPro:IPR018189"
                     /db_xref="InterPro:IPR023096"
                     /db_xref="UniProtKB/TrEMBL:E9BB29"
                     /translation="MSDYLSKLKEHVLESTEVNGCTPSMATSTFNAPYEVARRTKVLG
                     ATDSSLLSLPAWKRLQSLYEKHGNESILSHFENDHQRFGRYSIEVGLHSEENFLFLDY
                     SKSHINDEIKDALVALAEERGVRAFAKAMFDGQRVNSTENRAVLHVALRNRSNRPIIV
                     DGKDVMTDVNNVLAQMKDFTEKVRSGEWKGQTGKSISNIVNIGIGGSDLGPVMVTEAL
                     KPFSKRDMHCFFVSNVDGTHMAEVLKQVNLEETIFIIASKTFTTQETLTNAMSARNAL
                     MDYLKANNISTDGAVAKHFVALSTNTEKVREFGIDTVNMFVFWDWVGGRYSVWSAIGL
                     SVMLSIGYDNFVEFLTGAHVMDNHFASAPTEQNLPMMLALVGIWYNNFFGAETEAVLP
                     YDQYLWRLPAYLQQLDMESNGKGVTKKSGAVAVQTGPIIFGEAGTNGQHAFYQLIHQG
                     TKIIPCDFIGCVQTQNRVGDHHRILMSNFFAQTEALMVGKSAEEVRQELAKSGMSDEA
                     IQSMIPHKTFTGNRPSNSILVNALTPRALGAIIAMYEHKVLVQGAIWGINSYDQWGVE
                     LGKVLAKSILPQLKSGNIVSDHDGSTNGLINMFNTRAHL"
     gene            <296266..>296769
                     /locus_tag="LDBPK_120500"
                     /db_xref="GeneID:13390184"
     mRNA            <296266..>296769
                     /locus_tag="LDBPK_120500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859119.1"
                     /db_xref="GeneID:13390184"
     CDS             296266..296769
                     /locus_tag="LDBPK_120500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859167.1"
                     /db_xref="GeneID:13390184"
                     /db_xref="GOA:E9BB30"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="UniProtKB/TrEMBL:E9BB30"
                     /translation="MHRTATRCFFSSFTRGFSKGFWKEFGGAPGGLGGSSGSGGASLF
                     ARKGGSSGSNGGNIFGGFGGGSGFPPGGPLGGFLNKALEWCSESHARDIAREMGVDLR
                     DIRFDKTPEGGINVMVDAPKATPLQIEQLGKRVQEECPVARFRKTQVNSPKHEMKWVQ
                     LPPRYDR"
     gene            <300587..>302086
                     /locus_tag="LDBPK_120510"
                     /db_xref="GeneID:13390127"
     mRNA            <300587..>302086
                     /locus_tag="LDBPK_120510"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859120.1"
                     /db_xref="GeneID:13390127"
     CDS             300587..302086
                     /locus_tag="LDBPK_120510"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859168.1"
                     /db_xref="GeneID:13390127"
                     /db_xref="UniProtKB/TrEMBL:E9BB31"
                     /translation="MHSEQSICEFIHMQRELRRCYATMENYEVVIAQLRDDCALSRAQ
                     LCRSQQEYAQHGKEMEAQVRAVLTEQTNALLSALRQSGASDASCLKTSAGPDRNTKDA
                     AEECLRDTWQATLDELRRALREEQSAHAECLARLTEALAAKARWKSRAVELLKWRKQV
                     CGKIYMSSTPSSSSFAAGARAIGACGAPPGVSTIGNCASDSQAEPNAGNSASDASSPS
                     QRLYRPPSLYKPPPCVSSPSEAGKLRSSMTSEASTALPASPYEGATGDCASDKENEKD
                     SSSMPGVDMNCQSDTTVASFLSPSATPAGRVAQALGSGVVVVWPPLAEGQEMSTEKSA
                     ESSRTQSSTTAAALESGDPALLDDAGKQGLQPSPTISSVSPGVLPSSVGRYTTSAVGS
                     RTQDGCRLPLVGCEKAVVAAEPLRVMPDPFAFPRPPPSGGEACTIYSVLPTSDGLPTS
                     CDVSAAMASGAAERQCKELLRALLDKEQQLALIAEERTKYKRLYEATRS"
     gene            <305367..>309476
                     /locus_tag="LDBPK_120520"
                     /db_xref="GeneID:13390160"
     mRNA            <305367..>309476
                     /locus_tag="LDBPK_120520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859121.1"
                     /db_xref="GeneID:13390160"
     CDS             305367..309476
                     /locus_tag="LDBPK_120520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859169.1"
                     /db_xref="GeneID:13390160"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BB32"
                     /translation="MPPKRSESSNAAETGRSVAIMKRRREGQRSEFSSSALYSTFEAH
                     VTAAQNSFLRGDSQAAEHEAVQALRIRPTAHLFALLAVIAESKGKFDQASDFRLLQAF
                     LARDIVLWEELLHDFMTQQLYYKSVVCLQRMSALEKNQERYRALQLQLADLLIGLGEI
                     RRASNVLVPLWNSSRCRDFEVFALLSSLYFQLGKWASLQRLIESSVKHAFQLLPTAEV
                     TGATAAAGETMAHGAEATAQVSSSTPGTEQQLPSPPPDSSISEQRVSKRVRFFGMDAG
                     EDGAAVPVTADLTATTAPTSLSPAEASLDEFGFDDFISPASPLLHPPSSNRPGDVAGS
                     TGAHRGGVVHQLYGERIELRSPQDQKNFLTLVNVHAELLNEQGNFSDTVQLLHMAAGC
                     LDVDLMELPPDLLVRLGVAYAFLGGVYEQPCRDVFQHLVAHCSMEDYGDVLLDAAMSL
                     QKVSMHAEAAQVYVTLARYHQFVYDRVRRQVGMAEAELTLMQDTAPLNQVQSATDALK
                     ALKAEEADLKTVLAAALQGQAQSAYARELYDEAKEYAERVLQLEPTHLQARLLLGRYY
                     FYQHKDTAAAVEVLTPSKHEPALQRIQLGVFLVHVFQRAKRYVEAIALGVSIFELLLS
                     SEEDGDTQSVAPGTSSRRSGASLYLPTMTRASSAIIPASSLAGMVGGSTAAGGSNVAA
                     RTSFSLAASIKASTSVARQQLARRGLESLTTTVYGASAAASLAAGWDRREEEGQLKDT
                     STIFRFNRRRRRPGGERRVADGALLTDEKPEGPVEDAGERSGDATVHGEPGVTRLKTA
                     EERRAAIISMEPAAFWPAEEGGEGDGAEEDQPSSSRVKPGADQSSATQSVKEEDGGDG
                     EKDRSRADALRPPVKRDRGGERVADTAAAVAGVVKTSSGMEGKGVGKTTKKASAGAAV
                     GRFNNTIVGERDRDLTELEGFLTEAEAIANAEAELAEPSGNAREVAAGSMRDDEQHDD
                     DAVDVLPESYELPSLEEVSKQFQDPVMAQLFLDASSFTPGGGVRSGEGQDSGQNPWAD
                     LAEANHNASAAPGLPAGTGLEDKVTLREAVAVLGKAGFISLAVAVVECYSAVGQFTEA
                     REFAFVALTHFSQKRRLRQMGNGLERPLRLAVLRAALAAGESEDAYRVGLRLLQQDTA
                     EDKRREVVELMHSVLNRCYDRSSILYRAVADGYNDPALLVLLANRYHQTRSYARVLNL
                     YLMALRERPSDILLNFMVGLSYLFCSHRKRTRSREACVSAAIYYLTQYQQLRLALEPA
                     AGIGEVLYNIARTLQFLKLYYMCIPLYERVAYDLCPPEECTIALQRAARVNLYFVYRW
                     ASGNRTLALTALQARSVPNGTAVTSPRPPSPFRLKTDGEILNVPSQRTP"
     gene            <314389..>317727
                     /locus_tag="LDBPK_120530"
                     /db_xref="GeneID:13390161"
     mRNA            <314389..>317727
                     /locus_tag="LDBPK_120530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859122.1"
                     /db_xref="GeneID:13390161"
     CDS             314389..317727
                     /locus_tag="LDBPK_120530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859170.1"
                     /db_xref="GeneID:13390161"
                     /db_xref="UniProtKB/TrEMBL:E9BB33"
                     /translation="MKEAIKLSLCMVVPSIFQVYALDNSSVSPAAGAAVIALIYNPTG
                     SESFHYASGRLLGTVLGSIGALLSVQVARGQLWVLYIFIVILSFIGAYVQAAPGFYAL
                     GNAIVSSTISVCTQYQDENAAMVRIQQNCFAILMYFVIACVLWPMQARTKVKMSLNVT
                     LRCTREAVTRMLRNLDMPYDANEVTADVSALLIEMNKKVRTQSRFIPGAVEEPTMGSV
                     EYPEDSWKRIVEAEKKLCLALSMMCFAYNTFMSSRADPTTELSVHWVVLHRIAPHAQD
                     LSDLIYASIDLYLLSLSKMTIVPTAHLTRLRVGMVDANQAILDTYMSTIFRKVAGEQD
                     TDEGDMYSSSSYMDDDEHDNDSNAGYRGGEHGSSGGPHLPPSRRGRSYTDKADGGVGS
                     TASVDCKAAAVHAANRPSEREGNEAKAGNDDDSSASPTPRQQRRRVDCDHGHRRGNHS
                     SGDSSGSSSSENGEHDDNVNAHTHKKATGKGGDGKKKMGYLGYELTAEEAAALRAFVA
                     NRVSNATFSTNKSMVVNNSTFSGRAAGGVPTAAAAAAAAALATRASIAMPGSLPQGNN
                     DARLMAVTGGDDGLAAALRKKHKVVVRRGRDEENDGDAEEAGPEGPHNEGRAKSGRND
                     VDNVPGIFNTSFLNNSFMNTSLLGSLFAKRTKELRDLDAAEMPQLHAGRSRASSESST
                     TSARSQRDGKKKKQQRRHLGKRREAKDSDSGDEGIRQHSTPLTSPTPHPRASSVGSEF
                     SDIEDNPRPRNPRLSSGKVLRSSGTVAVAENAKVDERPPMAHSTPEVLPAADNLATNP
                     LGEDGAGREGATGGQRNLPPMSQSAPMTSGRGSAAETFAVLRKEGSVEASRQQASSLT
                     AGQLCGVAAASMVSFSGDDAAVLGASLNNTCSAATTVSHHPPQPLALAPGSSSGSPED
                     HKGSPPRACSSAAEGKKCDNRDSNTRREVPDKDGEMTHGNTEKQQPHDRSGDTPGMDV
                     GASGKPGEVQRDATSAVDKDTHPLADNASLHHALASFGSRPSSKLRRRSLGIGGSSQC
                     VPAMLDRSHDGDGTSMTPSDGGEILKGLSFFNAARGEFVLTNHDIHSLEAFLFGTRAL
                     VVHINDLQKALLEMQHATDLARLL"
     gene            <322694..>328441
                     /locus_tag="LDBPK_120540"
                     /db_xref="GeneID:13390128"
     mRNA            <322694..>328441
                     /locus_tag="LDBPK_120540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859123.1"
                     /db_xref="GeneID:13390128"
     CDS             322694..328441
                     /locus_tag="LDBPK_120540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859171.1"
                     /db_xref="GeneID:13390128"
                     /db_xref="UniProtKB/TrEMBL:E9BB34"
                     /translation="MEEEVTSAASTNPTRGSRVGGSTSTPHGGRRHVHARVHVRSASG
                     CSHESLESPGVGTPSAFSVPDFPRNRSKASALEDAVSTKDEKTLYAYQEQPPGPVSPK
                     PLQPHVHQVAAASTPSVTLEAAAAAAEMLPNPGGQRRMMAAGKTNPLHVWGQEMSFLK
                     SHFFHPQRHRSNGAAKAQSDKSTGATEMRENLTHARVDLWSPRSAEGKGGQSVATAAA
                     AKSEDALHVFGGQAPSPSRARRDAGESSGGQDSQQQGGKGTAGSGGSEGERLLPTSCA
                     SESMVRPKSAKANTWASLAVLRMRNMNALRAYSWDQRVFLPQGDGFMGTIFELLASPR
                     VWEKVDWAIRGSAIAILPTLIVCLEPTTSQIFPLPTSVVFLAYWTSKPTLGAGLRETF
                     TVLKAFIISLAFLCIVVAIQPGPKWLTILILFFSLSVGAFVAQQMRVMIAYCFASLLM
                     QYAAHPETTGYKYIGDFYLTLFIGQGFAVGALLFPYIRWSSESARRYLIVMGDAISLS
                     VHGACCSFWVESSLLERQLHVARLRQLRQTIEASMAKAEKGLSEMGYEPHSGVYTTRL
                     KTRMAFLKNMFNIVQSMTLVIEQIAANPTLIETPMCRAFGERIRGELSVAAAAMDATL
                     LRVVDLDDLVSAADMEAFCGAKARYEDAVSRVRDEVILSNEDYRTDNSDILLGFFLFS
                     VEELMELISGFQDAARSQDNLRYFLMFPLRDLQSLWSAFVELHSAITLRHSITRRLKE
                     GIKLSLSMALAAYIQTYALKSSSTNPILGVDTIAFLYRSTGGDSFQYGQGRLLGTVLG
                     CLTGLFGVQLADGSRPVLYMCTLVLTFIGSYVQASPTCGAIGNGMSNGVISVVLQYTN
                     RDGAIVRIEQNCFAVIIYFIVTSLVWPVRCQTKVKTGFDGCMRMGREVTDRLLRNLDL
                     PHSAKAVSSDAMALLDEMQKKVSQQLQNLTGAQFEPTMDSAEFPEIAWCMLVSTQRKL
                     VVTLLMMRHAYATFMSSTIGEEAADSRSASGEASGGAAAAATSISVHWVVLHRISPYT
                     RQLSLLLYEAMEVYLLLMSKVTFVPTSELTRLRLGMMQCYDRIVAVYIETIQHELRDS
                     DEDDNGGSFNDDKDMVDTAAKQAESAGQTTAPVTAGTCVPVFTPSGLVVDAGVRENRS
                     FLDSTTGPKSHADLHARRRRSKLSKSANSERKKNDSGGGRVAYKLRPAERQLLREYML
                     GQHTASTLNASFFASATAMAADQETGGPSAALGNVDAGASVASHSMFNLNGIFFDRRA
                     SMLDPALLRNAGIVVQEPVHEEPKAKRSNSTVPATLSAHPSTMHSSRRPSFLNLRSSV
                     TNVDGAVVIEVPGTEASAVTLPVFPLGLDRSLTTEGPLEGAVPAPPSLGHSCISVASL
                     GGDERQQQQRQIPGLPALESLASIPPMDAAPATSKAELLAPRPSVLQSYTVVPTNASL
                     AATQPSVVSAAANVQGVSGSGPHGSNAGGDAADQAAPSHGTLLSNSSLLMAATAGGAR
                     VVGGDVFALGRAARSTLQPHVGLMGALQHADRPHGADDSACHDDGASERSATHTAAPA
                     RDAALAPAPVTAATTPRADGPPRPIATCSATVPGEQGVYDERSTAAESSPEFMLDGTP
                     GVSAATASGGNAGTADGEGDWEGAREALGTLLSDRSTHPDNRTGRAAYCTASSQLGAT
                     LPTPTAAAAGVDAAADERAASSGTNTFPSNLDINGSFSRVGPAIPAALRSYVEGLAAH
                     QQQQAPPPPALLGNTSYITISSNLPVMNRTLLGGGGFGSPAANPEASVRAGPTLTASA
                     VAAASSSGGGVPAASTSVFPDAAPLAAAGGAASTEDACLRSFGVHNNTSDIADMLRST
                     HGTQSFNPVLLRLLQSDGEGGSEGAKNEYVLTNSDIHSLEAFLFGLRALITQVEDIER
                     YLLEVVHGREMAKKL"
     gene            <330263..>331819
                     /locus_tag="LDBPK_120550"
                     /db_xref="GeneID:13390162"
     mRNA            <330263..>331819
                     /locus_tag="LDBPK_120550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859124.1"
                     /db_xref="GeneID:13390162"
     CDS             330263..331819
                     /locus_tag="LDBPK_120550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859172.1"
                     /db_xref="GeneID:13390162"
                     /db_xref="GOA:E9BB35"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:E9BB35"
                     /translation="MFGESYVESGAPNAARGGGHYTTTRIESPALRAAGASSSGANGQ
                     QQHLRSVKEIIKTLDEEHEISGPKGGCCSRIFVPFLTLAMIIVIFVAIVYTNGTGSDV
                     EASPRVAMIVLEGFSGTVFHALMQSGVHMPNIAHMLSSQKGVWAECATSSQSSCARAV
                     VVENDTSGEVYVSAAAAMTSLFSGVSPREHQVYNGSLESMSMYANTSKMNPSIAKRVK
                     DAGMKVSVVGTSHAINSLSIAFGSCSQPGVLDMECAASREELLRASIDEYSSSVQLDC
                     LASSSCNMDTRKMNSPTDPKQCSSGQAEAQFTRHLNSIFGGLAYSTQTQEAAVQNTAA
                     DNLDDSLFVFHFDSLAVRAASTYLPGFQYNVSSKEYVAQVYLLDALVGQVISYVRDRA
                     RSQKENWLILGVSDHGGNDKPHAIPNPVSTSENTIAFFMATYTDNLKRFVTLAPLQRP
                     VTQLDVLPTVLTWLNVAPFDAETSAVIAGKNTTAASPAVEARVMERRHFEGLVQGICS
                     SGTSLKDCAV"
     gene            <333205..>336246
                     /locus_tag="LDBPK_120560"
                     /db_xref="GeneID:13390163"
     mRNA            <333205..>336246
                     /locus_tag="LDBPK_120560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859125.1"
                     /db_xref="GeneID:13390163"
     CDS             333205..336246
                     /locus_tag="LDBPK_120560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859173.1"
                     /db_xref="GeneID:13390163"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BB36"
                     /translation="MDAVAVQCERRGLINAATWLSEMSLHALPSLLTAPLQACSYGGH
                     GGNSLCSPLHSVIHLDSGVFGNHAIAGDARAAPSAGWQRLHRVALGYFIKGEYQRCHH
                     LILREVMRNTAVSSSCGVPLPSTTQRTWPMSVGEVSDNEGGLSLPLPEVVRGFRTTTL
                     PPLLQFLSLYALFMDGVKAKQLSNNASQGGGAESSGMGRSGQQRALHPHARVLRAYLL
                     EAMRNPVNMLNLPSSGNSDPEPQHGDGVDDEAALHAALGGALPSAHHTSSAKRPWTTS
                     SAVWLASRAVSAATTTGIAAVMTTGASASRSAATKQAGCTHDSVFPCTAASPVFSNVS
                     PAGSPAAKATAVQGGESDAAPTSDLLHIDPYLSWLMGVVLRELRMRQESATFLLAAVS
                     VNPLLRCAWEDLACLVSREAQLAELDAALDGLEPFFMVDIFAAEVRGLLGITPVSSAR
                     LRIAAAAASAPSDGFAQSPPCSAPPEGRAATTTAKAGTRTSSPPPPPRTNTGATPPIP
                     AAAPSNAWECFSLLFPDTPFFLSQLAHFYYHQRNRLDRAEALYQRIRALDPHYLAILY
                     DYSNVLYTKRDRLGLSSLAQSVYQADAFRAETNFAVGNYYVLLGQHDRAALHFHRATA
                     IDPQCAEAWLLLGHAYVEVKNTTAAVEAYRTAVELNERDYRGWYNLGQIYELLEAYHH
                     ALYYYWHTTSLRPADPGMWVAVANCLEHDGRIAESIACLERAETYDSSSSPSYPAYVR
                     RIATHHIANSSYTRACVYLEKLAQSPAASTEDLLLALPFIVQHYVQRARSSVEGFVRS
                     SSHDTVLFSPGANNVSLMSSPASGAVAAGRTALHHARAAAALQHLNKAEEHLSTMAEL
                     VMPSGRNGAGNEEAAQTPAASAAAGESEQAGAENSAPQRAAEDASNRRRTRQPRSGPA
                     ANASVSASTSAALAAVAATTAQSAGDMPPVAFVRSRHQEICMLRAQAMHLLQIGAGAG
                     SSTLPAAASASASAATQPSSSSSQQQQHRNPLVSQLLGRNQ"
     gene            <337319..>341713
                     /locus_tag="LDBPK_120570"
                     /db_xref="GeneID:13390129"
     mRNA            <337319..>341713
                     /locus_tag="LDBPK_120570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859126.1"
                     /db_xref="GeneID:13390129"
     CDS             337319..341713
                     /locus_tag="LDBPK_120570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859174.1"
                     /db_xref="GeneID:13390129"
                     /db_xref="UniProtKB/TrEMBL:E9BB37"
                     /translation="MPAALQTPPPLVDQDGAPPFSAQRATLGAATSAATVAPTRIPAD
                     SSNLGRQRAVPSSSLSSFATVSSPAHIPTTSGAGALDSRPDTPASLVRASAMAAAPPS
                     TTLSRSSSLASSSASSQPAVFPGSRQFGSSTHARESRVGATALEPQRQSPSMVPAATE
                     EDPGSHFPCSAADDAIAHSVPLPLLVEQQRHRIRALVQERDAAAAELSELHTLFQRLH
                     DDYEETTREADGLRLQLSSLRAQKEMQSDEHRLLRSSHARQQERIQQFELEWANNSKH
                     LREQLDALVSERDAMQAQRDACMADSNDLRRQLIQLQAEIHRVESKHREALREQADTH
                     AQQLRSALQEKEEQLQTRAAATRREARLVQQELDQLGAGHTAAHEERESMRWRLSELE
                     TVVTKKEQLRAELERMVTMLRSRLNDQEEAARQDAQRYTQRAQDLELLYRGQVAQEQR
                     RAQALQDDLAAARKATQEAMRQQEALQQSHSEQIKDFAARAAKLEDDLRQQLRALRRE
                     LEEAQAHALEHEAAARRSQRDAETLRATCSSEQEALERLQQAHTAQAQQLSRAEGSAT
                     VLQTRLREKEREAELLRCAMEQATWTREMRQAAHHTLASLLGVPRVSVRGGRRRVKEG
                     EEMEGWSPALQLEWAAEAQGAVPSPSPRKAQQRRDSAPTGAGDTAYVVPEGGESTPSS
                     REVEGVVPSPFKGAARAKRAQRHPAIASDSPQRPPATPTKAAAGQHVEAIEHTVPRDT
                     GQSDGKGHAGSSTEASHLLQPPLLFRAASPLTAAPPLHPGTPRTAGSSSPCPAQGSAG
                     YAAAANSTTAALRGGGAGASPFPSPLRALSFVPAQTTAGWANPLRTATGVARSQPLST
                     PLLSCQQVGHIYNIPEEEEQQHQPQAAVTEGHTSGAAYAAEPARGYSRTQRPQSATPL
                     SRKAGEVFFDDVVGAPRARGFPARVLIRGTDAGAAVPGSHERQTTSAQLVTASTAQVG
                     TSNTHLTPSTYRGSLASSDRVRGADGARDAQPSFSLGDSLSYDHGASAPGVRAAELIA
                     QLSHPSSAASDKTPAMQRGVSNTSSHRNVLNGGDSALQQYLRDTVQQVLADHGRGGTP
                     QRGPLHAWRQRPDGGSAILAASGYHGDGVNSAGEADEDDFGSASLLRSSVAVPLVRPA
                     PQPASTEGFANGGGATRMIGPGGSSQGDAGGAVAVTRNGSSAAATPHKTAAAVSAAGE
                     TVQTNRRESGIFQTLEQLAGRQQQLLQSLGHLPHAVMFPTARNADVPSSLPWQATAAD
                     PSLSEGLRSSASIIVPTSLSLQEHRCSLQHQGQREPDDSQGVARSSVGVVAAGGAPAD
                     AAGSALTVSAPLPNTDSAGFGKNITAQGHPAAAARYAKGSDAGTDVELDPRQLSYSTT
                     VATTQLTDVKQGDQSAVKKDTGDPTAAAAAVVQGSQPRAERQAAWSSEPALSVWAVAA
                     TTASARSAPSVSEVSSLSQLERRFATPF"
     gene            <342967..>344460
                     /locus_tag="LDBPK_120580"
                     /db_xref="GeneID:13390164"
     mRNA            <342967..>344460
                     /locus_tag="LDBPK_120580"
                     /product="alanine aminotransferase"
                     /transcript_id="XM_003859127.1"
                     /db_xref="GeneID:13390164"
     CDS             342967..344460
                     /locus_tag="LDBPK_120580"
                     /codon_start=1
                     /product="alanine aminotransferase"
                     /protein_id="XP_003859175.1"
                     /db_xref="GeneID:13390164"
                     /db_xref="GOA:E9BB38"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:E9BB38"
                     /translation="MLRHAARSLSPKQCYISPRVIEAEYAVRGLIPARADEIKADLAT
                     GRGSYAFESLVYCNIGNPQSVGQMPLTFYRQVMALVDAPSLLEDAVIAARLPEDAVAR
                     ARRYLAEIGTGTGAYTESFGYRFARAAVAEHINKLDHGVSPAATVNDICLTDGASMGA
                     KLFLQLLVGGASDAVMIPVPQYPLYSAQIALLGGVKVPYFLHESEGWAMKLPDLVAAY
                     ERCVTESGATPRLFVCINPGNPTGNVLERCVMEDVVRFCHERGMLLLADEVYQENVYD
                     TRRRFLSFREVVLGMPEPYCSETMLVSLHSTSKGVIGECGRRGGYFCMANLPAALRQQ
                     VVKLCSINLCANVNGQLMTALMCSPPREGETSYAMHQRECDAIFTGMKERAELLAREL
                     GNVRGLSCQPVEGAMYAFPRIVLPERYAQRNEELNAKEGRRLALDARWALELLESSGI
                     VVVPGSGFGQEPGTLHFRITILPPLEQIDRMVRAIREFQDRIYEQYA"
     gene            <346983..>348620
                     /locus_tag="LDBPK_120590"
                     /db_xref="GeneID:13390165"
     mRNA            <346983..>348620
                     /locus_tag="LDBPK_120590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859128.1"
                     /db_xref="GeneID:13390165"
     CDS             346983..348620
                     /locus_tag="LDBPK_120590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859176.1"
                     /db_xref="GeneID:13390165"
                     /db_xref="GOA:E9BB39"
                     /db_xref="InterPro:IPR014819"
                     /db_xref="UniProtKB/TrEMBL:E9BB39"
                     /translation="MLARQEKKSTAFSFLHFRAGERFYQGHWGSVADMQAQFDAFTEA
                     AQTTLSKRISRPYLRGTPIPGLTLFNNDLGLQSPLVQCSYPLIVAQRLLLFPDYLRHF
                     HTICGRENVPCDFYADIDLPGESAAGAEKMLLEVLNYLEVRLPGVGFTDPFFLVLTNA
                     VPSRDKVSYHIHARSFTHMKNRPLASNAEASTNGKAKRKSARQMKAKAAASAPAAPAD
                     RKFDEDDIDEEHDEDPYDDLSDMVSAVDAGGKGSTSSRGGSAATPKVVAFQDYRAVKL
                     IADEVNQTIGRDIVDHNCYRTNGMLRCAFSAKMPSAQDHNYHQQTDNGAAAARKRLVP
                     LVTASDPALQQRLSETESVLRTMTDPEVLELTFVTRHLDADAKVIKAARKHATSLLAH
                     ESDAPAESAEQLHRAAVLDATTRHRFKLIRPRQIMGPQATQAVEYDAYGNVVPPFLTE
                     AAKWRRFKAVTAKLRTLPPRAAESYDVWVRVGLALHNFSNEDHVFEEWVRFSLKSPLK
                     YSREVCRKKWMQFERNPDALNWRRGFNYLNSTVWRQV"
     gene            <351508..>353361
                     /locus_tag="LDBPK_120600"
                     /db_xref="GeneID:13390130"
     mRNA            <351508..>353361
                     /locus_tag="LDBPK_120600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859129.1"
                     /db_xref="GeneID:13390130"
     CDS             351508..353361
                     /locus_tag="LDBPK_120600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859177.1"
                     /db_xref="GeneID:13390130"
                     /db_xref="UniProtKB/TrEMBL:E9BB40"
                     /translation="MTQPPGASEKEKTARLVASLSRHEQVELLAQALLREYMHRRGLR
                     ETLRTFDAENPRDERTISSRALMRQLLNIPVDGRPSRLQPTASSSSAKPQAPTFMEEL
                     CSYRLTKNSYRSLDGKRGGEQQRIQEEDPSDVELRALREAADAQRAAKTSCEQKQREY
                     EELLAAEEAYQQRKEGHKERRKRKYKDKRRRSLKQRSRDDAGSNDDEAESESEQSDDS
                     EGKEGAALVAGYSHASRRPQWAPSGKRRLSAESGSGVNATAVAVGAHWQPPGNAARAG
                     ADHSTSGDGVSRRSAKIVSGGTVRLGLDNADIKDRSDHESEEDPFGLSGASRQALMAR
                     VRAESEHWPTQANGGATHAHASSTSNVNGDGGAPDSTLSAAPAALSTLAGRGAGDRGL
                     ASLSGPRPVGRAAAGFNPNGTYASPSFSGSLSATVPAGANGGMAALRMKASSIPIPGL
                     SADGAVRGLASTHSSGFPSAMPTVSSAPSILVKHVSARQQCDDGAASDGALHSYDRTA
                     LPRSSALAGSNGGSTARTAAACIPSPNASALSESASPVFSVASRSPASNAGGSGGGGG
                     SGLRHGIGFRTSSTSAEGTASSSAAFIGAADPAAGAAKPSRKERRVKLLVD"
     gene            <355297..>358182
                     /locus_tag="LDBPK_120610"
                     /db_xref="GeneID:13390166"
     mRNA            <355297..>358182
                     /locus_tag="LDBPK_120610"
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /transcript_id="XM_003859130.1"
                     /db_xref="GeneID:13390166"
     CDS             355297..358182
                     /locus_tag="LDBPK_120610"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /protein_id="XP_003859178.1"
                     /db_xref="GeneID:13390166"
                     /db_xref="GOA:E9BB41"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BB41"
                     /translation="MGCDSSKESVASNTASASSRGSRNCAEKGKGGRRTYSNGSTEVK
                     GKSGASGAHNGGSMAGAGGTMADQSRWPTCHFCHRKVPDKDYNAHTVMCDEREVTCWN
                     SWCRQIVRQGDLQKHLEDCGRRQKAICPKCGAEILAMEMLAHRDSCQPKPCPQCGELC
                     ITRIHKWCPKTILAKVKFINGPFATEVLQRRFLPPGKEKDPRAKLEYSVARMQLLWRW
                     IKCKGMIEETIFRSVYKEMDLKKEGFAIFKAHDKVNEQHVMAPKRSRSVIQAPVVAPA
                     TSSHYFPVNTNAPITLHHVEQMIKDIKNRVLLPYPAAWRVFTDAMNHLNTMPNVVRVS
                     PAVGARVSNGRVIQGCKVVVVGDLHGQIADLLHILKESGMPSESNYYVFNGDYVDRGA
                     CGVEIILILFSLMLACPKYVTLNRGNHECDYMNDEYGFDVEVSTKYDRNVFRLIQRCF
                     CALPLATLIGGKIFVVHGGPPRRRGVSINDISRIQRFRQIPIPNYSQPEEDEIFQDML
                     WSDPVEDIKGWRESQRGAGVEFGSDVTMEFLENNKLELIVRSHEDCLSGYEEHHNHKL
                     LTIFSASNYDGPNSNYGAICTFIGDNLEPSYHTYQMFEDEYDDSQVVSLTDSFALTAP
                     NIARISSFTATIGSVGFGVNKSNFMSRVLLHRRTKDNILRELRERIYQRRHRLLAYFS
                     KLDRTNKGSLWMIEWVESMRNVLNLDLPWYFLRGYLVEVDDHSRIWYAPFLNRFHNVL
                     QDLWGEEWRQSVCARVLQQQRMNHRSQLVSAAFNKEVVNYNEFCSVMRAIDYTTSDCQ
                     LFQLFESFDEKGNGHISGPEFLKKVQQIANDKPDPLRWDIDAMEQLQNIVIQGRSQLP
                     SLFRVTSRDKALSRERFMAGMAQLGRCMRKQLTQPQREAIFDFMKQRVPEGEEMTFDM
                     FLLCVYVFDRRTVAGMKSSYSLSDLNELGLAPISFRNTSFSGSGTGR"
     gap             361358..361456
                     /estimated_length=99
     gene            <362909..>363940
                     /locus_tag="LDBPK_120620"
                     /db_xref="GeneID:13390167"
     mRNA            <362909..>363940
                     /locus_tag="LDBPK_120620"
                     /product="cytochrome c oxidase subunit IV"
                     /transcript_id="XM_003859131.1"
                     /db_xref="GeneID:13390167"
     CDS             362909..363940
                     /locus_tag="LDBPK_120620"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit IV"
                     /protein_id="XP_003859179.1"
                     /db_xref="GeneID:13390167"
                     /db_xref="UniProtKB/TrEMBL:E9BB42"
                     /translation="MFTRRSVSAAVGAAMATSSSLSMQRRYDHDRWYGHALELDTHNY
                     KFNGEPPSWMKTHAKTEEETSFAKSVLPHIDFASSYECLLFDADRLNTNLNRKEFGNE
                     IKYRLEKQANTVARAQQLLRDKKAGTGPDAEKVENTLIARIFDEEHVQAEMKYVKCIR
                     ANELAEDNRLDILPGGSPNSLREKTRWNLNTELHPADRAEIGARLTAWLPEKYHIVYF
                     DDFQTVAANDATARKEMLEIVESVQKEYTAEAKECGYENDLKETVAELMDDVDPTRTI
                     TMEAIKSCKDLQQLEDWSRQVHEYNGDDRIIEIYARAAEITKNAEHQALVRQMREWRK
                     LATKNESRL"
     gene            <366328..>367626
                     /locus_tag="LDBPK_120630"
                     /db_xref="GeneID:13390131"
     mRNA            <366328..>367626
                     /locus_tag="LDBPK_120630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859132.1"
                     /db_xref="GeneID:13390131"
     CDS             366328..367626
                     /locus_tag="LDBPK_120630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859180.1"
                     /db_xref="GeneID:13390131"
                     /db_xref="InterPro:IPR006606"
                     /db_xref="UniProtKB/TrEMBL:E9BB43"
                     /translation="MRKRRGGGASSPSGTGRGITKAFAFWQDREIHFDAAAPVLRLRE
                     NTEHVYATFDDVEDTKGNNGCPGTLLVTNLRLIWRCKQRPNVNLSIGYYCVHKLTVQE
                     AESKLAGRMTECITLGAKCGASRFQFIFSVAHNAGGIGSSSAASVSTSGGAAAQRDRE
                     NRSRRRPSNSTGDHQRLYATIRAVWNAYESTRVYRELRVRSAVVQHGNLILLDGENVI
                     SRTSGVSSVSKDEGHLGTFIVTNIRVVWFAAAEFFNVSVPYLQFVGLRSQMSKFGQAL
                     VIETSSYAGNFVLGFRVDPEEKLNEMYAEISTLWRTWTARPLLGMKVELHDDTGKVMV
                     PEALGVGGGDAGDKSGSAEHPHGGGLPGAASDAQHERQMEGQNVLQEVPTDALAAYYA
                     GGGRKGEDRRPVYEPSIGLAVEKLRKGTTIQSLWDTSISS"
     gene            <368801..>369295
                     /locus_tag="LDBPK_120640"
                     /db_xref="GeneID:13390168"
     mRNA            <368801..>369295
                     /locus_tag="LDBPK_120640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859133.1"
                     /db_xref="GeneID:13390168"
     CDS             368801..369295
                     /locus_tag="LDBPK_120640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859181.1"
                     /db_xref="GeneID:13390168"
                     /db_xref="UniProtKB/TrEMBL:E9BB44"
                     /translation="MQIILKSRNRFFAVALWSGATTVVMFWLVLRRTGFNTAYSRCTY
                     LVMMGEYKQLLEPGTFPSNDRLPPHLRLDKPSYLDLRDTEIALPPVIDVSLSDRDQVR
                     QLEGQLPSTERSDLHVHFGPIKSQTIIMTPSSNERYVRRRLGLSEKDRKNLEAEGQQA
                     FAQA"
     gene            <370279..>372831
                     /locus_tag="LDBPK_120650"
                     /db_xref="GeneID:13390169"
     mRNA            <370279..>372831
                     /locus_tag="LDBPK_120650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859134.1"
                     /db_xref="GeneID:13390169"
     CDS             370279..372831
                     /locus_tag="LDBPK_120650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859182.1"
                     /db_xref="GeneID:13390169"
                     /db_xref="UniProtKB/TrEMBL:E9BB45"
                     /translation="MYASLGISSDQVYGDMYTAWLRDTHEKNTPEVKRLYTTTIENGF
                     GDQKILLRRQRLGANFISSLAPLLHQCSLVKLDLHGNMLRDVGCEMLIHVLRDAPQLT
                     YLDLGANAIGCSSVVASGISGGGGGTVFKGKGSGRGSPAGTLASRRGGAGSSGGAGGS
                     GARVSSSYLNAMQGLGNAIAQHKRLAVLILGSEREEAYANQIEAIGAMLLLEGCVLSR
                     TLKRLDLSGNPFAMDGDTPSAGAVPGSLAAIGGAAAGTRVGSASTPGMDTAAARGGGA
                     YGMRSAPRTPVQLIAQLLRTSVTLTHLTLQSVCLTDGGAAHLFEAAGASRTLQHLNLS
                     ANGLSSRVADEAGRLLQQRTAVARGGALGCTLHSLVLAHNDLWDNGAAAAQAHRGSLG
                     IGAAAAARPATCDGIGLHNRAQSTTAMTLTPTSSPSKFVDRTRALRDGTHGETDDASQ
                     SGYHSQQQQQQRDPSPGIVLLLALSHDQFITTLILDDCVMDDTALYTLCQSLMTNAML
                     KVLSMRHNNLSPDGVVQLGRSLCRHPCLERLLLSGNAIEDEGACALATALGQPDAPLV
                     ELDLVKTWLGDRGLIAIGVALQTNTSLRVLRVSDNHFTHNGGASFAALLESNSYVVQC
                     ELGATSVPHHILLRVERTTARNCTRAANADADALKAEVVRLHYQKYKLSEAHLELEAL
                     RENNTEVKRTIENFDLQTKQDHSDFLKRIRELEEHIENAKQQEARYTEQKAKLEADLT
                     KAERAHEVDMTYMAERLSVEVGLREKAEAELQQRQRELTYWQEKGPEREAQKREQLAA
                     LKADQEAWSSQRKAYRDRTAELQQQVSTLEAAAASAGASRGMPKRRKKSTMV"
     gene            <374169..>374495
                     /locus_tag="LDBPK_120660"
                     /db_xref="GeneID:13390132"
     mRNA            <374169..>374495
                     /locus_tag="LDBPK_120660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859135.1"
                     /db_xref="GeneID:13390132"
     CDS             374169..374495
                     /locus_tag="LDBPK_120660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859183.1"
                     /db_xref="GeneID:13390132"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:E9BB46"
                     /translation="MVNLSAKFQISASNHKEFYIYYLAKHSKQWTRRMHLIGTAVGVV
                     GAAVSAVRMDVIGATVSTAVGVAICWAGDTVVEQTQPTTFKNPIWSVMSNFKMVASML
                     KGDMSI"
     gene            <376957..>377283
                     /locus_tag="LDBPK_120680"
                     /db_xref="GeneID:13390170"
     mRNA            <376957..>377283
                     /locus_tag="LDBPK_120680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859136.1"
                     /db_xref="GeneID:13390170"
     CDS             376957..377283
                     /locus_tag="LDBPK_120680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859184.1"
                     /db_xref="GeneID:13390170"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:E9BB47"
                     /translation="MVSFTPQMQVSCSSFPEYRLYYQGTHCNIWTRRSHLVGTAVAAI
                     AAVLAAIRLDLRMLVSSLTAGYLICWGGDVFIEQRKPASFQNPIWAFRANMAMVQDVV
                     RGKETV"
     gap             378602..378700
                     /estimated_length=99
     gap             379993..380091
                     /estimated_length=99
     gap             380770..381015
                     /estimated_length=246
     gene            <381250..>382569
                     /locus_tag="LDBPK_120661"
                     /db_xref="GeneID:13390171"
     mRNA            <381250..>382569
                     /locus_tag="LDBPK_120661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859137.1"
                     /db_xref="GeneID:13390171"
     CDS             381250..382569
                     /locus_tag="LDBPK_120661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859185.1"
                     /db_xref="GeneID:13390171"
                     /db_xref="UniProtKB/TrEMBL:E9BB48"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWILYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGMVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIKDWQPRNPDDPLEMFPRPPQMLLRWDE
                     SVDEHGNRAFRYRYDYDMMGPTGKWEAYPRYPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGRETDPSEDPEYDLAQASEYVEPRDGRRAEWRHLWASGRKPGESLPFQVTFNDG
                     LCFEENEGGPPAHPAAHYEATPKGAPHGRYEDADAAAARAAEAAHKAACEQSLSEAME
                     RHRRLFGDTSGEPSGPRAPLPTGCRPMRCAPGPPLPSGRRRSSAPEQ"
     gap             384347..384445
                     /estimated_length=99
     gap             386486..387988
                     /estimated_length=1503
     gap             388092..389723
                     /estimated_length=1632
     gap             390330..390429
                     /estimated_length=unknown
     gap             392317..392415
                     /estimated_length=99
     gap             393498..396964
                     /estimated_length=3467
     gap             397732..397818
                     /estimated_length=87
     gap             398395..401885
                     /estimated_length=3491
     gap             402239..402447
                     /estimated_length=209
     gap             403953..407727
                     /estimated_length=3775
     gap             408299..408397
                     /estimated_length=99
     gap             409654..409752
                     /estimated_length=99
     gap             409940..410446
                     /estimated_length=507
     gene            <410501..>411088
                     /locus_tag="LDBPK_120667"
                     /db_xref="GeneID:13390173"
     mRNA            <410501..>411088
                     /locus_tag="LDBPK_120667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859138.1"
                     /db_xref="GeneID:13390173"
     CDS             410501..411088
                     /locus_tag="LDBPK_120667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859186.1"
                     /db_xref="GeneID:13390173"
                     /db_xref="UniProtKB/TrEMBL:E9BB49"
                     /translation="MSFLALVCPPPSASHIPCVCASPLGGDIGARPCHPLLPHSLLAT
                     SWAVRACMDVYTRIEGWGRVHVCAYTRMCVGAPLYICVCACTPTDRCVGAHVHVDMRI
                     DVYSQPRAVCRRVCVYISVCRHVCRATLSCPPPLCLSLALGALALAPGGGRAEGGRPF
                     LISFAISLCPTRVEKRQLLGPVAPTRAVGGGNVLW"
     gap             411689..412877
                     /estimated_length=1189
     gap             413397..414630
                     /estimated_length=1234
     gap             414958..417630
                     /estimated_length=2673
     gap             417749..418039
                     /estimated_length=291
     gap             419395..420904
                     /estimated_length=1510
     gap             422331..427866
                     /estimated_length=5536
     gap             428532..430191
                     /estimated_length=1660
     gap             430967..431139
                     /estimated_length=173
     gap             431901..431999
                     /estimated_length=99
     gap             432598..432708
                     /estimated_length=111
     gap             433263..433361
                     /estimated_length=99
     gap             434335..434433
                     /estimated_length=99
     gap             435089..436413
                     /estimated_length=1325
     gap             437357..437455
                     /estimated_length=99
     gap             438499..438597
                     /estimated_length=99
     gap             439057..442116
                     /estimated_length=3060
     gene            <445251..>450344
                     /locus_tag="LDBPK_120700"
                     /db_xref="GeneID:13390133"
     mRNA            <445251..>450344
                     /locus_tag="LDBPK_120700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859139.1"
                     /db_xref="GeneID:13390133"
     CDS             445251..450344
                     /locus_tag="LDBPK_120700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859187.1"
                     /db_xref="GeneID:13390133"
                     /db_xref="UniProtKB/TrEMBL:E9BB50"
                     /translation="MHGGSATNEQEAAAPHPLLPHQGSTSVSSAGAVASSSGVSHLSC
                     VEGGKRAVLATLWLDAERYTYEALCTAGAAAVSTHYVRVVEYGENNRDEEQHGIPHSI
                     DMHAGDGRYNEGLPADRTATWDDLATDPRAQPLLRLVPHESVAVTRGRSSSSAPTSIV
                     GAATDDTERRAGCGQGEQQAKANGCAVADDSTHRDSATEALADAHAAPSTSSGLLPLS
                     LRDADVRLDILEEVELCNVAPILPRTFAVEQLVQQIVPCTHAFASQTPSPSIAESALS
                     AEFACDGATSPSTTGPERRFSIPPLRTSMPGRCLARLRKVSDEHLAFLRAAKGSLVTT
                     GVATSASAENGEAFTEEDSVLRARMALPCVPVYMQATSVATYEGSDNVCPTATHTGES
                     SDSDPHEDNEQQSSEVGKGEVPTVPPVVGISQPLLSQLADFSSHSSAMEVALAHEAQA
                     RQTAVTISAVRSRSEELLLAGSDNAPTPREARESVSPISASLAGAMFAAKATAEASLH
                     GALNDDITWPRQEHPARAPGSPTPSALPMSASMEHVGSCLSEENIACSSFAAAQARYE
                     RYRQLLPQRCRAGAGFSTNSASAQESPTKLGGQSAPTDAAQYATAPCTAVLPRSTEDL
                     EAAQEFWSTAAAASLEPSSMTTNTATNVAASATAATDTDADDADFLQWMTALSRQRCT
                     QRLSIPLESSSQQGSRGQQQLAHQQLLRASQQRQGGAVVEWSSGAVSYTADTLGLYEE
                     QQARSQRFYHVLPPPPLSPSLVSTVPGARPVNAAPVDGSISSVASTEDRSSLRGAVLA
                     QLQRLSRLRSAECAVAHGAAVLEGEDTIEPLVLENRRPIAGAACLSPQPPVPVKGHPS
                     LLSSNSSTSTPPTMSTVALSVRRCRCYRCLPLIVQFAQVPSLASPVLRRYLDVLHQTA
                     LPGLPAQQRHHGADATSAVEVGAVSLPEEAREPATQRVPSSMTDALAESGGPGETTVA
                     GARSSSDRRHRRDTAHRNSRHRRYGAEDKVKTANGTKGSKRGREETTVATPTMPHSPQ
                     TGGDAQRPRVAADPLKVFPALQQWLMRRQEGGIPAQRASPNGKRSTTESGGAVLPLSD
                     DIQQSGGAFLQPVAQTTTSHRHDTETCASCASGAALPPTLPSETLSGEVGSLGWVDDA
                     VLDEVVVVGVVPRGHPHQLQLVAPSRAFCLTLTQRLEEVAEAAVHILGFLTPPHSALL
                     SPLPAGMSRAPEAAAAATSASSSETTSDWRAWLETQYFVAMWTTLRRRLTTVEWQTVL
                     QEARGSPFLARWTTVAAARSSAESAVFRGHPQRTGIELFVTRASEEGIAGSPAAEKHK
                     VEATAHEVLQGVRESVCSAAELHTSACLSAAEDIVTRVVLTALVPILHRRITVMYELL
                     RHFASKSLYMSHRMQCDAYQHWYSMTPSPAAVLRLLQRSGRFSRALARCYPQYDLSPV
                     TLSGSTTLDDSDHAGAATRTAVPLMSFPSHPLSWTRDAAGTPTAACNVAARESGVTAD
                     LSSKHEEYSPQRDGFSASCATASPVRSQARVTAPAEVREMESSLSPSSSSSLTTTAAP
                     IPAASAWVSFLPSWSDEASTQASSQQEQQPVMTYVPEAALLDPRYLQRFAWWMHRSHH
                     STGTNGSGSTMTISSNDTDGAGVRTQPLPRVASTVNIPGDYLRVLPMHEQDASIRIVL
                     RSIAQKGRTLDLLEMSQHIHSHYTSYVYH"
     gene            <451004..>452830
                     /locus_tag="LDBPK_120710"
                     /db_xref="GeneID:13390172"
     mRNA            <451004..>452830
                     /locus_tag="LDBPK_120710"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859140.1"
                     /db_xref="GeneID:13390172"
     CDS             451004..452830
                     /locus_tag="LDBPK_120710"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859188.1"
                     /db_xref="GeneID:13390172"
                     /db_xref="GOA:E9BB51"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:E9BB51"
                     /translation="MTDRCYRTLGLDRGAAEADIRRAYRRKALLLHPDRNPNGAQAFK
                     VLQGDYEEALTDARRRRARGGGEPPFSSLESSSWNPAAPAAGAAYRFARAASTACPPF
                     FPEPSPAPLFTEEELFSDSIPGGWRDVCARRGAPARGGAKASGRNNAEGRTEEINGSN
                     SCGSQEAAAADARWRRAHGARVPVSAYEFSGPVPQPPPPPSRPSPHASSSSFQSSCTQ
                     TRASVVVTGSRLSTQAQRNRFLSRERAWKSSSAEDLSLDAKQEAGGADNVGRSRGCDG
                     YTGQNREALCGSDTRESAEDRAYREAVFLHRRMPELSGKSRDTAAERTLTYLQPDRAF
                     LTEGALVGSNATSPAKRGVYHQRSDLHTRSNITTATTSSTKGERLEAALNQREALCRQ
                     CRDTETTLQHEVGDEHAPASRDEGDASAHPDKGEGGSGTNAALGPSAAVPLAASGCDI
                     SRADDPFPVRQSAFPEPSSDNRLRGDLPHRDRILDERRPLQSENLPCRYTPNPAEVAE
                     VSDMEVHFLASVAEDINQKMQTVMAARLSKAPCSCCASTPRAHQHVYFTCTHPSVCED
                     CYASGVSECPLCGAARVDRSSPPPPTATASSSIEEGVTAGRF"
     gene            <455499..>459362
                     /locus_tag="LDBPK_120720"
                     /db_xref="GeneID:13390134"
     mRNA            <455499..>459362
                     /locus_tag="LDBPK_120720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859141.1"
                     /db_xref="GeneID:13390134"
     CDS             455499..459362
                     /locus_tag="LDBPK_120720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859189.1"
                     /db_xref="GeneID:13390134"
                     /db_xref="UniProtKB/TrEMBL:E9BB52"
                     /translation="MAMEFAPDESRTSFPGSLTITKTTLTVFKAKRSAATAVRDPATN
                     DCFFFVGVCSTPLIQFYRHKNVITLMRGTSFLFDNAAVSIDLQLGSDGSNHRASPIHS
                     SNRSRRDNPTMWETLAMRFASLEDCDRTVEVLLAHSAEEVFVPPFPIRSQGHASCNTL
                     TTTSLNRYSSHSSPILNSRRSASSPISERPERRDSTHRSSTRGSTPQTEVSTPRSSRL
                     PCRRESDDAATRSSVRTGELTPRSSRLPSRRENDDMASLSTPSQSIRSLQQRVAPGRS
                     TAARTPSQPDSEKLQGPQRRHHSSEKKRDASAATSASHSRLHSSAHHRLADPAEREFA
                     TVEVARPPSRPHSHRSHSRASASSRSPHLNGTAIATHEDIHVRRHGTPRNAPSTPSAT
                     SSTTSASAIRRYVSPCNDTIDRKSSVSPRSPVPHTKLEQDAFLRSMQPLQHNRLHFMQ
                     HLHKDIAHHVYLAEEAQLKAATASAETSLSRHSASSAAGGEMPEAGAARLREIEGRLV
                     KVEALHREAEREREEAARLRREYELKNEEMNARIGVSHDVSELNSSLVSPHRSSVHPM
                     NGQLMVMPQQNGGGSSYFLMGHQGCVVSPEWALAADPAAAPRPDDVDLGVAIVDRYIF
                     GEEWTRVYPAYEAEVRFNAQIDVCLTMKLPRRLVAITNIVVDRPGLRVTAEIRYDRVK
                     IERDGVERRMNGCPFRFLQRFYDMRDLYDRMHDGAAAVAGSGGAAIVMKPSAANGRRL
                     SAATSRRASRTVPAPRRRSSHGPQYTNSDVSEIGEIIEDDYDMGGRRDDYDRVCAPED
                     FMVKRRRRMAAELRRQLADSMAQLEQEEDYLRDRIQLAEAKDRQTVGREVRLNVKATL
                     KTSLANLEEEERVERAAMEVSAARQLHVLMGSHRRTLALFGLQASEAERRKQIGAQEA
                     QARRDLNDAMNPALAAQRKQAVRRAREGEALARRGALYPSKRELEAALADVEADEVAA
                     RAIIRSQAMEALLDLLSRSPAPKFKDGRRAPLYASFTLKALLSDLQADEAAQRRQIAA
                     DERRRRTLYRHEDVVKREAADRVAIEGAEIDDRDEIVDDMMALNRHQLERRLNDREQL
                     LSMINEEQFYRKTVLSDEQDAFEVIAELFTAGLKDLLARTPDVGDDDDEDLRRRRVST
                     TRQAKPFHYMTFSPDDMDYPPSAVLAVEGIVGCSINKNLEVVSVARPLPKAEKEDLQL
                     QAGDMILDVAGHSLHSLSHLREVLSNRALQIQEETFAEFPDVPQDQLTTSPALQKYIE
                     VLCEHHNFLVQVLRGCEIYQIIVRS"
     gap             462239..462337
                     /estimated_length=99
     gene            <466352..>469066
                     /locus_tag="LDBPK_120070r"
                     /db_xref="GeneID:13390427"
     mRNA            <466352..>469066
                     /locus_tag="LDBPK_120070r"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859142.1"
                     /db_xref="GeneID:13390427"
     CDS             466352..469066
                     /locus_tag="LDBPK_120070r"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859190.1"
                     /db_xref="GeneID:13390427"
                     /db_xref="UniProtKB/TrEMBL:E9BB53"
                     /translation="MPPSWLPSRSSSCSSATSSSFISASDCSSRSSGNADLAADGARA
                     PESGHNHHLRQEHRHRRHHRHNPPRHCSDDRHVTHGEIDRRSGTTAARRVQTSEHTRF
                     TSVLAGGRRFGDSDGPGAAPAVSCGRIDGNVDGGSPRTQDVAWWRSCAAAAKATVGTV
                     PTATCDVHPYCCAPQNPQLSLQRQQPAAGVDPACRDLAATPQAAATQRLSTISPFMAT
                     VSGTLIASPTPLPPPHPRRSSSAQNLDSNVLITHTTGGVPRSSKSLFKGKGSGGSGGL
                     LALTTMDGSVQLQPSRSVGCATRHVQCGTLRRSFSFTSGVPPVSASGYEAPPFSASRA
                     ASPITAANAAIGAPRTSLTGERPHERTASIASSVHSASSSVRPSVPLPPSHVGIASNM
                     MAAVWVDLPLSQSGSRSATPLNNSDAYAPPRRRRTTPRRCSGPPSPATSTLAASVASS
                     FDGAGYMSSATGGAPVSARRLLVTVSTQTDNDPTTAEVCTTPVSLPRRLYCNSSSNSP
                     YAAKVGGGERCGDAAHQYNLNGPFESEGAALTTAASVSSTSAEVSPRSLLASVVEIRL
                     DDHAAQTALDGDAARRVRQNTAGDDMPAAPPSAPTSLSIDVTTKVDNLSEGDRPSSAS
                     AEPPGAIYAYETLRVDVPPRKGGTKAAAAAAVNTSAATEAEMDSTAGALAPPATFPLP
                     TSLVTQSRSVVSPALSRSEAGAPPAGGIPPPTTTAVISDEAGAHSTLKAAGEEGRRGA
                     ERGTTSVDFGATASLEEAGDSSDPQPLAPSRNDEVRRLRAELAEMRHQYAQVVQQLRQ
                     MQESAVAAGPAVGSTQPSHAAAALNAGHRAATEAVLITTSPSLPAASPPSSLRTVAIR
                     NRSGAPENPLVESASSVSSNSDDSGEDATTTLDRVRAALQRARQRATN"
     gene            <470751..>474983
                     /locus_tag="LDBPK_120065"
                     /db_xref="GeneID:13390428"
     mRNA            <470751..>474983
                     /locus_tag="LDBPK_120065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003859143.1"
                     /db_xref="GeneID:13390428"
     CDS             470751..474983
                     /locus_tag="LDBPK_120065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003859191.1"
                     /db_xref="GeneID:13390428"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022100"
                     /db_xref="UniProtKB/TrEMBL:E9BB54"
                     /translation="MLALRDAHAHGATRVSIGGQHLLTGGADGVVSLYSTKHWPTAAA
                     LWSFRCHDGAVTDVALVDALELALSCGRDGRILFHESIADSAKLVSRVICQVTGEVRC
                     MHMDIERRRLYIAGDSLRCLDMSQDKFQIRTIPLVVPFPLVSLAVSPCGRYIAMASAS
                     GELGVVPTHATTPAEAGATPKTQFVFRSVLSPTAKKEDTAMYRMSWCRTAISGLMLMV
                     PTSTEVQVYALEDCDSNSSLSAPRMRAIGGLHDRHFTDLHGALVYPITKTQVACLLAT
                     RDGLFVGKVHSKTLAMSRHMSERYNTSSFSTPSSGAVVVAAAEGEDRGSTAVVTDVQV
                     NPVNGDVAVGLTDGRISLLRRASPKAWSSGTATGSSTASMAGNADEDAEGIAEQEDKG
                     KVDNRSMRHERRACRADKSGCGAAQTEKSDDDFIDDGSNDGTASVDSSSSASSSIASS
                     DSGAAPEDFGKIVVDLQRDGASLHGRESERPSRWRDDEEVALAHAKREVERQRGRSRF
                     LDDEAEEGTPSDDEEDGPGDDNVRRARGQACAPYDEEDHFGDDLSMEGHTDENGDLAN
                     VSSGRGGDSTLPVGRVPAVQDYSFQVGATPAGEEGNCYLAYNSVGYIHCSRDATTVHF
                     HDISHPAVRLQLRDTVLMGTLSPVGAAFIVLPADPTEAQGSVDEAPRLSVLYHAFTPL
                     GAQSEWRVALLPGETVRCMAAGIRYVAVATSHYLRIFSLSGLELAVLSKSQRIVTMVG
                     TSSRKLMSSFKADFDPLVIISLTGTGELQMEVIDVGARTSALPPRTVPLTELPDGSTH
                     QLQWLGWSEDGLLHIVDTAGVVRQFTEDWGGSWVPVYDPRTLVDQSYALWVYGVSESA
                     LLAYRYSRDDPSYPAAAASGLSTELVPLFLPLTRTMGEDGLERWDKLLRQQLRCDELK
                     RHSTFYSANIAKYDEVHDHHLLQFFDSALKSQQTTRAMELAMLMEIHDRVVKCAQLAN
                     ANGHVKLVPKLLALYEMRMATKQKRKCGLPAKEKLASDKKKDELLHKLLGQILPQDKR
                     EKPADSAAAAPPTPIAVEVVDEESKEMKTENRTSPLRGPTSTTASSLTATSPSAVSTA
                     TTADPNALPSQARRHISFAKEVALSPPASLSSQSTTTSTLPTTGSSAPALSRKLANPF
                     AKTSVTPVKAADQVRHTSLSNPQQSHHQHQSQLQAALPTSKPHSSTATATGAATLLGS
                     SQLHTPPRTRVAATRTTAVSVVQESDAAKCVFADDTTPTGSRVSAARTPSSPIHGASP
                     VPTASTGGSAVTPSVSATTCKPDVHRAAASTSSPAFVARELPTTSATLVASDTPRLSS
                     GAFDPFLEEPRKSFAGTPSCEFLMGSHTSATSAAAEAPISVQSLLDVGHGETAPVVRS
                     DSFGEALRKRYREDEEEDAEEAPLATLPKLSV"
     gap             476264..476362
                     /estimated_length=99
     gap             477470..481469
                     /estimated_length=4000
     gene            <483088..>484242
                     /locus_tag="LDBPK_120730"
                     /db_xref="GeneID:13390112"
     mRNA            <483088..>484242
                     /locus_tag="LDBPK_120730"
                     /product="NADH:flavin oxidoreductase/NADH oxidase,
                     putative"
                     /transcript_id="XM_003859144.1"
                     /db_xref="GeneID:13390112"
     CDS             483088..484242
                     /locus_tag="LDBPK_120730"
                     /codon_start=1
                     /product="NADH:flavin oxidoreductase/NADH oxidase,
                     putative"
                     /protein_id="XP_003859192.1"
                     /db_xref="GeneID:13390112"
                     /db_xref="GOA:E9BB55"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:E9BB55"
                     /translation="MSAASKSIDVMLKPLLVGGRPISNRFVMAPLTRCRADDNHVPTA
                     AMVKHYSDRASMGLIITEATQIQKGYSTFAHEGGIYDKEHVDGWRKVTDAVHDKGGII
                     FCQIHNGGRSTVPSNVDEGVRIVAPSAVAITGHKCAGSFARNGKTQPYPVPHAMAAEE
                     IASYVSLYAAAARNAIAAGFDGVEMHGANGYLIDQFLKTSSNQRMDEYGGSIENRCRF
                     LFEVLDAVIQAIGRERVGLRISPLNSFNDQSDEDPQALTRYICSQLNLRTIAFLDVMR
                     GDFFSPARGADKWAREEYEGVLFTGMGFEIEEAAKAVESGAADAVVFGTKALANPDLV
                     ARAVAGAPLNKPDPATFYTNGEAGYNDYPFMERSPCLPASPSGAQEAPPQ"
     gene            <488548..>491034
                     /locus_tag="LDBPK_120740"
                     /db_xref="GeneID:13390111"
     mRNA            <488548..>491034
                     /locus_tag="LDBPK_120740"
                     /product="n-ethylmaleimide reductase-like protein"
                     /transcript_id="XM_003859145.1"
                     /db_xref="GeneID:13390111"
     CDS             488548..491034
                     /locus_tag="LDBPK_120740"
                     /codon_start=1
                     /product="n-ethylmaleimide reductase-like protein"
                     /protein_id="XP_003859193.1"
                     /db_xref="GeneID:13390111"
                     /db_xref="GOA:E9BB56"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:E9BB56"
                     /translation="MSSAGNHPVYTHLFRPCRVGRPTMKNRMIMSPLTRCRADDNHVP
                     TAIMTEYYGSRASMGMIITEAIMVQCNYSGFAYEPGLYSAEQVEAWRAITEAVHARGG
                     LIAAQIYHAGRATTPANLTSDGLVPIGPSAMGIPPEAQQCIAQWSRDGKAQAYPQRIH
                     AMTSAEIGAAVKFFTRAARNAMAAGFDAVEIHAGGGYLLDSFLRDAANLRTDEYGGSM
                     ENRSRFLLEVVDAVAAAIQPDRVGVRLTPLDTFNGAKDSHPEALTTYVCQQLDARGIA
                     FVDIVRGDSRANVPGNAEVWVRRSFSGAVLAGQGYTSTDMAEQAIADGTVDAVLFGEQ
                     AVSNPDLVWRVLTNAPFNRADKSTFFTRGSKGYIDYPVCEPHSFSDPRVVAGMKTRSG
                     GDSSRRLSCQCSTSMTMPAKERPYFAVSQPLLLGATTMKNRLVMGPMPRQRCDAQQCP
                     TAMMEAYYARRSSYGLIISEPCEVQPSYNTYVRGAAISTKAQVQAWRKITDAVHQEGG
                     LMYCQLHHGGRATLPCNITNGKEKRAVGPTTQGISADYRCPAAFAADGKDQPYPAEVV
                     RLSAEKLKWIVKLYVAAAKNAMVAGFDGVEIHAGGGYLIDQFLRKCSNTRDDDYGGSP
                     AGRCRLLDEIVDAVAAVIGRRRVGVRVSPTDLSKGMKDTDQDVVAETVATHMAERKIA
                     YITVASGSDGYYHGPVPACILKKVLQCFGGVVMCDDNTSLAEAEKRVVADAVQGVCIT
                     LGAIANPDIMNRAIHGVAPAEPDMHTLFTHNSDGYDSYPTYAEIRKEARAEQARQSAV
                     NRSHYSPPMLNRSTPVAMNNNKSLKAPFVH"
     gene            <496184..>499552
                     /locus_tag="LDBPK_120750"
                     /db_xref="GeneID:13390135"
     mRNA            <496184..>499552
                     /locus_tag="LDBPK_120750"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859146.1"
                     /db_xref="GeneID:13390135"
     CDS             496184..499552
                     /locus_tag="LDBPK_120750"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859194.1"
                     /db_xref="GeneID:13390135"
                     /db_xref="UniProtKB/TrEMBL:E9BB57"
                     /translation="MRRLLREVKLPFMDVHLIETYLFHLAWGTPAKESIGKESISDVP
                     ISGDWTSPEAGICREVKRPSPPTLPGVGLKSTTMARPVTVATISHAPSLEVAEVSKSE
                     CYYPFKTSTGGSERHRDGHTDNAAAVRRPLRWGARRIAEDDCFAAAQTDQHTKDLGSC
                     PSTTEAPDIIDKADAMSCALAEEGHPRPPPRPPRPQPSSRAAMVSRSAFTESCAQQQQ
                     QHMPAAFPLSLLGMMERVLRGYKAALAVALRAVMHREAVWTALQQFLNVVRLDWAPLA
                     AHVSQVGAPVAPRAHGQSNGAANGTLGSSGISGALPNLRSPRDGVGNSGDMAVGACRS
                     EALVSPHYTAHGMSSSSSTAESDCGNPKRSSTPEKQAALHTSSDRTGTVVDGETMRSS
                     SAPLLKRTVSPAESAVRHEDTSVRTASCEDDGQVAITGPPPEAIGSAQQDRHPRGQQR
                     PSLCLSAESLRQTSVQYARGASSEAAALNDSPVCKPQPPPPRIVPRLLRVPISTPSSS
                     AGAARDATSALVPSRARSVAAQCRRTLDRPDPLLSAGARGPVCNAAAHRTLALRHAFP
                     ALPGKQQACRAHRSATPADGTRRRSRSAPCVTEAELPSPCPQCDSSFFVTPRARIMAR
                     HDAEACDVPSRTRRLVLHPGDSVSPMTARVYRQLHASSASPAPRRQELHDTSLVTRPS
                     EGKSALRPHSGLVPSLGMRLHAVSRQVYADCLYHYLYYLQRTTLAVVEAVDELRRHHL
                     SHDAPFVVERRNYLLEVLMQTSTLACDAAVQWLMHESTFENEGDLKDGGDQHPVAGQP
                     SDSTSDAVYCSTLLPGAARQTCDHVSEARRWPPEMPCSNSSRQCGDAPAPEIEPEGER
                     GAQGTMHRAVARGQWPEQLLRAPLMSTHASLARYAATPRFLVRLDEAPTSSPGARQEA
                     ASRTTQPGDGGRGQNTAPTTITPVSASLSPWRLVLPADVLASYGGGTAAPEDERYQTR
                     IASAYAVRSSAASSAAALRRRLESGEHLLHLEVATQLAYLRRCMQCALQHEYMLYLRG
                     MSEVHRRFYADKRKMAMCRHGAAAQVCATDCDRMNAAVTRVGTPAKYGSVAATMAPDR
                     YGRVSLKDELLRTDWMRELRESWQLLMSGSSSVA"
     gene            <501511..>504354
                     /locus_tag="LDBPK_120760"
                     /db_xref="GeneID:13390429"
     mRNA            <501511..>504354
                     /locus_tag="LDBPK_120760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859147.1"
                     /db_xref="GeneID:13390429"
     CDS             501511..504354
                     /locus_tag="LDBPK_120760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859195.1"
                     /db_xref="GeneID:13390429"
                     /db_xref="GOA:E9BB58"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:E9BB58"
                     /translation="MAEVSAFVYGWVSGIAAVVIWILYGTATLPQLMRSVKSVCAYIP
                     VLSLLVEGMETQQTGVQGGDGASALPPFFRFDGAAVDHDLEGLRGSPMRVKPITASAT
                     CMMSWYGPDGTIGPPIECLLSLENNLVTVYQLLHFTDSGTGIMASGSTGRGSFHSKSK
                     DAHRDSKFFRTATGVTVVEHRKGKVCVLNTTVMEVRQFNASKKTATAAADQLKPSTAD
                     RGASGASVGEAASARVSSKASSLPGLLGFFSSGGFASSGAQVSERWEETLNESTASAK
                     GSMSQRSVAGSGAAVSGASEATAANLMAGSGGADSVFTGRVLIWRTVDGRPLFDSSTP
                     PPQSFSSRTGNSTFAVGCGHSMPFSNSHSHRAGGARTSGNARSTESVDGHSTNSSNDA
                     DDGDDFTVTDSDGGDAAVERRQQQAHHARSHHQRRCMMNDMATWSCVIIKFERSRECE
                     RWHTLLSGLKEAEAWHEYSKTLPNPDTINTFLSRFFFQNMRLAPFSDTLIELIRKQLR
                     SLPLKKFPRDLGGDLILDDLLIGTQIPWISDVSEPRVSANGEVGFDFNLFYKGGEEGL
                     SLFFRLALTYCGIRIPHVVFSVKLLELEATVHVSIGPPPSKTFWFGAHKPPIIRLEVH
                     QGCASGKGVLHRILTALPDLSGIMTNLVKLYLFSDMVLPYMDDFPLPSVVKSPKGSFA
                     DLRVRAFDWQRAAKISSAPHRGSFTSGASSNDGSPEGKAAERSTEQQATSGHGSPLTP
                     WRSSVCSTATTPSFASTGRALKGAVASDSRDSLPPVILDDRSASNRLNAGAGEKLPAS
                     ASGDSDGNTGSFTSSCDANASIGVGSPRTPALHSSRLGSQRARDSPTLPPGRAASDRG
                     SDPTWLPATHPGNRSGSCNASVSSIPMSTSAMDDGLFCDNSTCNSESDRVMSSASKKR
                     SATSAAMRNLKNLLKVKGKDMTRESVSRSKKKS"
     gene            <506339..>508441
                     /locus_tag="LDBPK_120770"
                     /db_xref="GeneID:13390430"
     mRNA            <506339..>508441
                     /locus_tag="LDBPK_120770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859148.1"
                     /db_xref="GeneID:13390430"
     CDS             506339..508441
                     /locus_tag="LDBPK_120770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859196.1"
                     /db_xref="GeneID:13390430"
                     /db_xref="GOA:E9BB59"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:E9BB59"
                     /translation="MGIFTLLSFFYGAVGGATSFLMFFFIIFRKTESVLSDTVRKKAL
                     KHAEFDAVAKEAAVVAPAKVETLCKMVRFDDGIVGDAIQCRMVFYGSTIDVYQVDKLR
                     TLPDHRHEVVSEHMLGRINRACIIATSQRISKYHRHRNQSTRYAAIKGKCTVLNHKDD
                     MPLFLEDPNAILKERLRCIKEHQAHEAMMERLCRRFRRDSSPMTDKEFAVEMKGTQDG
                     AYDERSDHFDTAARGLGYQHDLMGMNTAATSCRGASSLSALNLPCCSSGASAGRCSND
                     LSPGALEEAPLSKWTCVAIKFPTRRVQERWLNLLQSTPESAQWHDFITHLPQVDVFNL
                     LIARLFFENSRANTLHDLLEEKLKKKLARVSKSLPPKLRGNIFLDLLDVGGEIPLISN
                     VSDPVSSTCGDTEFDFDVLYRGGLALKIRFSVLYREIRVPDIIFSIKVLELAGRMRFV
                     VGPPPTRKFWLGGPQPPQLRLEFTQEVASHDGILNAVLRLLPDMSKIASNIVKVLLFE
                     DMVFPNMDDFPWPVFGEDSDDDDSATAYSDLAGAENAQNSRLASLGSARNTGDAGGDR
                     ERRGSSCNSTAGSAVSENRGVQNSATSEMPSAPPLRPIPHSTSAPSIGVPHPHSGSFG
                     TFDRDHDAGAPSLTRSPLLQPSLRADPASAISTLPHGLPPRPPRVASSGFLHGTVARV
                     PKSRAPRLLGSPAPSGPN"
     gene            <509437..>512070
                     /locus_tag="LDBPK_120780"
                     /db_xref="GeneID:13390136"
     mRNA            <509437..>512070
                     /locus_tag="LDBPK_120780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859149.1"
                     /db_xref="GeneID:13390136"
     CDS             509437..512070
                     /locus_tag="LDBPK_120780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859197.1"
                     /db_xref="GeneID:13390136"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9BB60"
                     /translation="MPPKLTSKNIFDVVFDELPVDAFIDTGPASLKEELMLEAAGMLS
                     STGEGTGGQRSAQRGGTNAANGSGGGGGSTSYRRHLLPSAFVAATAAIVRSSGRLAAA
                     ASEDSAAAAAPEAAAEQCEDPQDADVLDAEDLEDGTSSPLSAHARPPAYTSTPARTTE
                     VYSGNVFRTVDDDVDDRSADRFVARRRGIRDAHGRRDGGRDATDAERGLDMQMDAEDD
                     AVKEATKYAGCVAEIQATEQAGTKPQPAFSGQPIGSGSKPNLLDARPVASSAGSRIAP
                     GVSVAGSGTELSISGDAAVEGTVPATVTSVTAQSTEGIKTAPLVAAGASSAAVSGAAS
                     PHGEGQIGDQALPSYGQVRSEARGAGHAAVSGGQAVSVAGGPLLQRPFGVARAPQRGG
                     TLTAAEQLALMPPGLDRMYTGACVMYRHPKNFGFVSPDVGGPDVFFIIDSIALSFTKL
                     ALRAFYLRSGMPVPPSVAAAYRLGAANDSSTPAGGDGAPISSTTTAEANAATAADANS
                     TAPDQVSVPAPAFPGVAAGVTAARNGQATIAGAVLGELGVLGATPVSATRPGDAGDRV
                     SIPPTTAEELAWAETAASLLTSATARLLQCQVDQGIGGGLRVGDRMSFVVTRNHAARG
                     GNGRLLRAEFIRGVPAMQLAMPLEQSWFHPLFPGAVGQKTSAPYGAASRPPPPPPSSS
                     SAEGGGRDASSAGEPLGPFDSTSTVLTRYTGCVRTYDAEEQRGYIRCDESDGSGGGHT
                     PDVIFYAHSVLWDLTRCPPLKRQVKESMRLAYSVCGTERNGKYVATLITNPDGEPFCE
                     ENMTFAENVLPFFIADGGGPSRRRGRGEDGGGVSSGRGGMGMDVGAGASAEGVGSDRK
                     RVKAAEDDMLLLYAEDDYPFM"
     gene            <513775..>518601
                     /locus_tag="LDBPK_120790"
                     /db_xref="GeneID:13390431"
     mRNA            <513775..>518601
                     /locus_tag="LDBPK_120790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859150.1"
                     /db_xref="GeneID:13390431"
     CDS             513775..518601
                     /locus_tag="LDBPK_120790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859198.1"
                     /db_xref="GeneID:13390431"
                     /db_xref="GOA:E9BB61"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BB61"
                     /translation="MYFHGPNSGGAVDGPSLSCSPPTICTGAQSTAAAALHDIHGQQR
                     GPSPWSALSSYSTWINASFLRALHGAHAATLKAFGQSDGQRARNGDGVRESTLLPCAV
                     ARRLHAWYEALSTTRACAVVLPQDVDGPLVVHLTLLLIGWEVMQATSVYLRRRRAMRA
                     SAKAEAEATQACDENAADAQESRGLSTSRQSATAQVPSPPEMESVQTRQSLLPRNSTR
                     AVHRLCSYWALIEKAVLAAPRKRAGAPTNVAALGWFVSSALAGRNSAQGGRNRRGFYR
                     LPSDGAPHDAGTVLVLSDKSAFPVMTEPGGNSKRQPGATSSAASLVTAEKPAEVAEPW
                     RVMHFLWTDMVRYSVTYTELRQLLLGCSVAEIAKVFENAGDVDSYQGGLCAAYGARAL
                     QPIWRGRSSRNISHEAAASTARCVTSPPSNGVSPSCYADPRAAVACVALTWYLSLVRE
                     VYDAVIVHEDVQRCAGALEELEEHSKAVYQHGVQVGLAFFEEELHSVSYRGAADARSG
                     AGGGCASGQPHRHEHSMVLPEVESTADGHAVHAASSSSVSMAAGVHLSCHRAGNGNHL
                     RCGDATDSPLALSPPPRGRGERVLVGATHAPIRVASPLACWAELNAALAALLWRRRLM
                     KLLHVRSLFCYMYTGSVAKMVSSAVLAGLTCLSSRVATTGQVAREAISSNLDTYYRTH
                     GERSPPGSHSDSGSGPLHGGAVSTQQRIIALCLLECMRLTVNTVLTRTTHAYINMAAS
                     QRRNTVKAELYEALTHLPLAFFDTHSFDEVEQIVYYVNDIEGVEVHVHHYVCGLVMSL
                     FAMQHAVHQLPRRARLLVGATVAVSLTIKCIGQRIKQWVQVAQRTGGVLPPWLRGYES
                     GGVAPGTTELDAQVEENTESNARQGGVMLRGLDILAVLPQLRPYAADLSLMRWWTRHT
                     HACSAAAGATEASTFLQGVLVLPFQAYGHLLPAFGGALMTFADWVLPTLVASYGASMA
                     FCSVDALSLSNRLIEAMRGVGDTVDALLDGRRVAEVVLLNAYKANVLEKVLDGRRWEP
                     TTAEYARDFGFPGEAHKHDRSKDKYHDAGVGCAARATEVGSPRCDQRRHLLQSLRRAD
                     SHTVTPSPSLLMLRWMRVLKHNCCWCVTHAPPISILGRFLRLVRRGLATMGIVKKDRR
                     GNSRRQSRKPYRHHRRPNRPCHISCRRRRPSQQEDQQPFKSPRSLAPGSASEATDACL
                     SNHSSEDDNGRGADACASSSPLSDDSDVDREAAAAATVALLTSGSVHAVTVRNVQFCY
                     PTAPTVPVFSHPITCSFVLQGDRDASSPSPSSASQPQTARCGCSSRGRLVCLVGPSGH
                     GKSTLLSLLLGMYTHYGTPSRVLDNDNDASRGGGGGEAQQQGGAEAREGEEALFNPSC
                     PAVIPDIVLTLALPRSLAYSSEELGSAGLQDATPTPAASAMLEMVYEQLSVASIPRDI
                     LRGKLFSFVPQNPVIFSGATIAHNISLENYVSLEQEELLAEIAQCAAWAHCEYIQRFP
                     QGLLTYIADSGTGAWSSPLASAGTGGCGAGGGGVVRLSIGQAQRLMMARALFHGRRGG
                     TVLVMDEPTASLDKEVKLQILGEWRELLDSGIVRGAICATHDDDLIAVADQVVRLP"
     gene            <520719..>522020
                     /locus_tag="LDBPK_120800"
                     /db_xref="GeneID:13390432"
     mRNA            <520719..>522020
                     /locus_tag="LDBPK_120800"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859151.1"
                     /db_xref="GeneID:13390432"
     CDS             520719..522020
                     /locus_tag="LDBPK_120800"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859199.1"
                     /db_xref="GeneID:13390432"
                     /db_xref="UniProtKB/TrEMBL:E9BB62"
                     /translation="MEATADFNSCLGVLFAASLIFTGETEGVAKDTLCSVVAMLKSAQ
                     ESGDEKVFRAAVVNIVNRILLCTPLKPPARNAAKEAARKNAGKQQEHARQEPKLKDEC
                     LDFLTVEDGAPVLLEGVWKRWLRYFEDGYVRYVEKLMTEEHQALEAAAAAAEADDEDK
                     DEEAQYVDGVPATATQTISTVPLFTPWQDYWKSPTSAYAQFCYFLLAIFFVRTKDFSL
                     NYLARVTKLVQYFTYQLESKDGEPIAVRTDTDAEEESAQSEDEDDETAPPQQEGRQEK
                     RAHSLPMPEYDKAVTQRRFTMARRSGSRGLAPTVVSVKKAEKPRRHCHKCFLTDVLPG
                     ELRPSVEAVRQEEAEAAARDSEEHSHLPLVRRSDNLDLCDPSTTPQREREQLDACDAS
                     TESVQGVWDPAAAESLEGSEEQRSVSNAMALATPKEDAESL"
     gap             522588..522686
                     /estimated_length=99
     gap             523814..524199
                     /estimated_length=386
     gene            <525671..>526552
                     /locus_tag="LDBPK_120810"
                     /db_xref="GeneID:13390137"
     mRNA            <525671..>526552
                     /locus_tag="LDBPK_120810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859152.1"
                     /db_xref="GeneID:13390137"
     CDS             525671..526552
                     /locus_tag="LDBPK_120810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859200.1"
                     /db_xref="GeneID:13390137"
                     /db_xref="InterPro:IPR015414"
                     /db_xref="UniProtKB/TrEMBL:E9BB63"
                     /translation="MAITMHVGNQVERPARNALRVLVPLFTCLFFLLYITGTFSVFSR
                     VQEIVQAEETSLRSASGIAEFCKDLQKLAQQQYWQVLFFITSLYLTLQTFCVPGTVVL
                     NAAVGAVMGTLSGVPYCTMLGTMGSMCCFLFSRIVGTSLVEAVDARLMRGKGLTKIRS
                     QVSHHRADLFVYLLFLRLTPILPNWLVNLASPVLGVPLHTFAGATLLGIVPQTYLTVR
                     FGSLAHSGGPGEKKRIVTPWDTLLLAVTGVSILVGFRLKKKFAQSRKDGGSGGVAADR
                     FSGITASSGSVCAPPLV"
     gene            <527108..>529708
                     /locus_tag="LDBPK_120820"
                     /db_xref="GeneID:13390433"
     mRNA            <527108..>529708
                     /locus_tag="LDBPK_120820"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859153.1"
                     /db_xref="GeneID:13390433"
     CDS             527108..529708
                     /locus_tag="LDBPK_120820"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859201.1"
                     /db_xref="GeneID:13390433"
                     /db_xref="GOA:E9BB64"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9BB64"
                     /translation="MMDARRASSMDRSAVAGFDPVSHYSSCPPLPVIRQPQSTALSAC
                     DACTAPHAGLRQHESGVAALKPSRKAASPPYVITEKTPRPELLAIIMQLQADLTQRTD
                     SVNAIQRNFERLSAMRHAEQLELRRLRLLEKTRPESAPDGGDAATRQLESVLAEMRHR
                     AVEQQATFAQMEEELQAANRLCALHQGIARLIASHADGFRDVLQAEALAHSQLYKSAM
                     SERAGIGSRHEATQQQLLCKDVAQLVADHQAQIVPKLIRGGAAERCRMKNPAQVSTAT
                     LLELVRQGLRETAEAVHQYVAATHATDQERVLTEAEGQRDREELRRVLGELLRLRRRA
                     TEEAEATARTALLFGALQTSVTAHRAFDHVRLLTANADAAAAATRSSWEVTAALLTRR
                     ISDWRDAADVRLVDFCNTIEASMAEKARERDAQTQQTAQELLLDERKRLENLHASQVQ
                     TMQADWRRQRDAVQQSRAKQLEQVRRDLVAQVQVAEDRRAAAEKRTGAIEAALTQMTR
                     DHAAEVQAVEAHWRSAVLDAERHCEQRWRTMLEAYQEGQKASRGAVLQLMVDVLRTRG
                     HCVYEEQAERAALCRSHWRNQTQHLREEQAAVMQHGVATAVVLERMRYHTEDEAASRA
                     VLHASEAADWAALVRKEAAHNAQVHHAVSMAAAAARLEGLRAEMAGREARWEQRLDAL
                     ETDLRQAQQECLGAVHRASDAVVAAQEAQAALQATQRDFAAYRCGVGAAAQRIEVAES
                     ATESACCCSLCLELYCQPVACVPCGHIYCANCLLRHARNRSLPSVASAFACGAGASTG
                     ENGAVGARAQLEVTHWLRNMSTPHASLFCPECASTTVSTVVELPILGELTAKYDYKKR
                     SLAVLLAELR"
     gene            <531689..>535807
                     /locus_tag="LDBPK_120830"
                     /db_xref="GeneID:13390434"
     mRNA            <531689..>535807
                     /locus_tag="LDBPK_120830"
                     /product="puromycin-sensitive aminopeptidase-like protein"
                     /transcript_id="XM_003859154.1"
                     /db_xref="GeneID:13390434"
     CDS             531689..535807
                     /locus_tag="LDBPK_120830"
                     /codon_start=1
                     /product="puromycin-sensitive aminopeptidase-like protein"
                     /protein_id="XP_003859202.1"
                     /db_xref="GeneID:13390434"
                     /db_xref="GOA:E9BB65"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="UniProtKB/TrEMBL:E9BB65"
                     /translation="MVGMASSMSLSPVPEAVLQGLQTPEFRMPSLVLPQHYALEFQPD
                     AQQHSFVGSVYITMRVLEAPSLPLRHLVLHALDLRLEASSIRVFVPADPSSAFAAAAP
                     PAHPSHHLGDEASRQRPFSTEKGSYVACQGLDKIDISETVLLAFAAHLPSKFGDTFVL
                     IIDRFDGVIATPPEMEGLFHSNSTDAAVLSTHLEPTGARRLYPCFDEPAIQATFQLSV
                     IATAAQTVLSNTEVEADISVAALPYAAQKRQGTSEDTSNRRREAPESSTSASASLPQS
                     APSWHCVLFETTPRLHTCIVGFHVGRFTFLEQRSRRSGVLCRVVLPHTEASSGGCFVL
                     DLATKAVDFFTNFFRVQLPLKKLDVVGVETFCVLGMENWGMVNLLKDYLVVTETTPLE
                     RRQRVTRLIGHEICHQWFGDWVTIEWWNGLWLKEGMCRYLEYFFVNAVFPGWGLWNEF
                     LCNIMNSALLADADPRETHPVDCCNPAPRRIYDSFDAISYGKGACVLRMLFSIIGVEW
                     LKRATHLLMVRFAGRAINAKDLVDCIVDTTKERCSSEAQLQHVKALHACLSMVETVGH
                     PYLYIYERPGESYTITQYVPPSKQHGLLVEYLQQQRRKSNAPVIDLFSTPVGASFEWT
                     PESTLSRVTASFSIPLRTVEWSPSGCANASLIFLEEAEHQFACPTSASTLRTTRDDTP
                     LMQPVAAPDHAGVETGEMPGSAASTAPQQTSSSSLLFGAPGCTRYFNQGGSGFFQCDY
                     DAATWRRLFELVAFFSEEDRVIITLHFINFAKSQLGHQPGDTGDRCTLFFEWLLRLTG
                     TSGAMNSFLWELVTNALTTLVQLVQHCYCHSIVKEFVNTLYTPLQRRRVLSFLAQDKT
                     TSFQSSIHLSRQLVLRILQLLCLCDNSAVVKEAEETAKWSLRALLSPGDSHAHPSSSI
                     SSSTCGAAANEAGSGGVANRRMASVSAGLGLPSGSGAGAASPLSTKLPTAGNSGPLQS
                     AALISVAGALPARGEPAALMSRGANWYSCGSVPLPSSPVKLLSVSNASISGHAASSVT
                     RSVAPLSCTLAANHGGSSNVFAASYCNPAGGVAEPSSAKSTSWHSYPDQCAGDFDLED
                     ASHIQAGSIALSHLVTQGRLEYWVAAAAVAVELLRLDRDELRRVSGMPVPTPGMVNVS
                     QAHRRSILRLVLPAVFALDQESAFPLMTKVFHAAPFLESSSVMGLYRNSRFFFNLLSS
                     RRLVTDRRTLEFLLRYGAEVCGNGYIIAQLKLLAQGGPSAHSAARIRGVEQYKGVEFA
                     DSVQPTDSSSSTKLPANVSSPLSSSSSAAVSERSALRKQCPAVAAALDCMESNCVWMG
                     YCCSHYDQFLREQLHRRSWQAVHDESSAAVQLPTPLGNESCTHSESCGGVSI"
     gene            <537048..>538367
                     /locus_tag="LDBPK_120840"
                     /db_xref="GeneID:13390138"
     mRNA            <537048..>538367
                     /locus_tag="LDBPK_120840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859155.1"
                     /db_xref="GeneID:13390138"
     CDS             537048..538367
                     /locus_tag="LDBPK_120840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859203.1"
                     /db_xref="GeneID:13390138"
                     /db_xref="UniProtKB/TrEMBL:E9BB66"
                     /translation="MLHLTSEPQKKKGPAVPECSRFLLGLALLLTIISDGAMNSQFTA
                     LSTIITANSDPSALQQLATFAAMEDVAEEEHLDWGSTARLVQAQPTSPAKPRNAVPPD
                     PTTLGSVSAHAHSRTDSENMLSDGLSKSLTDISTNGVVGNSSAASSSSSRRRPHRRHH
                     RRSGTVSDVPSKDDATAALSASRPVHSYHMWTQFHVMEMAYSTGSNNFVHITERFLEY
                     QQMFPIVYCCDVNKVDCPYEAELLASPKVGLAASSRWSCENCGKRHNVVRESCLRCRA
                     PGMYSKLFIGQAVKEVGCTESLVRFFYATHPDIVIHRAECHHDTDADALQRGKGCASI
                     YVRREDAALLQQKLHRNAFFDVDSVTEQLLVYYVYAEQQQWLHSYAQQRNAGMRKRPL
                     FLPLSPLVVEESASSSAPARRVTGHGQGRRRQSIPDSTSLPSERAVH"
     gene            <541311..>542342
                     /locus_tag="LDBPK_120850"
                     /db_xref="GeneID:13390435"
     mRNA            <541311..>542342
                     /locus_tag="LDBPK_120850"
                     /product="arginine N-methyltransferase-like protein"
                     /transcript_id="XM_003859156.1"
                     /db_xref="GeneID:13390435"
     CDS             541311..542342
                     /locus_tag="LDBPK_120850"
                     /codon_start=1
                     /product="arginine N-methyltransferase-like protein"
                     /protein_id="XP_003859204.1"
                     /db_xref="GeneID:13390435"
                     /db_xref="GOA:E9BB67"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BB67"
                     /translation="MSSAKQCEEAAAEGTVVKTTANKDYYFDSYSHYGIHMEMLKDYH
                     RTTAYRDAIWRNAYMFKNKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARRI
                     VQDNGFSDVITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGTPD
                     VKILPNSANMYACGITDPQYIEQKFDIWKNVNGLDFSYFKRLSYIEPLIDTVDPEQII
                     TDIVPFFSFDINKVTEAELSFTRTFALEAKQGDFVHAISVHFDTPFHAGHDPVVLNTS
                     PMVPPTHWRQTVLYIFHPLIMKRGEKADFTIKCVPNPGNPRDLDISLRIDFDGELQAC
                     HYDQDFRLR"
     gene            <543832..>545751
                     /locus_tag="LDBPK_120860"
                     /db_xref="GeneID:13390436"
     mRNA            <543832..>545751
                     /locus_tag="LDBPK_120860"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859157.1"
                     /db_xref="GeneID:13390436"
     CDS             543832..545751
                     /locus_tag="LDBPK_120860"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859205.1"
                     /db_xref="GeneID:13390436"
                     /db_xref="UniProtKB/TrEMBL:E9BB68"
                     /translation="MRKPSLQQGTRKPSRSPAGPRGIPPVVRQAPLSSDLDTPPPPSR
                     RLRSRSSLLETTPSPPSLPLTSEICINVVAAQPCLRSKPVLQRRTALSVCKTSAVALV
                     APQTSRVLSRSEARRRREHVPKGHPGSHSADAMALRRPKVRSSGCVVSSSRPAVITTD
                     EPIASQSSLRISPDSSASEYAGVTIHHGPRRQLEAFDRSAVPTLVLSPVSEAVSASFS
                     PHTPLFAREEGAPPMPRVAAADGTPMSGRATVTALFTLPQTLNMTHSSTLSSLREAAP
                     TTVEAAPLVHLAPLLESRCTTSSGQQNEERTAGHPSASHHLTRPSAIDDSTTSFASLW
                     SPPMPPIAVNRQSTPSVPSITGTPGYPTMMDTAFPPPAGSHVTWLPATNARDLSECAP
                     TSYPESSPSELQPLNMPPLMEGDGSHHRHSCMAPASQGTESNNATPAQVKSCPLGTPP
                     LSHNPVAENPCSTPPTASAHDVSDVVHITHTPEQYRLRSVLPSSGHAVKASIPLQRVS
                     ASSALTHGASVRPTLMREGATCGEGARVTLSGSDVCTPSCHSAHRARTLCASPSRTPR
                     YVSNSSDRHRPLTPTMSAAGAGNSVASALTKLPAGTLSAELTRRAIKERRRRELYAWN
                     EHLRLQNESSVQDAV"
     gene            <546788..>547429
                     /locus_tag="LDBPK_120870"
                     /db_xref="GeneID:13390139"
     mRNA            <546788..>547429
                     /locus_tag="LDBPK_120870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859158.1"
                     /db_xref="GeneID:13390139"
     CDS             546788..547429
                     /locus_tag="LDBPK_120870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859206.1"
                     /db_xref="GeneID:13390139"
                     /db_xref="UniProtKB/TrEMBL:E9BB69"
                     /translation="MEGLPVKKEAHKELRQAVAPASVLLPDSAAYNADADRDADAIEI
                     ADVDIKDPFPAGADGREVLVGIPGVLRGGEEMPPCMSAPYMEALLNTDPRISFDALHI
                     GALRAIEEREEMNRPHEDYISWCIPPTEFVEHPANGRVPFFTVPLMHPVVRTRPPLDR
                     GDREVDELLSHPTREALTTAIGADMLEHLRFSRNTEVMRRRRSKRAAAVGGKG"
     gene            <547888..>549756
                     /locus_tag="LDBPK_120880"
                     /db_xref="GeneID:13390437"
     mRNA            <547888..>549756
                     /locus_tag="LDBPK_120880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859159.1"
                     /db_xref="GeneID:13390437"
     CDS             547888..549756
                     /locus_tag="LDBPK_120880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859207.1"
                     /db_xref="GeneID:13390437"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BB70"
                     /translation="MPAAPSGAFAQGETMEQLRLKGNACFADDPAEAAEYYTQAVQLY
                     EERHGKDAACTMDEFTKSAGNALTCLFKMGETEQCAALAMRVLASNPILAKANAFYGR
                     CALVDPSLDSVSTGFGTASAAALVHLCRAIYELPALEPSTRENIDEALTRLIGERVSV
                     TEAFARSPEAGVKLVRGQCGVGVEAIRTLPPLVEVVSLLTPFSVGAFEDFAGRGCCVE
                     CSKVIGLDIADAAAEEPNEDEGDEENDKDDGNAQAKKEKPSTCTTCNMVAYCSPACAD
                     AHREQHERFECARMRRLSDMMEGIEARKLDVPEQFFELAYHCITTLAGIKAKRPGHER
                     VLTLTAHVDEVIQSLHPIGPLMSDLFKGEEETATLYTIIGVLCCNALEVTDPSGLGVA
                     QALHAGNSIASFFNHSCTPNCAIDTVRHAIITTRTIHVGEELSIAYIPQLYWPTRLRR
                     ERLSEGYYFVCRCQRCQSSNKDPFERALGMELPTARRDATKHFHPIVQTACATVRSRM
                     VDDVSQKDADELSKLLSDLSTHLFPFHYLCHEVRNCLSFVYAVLGQTRECLCSCLDEL
                     LMWECILPGALPVKRMKIENALECVQGLGTKVSDCSAALLPHLSRLALVYDAEGPI"
     gene            <550818..>551129
                     /locus_tag="LDBPK_120890"
                     /db_xref="GeneID:13390438"
     mRNA            <550818..>551129
                     /locus_tag="LDBPK_120890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859160.1"
                     /db_xref="GeneID:13390438"
     CDS             550818..551129
                     /locus_tag="LDBPK_120890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859208.1"
                     /db_xref="GeneID:13390438"
                     /db_xref="InterPro:IPR013924"
                     /db_xref="UniProtKB/TrEMBL:E9BB71"
                     /translation="MKRDPGNGLRHATLRGRALLGEEVQLPEGYAVVMTTITTSKPSC
                     SPLPTPASLSTFTLQIAEVDELEMPDEVFREPCAPRYVVWDHDRAPSRAASISQWIML
                     A"
     gene            <551958..>554570
                     /locus_tag="LDBPK_120900"
                     /db_xref="GeneID:13390140"
     mRNA            <551958..>554570
                     /locus_tag="LDBPK_120900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859161.1"
                     /db_xref="GeneID:13390140"
     CDS             551958..554570
                     /locus_tag="LDBPK_120900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859209.1"
                     /db_xref="GeneID:13390140"
                     /db_xref="InterPro:IPR028091"
                     /db_xref="InterPro:IPR028097"
                     /db_xref="UniProtKB/TrEMBL:E9BB72"
                     /translation="MAASVDGAELQEALRSRAPYHLLPASLQQRMTPYDYQTKTIHHA
                     ILHGHAYYRLPEFVRAAVKEEAYYQEMVRYAAEQLQLYPYVHQKSIILYTKETPLSYY
                     TGIFAELLKQEQSYHRLPNFTAIDALNLLGIGRNQYLQLTKEVRSKLRWHVNRTYVNE
                     YLPSALLPSATVDPFWSIDTVDYTADVLKKRFQRLSPEDVVLYRMLVSKGTASVRPEM
                     LAALQTPQSVFAKDTIYTYELPKAALRQLYRNGLVLASFEVSPDAYVVVPPLGGNFVM
                     NRTSDDPQELLLYRVLSTVDDRTSLGLLAQLLMLDEEDVCGAVQLLLRLGLLQWKSPS
                     LPSRLDVATLDGVHPSWQEEVAARVIAFTRYQLQTSMGGLTEHGDAAAGCDIGPTASD
                     PHPSKRVALLYDATLTGFLMMTNLSHDPTFKRQAVMLFEVGKMPYEMVPAFLALLDRV
                     DWKEMERFGGEAKKYINSVMCMRRLLHALCEVVGPQGAVGVDLLKIESLNELEATTRY
                     SVLGRNYWAYVITSPVSAAPLIDVELSCVYGSTVSFMTSPWMLLFLYTKLQRGPPSLL
                     LPFGTLLHRWPPFLDELEEAPESETSAAAGSTVVVGYSVLLRQQTMTLDAEVTYTDLS
                     SSLLLLNEVTSTAPVFVQQVARIPLVLRKDGSVAADGAYQHLEVTVPFSASQTQLHRL
                     VESSIAAHHPSATAVTLVDRGDTMWSLLTDSVAALRLQNSLGYLTFTFTYEQLGTPDG
                     ASVAELFCQLRAAYVVDIGLGVPLTHVEACELLVDAIPRLLSEGCSERHNAAMRECVA
                     EFGAFLERYSTLTRAVHAKMTIQSTTTTGPVTQHHLRKIGGVGGAPYPATLLSFDGIS
                     LSVTDDADPLSEQW"
     gene            <555245..>558160
                     /locus_tag="LDBPK_120910"
                     /db_xref="GeneID:13390439"
     mRNA            <555245..>558160
                     /locus_tag="LDBPK_120910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859162.1"
                     /db_xref="GeneID:13390439"
     CDS             555245..558160
                     /locus_tag="LDBPK_120910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859210.1"
                     /db_xref="GeneID:13390439"
                     /db_xref="GOA:E9BB73"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:E9BB73"
                     /translation="MQAEEAGHASLRIEAYRVVSLGGPIPHKIESITTYRTLVFVGTS
                     DSKLLAYRVGACDGSAASLTLLQEITDSRRHAVRQLTVIGGRRLLVLVGDVITVYHIH
                     DDAASSGRGFQLRDVTTITGLKDTVAFHVKQHRGVVSMAVLQRKRVTFFEASHTNLDF
                     LLSATVVLPDGVKTLSWMGRSIVLGGRKEYLLCNPSTASTAALYPTPRSGAAPLVLPM
                     TPVPEVLVASDGAGLRALLYDGSEVPGDSRVLWATPPAEMRYEHPYVVSYHPSAPHQA
                     LQVRLPLLTTLEDATTYPRSCLYQTIDLPKVVKVAQCHWIDYDSAMPSKTAPPDVLSH
                     SPIVVADADHRLYFLARNSVTGQAEALAAAKLFAAADLLCRLCPHEVAPMTLRQIVIS
                     GALHKFIRHQDYVGCFHDLSSVESDPRVAIQLFPGFLRPDEATPSCPALPLAAPAAVV
                     AAALPALVEYLQSQRAALVLLSGCEPAESVQSQLKAVDRALVMSFCATEREEALLELL
                     RGENACDAADVAAILRERRQWVALTLLLEAHGQYEEAASQLRDLASTRDAETEALQAQ
                     SGALKELFQRHPFSAARLDAYAPQCTIREWLTSRSSAHLLSAADSTAMCTVATAMMTA
                     LSFFRRRPLAQFYSLFEKHSSWVLGTVPADIAVRIFFSEANAPHYTAALQVLQTYTEN
                     PSTTPRLMLVVEYLFQLFADARAHVTEPAVYERYWRGLGELLFASPVKTVTSVEERQR
                     LRDRLREFLLNSPHVNLEFAEAYFDAADIRSACLPERAAVHRRKGSHRAAIRMFLNES
                     ERLDDATAYARSVYADGSSDAYTALLEALLRPAAGTPRVTEALEVMNTCDGVDAAAVL
                     PMLPDEMPFAQVSSFLLHALRANTTAYRASAVYSAILKARTLQGQESRVHLSSRAVVL
                     EEGMVCPVCQRRLRPDTVLAVYPDNVVLHHGCACDEHVCSATLRDYRHDAYAALEDL"
     gene            <559068..>560930
                     /locus_tag="LDBPK_120920"
                     /db_xref="GeneID:13390440"
     mRNA            <559068..>560930
                     /locus_tag="LDBPK_120920"
                     /product="serine peptidase, putative"
                     /transcript_id="XM_003859163.1"
                     /db_xref="GeneID:13390440"
     CDS             559068..560930
                     /locus_tag="LDBPK_120920"
                     /codon_start=1
                     /product="serine peptidase, putative"
                     /protein_id="XP_003859211.1"
                     /db_xref="GeneID:13390440"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:E9BB74"
                     /translation="MVVMASRLDAFVKSIIFPRPKIATYDTSTHPNKLVHIPLVDPHR
                     HVENGAFTYGYLLANPKATHVLLYAHPNAVDIGMAYKELRYVSKEASISVLLFEYSGY
                     GLTHTPITEASIHQDTLSAYLFLRRYFGVPSNRVILCGRSLGASPAAFLAAFLPPQQR
                     PCLLILQCPFTALSECINEFSQNAVSIANFLGYNWFRTIDIITDVSCPVVLHHGTNDT
                     TVRIDHSYTLQRARDTAAKPCVTYLYREDGKGHNNLSSATLVRILRERVVTEALLPLL
                     LPHTKLFLANAPVYARLFCDDSGMGFATLSDAVASWLAKLSLHICAPPLDQLYVLLTA
                     SVCAFTMECARAWQIYCALIRKNLCGDAAHERCTKDVFLHRCLACWGSPLAVHVAVER
                     VQSTKEVRCFGFATCRDAMLDAPAMYPAKSPEALLTVLEIGVTPGLLSCMKRCLNTAP
                     DMLEEHAMPCFVQQDTVSAVQLECERSVAFLTEDDKQRLCALLKDMDAGFSDNLSSKA
                     YERLRRSPSTSPQMSAESFEELKEWLRPWTSTRGTDMHALAQEVPWDDYLLRSRSVAR
                     QHVLNESMSWEECCQAMEESDVVSKIYTLFQEMSAQYLRPTFHPHPTASVESRA"
     gap             561389..561478
                     /estimated_length=90
     gap             561872..563188
                     /estimated_length=1317
     gene            <565855..>567171
                     /locus_tag="LDBPK_120930"
                     /db_xref="GeneID:13390141"
     mRNA            <565855..>567171
                     /locus_tag="LDBPK_120930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859164.1"
                     /db_xref="GeneID:13390141"
     CDS             565855..567171
                     /locus_tag="LDBPK_120930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859212.1"
                     /db_xref="GeneID:13390141"
                     /db_xref="UniProtKB/TrEMBL:E9BB75"
                     /translation="MATPRHGELNSICSPSSSEKSPRDCRQSSERLIDLLTRPCEQGG
                     YGGRLNYTGFATLAASLGWNQEDMDDCWYDIVMGEPCAEAVDMKRVAECVCSYCLASP
                     LPILEHSTLAKSSPSEPATPPRLPHASRERSTTVLLSPPTPRSRRAKSVASIAPKTGD
                     KERTTAAAASLPPVSARSRRTVPSVFHRYAVETVSSEQKKASLSPQRGPHRPHSGRTT
                     TASSRQTSPVLAPSQTSGPPDGSVFSRLYEKGMEQHRKRIAVKPVDSDMAECTFQPHI
                     TPYTPKASDTATAQYNKPTESYFAKLTAPHTPPDAVGTSPETPRVTYHPAPGPSSDVP
                     PGYVEGVARLRSYIASRYAHATFEGTLRGSSSANVARLVEAPILRLPVTVGGVTDAVD
                     VRLASPDTRASLGRECSVGLGSPCCRRRSEARHVSFPSPSRMRFRS"
CONTIG      join(FR799599.2:1..569561)
//
DBGET integrated database retrieval system