GenomeNet

Database: RefSeq
Entry: NC_018242
LinkDB: NC_018242
Original site: NC_018242 
LOCUS       NC_018242             618357 bp    DNA     linear   CON 30-MAR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 15.
ACCESSION   NC_018242
VERSION     NC_018242.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 618357)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 618357)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799602.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..618357
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="15"
     gene            complement(<1160..>1462)
                     /locus_tag="LDBPK_150010"
                     /db_xref="GeneID:13392983"
     mRNA            complement(<1160..>1462)
                     /locus_tag="LDBPK_150010"
                     /product="histone H4"
                     /transcript_id="XM_003859478.1"
                     /db_xref="GeneID:13392983"
     CDS             complement(1160..1462)
                     /locus_tag="LDBPK_150010"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_003859526.1"
                     /db_xref="GeneID:13392983"
                     /db_xref="GOA:E9BC42"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BC42"
                     /translation="MAKGKRSADAKSSQKRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVNALRKQGHILYGYA"
     gene            complement(<1977..>3839)
                     /locus_tag="LDBPK_150020"
                     /db_xref="GeneID:13392985"
     mRNA            complement(<1977..>3839)
                     /locus_tag="LDBPK_150020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859479.1"
                     /db_xref="GeneID:13392985"
     CDS             complement(1977..3839)
                     /locus_tag="LDBPK_150020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859527.1"
                     /db_xref="GeneID:13392985"
                     /db_xref="UniProtKB/TrEMBL:E9BC43"
                     /translation="MPHLVRLVRSSQRALRQQYRSVEAAAVERLRWMRHELVRLCGSE
                     NDVLRFKRFLFSTLYLALILAVTTAAAAVWRPNAPHCHYVYSHIHPARRAALGKREPL
                     PQRDPGDHPDANADLQRSVNAYLSQHNGTDGVTYLPTRIHFIVASNQTDWSFCMVTAS
                     CALAGVRLSVLGADSTYSHVWRYEHYLDYLDREGLRDEDIVVTLDTDVAWTGSDVVPF
                     LQKFARYSPASEAALDLAAVRAWEDYGEEVGSAFMATLRTTPNQQPRPLVQLPPVIFN
                     ADDDCYYHQPVDGLFQCFTSDYITTHLIAAARNGASFFSPHDAARASREDWNYYKNIY
                     DGFFAQGHGHRLLNTSLEAANFLRTPGDRFFYDGAFSVGRNPAHYLNAGMHISRVWAL
                     REMAAGVLRFAKEQQPRVKREWFCDQSILGVLRYYSRMFEVNEGLLLQTGHRADGRLV
                     RDPFGLPVGLISVDQLTEFMFTSHLRRRQRLGQLTSYYTRHRDDVLFTVPDRDLIAGA
                     SGAFITPPLWGREVPPRCLDVTLLDGSVSTRCSAALRRHVLPSFLHFAAGSKRRYYLR
                     YREWFAWYFAVRRSFKALSTAMTVLDKLKLALWCNETVQHIPFFAVCPSPFHSP"
     gene            complement(<4682..>5959)
                     /locus_tag="LDBPK_150030"
                     /db_xref="GeneID:13392986"
     mRNA            complement(<4682..>5959)
                     /locus_tag="LDBPK_150030"
                     /product="ATP diphosphohydrolase"
                     /transcript_id="XM_003859480.1"
                     /db_xref="GeneID:13392986"
     CDS             complement(4682..5959)
                     /locus_tag="LDBPK_150030"
                     /codon_start=1
                     /product="ATP diphosphohydrolase"
                     /protein_id="XP_003859528.1"
                     /db_xref="GeneID:13392986"
                     /db_xref="GOA:E9BC44"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:E9BC44"
                     /translation="MRPYSSVRRMTQQSKRLRIAGTLVLSALVIFGFLVYYQSPLLSP
                     CDSAYANVYDVVIDAGSTGSRVHVFQYERGRTGLVLLRERFKRVEPGLSSFATDPDGA
                     KESLAGLLRFADKVVPQSYQKCTFVTLKATAGLRLLPESVQQVLLDAAQHTLNASPFQ
                     SRGASIISGAQEGVYGWLTVNYLLNRLDTDVATVATIDMGGASTQVVFETTPTSGEWL
                     PFNYAHQLRTPKRTITMYQHSYLGLGMNEAKKKLMMSFAEANGTSSFPCFPRGYAKRL
                     NDVELRNSDATDFDACAGLFHEHVITKTTCKFDACGARGVPQPLFPSRRHLIYAFSYF
                     YDRLYHFSKEGSPVYVSSYKEVGQEVCHRESARRTTAPEETACMELAYMYSFLTYGLG
                     LSDATALTVPNRIEGMAVSWSLGSSLSFLLKME"
     gene            complement(<6807..>7805)
                     /locus_tag="LDBPK_150040"
                     /db_xref="GeneID:13392987"
     mRNA            complement(<6807..>7805)
                     /locus_tag="LDBPK_150040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859481.1"
                     /db_xref="GeneID:13392987"
     CDS             complement(6807..7805)
                     /locus_tag="LDBPK_150040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859529.1"
                     /db_xref="GeneID:13392987"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:E9BC45"
                     /translation="MSTLRHSHESSPYVQKGEDLSGQKLTPTIKSYRNMEFLNSYSGR
                     MIRILCEFEEPKQRLQQHFIRTTVLFFGSARSMTQAQYDSTVQNIHSKLAAVTDDSTK
                     ASLQNELARLKKTQWMCKWVDVVEKLARMVAEFSQKEQDMIIRSFRYIPDYFRLTPED
                     GSESLDDLQKRFHDLVVTTGGGPGFMEAANHGAESVPGAVTMGMGISLPFENGLNPHV
                     TKGLAFEFHYFFTRKFWMMYSCRAIVVAPGGFGTLDEMFELLTLKQTKKIPSLPVVLL
                     GKEFWQMVVNWQALADYGVISQEEIDSLLFTDSAEEAVEHIKDFYHRLASDSPSAE"
     gene            complement(<10257..>11096)
                     /locus_tag="LDBPK_150050"
                     /db_xref="GeneID:13392988"
     mRNA            complement(<10257..>11096)
                     /locus_tag="LDBPK_150050"
                     /product="cytochrome-b5 reductase, putative"
                     /transcript_id="XM_003859482.1"
                     /db_xref="GeneID:13392988"
     CDS             complement(10257..11096)
                     /locus_tag="LDBPK_150050"
                     /codon_start=1
                     /product="cytochrome-b5 reductase, putative"
                     /protein_id="XP_003859530.1"
                     /db_xref="GeneID:13392988"
                     /db_xref="GOA:E9BC46"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:E9BC46"
                     /translation="MWSTTQQSEHLAAKCAKKPVNTFSPDSYKPFKLISSRYESHDTR
                     RFYFALDSPDDSFYMPVASCIIAKYTDADGKDVARPYTPISSNSTKGHFELVVKKYPK
                     GKMGNYLFSMQPGDELLVKGPFEKFAYKPNMWKHVGMIAGGTGISPMYQVIRAVLENP
                     KDKTNISLIYANNQRRDILLANELIEMQKVYNNFNMYLTLLEVPHRWLGGIGYVNSAM
                     VTTFMPKPGEKNTKILVCGPPPMMQAISGDKLFEPGKPPQQGQVSGLLKTLGYTEEQV
                     FKY"
     gene            complement(<17850..>20900)
                     /locus_tag="LDBPK_150060"
                     /db_xref="GeneID:13392894"
     mRNA            complement(<17850..>20900)
                     /locus_tag="LDBPK_150060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859483.1"
                     /db_xref="GeneID:13392894"
     CDS             complement(17850..20900)
                     /locus_tag="LDBPK_150060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859531.1"
                     /db_xref="GeneID:13392894"
                     /db_xref="GOA:E9BC47"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BC47"
                     /translation="MLMETQISRSLIERERRTESVFRPPKFVKCMPPHKKTLTATARP
                     WYPTGADVEKKPLTPPRLILAPPTALGQSPDVKPKSAPVLAPLTDLSMQSLQSSLFSP
                     LSTPVHTFFHNITEVATAARVYPVEMFMSVRKDASHTPHGVLRWCVQQYLEVPTLKVP
                     THLQLSMSEVLNSEDGISRGALGSGLKGKTRAKPVRQVHHKVMSVLSRITPQKFTELL
                     QELMQLPLRQTDESELHEVVKVFFDKAVQEPEYSELYARLFSELCEMKDGERELEAEL
                     RDRLFCNRINRELLHTCDEEFHRPIELTADEKVDRTTGKPYSEEEVDMKRTRLKNRLV
                     GNIKFLGELFKINLVTERVVENMFKLLVGDFDPSNPVEREDYIFEVFSTLIRTVGPIL
                     KERRPLVLARYLGVAKAVENSHPRPRIRFLMMDLSDLNRKQGWVSTERVMREADSCDD
                     LQRSSSMKHVDSVASTSFLQSSIMSPSEDNTMQRCDFVLPRPVSVAFRDNSGFGTSIT
                     ISPSTPSNSPTLSRAYVPPKPTALGPSHLRPSYNAPVQSSMPERRSPASAYIRPSINL
                     PASHSLSNAPPHSSLPRCRTSMAGATEVVNIQEVTQQLIQNFNDPREEATVLNGISAM
                     SLKNKVLCLTWWLRQVTTDTSRFEERQRITELLSSILTSCPSFQPSDLISAIIEWIRF
                     DIEKAEYHQCPRMFENMGHMIQRCYAADVSTLPNISEVQNLLHLGLFNVMLHDLTTSN
                     GTDQMVTLVKSAFSIGVSLLNTIADRKSEAATLRVALQCRFRLLPYFFSVSNLSETGI
                     PCTTPQCRTPTTPNTRNIPQMESISSVGHYDPLSQCMLFHKVTDDAEFVVLRRARVDA
                     SERTAAWKEALVSLALAETGNGSTVSQLVQMAKVIGALLACSTVSVNGTNLLSATEVD
                     ELVGEMLKRRSGPLFQAMAAMEVIMHHTLSVSGSNPRKSIRVRQLRLMYSRWCTLNIF
                     DTTVVMNLLQSLHAPENGASVYAVYHNALVDAELPWATVLTYLS"
     gap             21755..21853
                     /estimated_length=99
     gene            complement(<22231..>23637)
                     /locus_tag="LDBPK_150070"
                     /db_xref="GeneID:13392895"
     mRNA            complement(<22231..>23637)
                     /locus_tag="LDBPK_150070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859484.1"
                     /db_xref="GeneID:13392895"
     CDS             complement(22231..23637)
                     /locus_tag="LDBPK_150070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859532.1"
                     /db_xref="GeneID:13392895"
                     /db_xref="UniProtKB/TrEMBL:E9BC48"
                     /translation="MPLSSIAKAEAALQKTVHLSRGGLCAEFTAEDIRRISDGDVLRY
                     LSTHSSASAEGDRGIRTAPVERPCAPVTTATDIESHMAALQEEINTFITVVDNEGCSY
                     EIRVGASGHVQVPIADDDLEDRVSLREVEGEMELVPAGGVGLVASPDEGAARTERVTS
                     AAVSPLSSEATPTSSHPPSQRVRRPPLSKPVRSTRSTAHHSARAHQVTRFSKSPPPTR
                     PLESSRLSTAKPPAFAVRPQASLTDSEATRVEHLLDPSATAALMANPYALGAEKEQRL
                     RALEAEARRYAAARGAVMAEDALQRLKDAPTDVRAAALPEAKEAATDLGNAYMRHARE
                     HENMMHQLRSVNERLRALQRRAAAVALAPADEVPSSVAALRPSWAQTTEPPIEEEQVQ
                     RLLELAREEETRAKEAGLNCVLPPAPDEPFSGLRRHLGAICTRAANLLATYESAPLVL
                     RSPVAPGAEDADDSDPEA"
     gene            complement(<24921..>25886)
                     /locus_tag="LDBPK_150080"
                     /db_xref="GeneID:13392896"
     mRNA            complement(<24921..>25886)
                     /locus_tag="LDBPK_150080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859485.1"
                     /db_xref="GeneID:13392896"
     CDS             complement(24921..25886)
                     /locus_tag="LDBPK_150080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859533.1"
                     /db_xref="GeneID:13392896"
                     /db_xref="UniProtKB/TrEMBL:E9BC49"
                     /translation="MRRSSSCLYKIPKNMGVAPRFDTWNEKYEPWEHLKRMGRLAGTG
                     FYIPPEWYNHFRMFPPINHNFQQEKTLNPHNASEPTQDDTDHLSVERIALRDELARKS
                     RLLASEGMRYYNVFWIRKPLDRMERHYYELKRKGVAHSVAIKRVLQMFYDDLTVKKRV
                     AAIQAEEAKLSGKYISMREATVLMGVLTQLQKEQLTPHQVTLLAKEQREKAQAGEAFA
                     ATVERSTETVADAAKDAAEGDEVMSADSLAELLSTEADLDDSSPSISYKVTIHETEHD
                     SVKQLQELALDHTGKSDWYTGASPVLHVEEPMPTKRTPASKQTGS"
     gene            complement(<27697..>28968)
                     /locus_tag="LDBPK_150090"
                     /db_xref="GeneID:13392897"
     mRNA            complement(<27697..>28968)
                     /locus_tag="LDBPK_150090"
                     /product="heat shock protein HslVU, ATPase subunit HslU,
                     putative"
                     /transcript_id="XM_003859486.1"
                     /db_xref="GeneID:13392897"
     CDS             complement(27697..28968)
                     /locus_tag="LDBPK_150090"
                     /codon_start=1
                     /product="heat shock protein HslVU, ATPase subunit HslU,
                     putative"
                     /protein_id="XP_003859534.1"
                     /db_xref="GeneID:13392897"
                     /db_xref="GOA:E9BC50"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BC50"
                     /translation="MRPRELMKELDRYIVGQSEAKKAVSVALRNRWRRHQVPSDIREE
                     IAPKNILMIGPTGVGKTEIARRLAKLVDAPFVKVEATKFTEVGFHGRDVESIIEDLYK
                     ASLSQTKQNIRRQHEEEAKLKAEDRILKSLAGVSDGFREHLRSGALDDIEVMVELQEK
                     KEKPKTASGEGVFISLDIPSMMGGQRQQTVKKVMKIKDAFPAVLQEELDKMMDTEDVT
                     AEALRACEEDGIVVIDEIDKIVTAAGGYKGHQASAEGVQQDLLPLVEGTTVSTKFNVQ
                     VKTDKILFICSGAFHSVKPSDMLAELQGRLPIRVELQQLSKEDFHRIITEPRFNLIAQ
                     HKAMMATEGVDLIFEDDALWEIASIAAYINSTVQNIGARRLITITEKVVEEISFEGPE
                     RKSEKFVIDAAYVKKAVDKMVKKVDIKKFIL"
     gene            complement(<30559..>32253)
                     /locus_tag="LDBPK_150100"
                     /db_xref="GeneID:13392898"
     mRNA            complement(<30559..>32253)
                     /locus_tag="LDBPK_150100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859487.1"
                     /db_xref="GeneID:13392898"
     CDS             complement(30559..32253)
                     /locus_tag="LDBPK_150100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859535.1"
                     /db_xref="GeneID:13392898"
                     /db_xref="GOA:E9BC51"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:E9BC51"
                     /translation="MQSCAVIGCGPAGMAASTVLRQSGLLVTCFDLAPEPGGIWASNA
                     RDIFSSRGCVSPIYPSMRCVLPKELMAFSDVRFDYAVAQFPHHTAVRHYLHQYAAQKG
                     VRCLTRFNTKVESARFDSVDRMWKIISVNVVSGDVMEWSFDKVCVCTGQTQEVRFPAG
                     MQEALEGYVREGGEVHHAAHVKDFRSFHKKRVVVVGNGVSAYDYCVELKRMGAEVYQS
                     ITAPAPSSASSGPQTGFACSSLTAELWKDMVVAPWGRGGATKEVSDVRVAADAVTRIA
                     GLAARLPWLHNDAHAAKDVVRKWLRYRNTRLEVIPAVGLPLDNDGRGLRFAAAPSVRR
                     STADIVAEAKERVGHLDVSSAAPSAEVFVDKVDAVICATGYNRRYPFLHPNVRRVLEE
                     DQLLLTSSNSSSPFSTSSDAAGGPPAASRHGLYLGTLWCAEPSLALVGYQKDLLPPFL
                     LFEAQARFIAYAFTQRMPIPDGAEEMRAKEDALVKANPALADLYSGDGVGLHSAAYFN
                     VLQHELGVSSRDTYTSKVLQRHKWLLCSTLVRIYHKCRSMAPLKRKEQHLLFSNKI"
     gene            complement(<33381..>35774)
                     /locus_tag="LDBPK_150110"
                     /db_xref="GeneID:13392899"
     mRNA            complement(<33381..>35774)
                     /locus_tag="LDBPK_150110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859488.1"
                     /db_xref="GeneID:13392899"
     CDS             complement(33381..35774)
                     /locus_tag="LDBPK_150110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859536.1"
                     /db_xref="GeneID:13392899"
                     /db_xref="UniProtKB/TrEMBL:E9BC52"
                     /translation="MKAASTAAPAPQTKAAAEAKAAAATTAASSLSLSLLQYGASLYE
                     AHTHLPEAAAARLPLNRHADYLRHFGFSMERESRGATAPGTTAALDSTSPNHKMQVPL
                     DGRRGKRAETDTSYDPVEVAGWGLPETLRCEADQRCNAVGSLSDATEWSAIAKQLVDP
                     FMTVTWRQTATQCTIKKACCVYMWLCSHMTLQVSVPGAVENANEDNGGASTVGLPSAA
                     KAASLARNSNRPARKVKEVPATLEPAAPPDPLLVALQTRRAPAPVLADVYMHMLTSVG
                     VVCEVVVGQLKGAAPEEAFEWSWNMVTVDGRQYLVDVSAALSNGVLRSSASHSDVSSS
                     VAVHEAGKGQRAGNAAGRGKAAAPSQSSPPAGSGAVPCNESFQLLPVTPERLRREFFF
                     FTHPTYFLASHLPADPAKALVRTAMRVVQWGVRPRLTPAFYHYGLQLASHKTHSAFAA
                     SGSPSYVSFVNHHASTTELCCALYMGTLRTLPEDLSQTAPLGAEWVWHQREESTSTDT
                     FTLTVPQAGYYVLVIGARRIRADPYSAVFTVAGETAFTPVVSYEMRVGFTPSSSPVLP
                     RQYLSPSICRLITPLCSQILPGKHTFCVMPSCSNVLAVAVVKFVAVAATRTLLSLLTF
                     QPRNAAFEGDVDVRSGDGVEVWVLYGAPDRNGQELSQRTAAAAAPKAAATACASPTAA
                     AKFKATDKKKREASAEQQQQLSALESQLTHLTQALHKGEVFQRCVGGIEVRHFVSPAV
                     VGVIQPQPIVEQEQSITLRRLAGVTDALLCEAEEVVRRQPAPVGSYFGAAEAAAAKS"
     gene            complement(<36856..>37812)
                     /locus_tag="LDBPK_150120"
                     /db_xref="GeneID:13392900"
     mRNA            complement(<36856..>37812)
                     /locus_tag="LDBPK_150120"
                     /product="mitochondrial carrier protein, putative"
                     /transcript_id="XM_003859489.1"
                     /db_xref="GeneID:13392900"
     CDS             complement(36856..37812)
                     /locus_tag="LDBPK_150120"
                     /codon_start=1
                     /product="mitochondrial carrier protein, putative"
                     /protein_id="XP_003859537.1"
                     /db_xref="GeneID:13392900"
                     /db_xref="GOA:E9BC53"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BC53"
                     /translation="MTSTSRAERENLVSVFAGGFAGVCSTCVTNPLDTIRVRLSAGRS
                     ATGKSHKSLLITARELFNEGLFHAFSRGLGANIMASMPSNAIYLPTYRFLKGELADSR
                     VSEQVRPMICAFGAVTATNLTLSPLFVIRTRVQVDDKLTIHQVLSDVMRRDGMRGLYR
                     GTVTNIAGRFVEEGCFWTVYELLKRVTHEGSFGERGFWWSSAAMVSLTMIAKLVAVGI
                     AYPYNVVMNHLRTVNKVTGEHDYVRVMPTMRHIYAADGFLGFYKGLAPQMLRSVISKA
                     TQIYSFELVLFTYAQVYHRKPLPVPAVRIIDPAAESDGSAVE"
     gene            complement(<41249..>43201)
                     /locus_tag="LDBPK_150130"
                     /db_xref="GeneID:13392989"
     mRNA            complement(<41249..>43201)
                     /locus_tag="LDBPK_150130"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003859490.1"
                     /db_xref="GeneID:13392989"
     CDS             complement(41249..43201)
                     /locus_tag="LDBPK_150130"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003859538.1"
                     /db_xref="GeneID:13392989"
                     /db_xref="GOA:E9BC54"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BC54"
                     /translation="MWLELGLCKALIRAVSHLGYISPTPVQAEAIPAALRGADVCARA
                     VTGSGKTAAFLLPLAHLLLTRQPQKATTLNSRRRFIRAVVLLPTRELGVQCQDMLAQL
                     LQFTSGLTVALAIGGVAPAAQEAALDAVPDILVATPGRLVDYIHNYKNGAGLDLTGVE
                     VLVLDECDKMLTVTLQDQVLDILQHIPEETRQVLMFSATMTKEVDEFAKEHLFKPINV
                     DIGHIALQSKLRQQFVRIRTTPVTLTSTADDVDAAAVSTAEAAAKDGETPREKRLRQK
                     RSRAERASADDADDGRDDASAVESDQEHIAKVKTRYLVALCQNYLKDKTIIFCRYRTT
                     THRLALVFNALGLPAAEIQGNQLQEERFQAFEKFARSEVRYLITTDVASRGLDIQGVA
                     TVLNYDLPPTLTAYIHRVGRTARIGQTGTAVSLVHEVEDADIMRKILSVSGAINEHQV
                     ATVKRRDVPDALLAKATKDIDDIFPQVRAQLAAEQLEEKIAQAEKRYGTASDGFLNEV
                     TTKAKREWCLSREERKKRDEEARRLYEKEAEVTINHFQNELSNLEREETEILQRQRKV
                     RRVEREKKMHEASKIKARACELRAKSEKKIQAGVVKKLKQRRIRQAAKERRAEARAQK
                     GVAPYRHGDGKQRNKKSRHKKRMKKH"
     gap             46567..46665
                     /estimated_length=99
     gap             47839..47937
                     /estimated_length=99
     gene            complement(<53218..>53865)
                     /locus_tag="LDBPK_150140"
                     /db_xref="GeneID:13392901"
     mRNA            complement(<53218..>53865)
                     /locus_tag="LDBPK_150140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859491.1"
                     /db_xref="GeneID:13392901"
     CDS             complement(53218..53865)
                     /locus_tag="LDBPK_150140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859539.1"
                     /db_xref="GeneID:13392901"
                     /db_xref="GOA:E9BC55"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BC55"
                     /translation="MPKANKHAEVKPSKYKTSLCQFFCKGEECPYAGRCAFAHGEHEL
                     QTESKNVELLKATGLQRLDGLHAQKEVAVAESHTPSSNSVTGSATSESLAPSEPATPT
                     SPAVRPRRRTVMVSLPKHNTRSEMYQSPYSATPYEPCYSEYGRAEYRYPTQLAQQPVY
                     HMRSNESPHVSLCAPSNAHDNQYCDCRFSATCSQGQPSKYRHNPYGMAGRIAQCA"
     gene            complement(<58481..>59029)
                     /locus_tag="LDBPK_150150"
                     /db_xref="GeneID:13392902"
     mRNA            complement(<58481..>59029)
                     /locus_tag="LDBPK_150150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859492.1"
                     /db_xref="GeneID:13392902"
     CDS             complement(58481..59029)
                     /locus_tag="LDBPK_150150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859540.1"
                     /db_xref="GeneID:13392902"
                     /db_xref="UniProtKB/TrEMBL:E9BC56"
                     /translation="MAFATCHYIVEEDCEDFSDVPLKLHSFLEFLDAGLPSTDGSNTE
                     QHVSSNISEKSEGEWLESDIRHSLRGAPLKAAADRPRRCYCLDDAHCICGQFFLPPLL
                     TRNAAGALPPLTHGLATSGSEADAVDAAHTSSTATMSSFGEPMYISLCPNPVKVATPV
                     PVISLTTMSMASASTTTTGCRC"
     gene            complement(<61064..>63583)
                     /locus_tag="LDBPK_150160"
                     /db_xref="GeneID:13392903"
     mRNA            complement(<61064..>63583)
                     /locus_tag="LDBPK_150160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859493.1"
                     /db_xref="GeneID:13392903"
     CDS             complement(61064..63583)
                     /locus_tag="LDBPK_150160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859541.1"
                     /db_xref="GeneID:13392903"
                     /db_xref="GOA:E9BC57"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BC57"
                     /translation="MTKNRRHDIVKPSKYKTSMCTFFRSEEGCPFGEKCAFAHGEDEL
                     RPEPKDTAPLPEAATGEAVTAAAATLLTSESPHSEHFDTRAASGDGQHNDAPAQQLQH
                     EPSASTPAIAGAKWKTKKGSLDSSSASTGSAHGFPGGGPGGSGSGSGSAARGDAPTTR
                     GRALPNRRQQLPPPPLPGHGAMPSTTFGLTAPPPPLPQPTPPSFGLSGDFGGLAYAGM
                     PAVMPGMPYYIPAMGHHPFSAINNNQHALNAAPVMHGSTSYPTLQHAMQLPPPPPPPL
                     ATASSSSAPLSVTRRTNDVAAADALPSDDAKHRLRQPTRHVVSSNTMAHSTGRHPINA
                     SGTAPDDVATPQYLYNLMAAAGALLNSSPELASNSQPNPSVEQPAQPRLIVVPHPSGS
                     GVCMVPSTVMSYPHSDPQSFAAFGGVAAASSPRHSTASMPGSSDSGLRSPHPTPTTTA
                     SNSAAAAQFPPPDFVAATPAPVTVEQLPLSSTSHGQSGSGSRSSKVMGDSLWGPAEGT
                     MNPLTSSLASRSGANTSSTEEHGSSSGDYNAILSGLGIGGSSYTTIPLDRLMRQCSAS
                     SNEDDFVGGDFDWTGAVERWLQTAREDGMAPETAPANADDTPTTAAAAVATAEKTTAS
                     TPGATLAAAKNLETVAETYHLQSGRSVMAALNSNPVLVDMGIESTEANASLPAPGSSA
                     TEAKRRPIAAVCQVSRAAGGKPSQPQRRAPVTKNQFKSSCAAEADSGAVLLYCAEKNT
                     FVYIPSGGSGAAVAVTPGRRRGQAAAAAATTTGSVALPQSEEKWPATTVKAVPALGRS
                     QDSLNTPCCDGSLGIDVRFVPGRKKRSVLEEVTEEEAEYCI"
     gene            complement(<66347..>67561)
                     /locus_tag="LDBPK_150170"
                     /db_xref="GeneID:13392904"
     mRNA            complement(<66347..>67561)
                     /locus_tag="LDBPK_150170"
                     /product="protein phosphatase 2C, putative"
                     /transcript_id="XM_003859494.1"
                     /db_xref="GeneID:13392904"
     CDS             complement(66347..67561)
                     /locus_tag="LDBPK_150170"
                     /codon_start=1
                     /product="protein phosphatase 2C, putative"
                     /protein_id="XP_003859542.1"
                     /db_xref="GeneID:13392904"
                     /db_xref="GOA:E9BC58"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BC58"
                     /translation="MKMPVKRKNSSSNGNGSKHGNGNKGIVVKMKKQVEDDDFEKFLS
                     ELSKTTRHIGMERTERMVKEGRAREGQRKKHADLAKQRSTNELENALINRQKSMQLQQ
                     LLAELLTAQRPFGSKPMTDFHSETHTGNPNFDVAVGDMQGWRAQMEDAHLVNVKFLSG
                     GADSKEGYFGVFDGHSGVQSANLCSQIFSSTVEKYATPAGNHHHTIDFEKAFLDVDRQ
                     LKGALGEGGSGCTAVTVYVSPEEITCAWVGDSRAVLCRNGGAFALSHDHKPDVAAEKE
                     RIEAAGGFVQDNRVNGQLAMSRAMGDFVYKGDTKREVAQQLVVPVPGVITTKRSAGDS
                     YVAIACDGIFDVLSSEELIEFINDKKAKGLPNIDICKDVCNRCLAPSSPEGGPAVAEG
                     TDNMTIMIVDLK"
     gene            complement(<68973..>71210)
                     /locus_tag="LDBPK_150180"
                     /db_xref="GeneID:13392905"
     mRNA            complement(<68973..>71210)
                     /locus_tag="LDBPK_150180"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_003859495.1"
                     /db_xref="GeneID:13392905"
     CDS             complement(68973..71210)
                     /locus_tag="LDBPK_150180"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_003859543.1"
                     /db_xref="GeneID:13392905"
                     /db_xref="GOA:E9BC59"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BC59"
                     /translation="MADSSKVTLSRASPERLVHHHRARCAALEGETHAPYEVEAEPTQ
                     VDSSHRHYLHYGNAAHIGVHWHSSDAVHGGYSEPSAAGELTAESRETGAVNAAPAPTT
                     SSSTSSPNSASTAARTRLSSSHLSPRTAGEGQPASLTHNPPAVHADPAARPAAPMAST
                     GANGCGHPAVSASAEGRLNHVHATGEAGAPSSASSHSTGPPAPTAAPPKDASTTTAAK
                     NHPLASATTHARTGFSNGRLPSHPEPAASTAAGTTRPPSHPQLPLSHPTTSSTAAAAA
                     ATFSSGAVAKEGGTNGAGASTSDGADPYARPAIALSVHLLGLYKMVNARYCAQRRLES
                     PGPKYNSGYDDKDGHYLFLPGEVIFQRYIAQEVLGKGSFGTVIRGFDQKRSEAVAMKI
                     TRRGSSFRSQAKLELDILLRLNENPALNHLVVRLLKVFEWQGHLVLVFELLSFNLYQL
                     IKCTRFNGVSLDLVRKFAYQLTHTLLQLELQKPHPIIHCDLKPENILLRNQNRSGIRL
                     IDFGSACYTAKRFHRYIQSRFYRSPEVILFLDYGTPIDRWSLACVLVEMHTGVPLFDG
                     RTEAAQLAKIEATLGPIPAGMVAGSPKANRFYYGNATSGFQLKEPIPERRTLESVIGV
                     TTGGPRGRRLNTPGHDEKAYREFHDFISRFLRYQPEERMSCRDALQHPFLRPLYTSDL
                     QQQKDREVAQPISAPQPPQKQQHTQCSQNSKPQPQSPKNINATTTKMLTSTERSRASA
                     LPPAE"
     gene            complement(<74799..>76556)
                     /locus_tag="LDBPK_150190"
                     /db_xref="GeneID:13392990"
     mRNA            complement(<74799..>76556)
                     /locus_tag="LDBPK_150190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859496.1"
                     /db_xref="GeneID:13392990"
     CDS             complement(74799..76556)
                     /locus_tag="LDBPK_150190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859544.1"
                     /db_xref="GeneID:13392990"
                     /db_xref="UniProtKB/TrEMBL:E9BC60"
                     /translation="METLAHQDAAAVDAYVEASIPAASTAVVNSATVTPSTELDYAAQ
                     RQDVVKETLPSDAFCVSPPTMAQVPLPRLEDGVEAAAPSVGTPVPSLSATTTITAVAR
                     ESSHPHLHLLHIIQQQQERIAVLQASLAHAARSAQRSSEALESLQGKPRVPACTGRIR
                     AVGVASSPAGRASAPLASIAEVTSAVANTVRWADSVAATPMPTSPVSCGSFTEWKDDL
                     PQAECCSHTPSPPSIAPATFSPLPVVLLDITSMFTTRSTRAAAAHPEMQPSSLSTHRR
                     SSETQTDSVATEPTTPTDKYIGGSSGATRQLMDQLRGELAGAQRRLPTADTSVLWHRA
                     SMLALQQSCAPGASSREPADAVSSCNGGSGASRRFDSVPGVDGASCEGAATECIVHDD
                     KRKDMEELQRLRLLLRFSELKKDSDRLAEVEDALRESSSAQLRLRQRCDFLEHENSQR
                     GDCLRAIASCVETTLAASSSGTVGNRRDGSTATAAAPIEMSDKLVSLLRYVLHLCTDA
                     ALSPSAHKAPLPLPHPSPPKARQSSVHSRQDRLHKAVSDSRDGGRSLPLRPPSRMASW
                     HGSGAAAATALGERRASKH"
     gene            complement(<77705..>78196)
                     /locus_tag="LDBPK_150200"
                     /db_xref="GeneID:13392906"
     mRNA            complement(<77705..>78196)
                     /locus_tag="LDBPK_150200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859497.1"
                     /db_xref="GeneID:13392906"
     CDS             complement(77705..78196)
                     /locus_tag="LDBPK_150200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859545.1"
                     /db_xref="GeneID:13392906"
                     /db_xref="GOA:E9BC61"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BC61"
                     /translation="MSDATGSGAREVTRASIVLGVFLGFLVIIFVRLQFKSRQRLAEK
                     PRRDAFVPRAYTVEELAQFDGKQKPQVFVGVKGIIYNASLEWYGPEGPYSAFAGCDSS
                     RQLGKVIVGRDEINADWTTLAPDHLKTLHEWEERFRSKYPAVGWITDPNRNFVKRAAS
                     LSP"
     gene            complement(<79927..>81019)
                     /locus_tag="LDBPK_150210"
                     /db_xref="GeneID:13392991"
     mRNA            complement(join(<79927..80811,80816..>81019))
                     /locus_tag="LDBPK_150210"
                     /product="hypothetical protein, conserved"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003859498.1"
                     /db_xref="GeneID:13392991"
     CDS             complement(join(79927..80811,80816..81019))
                     /locus_tag="LDBPK_150210"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859546.1"
                     /db_xref="GeneID:13392991"
                     /db_xref="UniProtKB/TrEMBL:E9BC62"
                     /translation="MRLFPRRLCIAHLSLSLSFSLFLQTLPQRSFLSCRRLLFLFSCA
                     FVPLCSHQGSLCHATSPSRLFTWLLTMAAPPPEDERPTMLPFLPAQAAPPAVETPADT
                     AAVSTVDTNITSFDGDSPPSERRAMSFEEFRQFYVASRRLNYLSNQRNATEVSVSRED
                     GGVLAHDTVSADALAGEAAGQRVVAGTLRRRIVGTNEDGPTPAQTAAAAPATPPPAAQ
                     APPPPLGHLARVIRAVGGCLNWLANRVMRNRAHFLQLLLVFFVLYVQVKLSRTHMICL
                     LVLYITVKGAQEFVRNFQISHEAGTTGAPSLLGRLFKPEGHVGSVSKLRKIGYVVAKC
                     AEAFLLSLFPTYSLEHLERELCADGIVR"
     gene            complement(<81439..>81645)
                     /locus_tag="LDBPK_150220"
                     /db_xref="GeneID:13392907"
     mRNA            complement(<81439..>81645)
                     /locus_tag="LDBPK_150220"
                     /product="60S ribosomal protein L13a, putative"
                     /transcript_id="XM_003859499.1"
                     /db_xref="GeneID:13392907"
     CDS             complement(81439..81645)
                     /locus_tag="LDBPK_150220"
                     /codon_start=1
                     /product="60S ribosomal protein L13a, putative"
                     /protein_id="XP_003859547.1"
                     /db_xref="GeneID:13392907"
                     /db_xref="GOA:E9BC63"
                     /db_xref="UniProtKB/TrEMBL:E9BC63"
                     /translation="MCACAFVREKDCLLFSRSLSRTPKHLFPRSLRHRHTASLSPFSS
                     AVMVGVRRRRRVRFLRFLFRSLVI"
     gap             81685..81783
                     /estimated_length=99
     gap             82756..82884
                     /estimated_length=129
     gap             84828..84926
                     /estimated_length=99
     gene            complement(<86258..>87817)
                     /locus_tag="LDBPK_150230"
                     /db_xref="GeneID:13392908"
     mRNA            complement(<86258..>87817)
                     /locus_tag="LDBPK_150230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859500.1"
                     /db_xref="GeneID:13392908"
     CDS             complement(86258..87817)
                     /locus_tag="LDBPK_150230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859548.1"
                     /db_xref="GeneID:13392908"
                     /db_xref="UniProtKB/TrEMBL:E9BC64"
                     /translation="MATELQLVMEANSELLAHAKVANPRGCSIHVDKHIQKPVLIMKG
                     TPSQTRVQVPREDRPLSSLRLHNSLLAAQICLNSTDHFAVEIVVSQYTVKRTKLIIGT
                     NVAAARYDKTDDELTTAYLPLIIPRNKWVQVVFHVAGIVHTVFNLPCITCIDAITLTG
                     TGKISCVFTSSDEQSCIAATPEGMALFAVPAYVPPIWKTAAATPEHLSSLLNIDSRSD
                     IPFTSDVSFGTAAAPCAESPSSPASPLSTHSVILPRLKLLKETAVPPSYPHVSSSASE
                     QVGAALGKGSYSAPSQCDYIRLVDNEDIVAKDEHSTISCSYGDGHRQQASQDTVAGRS
                     CGAARGAANSTACGLSGWEQFPEERVGTLVVFSPARLVKVDAAKRPPRKPRVVPGPPG
                     SSDNERLQRIIASRKHRVMPRQGSLNSGGDDGRSNISRRQQRLRRRMRVLRANEQKAN
                     KTAAAKALVASELPLSQRVAAVEDSTEAAPICGYGFGYLGVLKPNGEYEEDDDANLNL
                     EGALTLLTDNE"
     gene            complement(<88412..>89536)
                     /locus_tag="LDBPK_150240"
                     /db_xref="GeneID:13392992"
     mRNA            complement(<88412..>89536)
                     /locus_tag="LDBPK_150240"
                     /product="protein phosphatase 1 catalitic subunit,
                     putative"
                     /transcript_id="XM_003859501.1"
                     /db_xref="GeneID:13392992"
     CDS             complement(88412..89536)
                     /locus_tag="LDBPK_150240"
                     /codon_start=1
                     /product="protein phosphatase 1 catalitic subunit,
                     putative"
                     /protein_id="XP_003859549.1"
                     /db_xref="GeneID:13392992"
                     /db_xref="GOA:E9BC65"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BC65"
                     /translation="MAHTKRGRFTVDLSMCTLSSLPTDTLSVEKENDVLYRLLELLPE
                     RYTSKVLEEQRIPEGLIVQILIKARAIIASEPMVVEVDSPVYACGDLHGQYYDLVNIF
                     KRCPPLGGTVFGTDAKKARKETSSSIDDKTYSFLFLGDYVDRGARSVEVVVTLLALKI
                     ISPRHMTMLRGNHEDEQIMLLYGFYDECKRRYGIKLFKMFTDFFRVLPVAALVNGSIF
                     CVHGGLSAELRFVRDIPDTRPCNVPHSGIICDLLWADPETDLPAGVDWAPSSRRISSV
                     FSERALERFLVENDIDLVCRAHQVVEEGFQFFPDHKKRHLLTIFSATNYCNEFGNRGG
                     ILRVDEKGVCSIITLEPPDFVQQRDIMLFRDPLPNPLSHD"
     gene            complement(<90402..>91049)
                     /locus_tag="LDBPK_150250"
                     /db_xref="GeneID:13392993"
     mRNA            complement(<90402..>91049)
                     /locus_tag="LDBPK_150250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859502.1"
                     /db_xref="GeneID:13392993"
     CDS             complement(90402..91049)
                     /locus_tag="LDBPK_150250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859550.1"
                     /db_xref="GeneID:13392993"
                     /db_xref="UniProtKB/TrEMBL:E9BC66"
                     /translation="MLEKAGLPFRKSLYSVFEEENGLTDVPMFFSIEVEGANALKAAT
                     HSTDLQVPVAPTVNSIEVSSIVFKASVAGTSLRRVCLFMQRLDSDGKAVGPPVPLAVT
                     DTAQFSVPVKLKLFTGDRVRLLLFQRGTGPAVSAVILSGCILSSADCYFAPGTPPASL
                     LSWTPEPFRSVREPGVSASRKRSRSQPRAEQNESVFDDEPPTLVYAPVSGGDDES"
     gene            <92099..>93142
                     /locus_tag="LDBPK_150260"
                     /db_xref="GeneID:13392994"
     mRNA            <92099..>93142
                     /locus_tag="LDBPK_150260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859503.1"
                     /db_xref="GeneID:13392994"
     CDS             92099..93142
                     /locus_tag="LDBPK_150260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859551.1"
                     /db_xref="GeneID:13392994"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BC67"
                     /translation="MSSASAYGLDGQARSLCSLYHPSLNSQECHRFLIGTANPSVENK
                     IHLIEYQDDTKSLECATVWSHNDPVMGLWCSPSLSADSLLAVSSLQKLEVFQISENVL
                     SEPKCIATMNKSYSCVLWDLDGLQREFRAVHQNTLITVLLSSSKLGSETVNYTSSGGA
                     IRCAALAPYDPNLCLISCDSDGLQLVDLRSKKASSFAATKYSHGFGYTTAVDFDRLKP
                     GQFLSAGTDGYVYIHDIRYNASCSLAMLRHMKAHEHAVQSCLFNSFRDELVLSCSSDE
                     TVKLWDVEQNNEPKCLRRLADYGDSVVALCWSGNSPWVFAGLSFNGKLLVDTVPNEKK
                     MSILLDEKKWCET"
     gene            <93727..>95487
                     /locus_tag="LDBPK_150270"
                     /db_xref="GeneID:13392995"
     mRNA            <93727..>95487
                     /locus_tag="LDBPK_150270"
                     /product="lysyl-tRNA synthetase, putative"
                     /transcript_id="XM_003859504.1"
                     /db_xref="GeneID:13392995"
     CDS             93727..95487
                     /locus_tag="LDBPK_150270"
                     /codon_start=1
                     /product="lysyl-tRNA synthetase, putative"
                     /protein_id="XP_003859552.1"
                     /db_xref="GeneID:13392995"
                     /db_xref="GOA:E9BC68"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:E9BC68"
                     /translation="MSSLEELRKQIEAIASQIADNKKTKGTDSDEYKSLVKQMGMLRS
                     QLPQDEKKAKKDKTVEPSYFESRLAMVKEMGLLGAAYPHKYHRQYTIPQYRRKYAPLL
                     TEPDTSLDETVTIAGRIINKRSSGSKLHFITIQGDMETVQVISALTDYIDQSKFAEIH
                     SKLKRGDIIGIAGRPSLSKSSEFSLKATEITLLSTCYHMLPDDYFGLSSFEQRFRQRY
                     LDFIVNRDNIKTFIQRANIIKYIRKFFDERDFVEVETPMLNQIAGGAAARPFVTHHND
                     LNQTMFLRIAPELYLKELVVGGMDRVYEIGKQFRNEGIDLTHNPEFTSCEAYWAYMDY
                     HDWMTATEDLLYGLAMELHGSPIVRYAPKDSEGKPLPEVTFNFNKPFKRLHIIPELEK
                     RLQVSFDNVDFESDAGIQFLMDLCEKHKADCPPPYTAPRLLDALIAEFLEPECHDPCF
                     ICDHPRVMSPLAKWHRNDPRLTERFELFVNKKELANAYTELNNPIVQREEFVKQLRNR
                     DKGDDESMEIDEGFVAALEHALPPTGGWGLGIDRLVMFLTSQSNIKEVLLFPAMKPEG
                     KNAISYPPGTMLNGQGVPLL"
     gene            <96560..>97777
                     /locus_tag="LDBPK_150280"
                     /db_xref="GeneID:13392996"
     mRNA            <96560..>97777
                     /locus_tag="LDBPK_150280"
                     /product="nonspecific lipid-transfer protein, putative"
                     /transcript_id="XM_003859505.1"
                     /db_xref="GeneID:13392996"
     CDS             96560..97777
                     /locus_tag="LDBPK_150280"
                     /codon_start=1
                     /product="nonspecific lipid-transfer protein, putative"
                     /protein_id="XP_003859553.1"
                     /db_xref="GeneID:13392996"
                     /db_xref="GOA:E9BC69"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:E9BC69"
                     /translation="MQRIRLVGVGRTAVGALKRDAIDLAREALELAFAEANIAAKDVG
                     ALIATPSLSSGHFMQAHYLATKFQLTAANPAMLLKTIDTGGASPISSIGAALDFFRGM
                     PRLNVAVVVSSDAVHTLPSSEFAKRSNESVPSPHLAEPYIPHGYDFYAQWQMKRYGLK
                     REQLAMVPVLMSAMSVRHPDAMCRKRYSLEEVLGARQIAPVTNLPECARRADGAVAIV
                     LAREEHYKQHLAAGPLDGRRPYVLGVGEASGPLYPPATHEEVTSETFSCHRAMRLAYE
                     ATGGLSTSDIDFFGLYDCFPICLIRALEAAGLCREGEGGQMVEEAYRRAAQRGGDVDP
                     SEFPINTHGGLMCFGAPWEVPAMYNVAEAVAQLGGQAGPRQVHPTPRRALVYGNGGVF
                     SASAVAILSTDAP"
     gene            <98830..>104667
                     /locus_tag="LDBPK_150290"
                     /db_xref="GeneID:13392997"
     mRNA            <98830..>104667
                     /locus_tag="LDBPK_150290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859506.1"
                     /db_xref="GeneID:13392997"
     CDS             98830..104667
                     /locus_tag="LDBPK_150290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859554.1"
                     /db_xref="GeneID:13392997"
                     /db_xref="UniProtKB/TrEMBL:E9BC70"
                     /translation="MRASTDGPAARTAADLDKMDDKLRRLGLDVDRPTTTPPFFALSA
                     AHGSADYIHSIRAAKAEKQQARLDRLARLAAAAEKQQSSSSVAVVVAAAASSRAGAVT
                     DTSRADHTAVGDKALLASDVADAALRASEKSKSDLAQQLRTERMLKVAVVHQQSLTEE
                     RDQLVSMLPSSNTVPHSLKVTAPEWRERKRQEAVVWCAAVARGLAELAMEVSDNRHLP
                     ATGLCGRPVYRLHQDLPVTQWRQWLEKLVFPMSLSTAAAEIKRRSDDGAAGTDSEVAD
                     SSVLRSADAQQSLLQQTLDASLQLEAAKCITSATEAEAQEAVRAQAEAVTCALAKLHA
                     EVARQRKAAEETVRLAADEANLPAPQAAEGDVGVTGTLHREELVPGWAQRMPPAACLV
                     YGDDLSGARLLAETIEVCVQRKSHQQQPPSQSPHRRLAASRQYSLGAGEGAETSAVDF
                     SSITLSSTAPTSAAAPVEELFSHFVVSEIGVESIDPSLVEGGAVATYVTPRTLLGNSA
                     LGASGGDAKRSGSAGRSQRAQQHSSGGGGNPGGGGGASQGVATTAGPGTSSNTASRFS
                     QRVNAVSAECRRESEQLIEAVVREVVRVHRHNLGVLAGDRMLSWVPKPTAPALAPAAG
                     SVATAEEISQPNAAALGSVPLRTLFLVGFSDSASFVEVLARRLRQATAAAEAELMEME
                     GRRRAAEQQAAVAAAAAESSKQRTSPPVKGAKGASPGPPRSKSNRLAKTVAGVEEQAV
                     SAMVEELQATMAMPPLGVLATFLVYDLPTRQRRLEAASFATDAAAAQRASGDDCEDDL
                     NNFSGVGGGALLRAAGPEYTHPVYNPSPEEIQSFGPPSAAKELAPARLIGVHPGSLSG
                     GSSSPSLLFPPSPPGAASTVTAASTLCVQTWSVERLRTELKQQHAQQQRQRKEWMAAV
                     VAHAHREGVEAVSGGLLNAGASFRHTIKRREKSTASVSANLASASPDSERAGSIPRRA
                     SMSMVSRAVDSSTMTAGNLLEEKGLPRALFFVRVQDVSDPTTPLASSADPQLDPTNLG
                     TTIWRAAATSQFHAVDLQHGCAEARARTVNELTAQLRLLCRPAAGRVLTNESLAPRQL
                     AEPFRLGDYRLTEATCVRLKKTSKAFLGTLPVAPAPQSFERSGTFPGKAVAAAARDAL
                     AAEAEVWATVLQHAEQLYHLVAEEVFMDGVAQSECPVALPAAATLSTTAWFTGIDQSY
                     ARAKEAIAACTTYTVAHLEDCLALLLRFSVDVCLGQLAASVRLLCCSIARHHRVETDV
                     SFDAVASALGSGSDKVDEEVLRVAPRLSAEAARALIDSLRFVNASEASAMLSAELAVA
                     YWPQVAAAAAEVAVQFFKRCSLQNLAGDAFSSAANTPQPPQQTQVVAKESECARDSNA
                     GAANDAVVPELEAKILAEEHVPAAVQLLLEQAINAPAPLARAALLLQESQRMVCAARD
                     GAEAWVELLYREVLGMHATAPASTVPTARRPCSLDELADGPLAVLRIYTDEATNLRRP
                     SPWRCGQLELLLSSVRPAKPNAMVPMEKFERGLLVHQLQRLWRFLPDISAELAAKAKY
                     SIRDREAKTPAPTTRPVRPATFSSATAGPLALPDPSLDAYLLTSCPCRPSAALRFPFL
                     TTADVERLSAAAAAGVTSTAAAGKPLVMVDLELWLANLALRRCCFCATCDAPTAGAGG
                     GEPELAVMQTSQCMRACAAKPSSGAVRQTIATLPACVLAQYATFCTTAMPPLPSLVTT
                     PPPSLGEMPAEWMLVQWWWREWCGEDAWSQSEDVQRCYALWRILLGHVPPSRPSSPNY
                     AAPTLLTMAPLLSSLLRLLVGIGRHAGATEERVRRAFHCLAALRRVPAGALDTRTAKA
                     EENADADAAMTIEDDMTLTVDECAALGRLLSPTALTVGSNVPVTTTPATAAEAAVPVT
                     SESEVRGHEFITDVQLLLQVEGTKGVTLPLLLSSRWASLMMREHF"
     gene            <106273..>107706
                     /locus_tag="LDBPK_150300"
                     /db_xref="GeneID:13392909"
     mRNA            <106273..>107706
                     /locus_tag="LDBPK_150300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859507.1"
                     /db_xref="GeneID:13392909"
     CDS             106273..107706
                     /locus_tag="LDBPK_150300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859555.1"
                     /db_xref="GeneID:13392909"
                     /db_xref="UniProtKB/TrEMBL:E9BC71"
                     /translation="METYKDVIVSHPPAMYSQSGHTTHFALENYKGILLCQRPSNLGS
                     AAGFGGAGGADGYDRGNASSAPFVPSKPTGNPLGYGPSKESRDARAEQEALRVANQRQ
                     RQTKSSQALSRHRRWLRSFARQVQSMKESDRQLEVEAAQRAARVREAEKRRRAEQQQE
                     LAAIAVSTDNASAPPYNMHKSMEAHVATTLKGTAAPVAPSSRKPKWALTEEEAMDAEL
                     DFDRDLLDFAENLDYEKFISDFEVAEALGVMRDRVEEIARANNWSVDDIRRATTDDDD
                     DLNSVVSPSEAHLILCSKQRQQQGGGAAAAEARAALPEALAVHAHDWDSSSSGRGRLL
                     KKAISRDALALAERLFAASPSLQKVHTRHSLARALQRCALEGRVDVTESTLLRHASKP
                     SAAKGGGGANSDAASSSPAAVDPPAIPEPLVVKIGADAMPAPCSSADGFTGGSAAGIQ
                     PSRILRELQQSKERTQGLPYLYRCPAI"
     gene            <109439..>110212
                     /locus_tag="LDBPK_150310"
                     /db_xref="GeneID:13392910"
     mRNA            <109439..>110212
                     /locus_tag="LDBPK_150310"
                     /product="replication Factor A 28 kDa subunit, putative"
                     /transcript_id="XM_003859508.1"
                     /db_xref="GeneID:13392910"
     CDS             109439..110212
                     /locus_tag="LDBPK_150310"
                     /codon_start=1
                     /product="replication Factor A 28 kDa subunit, putative"
                     /protein_id="XP_003859556.1"
                     /db_xref="GeneID:13392910"
                     /db_xref="GOA:E9BC72"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014646"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:E9BC72"
                     /translation="MLASTPGSNFGGAVASSNNSGGQQPQRRMHPIRPLTIKQMLEAQ
                     SVGGGVLVVDGREVTQATVVGRVLGYENANMASGGGAITAKHFGYRITDNTGMLVVRQ
                     WIDADRMQEPLPLNTHVRASGTVNVWQQNPIVTGTVVSMADSNEMNYHMLDAILTHFR
                     LTQGNKRAPSSGVSIQNTASAVGMHNMLPGGDIKVLLTDLLVSFIKQHGSSGAGMSMD
                     ELTTSAQRYGFTHGDVRTAMRTLAAEGKVYQTHDNRFNI"
     gap             110571..110843
                     /estimated_length=273
     gene            <111983..>112241
                     /locus_tag="LDBPK_150320"
                     /db_xref="GeneID:13392911"
     mRNA            <111983..>112241
                     /locus_tag="LDBPK_150320"
                     /product="ribonucleoprotein p18, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_003859509.1"
                     /db_xref="GeneID:13392911"
     CDS             111983..>112241
                     /locus_tag="LDBPK_150320"
                     /codon_start=1
                     /product="ribonucleoprotein p18, mitochondrial precursor,
                     putative"
                     /protein_id="XP_003859557.1"
                     /db_xref="GeneID:13392911"
                     /db_xref="GOA:E9BC73"
                     /db_xref="UniProtKB/TrEMBL:E9BC73"
                     /translation="MRRLSSQLMCTAAAARFASAGGAKKYDLFGYEVDTNTALWIDKV
                     KKCRYYDEAGEVLVNMNVKNCPPDLETYNATLQKIYEAPSKQ"
     gap             112246..112287
                     /estimated_length=42
     gap             114100..114198
                     /estimated_length=99
     gene            <114509..>115072
                     /locus_tag="LDBPK_150330"
                     /db_xref="GeneID:13392912"
     mRNA            <114509..>115072
                     /locus_tag="LDBPK_150330"
                     /product="ribonucleoprotein p18, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_003859510.1"
                     /db_xref="GeneID:13392912"
     CDS             114509..115072
                     /locus_tag="LDBPK_150330"
                     /codon_start=1
                     /product="ribonucleoprotein p18, mitochondrial precursor,
                     putative"
                     /protein_id="XP_003859558.1"
                     /db_xref="GeneID:13392912"
                     /db_xref="GOA:E9BC74"
                     /db_xref="UniProtKB/TrEMBL:E9BC74"
                     /translation="MRRLSSQLMCTAAAARFASAGGAKKYDLFGYEVDTNTALWIDKV
                     KKCRYYDEAGEVLVNMNVKNCPPDLETYNATLQKIYEAPSKQDKPVENESKFCAMMDL
                     MEEMQHRNKVKPNEESWTWVLKECVQSGQFRLGYCVAKLMEAEFKRVPAELVQQNEAN
                     ASKAKADGKEHPSTLAQQQSLFDIKIQ"
     gap             115185..115283
                     /estimated_length=99
     gene            <117485..>119887
                     /locus_tag="LDBPK_150340"
                     /db_xref="GeneID:13392913"
     mRNA            <117485..>119887
                     /locus_tag="LDBPK_150340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859511.1"
                     /db_xref="GeneID:13392913"
     CDS             117485..119887
                     /locus_tag="LDBPK_150340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859559.1"
                     /db_xref="GeneID:13392913"
                     /db_xref="UniProtKB/TrEMBL:E9BC75"
                     /translation="MPPRAATRTVRLRQSPRAVAHTERLKLLTYPMALAQRGATVPLI
                     HSPTMNAGHVSGPATRLLADTLSCFNRGGGGGGARRPPAARAYNECVEGSSGVAASSE
                     EDGDATGAQTLPAPRRWVRDADELCVASIRRSNNINRINSYIATYKLGDPQWRPLLLP
                     EVHVLPKARTASTDTPKTAGAQEQQATGHSCRLSSSAASSTVDGYDVFIDYNKLTTLE
                     LMSRHANYALRHLVQKGHAMYLVTFAQHSVVQMRGLVEASYISCAYGIRGERLRTHII
                     HTGPVDVREVLEIDPVTLRVSFDLQKQHVRRGVVAVSTVEGYGTWFQRKPMLWQRTRR
                     IGALQSQMGSYDYQLCDSAEVGRLRPYEVSLLAPHVRLIGVQGGADAVALIASSQVAQ
                     NERLYMGQFEAPVLTAVDAVHQLIHRTALHHQLLRPALTEEASGDAAVPATAALEDPQ
                     LQELRRLAGMERFLPVSWVTRTPPPYVPLESDLPFRIQLSRPAVIRTDARSTQTGGTA
                     DSNAAIVFPTGGSVGSPFVRGVPLSLFEYNIHQGVDHYIFDDAPSARPLKWWNQKSNM
                     PYSGYVYGMRSGLLDRVEPAEKISNPLAPPAVAAASATPAKSGRRRKRRAARARRHTF
                     SAGSTAGAASEVSLSAIEEVADVVERAAPSSSPSSSPHVGDAEDDRPLNLAAEELAAG
                     EEELTGYEDDSRREAALAWAEDGMDISVEDRPPLHTLVAPTTAARRRLRRYAKASPLP
                     SSAGAASSSSGALETRANMLLQRQMRLRLMRRRRNAQGASPLPPKDGARPPDATSDEK
                     AL"
     gene            <120453..>120893
                     /locus_tag="LDBPK_150350"
                     /db_xref="GeneID:13392914"
     mRNA            <120453..>120893
                     /locus_tag="LDBPK_150350"
                     /product="ecotin, putative"
                     /transcript_id="XM_003859512.1"
                     /db_xref="GeneID:13392914"
     CDS             120453..120893
                     /locus_tag="LDBPK_150350"
                     /codon_start=1
                     /product="ecotin, putative"
                     /protein_id="XP_003859560.1"
                     /db_xref="GeneID:13392914"
                     /db_xref="InterPro:IPR023189"
                     /db_xref="UniProtKB/TrEMBL:E9BC76"
                     /translation="MSYCKIEAPYPTAEAGEKRIIFALDPKGDEAEQEQYMLQLIPGR
                     VLEMSRNDAANHQTLGGSIEQHTVEGWGAKFFHVKLAKQAASTLMHVHDEDHSEKVRK
                     FVAMPNAPLFPYRSRCPVVVYLPNDAELRYGIWCGGQQMQAVTE"
     gene            <122712..>124667
                     /locus_tag="LDBPK_150360"
                     /db_xref="GeneID:13392915"
     mRNA            <122712..>124667
                     /locus_tag="LDBPK_150360"
                     /product="ecotin, putative"
                     /transcript_id="XM_003859513.1"
                     /db_xref="GeneID:13392915"
     CDS             122712..124667
                     /locus_tag="LDBPK_150360"
                     /codon_start=1
                     /product="ecotin, putative"
                     /protein_id="XP_003859561.1"
                     /db_xref="GeneID:13392915"
                     /db_xref="UniProtKB/TrEMBL:E9BC77"
                     /translation="MSTRRGTTAAAHAPVQPSLRALDEHVQMLRAEARTGLGSRDVRR
                     ALIKEELRPPRVVCGGGGARGPKAPSLTTGSAASGSVTASAGADGGIADIPSAWLEGD
                     FHLKSAVADGGGAAAAFRPACVRFAGEETATMSTGAAPLPPDSSNALRTYQALCAAAD
                     EVDYDVSYEEALRQVEDRDSQTGLATTWRTRRRPSAPLPFSSMAVTASALSWDARGER
                     STCAGGVEAAGNLRSAASHELYTKPPSRPSAAGRGTAGRLFAALSASRPALQASVISA
                     ATSSAITTTRRMKAQVSRSCGGGGGGGAFSSLSTEGTAVARSSAATYAMALRQRVQEQ
                     REYASRVGGGPPRSSSTPAVWRGREDNEGSGRAAALEWRTRMTAAVTVAVCPSCAAWF
                     ERALQQPQRPLPSEEARQQTAGESDYAPRCCCPRCGHDVDTAAGADTPAGAGPRWVWA
                     PSAATGLSEAIKRDLDGTPARVIDSAVARCPQQPSSPASAARHRITNGAGSETCGTDS
                     VGFAESGNGGEEESFAALVARIRASKRRAQEDAEGGNATATSVSEARARQAPLSSASI
                     APLHPSTELAPATAPKGVGISRVCIETGMSGETMSFPPAAPLSGPPSLSELTLPARVN
                     PFAQRLRVALNRLYFYDLWASAIGEQT"
     gene            <126110..>128386
                     /locus_tag="LDBPK_150370"
                     /db_xref="GeneID:13392998"
     mRNA            <126110..>128386
                     /locus_tag="LDBPK_150370"
                     /product="ecotin, putative"
                     /transcript_id="XM_003859514.1"
                     /db_xref="GeneID:13392998"
     CDS             126110..128386
                     /locus_tag="LDBPK_150370"
                     /codon_start=1
                     /product="ecotin, putative"
                     /protein_id="XP_003859562.1"
                     /db_xref="GeneID:13392998"
                     /db_xref="GOA:E9BC78"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BC78"
                     /translation="MAASAHSPSLVDLHLLLTPFFSFLVSSLSFCRMVGGTFEYVFQQ
                     VLWLIGTTAQLIAAMGIGIKWMFMTARCVTFAAMDLVYFMPNVFWYLLSPNIIRRVSY
                     RSSRTTKLRNLEALLSKQVKQESLTTAVRTGAFPWNPVNNYDASLSASGLGGVRPGVS
                     PSPLRPRGPEEVDRETVERWASSINPADGTFVNGLPVHIGDEAHSCAASRHNAALTFN
                     NSFDDTLEALQRMYRHRSQQQQQARIVSMASLVEPSQTQVPVALTPAVSNESFTDSDA
                     EDDVEDRMNLHNRATLDIYLPVPLDSLFRFMHQERKSDETAHVQAGGKHQCSHKPGSA
                     APEHQQHQSHKRRGKLTRKRFPILISVTGGAWIVGFYLWNFLVARLFAARGYVVFCPD
                     YRNFPQTTMEGMTLDVSDAIAWVLNNAERYNGDLNNVTLIGQSAGAHLTMMSLLSQAQ
                     LSAYRHNAEKGIHEGVPPPSDVAYNVPRYNPRESIHRYVGLSGIFNVAGLVKHFNRRG
                     LYRDVLYQIAGGKPHMARYTLNAYFDDRRGGDTGEVLPDNIFDFFPQRMFFVHGDADK
                     SAPVTESANIVYVMRNAQRDAIVKVIQENPEAAKTLPKPVTIEYILVPGATHTDSIIE
                     EPLCGNSHIVEFLCYYDIDDDERRHAQLSGRTLAGAISKDGGAVVTDAVHSRTSSLAV
                     SSAAGGAADGSASGPKLTDLDAISQGLSPVLGGISPDARYTFPVLPATRPDGILISPC
                     PPSSRSKLMRLASYICPF"
     gap             128763..129070
                     /estimated_length=308
     gene            <132436..>135495
                     /locus_tag="LDBPK_150380"
                     /db_xref="GeneID:13392999"
     mRNA            <132436..>135495
                     /locus_tag="LDBPK_150380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859515.1"
                     /db_xref="GeneID:13392999"
     CDS             132436..135495
                     /locus_tag="LDBPK_150380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859563.1"
                     /db_xref="GeneID:13392999"
                     /db_xref="GOA:E9BC79"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BC79"
                     /translation="MLPYAIRQIVWMLTSALQLIYALSTGVVWVMQMLRFFVYGACVG
                     VCFIPHWWWYLTSPNIIRRVSYRSSEKTKRRNILRVLEAEGVDLREVLCKDSIAQATQ
                     PSQQMQLPPSPATAAAAARRRRRLATVAGAGQQDGAARDCSDSLPHTVDGEVDDRSLS
                     QLHNPSPFSTLRCWEASGSGYDQRTPLGLSSEPLGRDSDSYYEASFVSSSSQRRRRRP
                     TPSRSVLTRPCHGGTEASTSGPPGATALERLMGAVTCNLNPADGSAMRSLPLRRRQQS
                     QPQRPIIEDAAAHRSREPEEGIERRQDAHNGPSVTATARAKAHSSSSSGGTETQPRKP
                     RRDATGDEAAVCRAAPEDSTEEQMNGCRLRGSPQRVHGYEGRPVHYKTLPKVNPSSDP
                     MLRDVLAAFHEAEASDVTVGLSQAGHPSGPHSRRQPGGAAARRPRRRSGAPPPQRRGK
                     AAHEPRAQPQHKPRARTFSEENLFAELDEEDEEDRMNLHNRATVDIVLPAPLDAIMKT
                     LEYTQQSKRLRRKRFPIVIDVSGVAWIIGSHLWSTMIARVLAQRGYVVFCPDYRNFPQ
                     TTMEGMTLDVSDAIAWVLNNAERYNGDLNNVTLIGQSAGAHLTMMSLLSQAQLSAYRH
                     NAEKGIHEGVPPPSDVAYNVPRYNPRESIHRYVGLSGMYNIEGLVDHFQAAGLTTPVL
                     YQIAGGRDQLARYTLNAYFDDRRGGDTGEVLPDNIFDFFPQRMFFVHGDADKSAPVTE
                     SASLVGMMRAAQERYTLRRSARNEEARRHAQRSRRLLPGALAAAAGEVKSSSAATAAG
                     VFPSPLTGLPSRRATVVDFDTVDSAAVATAAEQAVGAAVRLADNQEIIFVHSKDLVDT
                     GAAPNAAHQQQYSYGTGAPRASILSPTKISPIIPPSREDRPQPPVELGFLVIPGGRHS
                     DAFVDECIAAGRSCCVDFLCDYESTIDFQGNALEPGSHGPNAEGASGNSLGDSVWTSS
                     LPEADKAPLSWAHAPEMSVMPDAVLPLAVPYEDRSLPLRLCTMICPF"
     gene            <136543..>138027
                     /locus_tag="LDBPK_150390"
                     /db_xref="GeneID:13392916"
     mRNA            <136543..>138027
                     /locus_tag="LDBPK_150390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859516.1"
                     /db_xref="GeneID:13392916"
     CDS             136543..138027
                     /locus_tag="LDBPK_150390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859564.1"
                     /db_xref="GeneID:13392916"
                     /db_xref="UniProtKB/TrEMBL:E9BC80"
                     /translation="MSSEVEELLARHQRRFAVYEEFLRTDNKTLPPPPRSPSPQQREQ
                     QRQHQTAPSEAVLSTHSVSGRDAHYVSGTSAGDHNEERVGRSRDRGGHSSPGARAPKT
                     ATTSTTSVADVARAIAAHGSPVEPTRSYASIEAGTPPSLQRRSTSRSPCDAHTTAAAT
                     SVARHRTSAGELDDIDYLIGERLRSAGRYRLALTPDAAYIKSQAWALRRDQVKEALRR
                     EQEDAKLRECTFRPQLGPAAMEGTRDAEAASNGSGGHCPDVGAVKVSVTEDPGVSQHL
                     ARLEKARRHRRETETRLNGSNAHHWTSRSTVPHEFQLGLRVAESIPSLRKPYMPITSL
                     GGDLSTATSLQRHEREEIVKRASAAQRRRSFSSAPPSHVRDRRGSRPRSPLPTTTDAA
                     RRSVNGEQKKPRRQKGLPRTRQRFFSSTTLIPDAAHGEAYAPEPQRSCLEVGARDMVC
                     YLTNQLTHKDAIIQEQVENLERLHRELDAAMETLHQIASLGASR"
     gene            <138665..>140629
                     /locus_tag="LDBPK_150400"
                     /db_xref="GeneID:13392917"
     mRNA            <138665..>140629
                     /locus_tag="LDBPK_150400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859517.1"
                     /db_xref="GeneID:13392917"
     CDS             138665..140629
                     /locus_tag="LDBPK_150400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859565.1"
                     /db_xref="GeneID:13392917"
                     /db_xref="UniProtKB/TrEMBL:E9BC81"
                     /translation="MGAPLDVLSGGGGSSVLLPAARAGVRRRRQHSRCAPSLFVTLLA
                     LALLSTVRVSAFSDPFEQVPNAFQTTDTAVRAVYEAAQLTRSNPAWGSQRLLRSDSYV
                     LCVANGGGGSGGAANSSSTAVDLIARAWCTESGKGILVKQSVFWSMLASPGLQLSDSS
                     MVSSRALSWDCLTYSCDMENTIVAHATVNASSSSTDVTYTSPLPAVGGLGVSTPCCGS
                     TNSTFVLYMTRGLLVQSATLPVTALNNEAAALYSAFIDAESARDPLGERSNKNSSGGG
                     GGSGADRAEAVTAKDLVAGPSRSKEMDFCLVRQLAPSFYARSARSDRGDGGAVFAVNA
                     SICGADISDRINEQDATLVMRGYTAVLTAAEGVEALSFPKELIVGIASWIASTRHNAS
                     CNDDAKQSLLRTKGCCKWGWNASQATAYRTGEYLECLFDTSMLAHLPPLVLSLRNESI
                     VSTAETNSTCSIALQLNSCVSPDGNALRFYSTGSLVDELNRHRHSLKNFHEPAIVVGV
                     QQLRGATVAVTRSARVAKWFIGTSNAGYNLALLYLAVPRGTAVAADVSAAGALCVAKT
                     VCSTKQTFYASLNRCAYVPCTRVLFYSFHADTFTCTPRTACVSIVAALCFSLLVAESV
                     VLHLRRRTELAKEEHMRLLLQVQRRNIEAQ"
     gene            <142743..>144293
                     /locus_tag="LDBPK_150410"
                     /db_xref="GeneID:13392918"
     mRNA            <142743..>144293
                     /locus_tag="LDBPK_150410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859518.1"
                     /db_xref="GeneID:13392918"
     CDS             142743..144293
                     /locus_tag="LDBPK_150410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859566.1"
                     /db_xref="GeneID:13392918"
                     /db_xref="GOA:E9BC82"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BC82"
                     /translation="MREREATAQRPQPSSLQEDDDADRHDAIAVATETGRHVKRPREA
                     KGGDEDQSWAANAHQDTTTKVMRASSGDAAAAVPPSYTMKAFVVHRLDAATSGVLLFG
                     LNSHTARRTAAAIANKSLQGDGGGDDDDKPSHGSAGGGNDTREGAGSEAPPLPLPASS
                     SRKVYCARVHGRVHLESLAREQHHCILHTPSPLTQRTSDGLGAPDAAGASADASSATR
                     HSAAVELLVCRPIGCLDHHNSLYWSPDAAVTDSWQRHQADVEQQQQQAAELRSSSLSG
                     GRGETGRTPEAVAAKHKRMRQLTRGGGTASVGALAAALQAVSGAGAAQPARGTSTALS
                     DSSRRVQQYLETLRSAKTALQVMHYDAATDQTVVKCTLGTGRTHQLRVHLASLGHPIV
                     HDSKYIALEVHMRNLAKDGKHGLVESGEATAATGVPRTPLASEASLTRFYESRNVAAS
                     SEVGGSAAAAGAAMGGRWQSEVFAESRNARGCVCPEAIDLHAWQYTLAYDDGELVSVE
                     VPLPSWAD"
     gene            <144989..>145255
                     /locus_tag="LDBPK_150420"
                     /db_xref="GeneID:13392919"
     mRNA            <144989..>145255
                     /locus_tag="LDBPK_150420"
                     /product="60S acidic ribosomal protein, putative"
                     /transcript_id="XM_003859519.1"
                     /db_xref="GeneID:13392919"
     CDS             144989..>145255
                     /locus_tag="LDBPK_150420"
                     /codon_start=1
                     /product="60S acidic ribosomal protein, putative"
                     /protein_id="XP_003859567.1"
                     /db_xref="GeneID:13392919"
                     /db_xref="GOA:E9BC83"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:E9BC83"
                     /translation="MTTAQLACTYAALILSASGKTDADSICAVTKAAGVEVSHGMAAA
                     FANALASVNVNEVLGSIRFSGAAAGGAAAPAAAAAASGAAPAAAG"
     gap             145257..145355
                     /estimated_length=99
     gene            <146221..>146547
                     /locus_tag="LDBPK_150430"
                     /db_xref="GeneID:13392920"
     mRNA            <146221..>146547
                     /locus_tag="LDBPK_150430"
                     /product="60S acidic ribosomal protein, putative"
                     /transcript_id="XM_003859520.1"
                     /db_xref="GeneID:13392920"
     CDS             146221..146547
                     /locus_tag="LDBPK_150430"
                     /codon_start=1
                     /product="60S acidic ribosomal protein, putative"
                     /protein_id="XP_003859568.1"
                     /db_xref="GeneID:13392920"
                     /db_xref="GOA:E9BC84"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9BC84"
                     /translation="MTTAQLACTYAALILSASGKTDADSICAVTKAAGVEVSHGMAAA
                     FANALASVNVNEVLGSIRFSGAAAGGAAAPAAAAAASGAAPAAAAAKEEPEEDADDDM
                     GFGLFD"
     gap             146643..146741
                     /estimated_length=99
     gene            <147557..>148753
                     /locus_tag="LDBPK_150440"
                     /db_xref="GeneID:13392921"
     mRNA            <147557..>148753
                     /locus_tag="LDBPK_150440"
                     /product="cytoplasmic l-asparaginase i-like protein"
                     /transcript_id="XM_003859521.1"
                     /db_xref="GeneID:13392921"
     CDS             147557..148753
                     /locus_tag="LDBPK_150440"
                     /codon_start=1
                     /product="cytoplasmic l-asparaginase i-like protein"
                     /protein_id="XP_003859569.1"
                     /db_xref="GeneID:13392921"
                     /db_xref="GOA:E9BC85"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="InterPro:IPR027475"
                     /db_xref="UniProtKB/TrEMBL:E9BC85"
                     /translation="MEAGIEATATPAAVSRPPAAPRPGRNTRRILVLYLGGTIGMKKN
                     AAGALEPVAGYLTEQMREMRELRESSEIAPFDIIEYAELLDSSDMNAADYCRIAADVQ
                     VHYDEYDGFLIAHGTDTMHYTASALSFLLCNLGKPVIVTGAMVALAEPYNDARRNVVI
                     GMMIASNPKICEVCIFFNDSLFRGNRCNKVYHTYGAFRSLNYPALGVVGATDFVLKDE
                     HLLPQPMGALKIMSDMRGRVGCYPIDPEADVDTFVALLEQKRPRSSPCAFSVTAAPST
                     DDSDGAQKPLLDAVLLSLNGVGSVQGVVAQQLRRIVAVAHKHNIVVCAVARDISGTLN
                     PSEVQRLHAISPEIVYLNDMCASAAEVKLMYLFGKGLSPAKVAAAMTQNLRGEITPLL
                     EVHAKL"
     gene            <149515..>151557
                     /locus_tag="LDBPK_150450"
                     /db_xref="GeneID:13393000"
     mRNA            <149515..>151557
                     /locus_tag="LDBPK_150450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859522.1"
                     /db_xref="GeneID:13393000"
     CDS             149515..151557
                     /locus_tag="LDBPK_150450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859570.1"
                     /db_xref="GeneID:13393000"
                     /db_xref="UniProtKB/TrEMBL:E9BC86"
                     /translation="MTHEFRSLFLPLAAEEQAVFADFFPTLMASSTSIQDGAAGEHSL
                     QPKVSAALDTSSSAWATSPHSSGECGNLPEVGRGTATDAQARCGAPLRSLVFAIGSGR
                     ADAVIVVLRRGDVVLYGLDRLHTPPYEKCRIQPLPTTQQLMAARENARRYSNADGAAS
                     DGSRADASGSGVLAGSCRVGNGGAEATCAALLPLHIAYCCRIPLSASFSSATPPAGGP
                     RRGGGGGSRDEKDEDVVYLRGIVGSSDGRVSLFSDTSYTLSFAAHDIPVAQVDAVLLP
                     PCTLDGCVSTNASPTTSTRGVRSMGAGVNTYAAPSGELASPTSPQRQERLARATQRLG
                     LVTSGNDGVVLLWRRLGDSMSPIVVVRPSTFSSRAAYAVHHPSALSALLSSRAPPSQR
                     EAAVDAELSCPPSCLLHAATSTSHTLRVRQLSSISPKPTHKSLSSTARRESVEEAAPT
                     SMSTALPGSWSATVTAIAAHDSVTLVAMGASLLSLVKLNPRSVARVWKAAESITQLVL
                     VDSVALAVCARSGTVHVLTIHPSTGQVVRQRVYYSYKNRAIHHTSLHVASLLMTLVDV
                     CGSTELVQLPADVLLPCGVRPLRGEYASGDAAHVNLLASMAALRAKVCIEVIKDGSGG
                     GASGSVTANEAEVIGGSTSMYEANAAFDQLNERLLLARYAVPEECDDFMGANVHVF"
     gene            <152288..>154372
                     /locus_tag="LDBPK_150460"
                     /db_xref="GeneID:13393001"
     mRNA            <152288..>154372
                     /locus_tag="LDBPK_150460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859523.1"
                     /db_xref="GeneID:13393001"
     CDS             152288..154372
                     /locus_tag="LDBPK_150460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859571.1"
                     /db_xref="GeneID:13393001"
                     /db_xref="UniProtKB/TrEMBL:E9BC87"
                     /translation="MLRRSFFVLAPSIPRSVWDPAHYNENWVDSYSTSIADRRHWPAK
                     KWSIGLEPRTPRDWLRFSYRNLAYAYNGALRACAAFPEMLVYYKEMKQRGVKVDVDTL
                     NALLSRAARYEHIQVDDVFLLFDELTALGARPDIASVETLHTVLEHAAHQPPEWRETR
                     RRQLVELYQYLALEEIERLAPHRVDALLSAQIARLRGNLKQLNASLSPSVYRRYFAVI
                     DLGETLIQEVHNFLWEYVGADHAAMDVPSLQLRIPFVASVMKRPLATADPAQVKATDF
                     EDTDVCSVLLAAVERCVDGDFHDRRPVSERRMYLALLTMLTSSGVLYSADLMAQMMDV
                     VKYSRDDRGRDRDAQRLLRYALRGSSAADDAAYRELWRAVAPPVDARVVGRYLASRDP
                     WSPVHICYDRSFQFRAFPELQQITQSQSSGSSTDSPAAAASTAAGAGSSSTAAAAAEP
                     EKALEGVSAGLPPSTVAAKTAEALQQRWDDVRKLIDITGVLKLGAGLKSARAGSAAPT
                     QEAAQQAMEVFTGAAAFLRGVATGCRYGELADALAIQAVGDGQQQQHHAPRATSFGGA
                     AATAGAARSSSSNASTELYAGGLEFDVWHRLLQCVQQLRQDMEQFMAQQYEAHGLQVE
                     PEFECWEAMLVVLRCILDFCLVHTQQYGRTAGGGMAENLFQESAQLRAQLVEESRTRF
                     NGRMRILWLQEV"
     gene            <154966..>155406
                     /locus_tag="LDBPK_150470"
                     /db_xref="GeneID:13392922"
     mRNA            <154966..>155406
                     /locus_tag="LDBPK_150470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859524.1"
                     /db_xref="GeneID:13392922"
     CDS             154966..155406
                     /locus_tag="LDBPK_150470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859572.1"
                     /db_xref="GeneID:13392922"
                     /db_xref="UniProtKB/TrEMBL:E9BC88"
                     /translation="MNSAPRAPMRTLAAKGVAGPPPPSTQEPMPGGMPGMPFSPLGAN
                     APDMTQLMQYLPTIMKVASQIPGILVGFLVTMVYMLVVVCRRGFTETVSPVAGFHIFA
                     LFLLRELIEPWRQGQARAQAARAREVQRRSFTTDIAMQYREKLD"
     gene            <157009..>158046
                     /locus_tag="LDBPK_150480"
                     /db_xref="GeneID:13392923"
     mRNA            <157009..>158046
                     /locus_tag="LDBPK_150480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859525.1"
                     /db_xref="GeneID:13392923"
     CDS             157009..158046
                     /locus_tag="LDBPK_150480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859573.1"
                     /db_xref="GeneID:13392923"
                     /db_xref="UniProtKB/TrEMBL:E9BC89"
                     /translation="MNVYTSDGLLVSRGADSGGLSTEQGQQLISIYRLFLQLHHAGTG
                     AMRIKDMIKPETTDAVSEHGSGGAGGDKNADRRGGGAGRGGSGAVNATWSAIMPSMPE
                     NTAYTSSIAVVSTGTPYPMFLLSSNAIPETHRLRGFASAVAPQQQHHAAAAGTATTAS
                     TKNNNRSANGCEEIALRWSLLTKQPPSCPTAAAAAGSAVGAATGASAGTPASMTATVN
                     ATKATVMTAETAADVPVDRTGFPGARNFSMSSTKSAGHLPGASQRDRMAGEWSNAGNV
                     APAATSPARTAALAPCAYPSGWTAAELQVHTTKQMMVCTATELSLDLDGGAEDGNAPL
                     LFCCSTLPISG"
     gene            162583..162680
                     /locus_tag="LDBPK_15snoRNA7"
                     /db_xref="GeneID:13392924"
     ncRNA           162583..162680
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_15snoRNA7"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966710.1"
                     /db_xref="GeneID:13392924"
     gene            <163611..>164312
                     /locus_tag="LDBPK_150490"
                     /db_xref="GeneID:13392984"
     mRNA            <163611..>164312
                     /locus_tag="LDBPK_150490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859526.1"
                     /db_xref="GeneID:13392984"
     CDS             163611..>164312
                     /locus_tag="LDBPK_150490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859574.1"
                     /db_xref="GeneID:13392984"
                     /db_xref="UniProtKB/TrEMBL:E9BC90"
                     /translation="MIPTCSNHRPARVCGHTHELLLQKDEAERSHSSEVDDEDTNPLR
                     AEIQAPRKRQHGPTKQEESLEADEARSSATSTRSSTSSPLTTTYHRTRHNRAHRTPPS
                     PCISVKYEGPASSTPKQQTIGHHPIRQLTRRVGPAPVATAAESTATVTRIRPSEQSLG
                     HRELNSAHTLADTIDDSLSAATTAAEHTHTTILRQHLRRERYYHHKLHAESHHLNHVP
                     MRFIGTPVDEAERALE"
     gap             164313..172828
                     /estimated_length=8516
     gap             173780..173878
                     /estimated_length=99
     gap             174366..175451
                     /estimated_length=1086
     gene            <183381..>185036
                     /locus_tag="LDBPK_150500"
                     /db_xref="GeneID:13392925"
     mRNA            <183381..>185036
                     /locus_tag="LDBPK_150500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859527.1"
                     /db_xref="GeneID:13392925"
     CDS             183381..185036
                     /locus_tag="LDBPK_150500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859575.1"
                     /db_xref="GeneID:13392925"
                     /db_xref="UniProtKB/TrEMBL:E9BC91"
                     /translation="MRYVFEHCDLSRYAASGSGASALLSARLRELEALLQAWIVQRSK
                     GAMQHRATAPANDQAARSCRRLQAADSSGSYENPRRLPLRWAHLTVEELDSDDGLRHL
                     RDSAAPPQRIDSYLAAWSARKQAANEALFATFPFLATLPCGYALTEVGFTNDAEFQHY
                     MRGGAYQESVHVQQQMRDVVDKLARTKAAAAEGRQATRYADRVRATVETTRDAAGPAT
                     GSTERQSGGDDRAPLQNAQALAEYPEDPQLLDAILAARVKRTNRFLDKRQRLSFVAQS
                     KQESERLIKRMMVRMKKECTSDIPMGMEDVETLRFFFDGVDVDHFGVLDRTDTTDFIM
                     LTLGEEKRMSRTDVERLLFPDVPRGAVLPTLVDFSDFSKFYKKVALQELLKQDSTFDK
                     KVATRATTVPDAGAETSRTITITPRRPEPPSTSPRTGSDRRGRLNTVSSGVLPVRAFA
                     ATSSSAAASEAGTVAASANTPRRIGLRRPSSEPHPHHEGSGILHTLQHRHGSAYTPPT
                     SARDRVRVPEGGAVASTDRWFEYGRPSSGHVSAPAGTPPQAEK"
     gene            <185288..>185662
                     /locus_tag="LDBPK_150510"
                     /db_xref="GeneID:13392926"
     mRNA            <185288..>185662
                     /locus_tag="LDBPK_150510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859528.1"
                     /db_xref="GeneID:13392926"
     CDS             185288..185662
                     /locus_tag="LDBPK_150510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859576.1"
                     /db_xref="GeneID:13392926"
                     /db_xref="UniProtKB/TrEMBL:E9BC92"
                     /translation="MLVCVMSQRPRTSTDSPKNQTKVAEGTHISFRVCVRLPETRTRQ
                     ARSGNDFDDAAGVHAACVTQRAPHLACPPPPLPNCAHKSTHTYIGSTSPPPPPCVLSS
                     PPPPSSARLFYTRAAPSINSMS"
     gene            <188745..>191753
                     /locus_tag="LDBPK_150520"
                     /db_xref="GeneID:13392927"
     mRNA            <188745..>191753
                     /locus_tag="LDBPK_150520"
                     /product="katanin-like protein"
                     /transcript_id="XM_003859529.1"
                     /db_xref="GeneID:13392927"
     CDS             188745..191753
                     /locus_tag="LDBPK_150520"
                     /codon_start=1
                     /product="katanin-like protein"
                     /protein_id="XP_003859577.1"
                     /db_xref="GeneID:13392927"
                     /db_xref="GOA:E9BC93"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BC93"
                     /translation="MFDALRSIRRQADAVQAAAQKRCLFDSPAAPRTTDDRRWLFPYL
                     CDINRRQRAFCSKLEADGDPQGRRAGSDGDTLPVAAGSPASHQVAEVCMRYSRPLAAT
                     ALAGSQRCGAGVAALLSTTGLLREASRDDAELSVVRDALPMCTLWGSVLRLWCTAGGE
                     CPNLRTLAAAAQLQCLSPRGKPLEADDAGMRCMCAALWAGAPDKLRRLLDAVGMSKDN
                     DAASEERGRRHTNSSRAGSPAARSTPPQRRPRSPAERGTDDAPQRRARRDAGVNSALG
                     EGGGATSSLVPPLPLRATSARAQAAASRSRSQTPPSRSRSQSPPPPVSVAPATRPATA
                     ARTRQSAFSFAVRVGDSSGGTAAVSAAVAPKPQQQQQERENGDASDMAGVTESQTGLV
                     SSAPHSHDGPPQSQQHPASVSPSGPLRQKTLAAFISGGGLSKPHQCQQQKPPPPASTA
                     KRSSWFNQPPQQQPVAPSKAPPYEHGLRHNTGSSRIGGGVDRGDEESSRALMAAPSSG
                     NNLAPSSSISSPSTTIGGFVTAGEQLLTDVRQGRTMSSAYLSKRSPALGLRRNTGFQP
                     QHHQQQPKTPAGATDVQTALNSITTPHVRKGIGGASQAVGPSGGTCGVRGTGGATASH
                     NQGDGDDDSGSFPASLLLPDGSVPPILLPLDPKLVTQVAMEILENGAGARQVGWDDIA
                     GLQHAKASVEEAIVWPLRRPDLFVGLRDPPRGLLLFGPPGTGKTMIARAIANRAACTF
                     LNISSSSLMSKWVGDGEKLVRCLFAVATVKQPSVIFIDEIDSLLSVRGEGETDSVRRV
                     KTEFLVQLDGVATDRGDRVLLIGATNRPDELDEAARRRMEKRLYIPLPDEAARRELIQ
                     RLLKSLGPSEADEDGALGSAGKAASTATATTTTQVTHTLTDADLDSLVRSTDGYSGAD
                     LKQLCREAAMGPLREMSVMQLSAVAAADLRPVQRKDFRQALKRLKPSVGPAEVQRYVE
                     WNKLFGSFNEHDDDEDDDDELEHQEGHGAC"
     gene            <192746..>192883
                     /locus_tag="LDBPK_150530"
                     /db_xref="GeneID:13393002"
     mRNA            <192746..>192883
                     /locus_tag="LDBPK_150530"
                     /product="ecotin, putative"
                     /transcript_id="XM_003859530.1"
                     /db_xref="GeneID:13393002"
     CDS             192746..192883
                     /locus_tag="LDBPK_150530"
                     /codon_start=1
                     /product="ecotin, putative"
                     /protein_id="XP_003859578.1"
                     /db_xref="GeneID:13393002"
                     /db_xref="InterPro:IPR023189"
                     /db_xref="UniProtKB/TrEMBL:E9BC94"
                     /translation="MPAGMSGAAGKTLANFKAPYPEPASQQRRYVIFLDPKGYRKELN
                     D"
     gene            <194390..>195526
                     /locus_tag="LDBPK_150540"
                     /db_xref="GeneID:13393003"
     mRNA            <194390..>195526
                     /locus_tag="LDBPK_150540"
                     /product="ecotin, putative"
                     /transcript_id="XM_003859531.1"
                     /db_xref="GeneID:13393003"
     CDS             194390..195526
                     /locus_tag="LDBPK_150540"
                     /codon_start=1
                     /product="ecotin, putative"
                     /protein_id="XP_003859579.1"
                     /db_xref="GeneID:13393003"
                     /db_xref="InterPro:IPR023189"
                     /db_xref="InterPro:IPR027438"
                     /db_xref="UniProtKB/TrEMBL:E9BC95"
                     /translation="MPSLQDYHVPYPAAAPGQVRKVIYLPQQNPTVEQQHLRVQIIPG
                     RHENCEDGRLYKLTGSVTEETLQGWGYSYYVVKLGDIYAAHRSSSDPARVTTFVALDE
                     NPVIAYNSKLPIVVYVPEGAELRYRIWTDDTSLVQSIQQQPEAPALPQPHLVPVTERQ
                     ECPHELPRCGAPGEYVTQDCKTSMLSVEEVHRLSSSTPPLIPSAVRGSAHEAHAAPPL
                     HSAELEERVCPVMEHLEVCPQNNGHEGREQPAEEASTLKRRSSSSSSSNPRHLSANEP
                     SPSRPRLSSTEYWPQENSKTKRSPSATHKPRRSTDSATIEEAGVGAPKKNRSSSSSAS
                     SKKKAEDNVYEKTMKNFWNRARSDSPRKASASSKKSGNGSKADP"
     gene            <198985..>204321
                     /locus_tag="LDBPK_150550"
                     /db_xref="GeneID:13392928"
     mRNA            <198985..>204321
                     /locus_tag="LDBPK_150550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859532.1"
                     /db_xref="GeneID:13392928"
     CDS             198985..204321
                     /locus_tag="LDBPK_150550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859580.1"
                     /db_xref="GeneID:13392928"
                     /db_xref="UniProtKB/TrEMBL:E9BC96"
                     /translation="MDGSPTEVADGAENLVAVKAADSAANVRDKSADHGRGCDDAVVK
                     PIPANSFFSRPSSTPATRTAPRTDHVGSLDDDELQQVEARSANSQTHHGSLISASAKK
                     DRSGGVCADDGNGGAEVRQGQQLSSPLITYTEPSSDIMGAAGLLRHQHVQHTAAPPSC
                     IAPSAPSSPTCGSPPLVPTEATEHQRQQQQHIDNTALPSALDVVLPRALTQRAPSLRR
                     AAKNQPLSPSSSRPSVPAAAHPPLLSKSTSQPETQHTRSSSPSLRSPTPLDLTAPPKR
                     RPARRSDMVEGAEETGEVDDPSEDDNVERRGNGSAAPPKSDQPQLLCAAKSCQGARQR
                     PRRLSFSESSAAATEDHFATASQAEAGALDKVGVAPSPSTPPPAVHYSGVNASGAQAE
                     AQEVIAASGESEPERISTPGADYTLASTASVTVSHTSLKPTAAVVAQQQLLSSSPSRH
                     ISHELFPSPEPLRDLGSPMRLHERQRPSSHPLVGTDGYALPAPVFLPDPPATATRAAS
                     CAATSATVKPLSGRHVERSPQHLQRQLSSAVSRSIRGADGSGGGSADGAPPCVPQVIP
                     THDSVFFPMGTDVIAPVVLHYLTVAGWSTTAGGRDYFSHRRLRGGEVAGHTVRWLHTA
                     KPRNQFVFLVAPVINRKEAAVECGKDATAEQRRRCTPSSIAGASPTASGSEGGGATGP
                     ALDVPPSSGSSTKAHRTWSGTTRATTMKTRWGWNMPAKRLQALRARVFGEAPWFTYST
                     KTVCACSLIAQVNDDDSLSVSDVATPSGDSLSDPSKDDGDDEDEVADSVSGSSSCSDD
                     AFQRSPRIRRSAQCLSPSLPEARMSGVSGGSLRKGIPPYSMSPERLARQSSQSPPASV
                     ASAASSPTSSSSPLVGLALPSPGIQRATTQNALPVIVPARSATPVELRRNSSSAGGGS
                     GIYSSYVWSPVTGTATAASVASPVTPRQPLQSLVPAAAAASSSAAASTAPASVGVEVV
                     VVAHADVTAMDYAPRLTSHRLSIEAKAAHTYFFPLLSDALAYYQCEDAMGLMEEQWAA
                     GVTSQIPRSRAGAPRSQRQQHPRRQSSYLSAAGFGSGSRNASMRTAPLLHEDGDSPNL
                     FSSTSREPPKTTADAHRCREGVFREAQTPWRGTSTADSAPHALCGSEAGSDSTATGMS
                     LSGTPLGPHRHHQPPHGTPALVHSAKLPPSQSLSLSDALRSAQRMGSVSCSSSHGGGG
                     QLGLSSSSTFRPPTLLPRTAATARITPASAPSAPRLVPTSQLQLCCRSTAQPHLTSSH
                     GEVVVSVYTADPVFNTVLRELLVPEPGTHPYTVSVAEQKRLLSMVEVGMPAWCVFYSS
                     TGLPYRRLFRLLYSGLTNLWPLLSLAVGLYDLYKHLPQLKRFMEHTLEPITRWMEQRF
                     TIRVSVLVTYLISVVVTICSSLSSFVSQFYVVQLFSLPIVQLVLALLKLPFVIAFDTV
                     WTLATTVLGTVGLALQVVRMVVMAPLVLVTNLASLRDTFGAAVPMAVEGTSVSVKQWR
                     AWVEFWQTVASPMKNAARAWWDSMMHVSTSAARRETSIRRWTSPKLEQLAMVVGDVQD
                     CLIINAQLWWTYILLPGIERKVLLSVMLVYMYWLFLGISPELWDEVIYASGVRHHPSL
                     RRGPSTSGVQKEMPAPSSPFPATTPADSHVDAQYKAGSIDTRDGDRCASVSTTSVGGE
                     WSLYAYFHTLLRDAGSHASPSSSSAGTRPPPAVSAEKSSSAAGVSGVRSLILRPEPQQ
                     TFAALVAELLLPNMVLELLHHVRSALVLGWSRGVSAASRMAARRPRRDMQQG"
     gene            <206559..>207803
                     /locus_tag="LDBPK_150560"
                     /db_xref="GeneID:13392929"
     mRNA            <206559..>207803
                     /locus_tag="LDBPK_150560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859533.1"
                     /db_xref="GeneID:13392929"
     CDS             206559..207803
                     /locus_tag="LDBPK_150560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859581.1"
                     /db_xref="GeneID:13392929"
                     /db_xref="UniProtKB/TrEMBL:E9BC97"
                     /translation="MQRMNSVSGGSARRRGHRSRASSASLLSPADVEQLQKQKTAYLR
                     LRDVTMGTNVADVLARLRERSDHHIQLKTTAAELEASMEQLDNERLALQSEWEEVNHR
                     AGHALVSARVMRAARDMRSGADKESGTLCGAEGKDGEGDSNRNAEGVAGGADAIDYGL
                     LADRRHERRLVLDEFRQHLHQRQDELEEAEEKHNWLSQLLREVDLGVQYLAEKLSISG
                     AQAVDVSATSQQHQKQRSATQTSLTIDLLRNCGAKLQLMLEELSPEELDAVVRSMSRA
                     KFVILGTNVRVPEVLEAQRIHPQQQQQQISSASRARGSPSHTGGASTSPVSMGAPGGG
                     PSSTVWRAGSTDSGTSTAGAAASGAATTASAAAALTEDYPENEIHDRQELKMMSMATV
                     QREQQKARKRQMQQRRSKEEMV"
     gene            <209289..>214544
                     /locus_tag="LDBPK_150570"
                     /db_xref="GeneID:13392930"
     mRNA            <209289..>214544
                     /locus_tag="LDBPK_150570"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859534.1"
                     /db_xref="GeneID:13392930"
     CDS             209289..214544
                     /locus_tag="LDBPK_150570"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859582.1"
                     /db_xref="GeneID:13392930"
                     /db_xref="UniProtKB/TrEMBL:E9BC98"
                     /translation="MTRTGAAAASGASSSTLSSPSTAVAPSDDVVPQQHQWQQQRHLL
                     RCFALADLLGVSPTVMQQLANAAATPSSSLRHARNTSRSSSHCSTESDPVMQAYQLEQ
                     ILVAAVLKRLSDRCCDSDQSIQDIGSVDARQPAASSVSTTARQPAQKHQPSSLKAPPW
                     SAALSEPRRACKSPQQPDGGLLLPSVLSSPQGVARVDALHASFLPLLLVALLQRVSEG
                     RGGDTQVTDAAVPKQKAGTNAAVLSLRQQRSCRDALHQLLPLYTHLLLQRQRAACAVV
                     SSVVVALQACPCSRHDDGESTTEEEESRKRIQRLVHQGLCCSEVKQWLHAARLLSDTL
                     VACLSHVSRRASTAAAAAPPPPPPGAVVVDEDDSMEARWTLEMAGVWLSVAGMPRQGD
                     TPVAEGRRPSDLWWWEAGMSVSSGAAQPDPDGSTLATSGASKNPQDCAPFTAATTTTA
                     EALALAEVMCAVGEETCNDIWPHEGGHSGEQQQLPPSSCAVVGGRIVAMLRDVMAFFL
                     ARHHDSRVFDPLRTLSASEVTATEPGHRYVLLLAERLETAQRHQHRLLAAAERAVHRV
                     LQQQHRQDLSVLWKPPWMIVALCSVTAYQLRTQLHRREQRMAELYTATAATATGAMIA
                     SPHMNIDSLPPSGSVAVTDPKRRSSSDEVDRDSRHGRYSSGGAPSTAAAAKPAQLGKW
                     LWSEEDDDDAAAPHEKSQGQWCARSLDEGAGLAAHAAVLSSTAGPATTTSAAAAADTT
                     ISMPSPPPPPLAVSSAPSSVHALAPLRYTPRTSSLHHGSRIYGTLPAMHGSGDASAAA
                     DEDAGDGERLARGSNDYYAPARSMERLWELPARVPRDWTPALATLMACCVLCLSSTST
                     TAAASRLAVLLGETLLSRHSAEAELAHNTASTSLSGSAFEPLARPVASPRASLPDFSF
                     SKRHEASAATAAGVSVRSSVCSSSATNSIADVSMAVDSTDRGGEFASSVVAVGALAQW
                     HLRGLIRQLCLPVNGRVLPSEQAGRDRLRGRHTKASRTRSAAGSSSLALLSNAVDRTS
                     ATPSSAGAVAGGDSWFTRYNQTTRARSRVLDAAMRSDRRGADAAASSSLPPAGGVLRR
                     LDPVSLLASCFALMHLLQTQPRFFQKARLGGRTMQELRLGVLEARWGGEPGCAAQMLQ
                     RHGSATSIVTVSVNSVSRALVDGTAGGHADPRAGGADASRRRRDAFRFARGRSLWDRP
                     GAGAPEAALGRPLGMGASDDDGDDDDADAPVPAAAADAYGSVDDSCDEAAAAATCNFT
                     EALLVVVSYVGCRALATALVQLAAPALDSAEAVDASFIPCLGSGIAPAVTFSAPPRDL
                     WCDALQAITGLLLEAHRAHRGGTAASRVRAVAAAASRSSVDHHDSTRACSHGILSSAS
                     RSVDRASTLASTATATVGVLLPASRASASTSVSPQPSDPRQALGLGSAPTAPSFHASR
                     PVGDGGRGAHAAAPPHIAITATHLMPAPLSTEAQFGIGAFFFALVRALLQLHALSSAA
                     ATCVGGPPGQQQQQYHHRPQPLLCVVQCLYAVASIIDDVLHDYSNPPPAVLCDVLAIM
                     LMIQPLHQPSATVQEAGAIVPPPPVSDTLTAWEALRLTPFWDGALLGPLEAASRAWAC
                     HEERSTAAPSDNGEERRSSDRQRGRPPRSATRLCESPSASHIPSPPQPSRPPWQSLLG
                     HLPCSRDPFSTSWLPAAFRGPSRSSTSWTLLALLAKEDDLLLADPPTATAANTADEIR
                     QLSVSIVASARYTEWMETLCEAWQA"
     gene            <215598..>217226
                     /locus_tag="LDBPK_150580"
                     /db_xref="GeneID:13392931"
     mRNA            <215598..>217226
                     /locus_tag="LDBPK_150580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859535.1"
                     /db_xref="GeneID:13392931"
     CDS             215598..217226
                     /locus_tag="LDBPK_150580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859583.1"
                     /db_xref="GeneID:13392931"
                     /db_xref="UniProtKB/TrEMBL:E9BC99"
                     /translation="MIRKNRDLTVQLGTTQQQLAAAQKALQAAQEKTQRLVAAVTVSS
                     LGARGAKAGSKSAAGAAGLDDGCNSSSGSKSGGGGSGGEGTAAASSAAVARVYDKLHQ
                     KQLAMAEVQRENVALRSLIQREVGLRDDTKEVDRLLRRATAVSSSGGSAAAVAGGKSA
                     SGADGGGWRGRAEEIVLLKSKLKDAQREVEEMVAAQSSSENGADACMDPLSLPASVRT
                     FLSASGDPAAEARSVVTTTTAQVRRPRRDVDDDARDRLSAMQQERAARQRQLAADLSE
                     LQQQLNEERMRSSALQARTKTMKSELDTLRSYVDTILEKSSTDDELVEAYKTELQRAH
                     EEARHWRRVAADALKEAGGGETSAAFTVSGVHNGLNSAAAAAVRTAPYRNVAGDERAV
                     AADGGDAGNVRRAPLPLSPPQPLKSFSRSLYEWVCQACDEVPEDKEQERTEPAVAASA
                     KQLAAVMRQAFQHLVLVERHAVAGNDMEHASTDGASAESVLLKENAALKKRIRALSAL
                     MEKELQAQRVLWATADAGAGATSSTETEERKRQQ"
     gene            <219172..>220170
                     /locus_tag="LDBPK_150590"
                     /db_xref="GeneID:13392932"
     mRNA            <219172..>220170
                     /locus_tag="LDBPK_150590"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859536.1"
                     /db_xref="GeneID:13392932"
     CDS             219172..220170
                     /locus_tag="LDBPK_150590"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859584.1"
                     /db_xref="GeneID:13392932"
                     /db_xref="UniProtKB/TrEMBL:E9BCA0"
                     /translation="MTLFLSAVLPVPMRLAPLLLGTLLLLTAAARANTADAPYRIATR
                     AFPGCSAYADHFPYMQTTIDCIVKDLCVTRKHCCKNAHETDLGRCLDVTAFSCDTAAV
                     CANYTAASSSSSSSTSPWFPETQDGGASLMCCHAAATTTEAPAVPPLDDGSSEEVNHD
                     SGLQPELTCDDTTSIACMVVPMLPPTIRAFCQNDLLNMYTDAYLYDNVPRMCCQHLAA
                     GPLNGSSAESSKTGKVACGLKLLNLPRTGEYHCSLDMRSTTNICCNGRIEYDASSSGD
                     AASAALSGEKLVFTYISSKCLFHLEPNGNSVSSPAMSVVRLLTVAALSVMAMHLCM"
     gene            <221962..>222939
                     /locus_tag="LDBPK_150600"
                     /db_xref="GeneID:13392933"
     mRNA            <221962..>222939
                     /locus_tag="LDBPK_150600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859537.1"
                     /db_xref="GeneID:13392933"
     CDS             221962..222939
                     /locus_tag="LDBPK_150600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859585.1"
                     /db_xref="GeneID:13392933"
                     /db_xref="GOA:E9BCA1"
                     /db_xref="InterPro:IPR007653"
                     /db_xref="UniProtKB/TrEMBL:E9BCA1"
                     /translation="MHSMRQRSCDIFASTVSALLVTAVLTATSTILRDLVLRPRPLVS
                     DVRVSSFSPLYHVRSPTLLSPEIPDAAIYYRPDTGGDGHRTAAKQLPSNIEIVDTVDR
                     PEDSEEDRQRKIWQRQRLPKGFKLGMRTIDRVVLYLSGSVDFSPCWDWNTKAIYVSFI
                     ARFPSKSASQNDVVLLDAVLRPVSLPAKIARLAKLRRQERRAALPGSGNERATVAAGA
                     SPAATQMLTDEERQQLAAFEQALRNVEHDHPSVYIDHIDKRLVLNDSFKYFVDAFDDT
                     SLGGNTVEVVLRYQVMSYSGWAPVREDVLGHQVKVKMPENAVLWKAQQR"
     gene            <223615..>224322
                     /locus_tag="LDBPK_150610"
                     /db_xref="GeneID:13392934"
     mRNA            <223615..>224322
                     /locus_tag="LDBPK_150610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859538.1"
                     /db_xref="GeneID:13392934"
     CDS             223615..224322
                     /locus_tag="LDBPK_150610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859586.1"
                     /db_xref="GeneID:13392934"
                     /db_xref="UniProtKB/TrEMBL:E9BCA2"
                     /translation="MPRKKNAFMYSIDPELYTRSRAPASTIAMGMKSSQASSLCWANQ
                     VQQEERIREMWGATYDPHHNRENRALQAVQQTRARDAARHEAYVNPEHNPELCSILYK
                     KVPPFSVSDAAAATAASSSPQHHTTTEAALAGTATGTGDPSDSAFARSARSVTQEYLQ
                     ARCRHHTLQQRYPSGPVTAAQAVGWAAGATDRASASSLEASSSPYRQVRRRQIGAYRK
                     PEDDEHALLFGYDYTPK"
     gene            <225164..>230470
                     /locus_tag="LDBPK_150620"
                     /db_xref="GeneID:13393004"
     mRNA            <225164..>230470
                     /locus_tag="LDBPK_150620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859539.1"
                     /db_xref="GeneID:13393004"
     CDS             225164..230470
                     /locus_tag="LDBPK_150620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859587.1"
                     /db_xref="GeneID:13393004"
                     /db_xref="UniProtKB/TrEMBL:E9BCA3"
                     /translation="MLRPLKGEWCAQGRPPTPHLEQQQQQQVSPSWTQDQPQQQRHSK
                     AQKGRSSRTREVGASTANGGSDTNARAPHRSSSCAVGARRPSAGLNDNTRSSSDHSSS
                     TESGNCFEAHTLRESWRSIDRRQRCRESAEPPARQKRSGHVKRAKDLLLQCPPAGKPA
                     TPALAQKGDVGGAAVQAAPAVAAQDIQGREEQHPRSGGGVLPLHHPLYCTRGEALLEH
                     PRHACPSDGDGSNGTSGRRGFRSPVKLQRTSPERSTHVSRTIAASRREGPFFRSAGIV
                     AYSSSSSSSTRSASSSDSCGGAGDGGHTRRTARLASPKPLIDARKVFKMSPNARLARV
                     RGAVCAQQQQGLPPSTLMAPTHEQQLIDPESVTAAPTATAICSAPPSFLSPAKRCWSS
                     SGVHRESAPADADPSDNGGDGIHEGCASHHSSKLARHAARLPPREAENEVPAEVMGVS
                     AAQTLLIRRGERGSNTSEYGKGSTQSHSSVQRNVKSARRHRRHHRRDYAPAHVVLENA
                     TPRRADDGAYSYGKNSSDSMLASAAEVGSSRCGRWPPNARSARSLESMASPNVALACS
                     ELQRQYGASLSSRSMQAAFTAYLHRSGHVSSPEGNARQRATPVQDAPPRITHAHDALP
                     AQQRPNMKAVAALSAHSMGMEPAADELALEKEVLLLRYSLLITYALLAATAVNGHDGG
                     CVGAMAERPWQHVARHYAKWTTETAQRAHGRAGAQAGESDEQSRERRRRHRRFTAPHL
                     RGPTPWPALEARLAAAVQAAAEELLFDGDAATAPQALPPPRLLLRESPPHDVVGLPSV
                     WYPPHRSDENDGPLSGRLWVWFSGDDGGHSEDGVAGVSLSSSDEGVKCSGDSGAKRRS
                     LSEDSTAWRRHERRKGEGLSSALRFSRSSIVERRRPQALAPSFRGAWRRCFVVADDSG
                     VCVYPTERDYADFASESLLMAVPYASLAYLIPDFAAAAAAVAVDDVSAEQEETGWSGS
                     SHSRPSNRPGRGGYPLQRHGSLEAVHVSTIEAVTAQLVTDATYTYFGFLHCQRDGVAR
                     RAAGMTEAFSTALQNAFDQEQGDARPLGFAPWRVSGDSGQRYAHRPHAPLLLRTQSRA
                     AHAEWVHFFAVKFNRHLYRLLFPTSSAAAVPKPPLTFRPRGNAEAVAVAEAGADDVLR
                     DHLRKGSHCPRSRTRSLSASSTQRQQHVYDGAASPSASSHHRSYRLPHADEALEGKDR
                     DDAQDEVGTGTCALHRLSNSSSSSIQVGDSCDYGTPAAATVERAAAEARREVRGASLK
                     NTNEAREAFSSRPSTTATPRRDWPSGACEPWWETTAALRYSVAQRDQQLQGQERKMAD
                     MAEALRQHAQRVHSLEENQDSLRTALRDARDRLANVSAAEGGQQWEGRAESSSKYHIH
                     LRHLPPSVTTPRKRHMINPGAFDQPRSPRAPGPTRPDPQHQEQQCELESLQAQLEELQ
                     RRYTEDAVSWRAERAALESRCLASEEKLEHLRSGTSRPSRSPAHQVVHEMGNDDHEIR
                     RGTEGCVDAVSSGQMLSSALAAAENNASAAVHVSRSASKCRRNGGAVPPITVASAPDN
                     AFASLLLTFEPSRGRAGAHAGACVDGALIVDEASARLLFSGPTANQRGRRWELRHRDT
                     DALLRIQLELLSRAPGDARATTGSTSRRRSQAASASSAPTAKTRASSSSAHSRPGHTT
                     PRRPTGAAAGALLPSSSSPPPAWSVHAYDQRSSHHYSPLPVSAAAASCSTASTQPRAH
                     MSSLLQTVNMMPRHTRASLLRQAAVEQKIQVREAEEERGGFM"
     gene            <232366..>236121
                     /locus_tag="LDBPK_150630"
                     /db_xref="GeneID:13392935"
     mRNA            <232366..>236121
                     /locus_tag="LDBPK_150630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859540.1"
                     /db_xref="GeneID:13392935"
     CDS             232366..236121
                     /locus_tag="LDBPK_150630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859588.1"
                     /db_xref="GeneID:13392935"
                     /db_xref="UniProtKB/TrEMBL:E9BCA4"
                     /translation="MSLLRVTQWLTADGKVQIDVTNTSGRTQYPPSQDPPSSLQPSSS
                     KVRRARGIPDRDEPCSLIVSLRSSHPQFFYYRGPQHKQLSFSTSVASHLYAPPPGSAS
                     SAGGVGGCGNNNKHQRGPSSVWGPRVVDPVIEDVSRQAWKDLGFPPIVAPAAGTVKSS
                     AAAPEAASSVVGKSNNGGSGDDRPLLVREELADCVLLPGERRTFLLEVDTPSVLQRLM
                     APLVQQKARITSVPPLRGNAMTQDSCPLPALRGSPPLLGGHSRDTGSKPQPRAAHTHG
                     TEDVTNVPLSESALRATEVFHLSRRESSSMGGKPNPTLFPATRRTAAKDAKSSLGDGQ
                     QQQQQQRALSKRGNGPLQSSRSRSSSSSEISDCDSHSYNSVPQLNKTQHPTRQWAMPW
                     GADDEGDRKGDAADQTPPGNGRRSRRPHEKRDMSDTEDGNDRSLSPQPLSIVQDSMTT
                     RESLDASRLSAATAPSAPGPGPSGGTARDSQLTSRDFTVPSSMSTTAASTPFLAKASR
                     EDSGKPNTHPRVGAAGSGATRTLYDGDANEAANPANDSSDRAQRWLPPASTSQRPTFY
                     VYYAPLGDENKCVDEARKWLLKEQHAYRQWLDKLVRVIVDLERKREQGWIRTSNNSVQ
                     SPHRPLGARRVLPPILGELVRWRTGDGGSGAVIDVMAPSPITAAAFQYYYGNLPLQKI
                     VHRPLSQLSVRSNSIRHSWMGGGSGSNRNAGGVHDKEAVLVLPPSFAATRHNRVSAKA
                     RKMFKEERHGAGTVVLPLQVKAQSAAQPSPKPIVGNGGAVSAATATQPSPSSSQTSEE
                     MCDLSRKSSEPPYSRVWTTMSSPWQLRTYQATSPPHYTMENSSELGDYRGSSTPMSES
                     PRAETGYERPRFKSGCGLALLEDSAATLPTFSRNSLADGMSALPSKTDNTGTPMDLKE
                     SFLSPSSSKVNRTETLDPVAAEMAAAGLPTSRWSSLSGVYGQMHRGFSDSPLQQRPQL
                     PSSPSIGDMASPDSRIPSSSSTGVGGTGAASQGAVRLSYNSPPSSSGAPGNARSADDS
                     AAASSAATAVGRSGSTPTTTSSNGVLKKLSLADIQGAITDGALTATVPAGSFAAQLLQ
                     SICGYGGSAKHDVDEEGNAAPHMRDISSAPPQTLAYRRRSTAVSNSFTGSIFGSSFSM
                     RPQERLNRMADQSMAAGSQVKVAVQQLTATASDLVQQHGPPAMSGLMSLLNFLKDTVF
                     TPENVGMIQMVVAPMVMACSVLVVVYLIFSGEGIGSDVFSLIDGRGL"
     gene            <238428..>239981
                     /locus_tag="LDBPK_150640"
                     /db_xref="GeneID:13392936"
     mRNA            <238428..>239981
                     /locus_tag="LDBPK_150640"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859541.1"
                     /db_xref="GeneID:13392936"
     CDS             238428..239981
                     /locus_tag="LDBPK_150640"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859589.1"
                     /db_xref="GeneID:13392936"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BCA5"
                     /translation="MSPLDACREQYEKDLANQTHCCMLEHVEEENKAANRKVFVRLLR
                     YQQDINTKGTLPFEPDPTDAQKKSKGNSAAPAYPENLTIRDPRQLKQILPIPDIHKVS
                     DCDLIYRFLIARRMDVNLATNDILHYIGFREKYSLDTILWDREVEAVFNGLDGEELMQ
                     QVMEEMKKGASPAAKVKITRPLLQAGWAAWNCGVDKRGHVIFYQRPNPKELAMLEKRW
                     PYIEGQYDCRNPDFHSVTPPYSNLLSRVYLREVEKGRRISRLLNYNQQYIIREGLHVQ
                     TAVKPTSTDTFMDNGGGATCLVDVGSIKLSHLTSSKCKKAFKLFRVLSLTGQSFYPEN
                     MNRMIIINGGFVFNMFFKLVRPWLDPQTQKKIVLLSAANRATLDELSSDSNHMSQSHE
                     TNDSEESDDDGAPAVGADSEKAKYALRDALAEYIHEDFIPSWYGGRLTVVDSPLFYGA
                     SPPKSLAENPQYAAACERLRARVVPQLLPDAFIFANAKEREGVGQEEWEAFCGMTERT
                     LFRKQASTK"
     gene            <242464..>243810
                     /locus_tag="LDBPK_150650"
                     /db_xref="GeneID:13392937"
     mRNA            <242464..>243810
                     /locus_tag="LDBPK_150650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859542.1"
                     /db_xref="GeneID:13392937"
     CDS             242464..243810
                     /locus_tag="LDBPK_150650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859590.1"
                     /db_xref="GeneID:13392937"
                     /db_xref="UniProtKB/TrEMBL:E9BCA6"
                     /translation="MSQTATAGPAPPPPEEPLTYPITFTKVAKESPQSEPGVAAPAAS
                     SGLHQITIFSALHWLLPVYELAGWLPKTTVQHSRKSGDKSSLVSATAGGSKSTSATAA
                     DGSFDLDAIPHDDVRAALRLLPVFEKFFVEGSKIIPQHTDLFYFIESFTLPTPKGPKV
                     ITRSKVEGDYRAVHQPSHAPASLGAAGAMTETTVTNSTAYFSLLPGHNQFLLYYEDCE
                     KLRRFTYLQLDQLRFAWVAVKELLEESKVFNLSDGSLTGLAKRDLQKNNAASPFCLAS
                     SAPAAAATESAAGNGNGSNGGAVIGRGGGNARLRQGTSGNVIIAPSREATEEKKRIQQ
                     MRFLREELESECQRRWPYTPVSKSCIFSLEEKIEAELPADALEQLGIVGAHNTKNSKN
                     GNRRGPRYYLATVDLPLLNKKGGAARFKSPRWWNNRRDAESAAAEATLLALRSMKS"
     gene            <248228..>251083
                     /locus_tag="LDBPK_150660"
                     /db_xref="GeneID:13393005"
     mRNA            <248228..>251083
                     /locus_tag="LDBPK_150660"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859543.1"
                     /db_xref="GeneID:13393005"
     CDS             248228..251083
                     /locus_tag="LDBPK_150660"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859591.1"
                     /db_xref="GeneID:13393005"
                     /db_xref="UniProtKB/TrEMBL:E9BCA7"
                     /translation="MEPGTHPQPHPSASYSQSTSSSQQYLQIRTDTTVVSSINSSSAA
                     DQSSKSASAAVAASSSGPSYEGLCMAVPHSPVTAPVHQPYTTRAQQSQAPHHRTSPKS
                     RSSPHRCAVSSTSMTCSSVGDADNLGLHRRHNNPREAYGGQCQNSLGHQLQQQHNHHQ
                     ADALPQPLERRSSDVVGAVSRSLNMHNDPELEGLPPMHCGNEGEDEVVGRAGGAVGTA
                     GHATTLYSKGFLIATASAKDASASRGNDGGGTYIPPHLHDGKEQQTPREDGEASLSQA
                     SQSRSPLASTSTGVSHRLLTADEINERRRASWGASRSVSQVHSVVAGPAAGDNAGGHK
                     KAGNALTSVQSTRKNLSTASGVSKGSRPAHRQLTKEEADQLIAHRQQQRTAEAVPVAA
                     AAKDVPAQQQQQQQQHGLSSLLANTPNNNQSGILHSAPPDSAKPWLLSGDGTQANYFP
                     PEPASTPPVASTSTVGDGGNTSTKPMAFEWLRGASAGDTGGVGGGANGAGLFSESTVH
                     SWPGVNGWRDSNLIGSSVNGGNVNTAMAAFLGAAGGAAGDGGSNGNFNASAAALARAG
                     QTPGGTSTAAFTWLPHTSNWSPRNQQQQQQQQQALFSFVPATPPQVCAVSGGTNPNTW
                     GYSNTAMGFTGGSLRSGSLTFLSSPPTPAALQGVSQERIEECIRQCDGQLEQLRHERE
                     QLVQELQRRLYASADGEKQQQQQQQQHNHADTASWPGALGPHAGTIPSSLMDTITAEP
                     SMLPRGTATSGTGAIGGGGSAVRQRPLWPFFGDLIVDGNGVAKTLPRGPVGTRELPGP
                     YMEPTVEVDSAEWAGRAATAAASHQRPGSSGSATVVGPAHQAAASTGAVGRSVGNWTA
                     GERSGGRGRRRAETGNQRNNNDGNNNGASSSAGARATTFNAGGGGHSNSNRCSHDNTP
                     QEQKYLQTDPFSMYMHNKKIATAGVPTAQGSSKAAAA"
     gap             251506..251604
                     /estimated_length=99
     gap             252904..253002
                     /estimated_length=99
     gene            <257024..>261124
                     /locus_tag="LDBPK_150670"
                     /db_xref="GeneID:13393006"
     mRNA            <257024..>261124
                     /locus_tag="LDBPK_150670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859544.1"
                     /db_xref="GeneID:13393006"
     CDS             257024..261124
                     /locus_tag="LDBPK_150670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859592.1"
                     /db_xref="GeneID:13393006"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:E9BCA8"
                     /translation="MSTVPQYMGCFTLLYADPEVKEQHQYLQPLYGLTADDDPPAPLQ
                     LPWGFSQDASASTSSISSSLTSQDDVQGSIAGSQRTASVDEPAAQRHKHSQTTAGALP
                     RPTNSPGAKDDDDSEARQAPTAAPVRPPRKINHVGLSLYPDLSTGIVGPQPVFGGAAL
                     SAAEPATTTTTSSAPSAAAAGVPQPYLFASNGTPMLSSVVDPDALQKLQEARRPYPAP
                     QPRSGHVLLPCPERGSLIMFGGLGNVPFNDVWEYDVRTGRWAELPCVPASEDEEDEEE
                     LLATQQRRSHMQRSGNRHLEDEDAATSIGTPSITSSSSGDEDDDDDSDDMHEGDEEGT
                     RAAAQRLPRRRQCRNMPPPAYGQAASLYQDVNGETCMAILGGISVGDICCSGFFSLNL
                     NRLTWRRVQTTIPFFDMWGATAQTLYAPRRSSVLYTATTPGAAADEERGGDEGNGTRV
                     SAEEQVVVLFGGMTEEGEVVRPVTHLFHFDHRLTAAEIDSNPDMYLKSIEYEKSEYAR
                     IMRRVLAEEDIADVHTTGENGLSPSIETRCSQWREAHPNTLMRWRRRALEKMAGKYWV
                     EYLPAPEDLHGRRRSTSAAYKRHFMYIFGGRDDFYFYNDLWCLNLITRTWVQVREGVP
                     PHLLRSFLAEPYNPMYGILINDRGAQLRQETITKTEAKLLHNSTNGTINPMYRARDVH
                     HALFASSVNSSARARTGACMVVDVQRDCLYVYGGFSYTGQQHLTFFDLHAFYIGENVW
                     RRVCICRERPWEVMIDAAADAVGIVNPAEEGRPYARHASPSSAAGAGGQTMGSGAPSL
                     PPTLMGYAARYLQGDPFTTASASGILVAASLGPPLAPRGSRTSRMPNTHSAPGAHRNC
                     FHLPSFVPEARTMAAMVEDPVHPGARFFLHGGRSGEEACGDFFELRTYVGRTVDMEYM
                     KLHRAAREEVVGLVSTRSSAGTNTLATPSASLSNPPATSVTTSFLTAAGAASGLSATD
                     AARLQWNSRRQLQRQLVSAALETQEGFEDMPAAHYSSINDTVPLPRRTLRDAATRWIR
                     DGLAAVDPKSLMFVELRNGHAVVNLRTHIHYLSRLSLLGGGSGDGSGHAEHGERGSAA
                     AVATTGASSTSSAANYTLNARTGTLAGTGSNISASSALATPMQFESMDGHLKRSARSL
                     ELLLYDVLLSKPINNGGGAGVGCSGGAARASCHRRTCSSTHMPGIEPATSPSTRGVAM
                     ATSPEVLGMFPSYPGSVVGGSPGTSPGGGTPLPTSPQVQIVSRAQYSTPRTPQVLSMT
                     LSGNSGGTAQQQQQQQLSTSFPSQGGDSTVLAARDARASSPALTSGSSSFCGSGGVGG
                     AGFSTCGPVSGGASPANNEYAYHVLFRSLFHHEPFYRPSYAADKKR"
     gene            <265998..>268094
                     /locus_tag="LDBPK_150680"
                     /db_xref="GeneID:13393007"
     mRNA            <265998..>268094
                     /locus_tag="LDBPK_150680"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859545.1"
                     /db_xref="GeneID:13393007"
     CDS             265998..268094
                     /locus_tag="LDBPK_150680"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859593.1"
                     /db_xref="GeneID:13393007"
                     /db_xref="UniProtKB/TrEMBL:E9BCA9"
                     /translation="MSASSVPREDSQEPQRVSVSPLATPNMSPAATQPPQQQPVKAAA
                     MMTSPIMNSGTTPRLLFTWDPYRNVSSSPGNTSAVTGGAVAKPPEEEVVEEGRLASSI
                     DGCSTTSSVNNTNTGAETSAGVNSATRGTSNSVAPSSVATPGGARPPLTISALLGGAG
                     YPNRGSPQLSATTVSLSQQQQMLHQSPNSDACVAPGSSHSTPSGPVLKRISTSAKDGR
                     QYFLDYSPSPASNSGAPAALAAGGMPNLMLPPNMSPMTTVTSPPAPALSQQRHQPPGG
                     MELLDSDGNSSTNISPQAVPLMSPPRSSSSNAGAYPSYGAVAAANSHSILSATPLPPM
                     SGMAQHNPYRTPSIFYATAHSTSPATQQQQQQQQQHVLHHQDIDDNDADLVYALESDP
                     SAFIVRLLPPPPPLPELARVLTVPGVVQSLCARWCTYVAAVLKSDAFAAITAAPPPPP
                     SSVTMSREGSNGSTKEELAAWYETAVDWWEKLDQEGTGAVDVRAKSRTVAAAVEVVAS
                     GRSRRQPSQNTSGSANGGRYNPQGGLGASGCRGRGGRGYHAGMGTYGYAASTTGHRGG
                     AHPRGGAAAAAAAVGGMATGAHNTGAAATGYRGGRGSGGGSGYSYDAAMSGGDNQHDI
                     PDEVDPAMHCNTAYYPSSNFNPYAESWHFSGTTGMATGAQQQQQPQQMQSSYTKGARP
                     SQQLQQQQRGYGAMNM"
     gene            <273099..>274529
                     /locus_tag="LDBPK_150690"
                     /db_xref="GeneID:13393008"
     mRNA            <273099..>274529
                     /locus_tag="LDBPK_150690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859546.1"
                     /db_xref="GeneID:13393008"
     CDS             273099..274529
                     /locus_tag="LDBPK_150690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859594.1"
                     /db_xref="GeneID:13393008"
                     /db_xref="UniProtKB/TrEMBL:E9BCB0"
                     /translation="MTSGAGIDGGVSGMAGGGRGMGSMLNTKTAASGMDINSPNSYSM
                     VQAQGMMGMMPYMMSGGSAGGAGGGGHGVMGSGRMGTGSPNSFLPPPGEDTDQQELMR
                     LQQTNYRVKMLPPPLTYEVHRKIWSRNEYGDEDDNDEDDVHGPGHGGAGGNVDQEHES
                     SGGGSIANEDPIDKEQRLEAYKQIMLRWYSHIHVLEGKPEVAKRLVRVRRACPSMEEV
                     VYSLTHPQQPGAALETEAGGDDEPTPTAVPPTLMAAAARRGSDGMPDMEEILATWSSR
                     CWNWWQETVKRKPRRARKQGELPIAGGNGASGTNMPTTALPLAGMANGAVMPRNPSSR
                     NMDMGDSAVPPPPPHLTGGGGGPYTYPSSYANHDGSGTAGGMPVVPSYKSFTDLSEEG
                     MDGPAATSGSLSHYSPHHNDGGSLAPSQAQPSHPALPHDASPMASMFTVNGPRTATLR
                     GTSEDFLENDHLTLAFTTELLKSLEE"
     gap             275089..275187
                     /estimated_length=99
     gap             276175..280439
                     /estimated_length=4265
     gene            <282190..>285291
                     /locus_tag="LDBPK_150700"
                     /db_xref="GeneID:13393009"
     mRNA            <282190..>285291
                     /locus_tag="LDBPK_150700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859547.1"
                     /db_xref="GeneID:13393009"
     CDS             282190..285291
                     /locus_tag="LDBPK_150700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859595.1"
                     /db_xref="GeneID:13393009"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="UniProtKB/TrEMBL:E9BCB1"
                     /translation="MVRTREKKPKGDSAFTTRRQKVGRKKLAPATATRAEVHARTLRL
                     TTSTAMSAAMAAPYVKDPAAHPASSETTSAGMKDSESKSKRLIIAVQSFSELLSATHH
                     YKAAQRSSAFATLTRLLRIQREKDNAAGAGAARHSGGAASNVFEEYMRYSASTNATAD
                     AAGVPFSSGAPPTRLSSLSPLERLKSFAAALEAVTDTDDDVRREALQALQVLVDYQWI
                     SCERDGSVAPTPSSFLEPTSTRKAADLERCNARLLSMQDGDGGRSGSAEVPVAISAST
                     STSSTSVDRVQTILQAVHVALTHALKPVRLSGVELLSLLLRVAPPSLVRAAARAVCKH
                     QTSYYATPAATATSAAGTATTAALEAAQERAATLLEEEEVWMLTLVRRVSSLVLRTKH
                     VPVLPALLGVFLGESGIGASGATAEDSITAELLRTPPLLGGVVASHVMSASGASDAVD
                     GSSGGALWRYPELVNSFFDDVAPQWANNWKELMELRLALLRQDDKLAMASALARSFAI
                     VLVFLKRQQQQGLSSRAGRSGSVNFFSRKRMHYIKALFIEKMPVTMHELLLMPSAGAS
                     VASSTTAPTAAATAPPKAMKARLELGLALVMVCVPLAGTEEGWHLMRDYFSIVFSLPR
                     ATPPPPEPFRFPSVALLEMSVRLFAQAIRLYPCVAPQFQVAGDTAAVPPGRNTGLGDF
                     SVPLVSCSDAKCDGPRRAKRDRGDAAGPAVSSQATPSFHQHRTVAERLLTFLPAVLTT
                     IIKHLVPRSDSLNSGAGDAASDDMALVRVLLCAATILERFAALPEDLFRRGGAVRRKG
                     HGGKTDGGCGDAATTAQRLEEGFGLVPRLLFALREQSQMRQRKPDAVKRARAEDEDDG
                     DNHVGDAPAQTDDSAATPVVTRTGVLLSYNGIVDVLVHRFLRVLWFLSSSGHPLLHDR
                     RTTSTGKAASSPASTSVSPSAPLAALLTKSIKFLFGSAGVSGVLQRCTTPTVLLAHST
                     LFYLGGGGGSASSPIALVGSADAVSVAAAETERTPMAEAVERWADVLGVIGALRARVH
                     MDA"
     gene            <286006..>286611
                     /locus_tag="LDBPK_150710"
                     /db_xref="GeneID:13393010"
     mRNA            <286006..>286611
                     /locus_tag="LDBPK_150710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859548.1"
                     /db_xref="GeneID:13393010"
     CDS             286006..286611
                     /locus_tag="LDBPK_150710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859596.1"
                     /db_xref="GeneID:13393010"
                     /db_xref="UniProtKB/TrEMBL:E9BCB2"
                     /translation="MSSQQHAFEKSREQAKEYLSKDAMKELRASLDPSATRARHGLLP
                     KDFQTTDEEHERRVNDYIRSHSTWRKDVYVLRSYEYWKLRADYYPYIRRSDEKDNFFL
                     RGITCHPRLSDYPVCKAVIRDYFVCRDRNPVLQIFNACAPLKEQFCACINEVFLKNHE
                     RGDKKFNAHRDEFFEVQRSKRFAKMLNHVEESMEAKTKLQD"
     gene            <287356..>288831
                     /locus_tag="LDBPK_150720"
                     /db_xref="GeneID:13392938"
     mRNA            <287356..>288831
                     /locus_tag="LDBPK_150720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859549.1"
                     /db_xref="GeneID:13392938"
     CDS             287356..288831
                     /locus_tag="LDBPK_150720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859597.1"
                     /db_xref="GeneID:13392938"
                     /db_xref="GOA:E9BCB3"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:E9BCB3"
                     /translation="MAAVFMRVGELACQKDSFLRELTATVVSCEPAKTAVAAAKKAKG
                     ASSDTVTYDVILSDSVLFPEGGGQPCDHGTLRVVSGDNDKADPSCGATAAPPLSITNV
                     RRVGDTCVLTSPAALPVGATVHQMVDWPRRMDHMQHHTGQHLLTAVVEREDTLRLPTV
                     SWSLTHPYCFIQVDVGGYASDPASPYHAYITKEKKISDEMVAKIEVLCNDAIAQSTAV
                     QCDVFENREVYMREQDRRHQTAAASADGGTEAFRSRGIPEDVTGPIRIISLDAIDSCT
                     CCGTHLRTLAELQAMYLLHQEVKGTLVKLYFITGKRAARQFHAMYHRERQLMPELGGS
                     RPNDFVSVVQRRSKDATDLEKLMKRWTLELASVEAQRIAAAVPASHAATVTVPLRRDD
                     VDLEFFNEVRARLDAAGLRRVVLVSAWAAERCTAGTLASAKDVAGQVFVTGGETPADM
                     EKAVQLVKETLEGMKGGTSKLGFRGKGSLKEWDTLVARLKE"
     gene            <290173..>293019
                     /locus_tag="LDBPK_150740"
                     /db_xref="GeneID:13392939"
     mRNA            <290173..>293019
                     /locus_tag="LDBPK_150740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859550.1"
                     /db_xref="GeneID:13392939"
     CDS             290173..293019
                     /locus_tag="LDBPK_150740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859598.1"
                     /db_xref="GeneID:13392939"
                     /db_xref="UniProtKB/TrEMBL:E9BCB4"
                     /translation="MRYLLFFFNALIPATAAAADWASSPAAPTRGRWGVAPPDAMGML
                     HTTATTPPSHDSVWHLYHFHHSAEAKPHVVQLEKLHIVREDIADPAAAVSPTSRCAPS
                     ELRTAEVQAQLLSFAQACATQTVARNLTYMTAPSSPSSASPPPSARPEGVPQGETFAH
                     GSTLHVLKQQQRQADRLQRVLHFLLSATGHRPRFHDRLWGATNDAEREFIRKARRGAA
                     STDTKPAKRRNPLSPSSSLAAAAPHSPPARVRPMSWIDDQETSVKVLLFDDDTRSVGD
                     AAAVQEERSKLLASIAKNWRTAYASHFYPCVANGSEPGSPLPRFPASSFPVSATAAAT
                     AGGGAASPVPDAERSRREQQLNGGHVTWEQVYRRFRDGSSATIRSTARMQHQAAAQRG
                     DVGSDDDAAIPSSSNPLFDLHLLGYEKRKQVYAAMLASTVEVPEGMGAFFGTCVSESF
                     LRWWCWRNRRRTEASQALVAPPANAVGDDRGRLPVRRHIALAPFTAACDDASPPRSLW
                     VVRVAARDPHDDIGRGEAEDESVTYSSSYSDVSTTTSNTSSHTLASSSIRFSEEREEE
                     NEFSTAEDSSELETAHAVAADEEPHVATAEASSPSQTPPTPSYHPPVAVLFPLPHMFT
                     YWFMMHHVSFYSHQVYRRMWGDQELTIAVWSRILSPTGHSAECRLFYSLRCATFPRMF
                     TKMMFTPGVLPSLTLQGKMSERSPYCSPSSSSAYDSQSLSADADGNAGSTPGSSSAST
                     GDKPVDSRQIYDLFWTGFGRVEVDSGPTISRSNMVRLRIALGLPADFPMGLLWNVVMF
                     ASGIGPLILKEHRHSLHFNYAKTFTDVVADEFGELACFGLGAQSPSRRNDSTAMANPL
                     DAEAVMWGRHAVSAMAPAVGQGQVVRTAGNNQETPEADEQAVNELDPAHHDTSSDPTP
                     LTGITNWSWDLDSEFSSDEAYWSLPGSDVSSGYQ"
     gene            <294700..>304062
                     /locus_tag="LDBPK_150750"
                     /db_xref="GeneID:13392940"
     mRNA            <294700..>304062
                     /locus_tag="LDBPK_150750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859551.1"
                     /db_xref="GeneID:13392940"
     CDS             294700..304062
                     /locus_tag="LDBPK_150750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859599.1"
                     /db_xref="GeneID:13392940"
                     /db_xref="UniProtKB/TrEMBL:E9BCB5"
                     /translation="MSASTPASTPTFTGAPWYRAFQLFSEAVQQHHVSPTAQHFNLLL
                     YIAQQHALWGRVDDVEEFWARLLSSVQQLRREKMRDKRRAEQAEWKGGERVGRHRTTP
                     ELAQLTSSSLSTHTPPASASPSSSIATPTPAITAAATTRQMDELNEMEQALMPNAQTY
                     ELLLGGALARGMWGRALEYCALRTRSGVAMMTDVSVRQVLQAYILAGASGAVTHATRS
                     HTEASPSSPAPYRPRTDERGQLLRAAAQPQRSSNHSTAQGGSAQQSYWSAALHFFRRS
                     FHRVSSMHTVWCMVTLLHRANHPAELVRVVREDCERLVQRSLRSLAAHALTSVERAAL
                     LQTLKMVSDAACELGDWRTALQMLREAVELRHQLLSERTALLEQLWGVPHPSGEAGMP
                     FAAVAGGDAASGAPGAPLSHTTTQHLASPDLIGAGSSDEDARLDEVHLSQYVLKNTLH
                     TLRRVRRYAQVIDLYRDTPGPPAAAVDAAAGAAREEEDDDGTVVWRSMWTPRAVGYVA
                     QAALAVRDLGLLLELCGLTPHGLEVATGNAAVSLSTPTEVYDATLRLIQYHIVRQRCE
                     EEKSGVGPSTAATAAKGRDRLQWDVLSQRVYGVYRKRALRTLAEETSPYHVYLERTCH
                     ALSSGGEGRAAVARSATAVAAVAEFDAPLLSSSHNSLIQLLAQSLQSGVDSSTVTTSL
                     QEEALKQLQRIRRPDTLAIALVMDILRIEAFQRRFSGEEAQSLLAAVQQVLDTILAEQ
                     HIESIQLLSMSPHGSATHGPNGSGSAQSHQSLHYHRCRSGSASLAASRPGAAEVGSKL
                     TPAQLASLSTLTAAAVHMSFDILARVQPLTLLAYIPACVELAWLPSAAAPAQLQLAQQ
                     AVVQWADEELKRGAILAAEPQRAAMTQMRSAANGIVGSGGAAATRSDAMDASPAAIQA
                     SGRSAVAHFVLTYTQFFSRKAITSSGTPPLVAGSSTAAAAASGRAVLDAAAQILVQLQ
                     RSKPGHPPTAAMSAFISALRHAWTVKTSPAHGPLPLETTLLHNAELEPVVVTSLNAVV
                     QQVGASTVGRWTMWGDCVDMLMTYMDSPLATTRRRGTQMEKGPAAVMQSRPDSWRRAE
                     ATYETLRVLHMFIRLCDKAETGFVERVTMDWLLLGADSTRSSSTGGGECAYRESSDKD
                     ASRHSMVITPVEHLRCLCELAHKQLRRAPPAPHEPFSPPELESMQLLLDALTWACRRQ
                     AKPLVRRLYGTLAPWLDTLLQDAALPPPPPPTSRARSVAAGAESAVEKGELLHQQLSR
                     LRETALTACMTVAQCLSSGPRVEVLQDWQLQLRALRQLTNQGNGPVPLSDFGSQRKAA
                     ALIDGIAAVAVKLKRTWRYLLTELALDSHRAVCEARRRRSASSSLQPLQLPEAVLRHR
                     KDVEDAAESFAAWCSAELLPRLVLSCLRACVEHEALRGTAPTIAPPPGATPSSPRALV
                     TAALHKVVDAVWDVDFAAFVWKVNFCAREGVDDDGARVQTLARLRTRGYRTLSMELCW
                     PNPDGASQRLARHLHIWILFAVHGAPVRAAVAALCRDLATLDVFRGTRRATACAAAQS
                     DESAAGCTATAASSMPFFLFFAQEVDTLTEAKVAEALSYASCANSAATAAAAPAAGID
                     GSSSHVAELARMADGRTAMEHLTKPLAHYTPSVLRVVQQAAQWVLYLTLCEGTTDVQA
                     AGGVAEAVHAHSSFLLSVVAQKPRSVGCAATGRAALPSALLLRRCLAWTGQAPAYHAL
                     LRVIEATAHETLREPEAVVYVFRYMERLGRAAEGADAATRDGETILSPSPVEAFLAFY
                     MSSNTLRRASPVSERVCLAALLACAANMRRGDAAASPPTVDLLTLLTAFTHVVSDLLV
                     TEWQQGRLSPHQSAVLTEWMLRFLWGGVPVSPMDASTASLKRYGVVTAAAADGNVAVV
                     ASAALPLRRASMQWLLVTRGTIVPPPLRDEGAEASKLSACAADDSAPQTPPSQAAASA
                     ERIASLVTALDRASQRFAACLGGVVVSPSAAAALRGDSSSMLSRESLASELPPRHLSI
                     SSPSADANLVRTVLQQLSTRHAAQQLLHRYQSSRGALRSPVRVRDTEAEVLVQVLPED
                     ARDSAKATLRGGADPAASYDSDSAREASRKMARNQARRSVRLTPAANEEEAAELESWL
                     DAAVASLTSTTPGLAPPPPLPVILRCSEQEGGRTWRTLYMQLLSVTKNVHQGREERTH
                     SAARASESLHNLDGYVRRRAVMLRPALLRLMSNLAGTSSCLDPASPSPDDGVGPCVCS
                     LLLMCYVLLPLRSLRPPPSLAEVLAVVRQELWRLLVTCSSASGAGECAPHVSGYLPRT
                     PYNALVQLCVRPLMLEALPQLRLPTFASSESGAAAFEAVAFGLLLVHRVSADVVEIRA
                     LSSTLADTAAIYASHRSTVPDANAVNTLQQTARELLHLAGQELYHLHTSFGLAASSPE
                     LLQMLYRRLVRAWMQAGVLLGDARSLLWCGQRLTAWSLQKQQEATALAWIAEGYGAVS
                     ASTAQSSEVVEADAATEWLCVLPVAVLLAAVCSPALRSSTGISEALSSLASVLPLPQS
                     IRDTASNSQYDSVVVAADEYVSLFRHWQQLLQGHVTEAASRYRGCQHQHWLSCHSPFA
                     VILHGSVPANATPALMEEVRRQVEEYLAGSATWYPPQSQQVTPVSSDVAPALGGGDSS
                     SSSHATIAAADLCAAFQCVKDASESDMRAFMRLEAAKRAPGGEGVVRGALKKALEVQA
                     AWRLIHRAALQERQQCGSGSGAAAPWTPLVPPAAWRAYLLNLHPVVPHSVHFVPMAVT
                     EVLMLQSCTTWTEGLAVLEHSLRTLHRSGATPVQQYMAQLLLERVRRTEGSAEGFKAA
                     DGRVEEHHFCTELETYTYTVLQQQPTEEETSGGKQVAFPRWRLWSQHMAQRSTHGTAA
                     LVCRIVDLMFIHHMRTTRASARDTITFSPSVLAKHTLMEALRCGVHDPALTRVLFRLF
                     WAEQHRRVEGAHVFLSALRAAKLARSDALALEAMLTYLRVSDANAATTQRTAEWSSRV
                     LQVINACEARSTIPGSRVPSSGFSSVSAWQHLKAAVEEAAELQGPTHRFSVEAHRATW
                     KSWTVLCRLQVVPKDVALCVVHLFKQYDRLTEVEELMVVTCYDMTMVQADRRVGGGDA
                     EE"
     gene            <304669..>306636
                     /locus_tag="LDBPK_150760"
                     /db_xref="GeneID:13392941"
     mRNA            <304669..>306636
                     /locus_tag="LDBPK_150760"
                     /product="flavoprotein monooxygenase, putative"
                     /transcript_id="XM_003859552.1"
                     /db_xref="GeneID:13392941"
     CDS             304669..306636
                     /locus_tag="LDBPK_150760"
                     /codon_start=1
                     /product="flavoprotein monooxygenase, putative"
                     /protein_id="XP_003859600.1"
                     /db_xref="GeneID:13392941"
                     /db_xref="GOA:E9BCB6"
                     /db_xref="UniProtKB/TrEMBL:E9BCB6"
                     /translation="MLRRAYRLLGSTNRYTDGSGRALEPNSIPRDLYVQTISNRAYPV
                     QGEYWQPVTAGKPSPHKGNVIISGAGVVGLTMSAQFALRGWHTTVIERSPPLQQVKDK
                     PMQTAAAASDASAGAVDLTVSPSPPSPPLSLQPYRGPLRRPHFGAASEQSSSISAGSR
                     DDDGMAGVASSSGLAESSSPSRYSPFIELQYALVTRRALDALEAAGVRLHAIRHLGVK
                     VRGVMDHPGAYNSWITAGLTEHHPFAVNMLSMDLFQLRRLLEEHVAHSLPSANLQVFY
                     EHVIEAVYPLRQQLVVCPWENSTLARQWAESSVGSSTSSPTEEGRTAQLVAEVRQPRR
                     QPHTSLTLSARKWEKKYADDAVDYDLLVSAEGVSSHLRDLVDVEGFVADVDMGVRWCL
                     LRSDQLSHEHVHRWLHRRRTTAITSAQSYHVQTAHQVPLTLAFPRIEGSNLFSVMVYA
                     PQGELAGLDDVEMLRYYLPDLASSSSSSPAAAELRSFVTDAQAYPTVYCEQLYNTVGL
                     PSAVLVGDAAHTCNPFWMQSLALGLEDGANLLNQVDAYSRHFYDAVKQYSNERGSSGD
                     ALRELTDKCLYYERRKHVSPFIRFQNSYQHFMNVCMPRGWNTLYEGSVNHVYSRSIED
                     MLNSRGYTSYDYAEKQQAKHRLFYHLGRLYT"
     gene            <307582..>308715
                     /locus_tag="LDBPK_150770"
                     /db_xref="GeneID:13392942"
     mRNA            <307582..>308715
                     /locus_tag="LDBPK_150770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859553.1"
                     /db_xref="GeneID:13392942"
     CDS             307582..308715
                     /locus_tag="LDBPK_150770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859601.1"
                     /db_xref="GeneID:13392942"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BCB7"
                     /translation="MDSSAGGFFFPFGSPSTTDRCPGATTVDAADSTSSTLGTAVPSP
                     PIWPPAKISTATFPWVSLDSDTLHEWAAGCCCVAPSNNVKCNLSTKPLQLKLRAVLPA
                     SAEGAPGEASSSADAKRSDIFTLCYQTSPEVDTLTSVAATQTPEMTPSSSAKRERRDV
                     VPGRYYGGLKVWSCAVLLAEYLANHAAQYRSLFEAAVVVAELGCGQGLPGLAAMCLGA
                     RRVVFQDYNEEVLNVCTKPNVAATVCANESLQLSQGGVGTTPLLHVKFVHGDWVDLSW
                     ESQGAASSSAGLEAFCDVILGSDVTFDKDACDRLACVLHRWLRPYTGTAIIVSKDYYF
                     GTNGGYLEFTESAEPYGLRVELLKRVDTADKMPHVVLRVTHAA"
     gene            <311274..>311996
                     /locus_tag="LDBPK_150780"
                     /db_xref="GeneID:13392943"
     mRNA            <311274..>311996
                     /locus_tag="LDBPK_150780"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859554.1"
                     /db_xref="GeneID:13392943"
     CDS             311274..311996
                     /locus_tag="LDBPK_150780"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859602.1"
                     /db_xref="GeneID:13392943"
                     /db_xref="InterPro:IPR021299"
                     /db_xref="UniProtKB/TrEMBL:E9BCB8"
                     /translation="MHADIICFLFHDVYIPLPPSFSWSPFLVLLWRRPVGARAFSADG
                     CCPPHPTHTPSPHGSTFQNNIRFSCVSIARHTAILFTLARTFPQFKMEKLVRASMNYT
                     IFGLASGVYWRELTKHLKYVSNGTSQLRVMHTHCFALGSFFFLFVLLLEKCFALTKQK
                     NYKKFYITYNIGLGITLMIMMIHGTLTVMGNDQNSRLISWTAGLGHIFLSVGFGYFYN
                     VLLSAVRASGDKAGKKTVTASP"
     gap             319312..319410
                     /estimated_length=99
     gene            complement(<320021..>322015)
                     /locus_tag="LDBPK_150790"
                     /db_xref="GeneID:13392944"
     mRNA            complement(<320021..>322015)
                     /locus_tag="LDBPK_150790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859555.1"
                     /db_xref="GeneID:13392944"
     CDS             complement(320021..322015)
                     /locus_tag="LDBPK_150790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859603.1"
                     /db_xref="GeneID:13392944"
                     /db_xref="UniProtKB/TrEMBL:E9BCB9"
                     /translation="MMSFPRDDCGSSSSSSSMPAAPPQQRQHHLLQQQPHPAQMPTAP
                     SQEHVQYSISPGPYNSSTAATILTADQHQQCDLQQRLLQHKPPAVNMYTPTSASLVDV
                     GGPLGAQSAMTSMQQQQHHHVAPSLSKHSSLSELNNPNAIQLHGLLPETSAAASVPGL
                     FLTAPTSSSPAHRRPSVLNSNDNSGPSTSSPLPLAQRLQPAFVDTTSSASILSSSSPD
                     PQQLHRTAAITPFTTCPPLAHRAPPPVAAYPASPHSPAGYGSGGIPSPLQQHQHQQLH
                     FLSVGANAAAPEGLVPFAASTAPPSLPSPGAVATPTTATATSLSVLAGLDDLQQAHER
                     PFRFKVLPPPPTFDGFLMLWETNASDRRSSGATTMGEDTSSNSITQQQQRIAHGGGHS
                     RGGAAPAMERGDVEAVLRASTSERAEPRRSASDFGALSAAEDDGASDGAAPCKAAAAV
                     DVHDKTRISGESGQSTPERRAMVAQYRQILERWWAYMVTFASKPEVRQRLGNMRLCPS
                     FADAHQAAAAASPVGSGSGVLDGVPTDAWQTNVLTAPAASADPFIAEEVVLQAWSTLL
                     LQWWEETKQRRLPRRSRHGAPRRGAPPTRMDDDGVDSTRSGNERRDAASSESVHSYEL
                     PSAEEGRLTRSLPPPDHDVLLHFDFTIPSASSSQADSLQL"
     gene            complement(<325562..>333601)
                     /locus_tag="LDBPK_150800"
                     /db_xref="GeneID:13393011"
     mRNA            complement(<325562..>333601)
                     /locus_tag="LDBPK_150800"
                     /product="ATP-binding cassette protein subfamily A, member
                     7, putative"
                     /transcript_id="XM_003859556.1"
                     /db_xref="GeneID:13393011"
     CDS             complement(325562..333601)
                     /locus_tag="LDBPK_150800"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily A, member
                     7, putative"
                     /protein_id="XP_003859604.1"
                     /db_xref="GeneID:13393011"
                     /db_xref="GOA:E9BCC0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BCC0"
                     /translation="MQLTSKGNRDAATRQSDGGAKTGAVAVAAACPEAPPSPPLHSYV
                     FPTAQELVSPAAPFSSSKSEDVLEIETPNPVAAAAGGCRPAAERRASRVRFLLALEPF
                     FEPRSAEPSDGLWNRADGDSVSLGHSNELHRTLSVSAAQLEPYSVITKTGGVHISRWT
                     QVLALLQRTGQQYMRQKLLIIAEVVSPLLFVVLLIILNVAFGTDSIPETVFTAPVVYS
                     YQLNLHDYMTYICYNDTTRPINGLHPCAHLEVPYSCDGDESGIPVYGLCYLSGFKKPA
                     MVVKHYVNSLMGIIISLPSLDSIIVHQWMAKKAGLAKDSRSRTALAALSNIGIGLSAT
                     TRFDSISYSGLLYFAPAANTPAALIEYFRKHCAMFEYVYGGVFDTVEEAHAVIKANGS
                     DEVLNSTWGLIIVNDITDGFDVQVQLHSSALPSLSSPTVSLEFRGGFTYDGTDMFLAS
                     GFLSLQQMLYTYFYESRAEAGALTNLHNGAVSPYTFKEIYPVIASYPTIAAHTPYLLS
                     LSPSLVALVMVMSLLYPFAQVTKRVVLEKELCIQESVCIMGLRRSSLWLNFLLVIFFE
                     YVLISILLTVLLCAVVAPRSDPFAVFIILFVYSLTLIPLCGLVSAFLSRARMATLVSP
                     LIYFVLSMPIFAMGTANRSIVIGLSLLSPTALASLLTDVFIVEAGGGFQMHHFKSPHF
                     NAEPYLIMIILACDCVLYLLLMIYLNAVLPQEWGTRKHPLFFIIEPWVWLKDTCGICR
                     RNAQRGSASEPASEPTGTTTALDVVRLTKERHESGTATATSQKQQRPGALAFDPRISR
                     DSSTDDEKNIGVRISHLCKYFQRNGKRFAAVDNVSWNMYRGEIAVLLGPNGAGKSTTI
                     NMITGMLAADSGDCFIEGHSITQNVAEARHEIGYCPQHNILWPDLTCREHLEFYGKIK
                     GLRGAELEDAVVDILRSVDLEEKVDAIPAQMSCGQKRKLSVAISFVGRNRVVLLDEPT
                     AGMDTAARRHTWSLLRAMTQHHTIMLTTHFMDEADLLGDNIAIVTEGVLQCAGSTAFL
                     RQYAGVGYTLRFDLTPVPAQEDGDAARQAKVAAVWAELHQLVMSHLPDSTLVLQTDAE
                     VVYQLRLSTDARLPEFLKDMESRGNRQLHIRGYALRAPTLEDVFMRVVEHQIAPSSQV
                     AVVRAADEAAAREQVAGEKDGGRTSSGPPAAPSSPLVRHFVNRRMSRASLHYLNNEST
                     LNYGNNAEPSDGDEYPMTDLAAASPTQHQAPSDVVGARSMAAAGPDGGDADGVHIAGV
                     PENNNASVTGLRKRESRSRSPNYHENADGAPSFSAQFPQEVVGSEDFCAVANRPLAGP
                     APSVRRTTTAALTAQQQQRQGSTTTDVSNSGIPGVATVAARVHRPDRVPCPPLSEAMV
                     SESAAQTSAAPVPTTTAAAAAAGTNPSVRSEAFLYKLVTDHHLTKVWESRQTSQRWHL
                     WGLQLRGMMYKRFFCAIRDPRMHFFQIVCPILCIFLAMSLQLVEGGTEGTLYLSPSVF
                     DVESAMQVSGCTNYMGDVARMHEYGHNFSKVSFSDPNFVSSTDMSSELLDTWFTHSRN
                     RFMSLQCGDPDVQLYLTFFYQDVIGTRQVSTLLYNTSSRNSLPIAMHMMYAIAYFGAL
                     GTSADAAAATYTMSLTGLPQDAKATQATSAISSILIGTVFLIPLTFLPANPVAWVAKE
                     YESRARHLQTASGLFYLVYWIGNFLFDFTAYVVSMIFIVVTFLIFRRWEYVGCETIGA
                     TIASFSTYGVCYCWCSYMVSFAFTEHTTAQIVVLGVSFLTGFLCVMLVFVLSLLETTL
                     SASNTLRWVFRLLPPYSIGEVILNLALLEQKKMTDPSLAAWSMSITGWPVIYMAVEAP
                     IFAAITLLWDHPNRRAVVDQLSVWWAARRCRCCGGSRCWRHRTQKADRRGRQATMPDA
                     VAVAVDGTSATPVSAAAASPGAPPPSAVSPILRSHDNGSPANGANETAEVAGTGTSAL
                     MQGAPPRAKVIVPDPSRSPHKEWGEEPVASNATPLPMTPISAADAIVGGGVVGLTGPT
                     RMGVTGAQQSQQQLMSGRSVSNRTNSATLPEMIYPPPRWCKAEVLRRRQEEDSDVEEE
                     RGAVYQAERQHFAEQTALSIRAASSRRHSRQPTGSDSKEKCQKEAEPTVASCDAVRLV
                     DLRKVYRAPRKVAVSALTLSIMHGEVFSFLGTNGAGKSSALSIITQEQLPTSGRAYVC
                     GNDVVRESRRAARCLGYCPQLDACLDLLTVTEHLLLYAMVRGVPVGQLESLVTSLLII
                     CNLTQYRHASARQLSSGNRRKLSVAIALIGAPKVLCLDEPTSGMDPLARQLLWRAIDR
                     VSRKCCIILTTHHLDEVEALADCVGIMVDGGLRCFGDMPHLKHKYAGNAYELTLRVSP
                     GARRCAQKRREEQRQRPAAEAGVSPVADCQRSNASTAHGLSNKNQGSTINSALGRRMS
                     TSYAGKDLIDTSDDIFQFMLKAFPSALLIEVFNNERYIYTLPATRDVADAMQQLLQQQ
                     RSQRSMQLVQTPLVSAKNYVGQHSAMSTAKKSPPIVRLSEVFETLRAAQAELGITEYS
                     VSQVSLEQLFLRVCSAEETLNQDRRHNRASAASPTSQSTTFVVNSNTCSGVTPHGHLL
                     QRQGSRASFIARSSAAAMSDSGASPSRRRLSMPSYGSLPGGTTAPRVTFAEYRRQRAL
                     WRLRTEAAEPHLTPSKQQRVAQPDH"
     gap             335251..335595
                     /estimated_length=345
     gene            complement(<337989..>339980)
                     /locus_tag="LDBPK_150810"
                     /db_xref="GeneID:13392945"
     mRNA            complement(<337989..>339980)
                     /locus_tag="LDBPK_150810"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859557.1"
                     /db_xref="GeneID:13392945"
     CDS             complement(337989..339980)
                     /locus_tag="LDBPK_150810"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859605.1"
                     /db_xref="GeneID:13392945"
                     /db_xref="GOA:E9BCC1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BCC1"
                     /translation="MNFLGGSLRSGGGHRRDKGFSAKNKVQQYHGDGSESIILVGRPF
                     RVLQKISDVPPPYMVGRQRSTKYGEGGSSYVYLVENTNHLPEFPRHLALKRSFFGVDQ
                     VTEAHKEVDIVSHIEDKNIVRVYHSEISRSEGRLGVSIAMEYCSNNLYRRIRSSAGTG
                     PGTRLTEAEICHVMFAVTSAVGYLHAQQPPITHRDIRPENILINNKHAGPTAYKLTNF
                     GNATTEAYQCETREEANMAIADIQMHTNPAFRAPEMADPWSKKRICEKTDMWAMGVLL
                     YYMMYLCLPFDPSTTIGKENWVVTFPSQAMTSYTTSLRVMAEHLLDPDPCSRWDVFAL
                     TNYMRFDEDCSRHLGTFCFTKTEWPEGWEEQDVKVLGRAPPPKAPPVSYNEPGHEQLD
                     SRGLSGQERVYGHVNRHQPPDDRGNGRDNAVVDSDAVQEAMIVLGGDPADDDPAVAEC
                     RHQIIMEQQEAWRRAKAAAGLRDSPPMEPQESSAAPAPTRANNGAERDVFDDLFASAS
                     PTVFPTSQAPPVMSPSAPPATHQPPEKDAFSASDLFSTSAPQLHPSYPMMSTYGQAPQ
                     QMAMGGWGSGAPVMGGGGYPMQQPQNQQQASWGYGVSNANNYAPPPPPPQQQQPFTNF
                     LAPVPGQQPGQQPSQQPETSQPPTARATAKRDPFADLFN"
     gene            complement(<343026..>344993)
                     /locus_tag="LDBPK_150820"
                     /db_xref="GeneID:13392946"
     mRNA            complement(<343026..>344993)
                     /locus_tag="LDBPK_150820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859558.1"
                     /db_xref="GeneID:13392946"
     CDS             complement(343026..344993)
                     /locus_tag="LDBPK_150820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859606.1"
                     /db_xref="GeneID:13392946"
                     /db_xref="UniProtKB/TrEMBL:E9BCC2"
                     /translation="MSVIGVFTKGRATGHPSVMSVLRYVPRARVPWQPSRFGRENLAA
                     DDMAQLWGTGRYRTGPGNYNSGYSTKKTHTLEDSTVSIIPKHELEKFMPDISLGSKAL
                     VTPVSLMSARNGHRVTHDLIHSYDPYIGRLQKPAVVDHDNITVEDPNRVGLNAATLDC
                     RSRIYRWLRRGPFFQEDNYFRRSTKLQRNGPVPVSVHEVPLMQRIIRLARRGQLKAAC
                     EEYRRVTSVPPVDVYRALTAACVPGAKLADAIAIFEDGNSRLFYVARDGEVLHNMLRC
                     AIRAKHRVRVMWVYNVMVGRHYENVVVRAEVDVIWRYRIASLALEYLLDSNAGEEART
                     VYDYLVENKLVDCDLHVRLGHVMQQALKEGKTVHVQQDALDGMALSQNVVVVAPQVAV
                     AVYARYLETMQEGAAWTDARGLPLTDPAKTGADTNGAAAVAWLKAAFPDIDPAAVLRL
                     ARFRRNSKDLMAKDRPAYVQRAAQWVELLSSAHQTREEAPLTYLRKSRPSMANPNVRV
                     AWLPERQRAHALLASDEGFKFAYGGPHTRFVEETFAYAENTLQSRYLAQQPVHTEVAP
                     SVALGAAAAASGISGGSALPRLPGSSAAPQILHASVLLDGSLNGSSGSGTSALRPERS
                     ESAKAAASPTAGISGRPSSASGSAGLDDTHF"
     gene            complement(<345727..>352074)
                     /locus_tag="LDBPK_150830"
                     /db_xref="GeneID:13392947"
     mRNA            complement(<345727..>352074)
                     /locus_tag="LDBPK_150830"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859559.1"
                     /db_xref="GeneID:13392947"
     CDS             complement(345727..352074)
                     /locus_tag="LDBPK_150830"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859607.1"
                     /db_xref="GeneID:13392947"
                     /db_xref="UniProtKB/TrEMBL:E9BCC3"
                     /translation="MVVLSVSPSASAPALPSQIPTRATAAPNAFITSVGLHPIEPIQV
                     VGLSSGEVCFYTAKTDALSWFVEMDAARQAQLRLDTATDAAMRSNSGSRANGGGAGTP
                     PVTLAPPEYPVKVMSFNTASAGCSIVHCGFLRGREEDLLREVVQRLQPYSSPSAARHL
                     LYVITSANDVYVVDVKTEVVFLHWAGGGSTSGSSSSPSKAPASPLSPQFIVTQAETYG
                     ALMYLTVARRSAVKAATEQAASRGRHLFSGGGGPERSMYQRCNEPAVYVLHLGCTKPL
                     AASTTKALIAGGGAYVIQAVSKGKPHPTSKHRGSNTASATASAGALSIRAHPLAPLLL
                     LLLNQSEVQVYAVDGDGGEATPKKAQLIFLSAASVPRDRFRSCSSSSSAQAAASRQQQ
                     PVIDAQFVPSAAVLVPCHGAGHSSSSCKWICHNVQILLVTPTRLQLLCTRAVAATAGV
                     SSADRGDVIAADRAFYTAPSMSAATSSSALPVPHVTFLRAWTWLGSPDTLFALQSDRV
                     LVELSCNDLISASMDVPSVRSRRLLPPRTVTRLTGCGAGVDVGSAAGAENCWLTPSSP
                     AKDRSGGSATAADGGGAAGLSCVQWPDVLPLWGRSAILSGVFAPPLPPNHGEDPHTLI
                     FSRLTGLARPLPIGGSAAAGGKDADAEDDTSAGSDVLHLSLLADTETISSRCICVRLC
                     LTPQPSLTSTSTAARPGLPLHHEQESVNVNVARLLCDSAMPALCRLEHGFYFVGSRAE
                     SAYADYPFLIAGLLYIDGVVEDAAGSECAGRAARLRAAMICLPADKHALRSLYELARR
                     SPDGDGLGSLAGAAVAPTSELKHALLQAVRHTQVQPLPIPQFDFEVFQSSSATPSKQL
                     LSCSFQLSNDGVVPCVWGLWAPLPEAASTSTAKSAATAPPPQQQPVQLTMQAYYIAAD
                     TQELRWRPPELVHMDDLLLANPSQVFALSSVLANAVTGVASASAAVALAPYKSVEDVL
                     LDVDPVVVARLFLYYADRKVLVLATVETVSSSSSGGGNTEAGGVMDDTYNFASRPSSE
                     RVMKRTLLTGGHGGAVGEDRQYLCLVPHAAAEMNGWKADSTAESLGCSLLTSVQLSAV
                     TVSDHDDPALQVAVVSRRFGVALATFPLPGRRGVARVSASLLPVKVRLCRRWDELLRV
                     TAAVNIQAEQSEGSRCDATSSGGMVPSSAPASPLRGRGSTACSLPLLRRYRAWVDTLA
                     HPASTYASVPLALWVWSPAWPGEDAVNYENATSAAAAPSPVLLLQRGCALYVLHVSGA
                     AVQMCASLLHCAPLQVVPRASPISVGGTGELHLQHGNYLCLVARNQLLRQLQLQYARY
                     SNPSTLQQAAATTCEAKWFKKLMRQAESSTAARLRLKERPQMMEWLRSVYAPAASELA
                     YDSPSSSSGSAKSMQLTGAGATHVADVLDVDVTHLLRLATLAVEALAASQGIQQFVFD
                     GTLGASLRHSLQHITAVLARGSSGGDKGHANGVAESRSLPGSWAVAEALARLPLACAT
                     RALSQEAAHAATNAAAPSTAARKEVPDSSWRCRAAAVRRWWWLVMRSSSLVLAVNEAQ
                     ADEAQRELSRTLDVIPLNSVLLRPMAVAANAPPPPNLHGDDHGEAEAGTVVDAVAQAL
                     LLCPPQFMPHSVTQLLRQRDGGNVSAPPQQQQQRRLRAALVAALETLGANGGEAGADG
                     TASLTALFSTVCIDSAHWTHAVYYTNLLGHLRHLALQESATEAPVREFASQCIKSADA
                     AMEGSAAAVLEVATQTVAALLGAVVDVPAASRSRMATAVAQSMSKRQQALQRCLGPSR
                     KAAGRGAGATGGSPMEEDVYFLEHSPVDQLRHHLYKAQWRDVYGNFAYPTRYFFRSAV
                     RDSAAKPAKPAAVEAAPPHYRATDLPYQLLYNSRIAEAVQQTSAPRADQNAPGATTSV
                     SVFSGRQGRVKKVLLTEQPVASSGAAAPPPAVELVPALFTPMSPLQHDTQLHDSSAQQ
                     QQSTTLSLCAAVAKEEAALHKTYFDAFAAADEGEAQAEAQRQQQHPLSSNSAGYDLRN
                     DPLLQQFQARLSAGEAEEAVSASTTLRHKQQEEERQRVLGPLAFAPSATRRVAHGQGD
                     AVGDGITTGGTGATGAATASPDLYGALPTQQEFFARFASDG"
     gene            complement(<353282..>359533)
                     /locus_tag="LDBPK_150840"
                     /db_xref="GeneID:13392948"
     mRNA            complement(<353282..>359533)
                     /locus_tag="LDBPK_150840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859560.1"
                     /db_xref="GeneID:13392948"
     CDS             complement(353282..359533)
                     /locus_tag="LDBPK_150840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859608.1"
                     /db_xref="GeneID:13392948"
                     /db_xref="UniProtKB/TrEMBL:E9BCC4"
                     /translation="MSSGYYSSCETCSDGSGAPASGSSTLPPTPPPPPSSSSLPQLTS
                     AELAELPPVPMSSSSYPTPSPSSAATESQRGSVDVDRAGNQGSSKGDASSPCWEEAEA
                     ELDDDVEYHSGDGGSESDETTARGASGEPVDAPLMVPDWLPDSPLSSLSSVSASQRTD
                     EEGVQQRAASTIPDSEQSSRQDENVPADAAMLHGCADGADGSTAAFRDAGEQGVAHDY
                     REAVVSDAAVTENDNEEEWRQGGRDEADDVSDAAVAARAASITSDVVAESVWASEERA
                     SAALQQFSTSLHSKLVEQLIDDAVVAVERTLQDTVRQHESRVRALMAQNRLLDRQLAG
                     QAVQMQSIRKDLEDSILRDLQRVLRVDLRQAFRSASADRSNGKEVSAESTAPPSPSLG
                     RRPSPDAHSPSAEEDVAGSIGMQRRSCEGSVSSTYAVDDSARPSVEELLAAYVNQRGT
                     LELLQKERAQWWKSTAVLRDRLFAATREVVQLRQEVERLQTTTVDVAEHCAVVQARGE
                     AEHQCTLMQLQLAKHIEEAEMMEALVERRELAQSQPPGAAEGNTGQAASTGDVTATAT
                     AAAAMNEELLRKGPQWDIALRELEEQATIAANSRQLREQLAKAEEELRSLQKDRDASV
                     AYAAELKKEGDVLRADLQSMVYRNSVLSQQVASLLVKVEHTCRANRQLQAMQALSPPP
                     QQQGPLDQLGAKKAKRSLCAPTSSRSSSSTFPAPSNELLSTLPSQAERRSAWLSVMWP
                     LSTSGGSDAAAENRLNTAVLYDQQKHRQPPPSPLASADASKMSSPTEVEEGVQQRLNT
                     YAASRLVAPQLGSGASLQLPRRPRHVSLRQLGSATLEVDRVCSPHLPASDQLSGYALG
                     RPSTFSTVDVARGTVTRQVGSEEVTVLLTGAAASSAHGSPSPATPDDSRAGDVDVWTS
                     AAAAASPSTRRVHSTDDVSRDPNLLRLLDTLDKDESLDRFSVNSVAELVLRNQELVKQ
                     LYEATQRAEAAERRRQQQQQGGVSASQLDEKGPSFGVMAASARDPSAPLGSGIDANFN
                     AVPATLTSTTAELLLREGDPNSRKRARDGDDDDRSQERGDAEGGRHVSGDQSENKASH
                     QHVTDGAGADSAAAAAAAVAMTESWFTKDASDAVASMIDAMVRRRDVRLTSADTEVSR
                     ALIQALAAQRATDNAVQRARTNSDGVPGTEVATEISPETDSFSVGISSRALSSCLHSL
                     AHLCLEQSSALVVLARKAEHQNEEMQKAVKNTWTEVQQVLLAALQTSRAALASSTSAS
                     DDNAATSAPRLSRQRVRLEGGAADSSSVVGNEGGAQRDGRHEFRPEEQVALLQQLRTL
                     LHTAAKKDETLLHVYQAAQARKDARQHQEKERVARLLLKLERKRRLIKALQLRHANMN
                     VVAAVGADPGARGLSHPSPLDCENSQGAVAAGFRLSPQPGSPARRTPPMPPMVLPAAS
                     TTDAGDERRGDDDCDRASSVDSGSSHPHRSYRDPHGRDDDDGDSDDELDDEILTLDIF
                     RELQQQLALSQASHQAAQEELDAEKTKHAALLERMWVLEAARDDAVAVAERLEKRVSE
                     MLTREEYQAAVAELEVAAASLKELNTELSNAKAAHLESQEQVEDLKRQLETQRRETEL
                     QHLEAEDAMRKREQRLRSEEVRFRQLHEQLKDLKHYAAGLEKAIALARKEVCDQQERV
                     RHKDSTIEELKAQMLMRDDVQELLCRLYPNHSVLHANAQLVRGLSETTARLQQELAET
                     RQDLAHVREELQQRELSAREAVQDRQAAEVRLQDALARLAVLQEPDDSGDAEQRSPGE
                     TAATRGTTHPQPAGAASRMAALFNVDEASLTALRQRVRYLHACVEAQAKDIAVLRSAE
                     SSWKQREIDLRKQLEVMSADPVSLTARRYGLSACLSFEEQLDEMQARQDALESSRAQL
                     QEEKDSIAVMVQEHAKAAAVAQGAADAAQTVVERTTAQLTSATEKCAALSSAITRLES
                     ERDEESSKRVDLERRYEQALSELADTKRGLSAVQESLEATVTQRDHFWKDNNLLISKV
                     EELEKALLQSDAEKRAAREALAQGLSASSASASRRRRGGDSGAADRYRRQASLTQDLS
                     LSSLSARPS"
     gene            complement(<360987..>362678)
                     /locus_tag="LDBPK_150850"
                     /db_xref="GeneID:13392949"
     mRNA            complement(<360987..>362678)
                     /locus_tag="LDBPK_150850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859561.1"
                     /db_xref="GeneID:13392949"
     CDS             complement(360987..362678)
                     /locus_tag="LDBPK_150850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859609.1"
                     /db_xref="GeneID:13392949"
                     /db_xref="InterPro:IPR013919"
                     /db_xref="UniProtKB/TrEMBL:E9BCC5"
                     /translation="MGSMSRELATTTATPSSLSPAEHRRGGGERLPLGKLLDPLRWYC
                     KWVRANPEGASSLEQFSRTLTMLWSDPTNLITSEACFTLCKLHTFSNFAIISSGGRRT
                     SKTELLSLVLRGIQEVECLMELIHRNYAGHRRTWNALLLLEAVKCTLKACVHRQLFLV
                     PWLWESMKVSLRRALRHLTTLTPRRRVRGGGNGGVASGAGGSGAGSFAAWASGAGVVG
                     TYAGPLTQVDYSGGSGGLCGEVVGPHNTRLVIPRVASGRRHEHRHVYRAGASCAADEG
                     EEHVTFAQEGDVDEELEEAEAIGFTWVDVLGMILDMYLLLRPVLLVAMARHAFLALPE
                     ETTNLIAVLPPPVSKEEMAAAAEAAAKAAEEAKKTGTPVKPTPGPDPLAALHKAMAAA
                     PQQTLLGSWRVWAGVTGCDFLVALLARLVRHHRVPVVYIKDNAESDDGGTPVALLEGG
                     EAASIQGGGADAADGFAASSTAVTGATDSRAIGAAMEPPVVSRDHMRVQQALRNALYN
                     VMRDPFFTAVLKQLVYHHFIRGFVSRVPLLGTCISFYATHYLSMQYYSFLYTLRQ"
     gene            complement(<363581..>363916)
                     /locus_tag="LDBPK_150860"
                     /db_xref="GeneID:13392950"
     mRNA            complement(<363581..>363916)
                     /locus_tag="LDBPK_150860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859562.1"
                     /db_xref="GeneID:13392950"
     CDS             complement(363581..363916)
                     /locus_tag="LDBPK_150860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859610.1"
                     /db_xref="GeneID:13392950"
                     /db_xref="GOA:E9BCC6"
                     /db_xref="InterPro:IPR009914"
                     /db_xref="UniProtKB/TrEMBL:E9BCC6"
                     /translation="MMTDRALGTLLLACNSSFFIYYVLWIGVMPFVDESHFTQALFLP
                     REYGLLLAALIMTTAIGVGMFVGSLHTIWRTGYVPPSSRTSMGTEATLLASGATTDRV
                     APDVTMAAK"
     gene            complement(<364652..>367786)
                     /locus_tag="LDBPK_150870"
                     /db_xref="GeneID:13392951"
     mRNA            complement(<364652..>367786)
                     /locus_tag="LDBPK_150870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859563.1"
                     /db_xref="GeneID:13392951"
     CDS             complement(364652..367786)
                     /locus_tag="LDBPK_150870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859611.1"
                     /db_xref="GeneID:13392951"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BCC7"
                     /translation="MSDAEGFADLFGGVEEVPESPLQTLFISRQALAGEGTTCAYFNP
                     LLDRFDNVSSAATAEEDAALLRQRLVRLAPPPLVVRFRDKRHSLWGHKLWNAAKYLVK
                     RMDERMIDVRGKSVIELGAGLGVPTLAAYKNGARLCVMTDYPDTNLLDILALNLETNC
                     APGDMDADVKREMEEQARQQLANGGDLDSVSADQLEAAMSTRCYVEPLLWGKKEDIAK
                     VMQYTTGGAGYDIVILSDIIFNHVCNDDLADTLAMLLAKNPHAAGYCVFSHHRAYKQL
                     HDFEFFDKCVRRGLQYEHLDEQDYPMMFPEDRGPESVRKPVKCYKITRRYDAAGCGLD
                     TSLCFDVVLQGTGMVQSILSAALARNGLKVLHCDGADYYAAAMATFDHATFLQYLRQP
                     SPSSMSSFSAPDIFINRIVDDVPEARRRRYLFDVLPMCYMARGPLLSHLVSSGIGRSL
                     ECQHVHRFLFLQHPTATSAGSAATTTAMEVPLTRASVFHNATIGLFDKRRMMRFVKDV
                     EASVAEQLHAKAANPADDPSVANTSVAAEAAVAKAAAVFTREAQANPQVTLTELLQSK
                     YDLSGTVLDVVSLMGMMDVLPATSSTSVACSQGAAAEPPLVRSVGMVRDLLLSTGAFD
                     GKSPYLTMSYGASEVAQNMCRISAVWGGIFVLRRSLRGVAVDEGKETQYAVLSNGQWV
                     PAKVIVTPEELAAANYLSYGVNDWYYDFLKEQEQGRTPLIPLPAEQSGAPVLAAAVDQ
                     TKTSDKGAAAEPATASASPEAVVRFSRVVLATKTASLFSLAAMQAAGVIEVDDARDYT
                     AAAPIITALAREPQTRAVVWVMQQSFTSDQAPARFSASDADGGAACDPCVVHFTADAK
                     QLSQEQLHEYVMHYYTSTAKTEKPYCVPYRDIVLAAAFTVDSREVAQRGVVPHPVELP
                     SETRWTHPYGWEESMKLRSAYENDRKHLLHHGRTGEDATPSAVEPTPVCSAAARAADL
                     CRSSENFHLVEVPTLLPNLVYDGHYVQEAERAYKRVLDALGLPTAATATSAAVAEGDE
                     EAAQAYAFLKPLPH"
     gene            complement(<368521..>369831)
                     /locus_tag="LDBPK_150880"
                     /db_xref="GeneID:13392952"
     mRNA            complement(<368521..>369831)
                     /locus_tag="LDBPK_150880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859564.1"
                     /db_xref="GeneID:13392952"
     CDS             complement(368521..369831)
                     /locus_tag="LDBPK_150880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859612.1"
                     /db_xref="GeneID:13392952"
                     /db_xref="UniProtKB/TrEMBL:E9BCC8"
                     /translation="MTGLSRARGPSYDAESISSSITGSCPSAPAPFKYLTASSEVTCY
                     QHPSFRSLELLLPAPLWSDAFVQERARYTLLPRHLFPFSSPSAGVIREPSSSYALDPA
                     SRTTATTAAALEEPRRASSADVGGRLSGRWSFMAIYRNFKRAREATATREKVAEVPRR
                     ACLAESPVEDALLLECPRCALSPSIRYLPSPSMSLVDGCSVAEVDDGDDYGEVVNVRG
                     NGLSSPCSCSTTTSRAESIGAAAWHPTTVAVASEMGTKYAMVRECQMTRSASSVTAAV
                     AATSLNAAHAEALRMFETVLDRVSVAHETRCPLCSPPRPPPWGRCAQPASLNGPLPAL
                     APTARAGDAAPIYPEKSRVVASDLLDAHELSLDAEKQAGMEAHRLRLLRRARSLLNRH
                     GDRLRYLSETKPSLFRETVQSHPLARACAQLGGLPLLRALSATL"
     gene            complement(<370758..>373238)
                     /locus_tag="LDBPK_150890"
                     /db_xref="GeneID:13392953"
     mRNA            complement(<370758..>373238)
                     /locus_tag="LDBPK_150890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859565.1"
                     /db_xref="GeneID:13392953"
     CDS             complement(370758..373238)
                     /locus_tag="LDBPK_150890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859613.1"
                     /db_xref="GeneID:13392953"
                     /db_xref="UniProtKB/TrEMBL:E9BCC9"
                     /translation="MPKMASATSSSASAASPADDANGLASCGPLRPPPVFCEGKGEAA
                     GHLAHPCRRRMRHPRQSSTPVSSRSSSHSPHIASAHLGAQQLQPSEHGNNSAKVPVIH
                     WRAASALTSAPTELWSDGVALGARHCSDDQERHQTVATGGSAVLEHYHVLELEEQLQY
                     WRQRALQVENRALRRERALQARWEAEFAAAQVSSETLTRKLLDKLRRLQKQLNPRKRA
                     VQQTEGQEQQSRSSSASADSTSTTPNLSTPGDSGHHCGGESEGTCSIPRGCGTNSVAY
                     PRRCASEWAEENASLLNSPAGQQREQQQPDRSRSAANAAESCATSNEKSRATLQANLR
                     DLCRAVLRCLSRSSLLREYGAVLCGNCSRNTHTTNDDDPEEPETARVAQALLDASRGR
                     KASDSPSSWSLARPLLALQSALEHLDTVLRACVDDVVFASSGLTSTPAAAYARHPQRQ
                     PPGDEHRSADLEAQLRQARAALFQEQQRRAAVQSALDAAMHDMRDLAQAQQDNVSQLK
                     IEARAAAEQAQQEYRANLERTRATLECDVVAATRRASAAEHQSMLRAQREAHWQARLY
                     ALKDERDGYARECALLKTQLALLQQARNATAAERAGQQQEGVDKAVLSVGPRDGAEAK
                     PATAAASALVVPPVDSSPAPRVTWADAQMDRLTTIDQPSGFAAPSSVCRSPSRSLSYS
                     PSPSTDKALRHAPGARADETARVHGAQLTSSASTATSGAPRLPSAFPSSLMVVVQPSV
                     LAAPEGDGDAEVIALAQRPYGDDNSAARDKAGVPVDSEALEQAHFTPWHAPSRQHTST
                     AVDAAVVGTPLARMRAWEEKFKAILNYA"
     gene            complement(<373980..>375365)
                     /locus_tag="LDBPK_150900"
                     /db_xref="GeneID:13392954"
     mRNA            complement(<373980..>375365)
                     /locus_tag="LDBPK_150900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859566.1"
                     /db_xref="GeneID:13392954"
     CDS             complement(373980..375365)
                     /locus_tag="LDBPK_150900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859614.1"
                     /db_xref="GeneID:13392954"
                     /db_xref="GOA:E9BCD0"
                     /db_xref="InterPro:IPR007271"
                     /db_xref="UniProtKB/TrEMBL:E9BCD0"
                     /translation="MAVPVAAVERFTPETKRFQDEGSAHPLFHSGPRKSVLDSPMQPV
                     PPLTLSNAIMFSYACSRKSEDDESRGTMWGVEDSCNSSAVMRVSCIRGVHKASEEREV
                     LFPPTEGASAGPPSPPDSTLPFLQSAALAATYMLTSMFFVLTIRYTENHHQNCNDALI
                     IFAIELAKLAVSVALKYREDAEFLPVTLLFTAQRREIWRGGLSYAVASLLYTVYNNVA
                     FANLKLFHAGTYQVFMQTRILFTGIFFSLLPHHALTVRKWVALVLLMIGVASKYYSPS
                     TLQLGSHVLFILLQALLSSMAGVYNEYALKKERHLSIHQQNFFMYLYAIIFNAVFGLL
                     ADPSIITGVFAATTTTTTSTAAVAELNGNAALPPQRSVAPLVVLLILFGSATGISAAF
                     MLKFVNVIAKAFASALEVPLTAAVAAALLGEPFTGHDAIAACIVMTSIYMYYTCGWGD
                     DRTISCRSATS"
     gene            complement(<376490..>379384)
                     /locus_tag="LDBPK_150910"
                     /db_xref="GeneID:13392955"
     mRNA            complement(<376490..>379384)
                     /locus_tag="LDBPK_150910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859567.1"
                     /db_xref="GeneID:13392955"
     CDS             complement(376490..379384)
                     /locus_tag="LDBPK_150910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859615.1"
                     /db_xref="GeneID:13392955"
                     /db_xref="UniProtKB/TrEMBL:E9BCD1"
                     /translation="MMRLSALSRVAWKLTGLQLAAAVGRKSSIAKAMKKTKGAEKRSA
                     SRRVTSRRRGASPASSRESMMGAAGPHLAVVPPGVSTKGVARAGIHVADLHKLGDITE
                     LVSSAVCLTGGGRETRASASSLPLSMLPASALPSSSPPPPPPPVPNVKGCSVSVTRLQ
                     RRIRSLLAQLVLLSSEPLQPSALFARYRSAVDEETASMCAWAAHAVYEYDHGLLRCGG
                     RVASHAARREALSEGEAGAYDAEQRTAGPTESNADSEGSSSGGGAAAEQRVLWKRGQQ
                     LSQAFRASVVPLVATLCGDGSCGGTEASVALSLPASHEVEQWMFLSIIFSDSEFRVSP
                     YSGAVSYPALPSMLLATVDPVRDRAVSKLCYALQWGVQAKTAAYAAFRETNGNGGAKY
                     LSGTTSRKHEQQPSVPPATAREEAVTNTCEFVWLNGAAGSPTWTTAHAQYLLHSALTI
                     ARKPLDESLARSAASTTEFSADQQLRKTISAAAALQHTSGHPLVDVMLQASSVVSVAT
                     RSGSSPTGEADLPVSGDGGGGAKVKTTRGAAAAAAHPPALGWNEGKKGTDVAKSFAMD
                     ASEDGLFATLMGDLPTRSLSAGAMYEINRRLIGHLFRRLAAIPISVARLSTVVRWNLS
                     VTHAAYYRSFFRFLLLTAANPMVRRMADGRRQRRHANAVCADVWGGKEDDSVEVRGGV
                     EDEVRNALAQYDPHTFKGLLNSSSAEGSAVAALRRALVADADVTKKCDHIANTVMEVM
                     CVRVLPHARPGRGSATTAAPRGPATGAAAAPVMGTTFCGYPLRYVEVLPTWRQTPEEV
                     LQYLWRQQDEAPPCGKDTNWLECNEEPYILVFSLDRGVLHTRLRLVVDRYLELTNGAA
                     ASAVSPHNAAAAQVTLHELGLMTLWAHEYGAEMAAELLFVHLLPRHEEVRLHPPRVSG
                     PALRHEEAHKQTAMASGDDTGSSGAVGYGAWTVEFVPALSPDPRRGALTG"
     gene            complement(<381727..>382698)
                     /locus_tag="LDBPK_150920"
                     /db_xref="GeneID:13392956"
     mRNA            complement(<381727..>382698)
                     /locus_tag="LDBPK_150920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859568.1"
                     /db_xref="GeneID:13392956"
     CDS             complement(381727..382698)
                     /locus_tag="LDBPK_150920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859616.1"
                     /db_xref="GeneID:13392956"
                     /db_xref="UniProtKB/TrEMBL:E9BCD2"
                     /translation="MASPTAPSPMAAEQAAIAQQESLEEAYVRLNTQLLLHLQRHDTA
                     AALRTAEVMRDVFLNALPSTARRSDGPGHGGGVAAPLPGADLFHGSPAEQFLQLRGQL
                     KASASAGSTRASDDAGLHEASEPQSASSETSSGSSTVESSCDDDDETDEVELVSDSEI
                     DGDTEETEEVTMVGGSSGPRQQQAAARLLAEALQSWSKASLKAACVSPAEAPSAFSVV
                     AEAASSSATALAKKSASKPRALQPRPPPPRHKAHDKGQANTSVEEAGRGPTMPSASSP
                     SPPLPVEGAACDEDGEGLDAEADTVWVQMQAQVVKEMDRLAIVRKHR"
     gene            complement(<383157..>385034)
                     /locus_tag="LDBPK_150930"
                     /db_xref="GeneID:13392957"
     mRNA            complement(<383157..>385034)
                     /locus_tag="LDBPK_150930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859569.1"
                     /db_xref="GeneID:13392957"
     CDS             complement(383157..385034)
                     /locus_tag="LDBPK_150930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859617.1"
                     /db_xref="GeneID:13392957"
                     /db_xref="GOA:E9BCD3"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BCD3"
                     /translation="MDFEEVDSGAASPPSTSSASTTRSLLTQHPVAATAAAAFPASSL
                     SLGWLSSRSPNVPLTMCFNFLDGSCYSMWAMQLLPVFLLKTSSSIIVVSFSASVCSAA
                     QLLGALVAGCVADRQPRQRSIRAGAGCAMVALAVFVWAFWTSRVWLIFGAQALWGLYT
                     GITSTSVEALFADSVPQGQRTVIYNVKWVIQTVCYVVGYGAAALLFFKWGNSWDPRRV
                     RVVMTLGVLAHPIALAPLCCLQDRYAVKEGDEDISRSSTQPNIVAVDAASAAERGRAA
                     VTATETKAVESPVHSTLQPTTQQPPGAESVLAAGSMGVAFSHVPTDGVRLRFTDALPL
                     SASAETFGREGCDGDAEDVRERTATTAHAALRKGLLSAPVNDSGSFQQQQQQNSSIVL
                     RDDGEGVSWVPRIVGSLRHSRWRGLTSVPYWMCVVDLLLAIGSGMSVPYFPVFLASDR
                     EIGPAALNGIYIASTLLTAVTSMCLPWLIHTCGLGRVPAALGVRLVGTAALLMLTTAA
                     TLPGIIALFLCRNALMNSVFGITRSVIMDCVTKDSRAKWSALESVSLVSWSGSAMIGG
                     YITKQHGYRCTFVATAVLQFVATLLMIPAALGARALDASLSNAPQVVEDLTLAVSPTT
                     P"
     gene            complement(<386135..>387556)
                     /locus_tag="LDBPK_150940"
                     /db_xref="GeneID:13392958"
     mRNA            complement(<386135..>387556)
                     /locus_tag="LDBPK_150940"
                     /product="myo-inositol-1 phosphatase, putative"
                     /transcript_id="XM_003859570.1"
                     /db_xref="GeneID:13392958"
     CDS             complement(386135..387556)
                     /locus_tag="LDBPK_150940"
                     /codon_start=1
                     /product="myo-inositol-1 phosphatase, putative"
                     /protein_id="XP_003859618.1"
                     /db_xref="GeneID:13392958"
                     /db_xref="GOA:E9BCD4"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="UniProtKB/TrEMBL:E9BCD4"
                     /translation="MSISVMSTPVPASSSADTGEMSLIEALGVAIEAADKGSRIIWQC
                     VEKRRLAMAAAATFHTTSALAAGGAASVECENKTSATNLVTQHSKQCRETIIRILRQY
                     SEEVQREKPHLRFAFLTEELNPGTPLSDDYTWVVDPIDGAASFVHGLPDCCISIGLTY
                     RKQPVLAVVFTPFISSGVRLTVAAAAVLNVAQQQQQQQYQHQQQQLVMSPTLSVTAPA
                     ISGTMCGSVAAAPLTPMDVSKTKMLDEHGTAAAPTTALPPTPPTPPFPSLRAAAAATA
                     AASASPHSVPIITHTTPSVVPECNGELFTAIKGFGAFVNGRQVRVNAKVVPATSVVVF
                     NHPCGVMLSTAEAASPDGAAIRRRKCDAAIDCSMAMREELLRLPVAALRCYGSCAATL
                     AQVAAGRVDAYLEPAGKAWDVCAGSLLVTEAGGVVCNMLGRPLDMAHDTTIVAAATQE
                     MADLMTEKCVRHGFGQYWLVEKE"
     gap             388896..388994
                     /estimated_length=99
     gene            complement(<391362..>393587)
                     /locus_tag="LDBPK_150950"
                     /db_xref="GeneID:13392959"
     mRNA            complement(<391362..>393587)
                     /locus_tag="LDBPK_150950"
                     /product="ATP-binding cassette protein subfamily G, member
                     4, putative"
                     /transcript_id="XM_003859571.1"
                     /db_xref="GeneID:13392959"
     CDS             complement(391362..393587)
                     /locus_tag="LDBPK_150950"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily G, member
                     4, putative"
                     /protein_id="XP_003859619.1"
                     /db_xref="GeneID:13392959"
                     /db_xref="GOA:E9BCD5"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BCD5"
                     /translation="MGTQVDQAHKPSVGTPTELTSIPPTASVTPPQAKSNAEDAKVPA
                     LSRAVNFTWENLTYQVPVEDKDGNVIYKTLLFNLSGCAKGGRVLAIMGPSGAGKTTLM
                     GTITGKLFNATARQEGCCFMNNNIYQQRYKRLVSYVCQDDIVMGKDTPREAIYFSARL
                     RLGLDSETARRRVADVIKRLSLTKCQDTILGIPGILKGVSGGERKRANIGTELVTNPF
                     VMLLDEPTTGLDSVNAVRVGHLLQDLAKNDMRTVIATVHSPSSELFDLFDDLLLLAKG
                     HVIYHGPTADSIEYFASLGYDVPPRTNPTEYFMNLLQLPEEILSQLWLAWEDYVMSDA
                     ANDNPCLTPVTGVITLTDDYLEEQLELKGANFCLQFSELFKRSWRMYLRDPGNFYGRS
                     VQTLFFAIFVGLFFFNLQLNQQGVQDRLGALYVTLMNNLFGAAMNGIAAFPPERAVFL
                     QEQANDAYNAYTYFLAKNLAELPWQILFPTVFDLIAYFMIHFHRSAGAFFVHWFILVL
                     LANLGYSFGLMFATFFKQSQAAFAMVPLILLPLFIVAGLFANTDRLYPYWEWLNYISF
                     PRHAYLGVFTNEFERLTVICNPVTPLCTFPDGQAVIEYMGFQGWHYWQTFVALIVYQI
                     GLRFIGATSLYYQGRQRRGKLQFVKNLRKRVASPRAIASARSNDELSDVQSTLVGSIA
                     TPSNAYGTGVSSPINNPENHQPIWDGESERATLALPDTPVTYVESPVDVKDMKPRKYR
                     S"
     gene            complement(<396576..>396866)
                     /locus_tag="LDBPK_150960"
                     /db_xref="GeneID:13392960"
     mRNA            complement(<396576..>396866)
                     /locus_tag="LDBPK_150960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859572.1"
                     /db_xref="GeneID:13392960"
     CDS             complement(396576..396866)
                     /locus_tag="LDBPK_150960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859620.1"
                     /db_xref="GeneID:13392960"
                     /db_xref="UniProtKB/TrEMBL:E9BCD6"
                     /translation="MPTSASLFGVCHSCCTAPRLPARPLTAPLNTPCALNCFPLFSPL
                     SLSAFFFLLCDPVTGACAHTYTRAPQPPQHPSLLSLPSAVVRAARCRHRRLR"
     gap             399439..399548
                     /estimated_length=110
     gene            complement(<399553..>405046)
                     /locus_tag="LDBPK_150970"
                     /db_xref="GeneID:13392961"
     mRNA            complement(<399553..>405046)
                     /locus_tag="LDBPK_150970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859573.1"
                     /db_xref="GeneID:13392961"
     CDS             complement(<399553..405046)
                     /locus_tag="LDBPK_150970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859621.1"
                     /db_xref="GeneID:13392961"
                     /db_xref="UniProtKB/TrEMBL:E9BCD7"
                     /translation="MHVPPPQRAKPEASQPPSGSPPLSSSEPAAVHLYDLDTVFLSKT
                     VVSLTDVFTNSTDGPFDLSPLCAPQQQGVEEQQRLQQAAATTASSPYTGDAHCSPSAT
                     GATSAHMCSASLPFSGGSAPFTSSSPKLAAWRRSNRAAALRPKAVARGADGQWRTVSA
                     DRGASAGSAFTPACSKPPSQEAHARMLLVPLDSYHFLLAYHDVDVAGQLRGRCDKRTA
                     MATVERLSAASPGCRPPRSGICVVRRLEGDQRGATKASSAATAALAGAASATRPTLSR
                     IAHGLPLDAFDGWVRDYTAYGLSCNEAVLRAAWEDKTRERAEGTLAMPAGAVMEVGES
                     AAPEHEAAGGGRSGEECRVACGGNSRCDNVGGVHIGVPPASCGAEATVEGAAALAPQL
                     SDAPAVLVPADGAAVGEGKGAATFASPNAERAAMVSPSLDRLHCSSTTSSSSAATPTP
                     SPPTARSEEGGKVGGAVSTTMSVSLASTAAQQQQQKDVLWEEERQRTQRAAAQLRHRF
                     LVSDGAQHAIWALEVRLPAMKVRVVSPAEFYALEVEESDEEVVPAAARHGEDDGNDGS
                     HDVSATRCAAETREDPAAAPPPGLVLPRRKTTSAITHGRAAVSGHRDSVKGAPGTDAS
                     RPRSPSPADPLATADTDEADDRGDSRPDGSDARRCSTSVATHHAGASCSTRRCGCSAS
                     SASPSLAMAEAVPTPLIGGARGFVDGHFSVARFNSPGSLCWRIDEDDEEDNENDVAGG
                     GSESGDIIDHAVAAASQANHEQGSRAHTRHGRVDPVSYLRRRRRCTVLFISDMGNCAI
                     RYANFHNRLVRTITGVDGVPGYRDGSCASSLLRGATALAWCSAGLLFTDGANNVVRLV
                     TNICKRRTQGRERGNGESTTEEGPGIPLARSATRATESEVQRPSELEVHHETSTATEQ
                     PRCVGGKPAGDSLGTRLATATESQDGALQELPPTPPSSSPLTPTHEGVPPSSTWKRDG
                     PAAAMPRVWTLAGCTRNTDADQQAHADASLTSYVDCAVPSRARFGYISDMALWTDDTG
                     DTQVLLVDQTHHALRILDVHGGVSTYVGPLDYEVTSMASPSTTSTPAADSLPLGLVFP
                     CCLTVGALIKERSPALLSAATTTAAATMITPQPYLCSSSPLLFTASAITGAVSVLLPI
                     SQRSAQTPWNVHANQHRLNAAEIREGEVTCNGENGNVSMFATIRSALELGVATEGRRI
                     IGEAATPSLKHVVLGWAADEADGDGVESTRAARRLLRVESAQQALQYLRLRFPWLLPP
                     SVPQLSTRLVAGCACHVSGKRRGAAAAAPVAARNAVGLPCNAGSGSQGAGASSGVLPN
                     CAKREKGGVATVTSTAQQRRRVLFQSPPRHPPIMTPRCPPAQTDAAVAAAAKELGSLL
                     LEPALLSATPPRMVEVLDTHLDGVGGDGAAAGDPEALYASRSSPPRAVSPRSSDMDPN
                     IEEGEGDSRRSSAGSNPLQSECKEEEEQKADGGDVCGGRVAAKWLAPPLKSVSRSPSG
                     SRSGGQQQQAVDPATSPLAPPSRTYAGQFQEWTPEQRQQRLRSTQEIPISTTSVRTSP
                     CGTPCALHKQQQHQQQQGEEDDGSPSQWCQSAARGSPPLSSPMSSSRPRGERAASPNN
                     LSGRGSPPLTPRAMVAHQLMQRRRTSRSSTAPHAASVEGGARRSIKCKRTAVAEVHDN
                     ISPIPQAPQQPEGSEGRAAPVEPLAMPAVPDRHLLQPYRADRPLHDAYDAAVRRLFRV
                     YSYLATKIVTTTTTTTASTAPLAAGVGAGADPRIAAVGSRRGRAPSPWATHWPRQVEQ
                     YTMSFAAFFRFVVLTGYADYLAEVAVAAVTAAATGAPGKDGADARAA"
     gene            complement(<406230..>408725)
                     /locus_tag="LDBPK_150980"
                     /db_xref="GeneID:13392962"
     mRNA            complement(<406230..>408725)
                     /locus_tag="LDBPK_150980"
                     /product="protein phosphatase 2A regulatory subunit,
                     putative"
                     /transcript_id="XM_003859574.1"
                     /db_xref="GeneID:13392962"
     CDS             complement(406230..408725)
                     /locus_tag="LDBPK_150980"
                     /codon_start=1
                     /product="protein phosphatase 2A regulatory subunit,
                     putative"
                     /protein_id="XP_003859622.1"
                     /db_xref="GeneID:13392962"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:E9BCD8"
                     /translation="MNSGSSTPHEDALATSESSLSSSPTEPPRFQTLLVSPPSTPSTP
                     ASPYPDPEPSAQPLGATSLGGASAVAVNASLNGVSGVGSGGSSSPNTSPNSAAASGNP
                     RRSLNAAFTLSPRTESDVEVSVECNNDASSVCFDLDRHDPPIKQYYNLGSLEERRTFV
                     TEGCVAAARKMSTQRILDHLLPALLTAFEADDYGESFDECAPCIARALPHIVACMETR
                     TTANLTYFMGLIMELCCSAEGLVAKVITTSLQAIFEMVEDAVLLELFLPFVLTMRVSF
                     WSTPRVVAAGLLGYLAMRPAVLQASGLSVTDMFNYYAECSSDASAMVRAAVVMSLHDW
                     VRVAAVHRLTLAEMPLPLLKSLATDDLSDTVRYLLIEEVVKLAQMIGPKSTSKYLLST
                     FVGAYMDPSWRVRYTAANRLGAMAALVLNADDLEVVLETLARDEEPETRAAVARQLEL
                     MVQHCSSEVVQHSCVPVAVALSQDADPVVRRSAARHYHCFIFGSEEVVRTMCKALRAL
                     MQDAVFSVQENAIESLGDLVPALEGSVQAAVQHVALGSAGGGSGVAHWPSNSSRGSAS
                     RRQQASTSASAHNRGSRHKSPHLSSRLASGAAAVSGPAGAGEANVALTRKRADAIVRS
                     FMTEVLNLGESRNWRIRNAVVRIVHHFCKVLSPDQFRPLTKMLFIALHDPVSTVRSQA
                     VRTLKEVAAAYGGEWAAQTATELLQSDTLAPTRAVSYMWRVVMIQCLEVLLPAVSELS
                     PREVRRQQLLATTLPLLRDYVTDRVPNVRLAVAHALPCWYSWFDVTETERAAYNAALK
                     QLQQDADIDVLNASHKISYNSGSSNNVAGGEAR"
     gene            complement(<411040..>411609)
                     /locus_tag="LDBPK_150990"
                     /db_xref="GeneID:13392963"
     mRNA            complement(<411040..>411609)
                     /locus_tag="LDBPK_150990"
                     /product="calmodulin-like protein"
                     /transcript_id="XM_003859575.1"
                     /db_xref="GeneID:13392963"
     CDS             complement(411040..411609)
                     /locus_tag="LDBPK_150990"
                     /codon_start=1
                     /product="calmodulin-like protein"
                     /protein_id="XP_003859623.1"
                     /db_xref="GeneID:13392963"
                     /db_xref="GOA:E9BCD9"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9BCD9"
                     /translation="MAAPEAATAAAAAAASPAAGNFAVPLEWSSTWNLFDERHTGSVS
                     HIDLKHILRSLGRRYTEAELNDLLRPLPNPASYDAFIKLMQQPYTGPTEEDLVTALRA
                     FDVGDSGRLKLSELITLLTTLGEKMPEADVRQLLAEVPTDEKGRVRIDELAAYLCTPV
                     PTTTPDIIELQRQLGQAQSTAGAPVTKSI"
     gene            complement(<412504..>416121)
                     /locus_tag="LDBPK_151000"
                     /db_xref="GeneID:13392964"
     mRNA            complement(<412504..>416121)
                     /locus_tag="LDBPK_151000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859576.1"
                     /db_xref="GeneID:13392964"
     CDS             complement(412504..416121)
                     /locus_tag="LDBPK_151000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859624.1"
                     /db_xref="GeneID:13392964"
                     /db_xref="GOA:E9BCE0"
                     /db_xref="InterPro:IPR007145"
                     /db_xref="UniProtKB/TrEMBL:E9BCE0"
                     /translation="MRRASAAPAIDAATDVADPRVAPAVQQLSAVAKRVYAVWQRMGI
                     ASRDRQQKWNAFLFGALLPFLDDFGALQEAAESNAAAENDALLRDVCHLAVRLDEAPR
                     QPEVASIVSLLREHYAQTQQRHPFAVDGGRSSNRGDEAGSLDTASESAAARRSNGDVG
                     GDAEAGISPSRGKEFMYLSLPSFVTLINASCPSGQRGENDDEQHQQERAHQGGGVGLE
                     ADEGNGEQGANFSGGDAHIAAAHALRRLLHNNTHEGVRRQLQAELGRLQRLADNRLQV
                     LQLLCKQRAMINRSAQEQVVLRAAYRAKYLSNEEEGGSSELGKRVSLDWESAVDRRLQ
                     TTVAVGATSTRSSGFVSPLTSPKTSGVAAALVAPSSDKCEESSSSSGGNEEADAIASL
                     INRPTTSLQDATREELQLLLCAASCSLDTQYSLSGGDSNVDHAPLKHGGEGELGSSAW
                     PTRSSTTVTTEARITAQTATSSTGVLAAAKGAGVHAKTVVRSPVGTPPGEAARATVLE
                     VDVSGITAYGTHQDLTLTRIQAEAEAIVRSIDEHNCLMQLEAQEELHALDTLEVLWRA
                     MSVQRPSPKASSPFSLPRRCKEEAESQGKASGSIHSNSPDENAVAWHAKTSICSPPLA
                     PFKPEPYRQTTEEIVARYRQLHAAYVADVAAQQQQQPCPAAGVELLHAMPTPPPSLKS
                     STRLTSSAAVDDSDSAREQKNAHRTGGGLYLPPAVRQVLRAASYAPVLDYVRRARAAF
                     QAHLSTQQDILVEKTMGRLRDVYEAYYAATGDKTYAVAPDGELRVAMEEELLETFQSE
                     ESAVPAARQQQRSDEVNEENASVVEAREAAAVAAPPPPSSPSGKVLLSFQRHLTACQQ
                     VREQAADEIEFLRLRLHIIEQAAPLVHNYQEIVREEAEMRATSRERLLNKKVNMAKQL
                     LQEEKARRRVAKELPRIVNHLKELVAAWDALQAATDPREDTADVGSCHNIGPDAPVSS
                     PPTSAKAELWIHGQRVRDLLTASQSTAAPLVSRVRGRSASSPPPLRSHPPVRSVSPVP
                     PELVRHRVEKRLAGPDRGASAHPSRKGSPTPAHTPLSRRGTTPLVAASAASQPLPGRH
                     RAAGVSNRGGKNGAASAERPGDPLRSHNNTTSPAVRSHTPPRSQPTARSHKPASFRPL
                     PPRVPSSSPPPLLPHRGLSPVSSNRNLQTHKRIAHPSTSPSPSSKSATTTTRFDRAPV
                     A"
     gap             417731..417818
                     /estimated_length=88
     gene            complement(<420588..>421526)
                     /locus_tag="LDBPK_151020"
                     /db_xref="GeneID:13393012"
     mRNA            complement(<420588..>421526)
                     /locus_tag="LDBPK_151020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859577.1"
                     /db_xref="GeneID:13393012"
     CDS             complement(420588..421526)
                     /locus_tag="LDBPK_151020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859625.1"
                     /db_xref="GeneID:13393012"
                     /db_xref="GOA:E9BCE1"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:E9BCE1"
                     /translation="MSDDDVHERLTTIPGACPTPLELGMSGWNILHSSAAVYPYKPSA
                     VQQTAMKNFIESWAHVYACSWCAYHMREYVRDHPPDVRDKLTVSRYVCEMHNDVNVRL
                     GKDVFDCSPSVVLRRWHPGYPNKMEDMPMIEEQLAASDREKSTAKEAKHSQQEEEQRF
                     SRSGLHAHEAAPNEAVAWRTASEAASKKVDGGLWSWRIFRKPVLGTHAAKSNAPPGTS
                     SSSPPPTTQHEPSISSSGALKAPSTGAVAAAASDVGAAHPRHSWSTSTSEAHNSFLTP
                     TPSRGKAADDDTDIDAVLKRLKRCQVYCPEDEELKH"
     gene            complement(<422416..>423618)
                     /locus_tag="LDBPK_151030"
                     /db_xref="GeneID:13393013"
     mRNA            complement(<422416..>423618)
                     /locus_tag="LDBPK_151030"
                     /product="NAD/FAD dependent dehydrogenase, putative"
                     /transcript_id="XM_003859578.1"
                     /db_xref="GeneID:13393013"
     CDS             complement(422416..423618)
                     /locus_tag="LDBPK_151030"
                     /codon_start=1
                     /product="NAD/FAD dependent dehydrogenase, putative"
                     /protein_id="XP_003859626.1"
                     /db_xref="GeneID:13393013"
                     /db_xref="GOA:E9BCE2"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="UniProtKB/TrEMBL:E9BCE2"
                     /translation="MPLSSSPAPKRFSAEVRDDNPYSRLMALQRMGVVDDYESIRDKA
                     VAIIGAGGVGSVVAEMLTRCGIGKLLLFDYDTVEMANMNRLFYRPEQQGMKKVEAAKE
                     TLEGINPDTVIEPHAYNITSTEHWQRFSEALTKGGVSPNSPIDLLLCCVDNFQARLTV
                     NLACLTYEVPWMESGVAENAVSGHIQLLLPGVTPCYECCPPLVVATGLPEAKREGVCA
                     ASLPTTMGIVAGFLAQNTLKYLLQFGDVSEYVGYDAMRDHFPRVELKANPECRNALCG
                     ERQAAYAAKVRKMGEAAHPLYTARKARADRAEKERQAAQARAKACAAEWDITVEAEGK
                     DSLTVHSGVANIAAALLGSNGEGESGLEYAYAGTAADNAAVEDEDKYVKMAGASVEEL
                     MARMKAIQ"
     gene            complement(<426697..>426924)
                     /locus_tag="LDBPK_151040"
                     /db_xref="GeneID:13393014"
     mRNA            complement(<426697..>426924)
                     /locus_tag="LDBPK_151040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859579.1"
                     /db_xref="GeneID:13393014"
     CDS             complement(426697..426924)
                     /locus_tag="LDBPK_151040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859627.1"
                     /db_xref="GeneID:13393014"
                     /db_xref="UniProtKB/TrEMBL:E9BCE3"
                     /translation="MHVRAAVCATTSASSRTLISRGPPHLPRPLPSSQHALDPASHDR
                     HYHLMCVCVCVCVSLSVRVEYAPTKQHSCVC"
     gene            complement(<427942..>428535)
                     /locus_tag="LDBPK_151050"
                     /db_xref="GeneID:13393015"
     mRNA            complement(<427942..>428535)
                     /locus_tag="LDBPK_151050"
                     /product="succinate dehydrogenase, putative"
                     /transcript_id="XM_003859580.1"
                     /db_xref="GeneID:13393015"
     CDS             complement(427942..428535)
                     /locus_tag="LDBPK_151050"
                     /codon_start=1
                     /product="succinate dehydrogenase, putative"
                     /protein_id="XP_003859628.1"
                     /db_xref="GeneID:13393015"
                     /db_xref="GOA:E9BCE4"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="UniProtKB/TrEMBL:E9BCE4"
                     /translation="MPSAPLPGQLANYSSPLYMYRHLIKNSTAKTPQLYTAKDNSKTA
                     MHLLTRRAANANYTVNRWYLKEKVDSSNRMRLEGLYECVLCASCTGSCPQYWWNREHF
                     LGPAVLLQSYRWLVEPLDRDFDERVRMFETGNLVNMCHNIFNCSITCPKFLNPGLASK
                     EIKRLSSPSAKRVGPAIEMEPVTSGKEAGKRSLAQMQ"
     gene            complement(<432204..>435266)
                     /locus_tag="LDBPK_151070"
                     /db_xref="GeneID:13393016"
     mRNA            complement(<432204..>435266)
                     /locus_tag="LDBPK_151070"
                     /product="glutamate dehydrogenase"
                     /transcript_id="XM_003859581.1"
                     /db_xref="GeneID:13393016"
     CDS             complement(432204..435266)
                     /locus_tag="LDBPK_151070"
                     /codon_start=1
                     /product="glutamate dehydrogenase"
                     /protein_id="XP_003859629.1"
                     /db_xref="GeneID:13393016"
                     /db_xref="GOA:E9BCE5"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:E9BCE5"
                     /translation="MMRYTASRAVARLCGRAFPASHAVTAMTLLGVAPLATPGRFASS
                     GATSPLVDRDAIIKAVTTQAVFDKNIVESLANTFVSGLEKSSYPRNFSQAEMIDHVQG
                     LLTAEARFRMGDSFEYVHENHRTAFYICHNEPQKKLRMLRKMARFVSLNQDPHLGSNT
                     HHYISEDRKFAIYNASIEPFVESGSEEEHVNPKSPALPTQTAARQLTEEQKNIIRGLL
                     RRQLSSVFPVFHVEEVEKGHVSFTMATMVERTNYVASLLSIFQEIEGAEIMMSVSYSF
                     SNGVQVYGFEIRGATAEQIEERASLVGLLPNRPFNAITRLHEAGALSCEETVFIDAAV
                     IFAMYFTPSPTTDDYRHLKAILAKEPNGVNRLNNLRSSLTQEVMSERYTGSVIALYPE
                     FVKLIYEDFRLGSTPERRAAIADKITHRLREDDRPEYDRTLFMSFLKFNEVIIKHNFC
                     KTEKAALAFRLNPVFLKELEFPRVPHGVFLFAGGQWRGFHIRFTDIARGGVRMIICKE
                     RDYRRNKRSVFQENYNLAHTQLLKNKDIPEGGSKGTILVSSRYLNKFDEVRCQHIFLQ
                     YVDALLDVIIPGEKGVVDGLKSEEIIFLGPDENTAGTFPAAGALYSKGRGYKSWKSFT
                     TGKDPELGGIPHDVYGMTTHSVRAYVTSIYEKLGLNESEMRKFQTGGPDGDLGSNELL
                     RSKEKMVGMVDISASLHDPKGIDREELARLAHHRLPLREFNRSKLSPEGFLVLTEDRN
                     VKLPDGSLVEDGSRLRNAFHFLKYSDADVFVPCGGRPRSVTLENVGRFLKIPNADGES
                     MMEGKYANLSPEQLKFKIIVEGANLFISQDARLALEKCGVTLIKDASANKGGVTSSSL
                     EVFAGLCLSDEEHTKYMSAKSATDAPEFYKKYVKEILDRIEENAKLEFNAIWREWEKD
                     PQQSKTLIADALSRKNVQIRASMLSSDIFKNRDLVRYVMDQYALKTLKEVVPVDLMLK
                     RVPENYQHAICAMWLASRYVYQTGVDSNEFDFFRYMTEVYATAAKSAK"
     gene            complement(<438309..>439388)
                     /locus_tag="LDBPK_151080"
                     /db_xref="GeneID:13393017"
     mRNA            complement(<438309..>439388)
                     /locus_tag="LDBPK_151080"
                     /product="solanesyl-diphosphate synthase, putative"
                     /transcript_id="XM_003859582.1"
                     /db_xref="GeneID:13393017"
     CDS             complement(438309..439388)
                     /locus_tag="LDBPK_151080"
                     /codon_start=1
                     /product="solanesyl-diphosphate synthase, putative"
                     /protein_id="XP_003859630.1"
                     /db_xref="GeneID:13393017"
                     /db_xref="GOA:E9BCE6"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:E9BCE6"
                     /translation="MLQRSLARLCAAAQRQGSKALAAEGRSFALVNREVTAIQEHIQS
                     LVTNTNNEVLDHAGKYVLAAGGKLMRPALVVLMAHAMLPLDVSARLLEEPIGSLDEVT
                     PGTILPFLRLAEVTELIHTASLVHDDVIDSTGTRRGRPALHKVYDAKRAVLAGDYMLA
                     RASFYIATLQVPRIVILMTTALEELTAGELIQMDGCFDIPRYEQKSFCKTASLIANSL
                     ASTAVLADPGNEALEQTAFDFGKHLGIAFQILDDCLDITGDEKMLGKPKLVDMKEGIA
                     TIPVLLVARRNAKVGEMVCRRFAEPGDAEFCLEAVEKEGAVAEAMHRADEHCRLGLES
                     LHKLHHSPARDALESALSMVMNRKS"
     gap             440529..440584
                     /estimated_length=56
     gap             440704..440802
                     /estimated_length=99
     gene            complement(<440939..>442222)
                     /locus_tag="LDBPK_151090"
                     /db_xref="GeneID:13393018"
     mRNA            complement(<440939..>442222)
                     /locus_tag="LDBPK_151090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859583.1"
                     /db_xref="GeneID:13393018"
     CDS             complement(440939..442222)
                     /locus_tag="LDBPK_151090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859631.1"
                     /db_xref="GeneID:13393018"
                     /db_xref="GOA:E9BCE7"
                     /db_xref="InterPro:IPR004015"
                     /db_xref="UniProtKB/TrEMBL:E9BCE7"
                     /translation="MLQETLAASRQTTEVFDSHSLAVQSRLRSASNKSNSQALALTIT
                     AAGGSSTGVDGAMHDPGPIVRSPTTKKKSLFTDALLLRSGGRSSNDNKGQQAGDGGSA
                     SGDLAARTSASSMMLAAVSEYSAGGGGAAAASANNRKVVVPFCVSSWQNRKKLIVPVE
                     QRLAQQQDDRLDPGGGIGDAVMDLAVAMQQASKEVAAELAEKERAKAEEEERRQAALE
                     AAEAEKARQLLEQKAAELAAHAQRRETREQRMERIRLERELREQEKLAKQQQRLRERA
                     ATRLNITVEDLEADEQLLRSVEEASVYAKSGSGAMAPADPTAAPSSKEKQEPFGGLGR
                     QVPSDNGDDDGDGTVGGSRKPAVRGGVFASAVISNEGIQREMQALAEVEQQQHHHHHD
                     GIRLREDDEASVADDDDDDGGSFQLNKFVKKKQRL"
     gap             444426..445545
                     /estimated_length=1120
     gene            complement(<445548..>445727)
                     /locus_tag="LDBPK_151100"
                     /old_locus_tag="LDBPK_151110"
                     /db_xref="GeneID:13393019"
     mRNA            complement(<445548..>445727)
                     /locus_tag="LDBPK_151100"
                     /old_locus_tag="LDBPK_151110"
                     /product="developmentally regulated protein, putative"
                     /transcript_id="XM_003859584.1"
                     /db_xref="GeneID:13393019"
     CDS             complement(<445548..445727)
                     /locus_tag="LDBPK_151100"
                     /old_locus_tag="LDBPK_151110"
                     /codon_start=1
                     /product="developmentally regulated protein, putative"
                     /protein_id="XP_003859632.1"
                     /db_xref="GeneID:13393019"
                     /db_xref="UniProtKB/TrEMBL:E9BCE8"
                     /translation="MTVFWPEQWWKRKDHRKIRGARGARFASLRFHGAFILSVVVLVE
                     YVFRSTDDFTARHFAD"
     mRNA            complement(<445551..>445727)
                     /locus_tag="LDBPK_151100"
                     /old_locus_tag="LDBPK_151110"
                     /product="tryparedoxin peroxidase"
                     /transcript_id="XM_003859585.1"
                     /db_xref="GeneID:13393019"
     CDS             complement(<445551..445727)
                     /locus_tag="LDBPK_151100"
                     /old_locus_tag="LDBPK_151110"
                     /codon_start=1
                     /product="tryparedoxin peroxidase"
                     /protein_id="XP_003859633.1"
                     /db_xref="GeneID:13393019"
                     /db_xref="GOA:E9BCE9"
                     /db_xref="UniProtKB/TrEMBL:E9BCE9"
                     /translation="MTVFWPEQWWKRKDHRKIRGARGARFASLRFHGAFILSVVVLVE
                     YVFRSTDDFTARHFA"
     gene            complement(<446904..>447245)
                     /locus_tag="LDBPK_151120"
                     /db_xref="GeneID:13393020"
     mRNA            complement(<446904..>447245)
                     /locus_tag="LDBPK_151120"
                     /product="tryparedoxin peroxidase"
                     /transcript_id="XM_003859586.1"
                     /db_xref="GeneID:13393020"
     CDS             complement(446904..447245)
                     /locus_tag="LDBPK_151120"
                     /codon_start=1
                     /product="tryparedoxin peroxidase"
                     /protein_id="XP_003859634.1"
                     /db_xref="GeneID:13393020"
                     /db_xref="GOA:E9BCF0"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="UniProtKB/TrEMBL:E9BCF0"
                     /translation="MDSEYAHLQWTLQDRKKGGLGAMAIPMLADKTKSIARAYGVLEE
                     KQGVAYRGLFIIDPNGMVRQITVNDMPVGRNVEEVLRLLEAFQFVEKHGEVCPANWKK
                     GDPGLKVDHNK"
     gap             447335..447545
                     /estimated_length=211
     gene            complement(<448117..>448467)
                     /locus_tag="LDBPK_151130"
                     /db_xref="GeneID:13393022"
     mRNA            complement(<448117..>448467)
                     /locus_tag="LDBPK_151130"
                     /product="developmentally regulated protein, putative"
                     /transcript_id="XM_003859587.1"
                     /db_xref="GeneID:13393022"
     CDS             complement(448117..448467)
                     /locus_tag="LDBPK_151130"
                     /codon_start=1
                     /product="developmentally regulated protein, putative"
                     /protein_id="XP_003859635.1"
                     /db_xref="GeneID:13393022"
                     /db_xref="UniProtKB/TrEMBL:E9BCF1"
                     /translation="MTVFWPEQWWKRKDHRKIRGARGARFASLRFHGAFILSVVVLVE
                     YVFRSTDDFTARHFADPPVLAPPPLPTSLGYSMTSEMPHLKSLELEREAPAHLPRSGP
                     LDLKGLRGEDRLSG"
     gap             448605..448703
                     /estimated_length=99
     gap             449577..449675
                     /estimated_length=99
     gap             451296..451394
                     /estimated_length=99
     gene            complement(<451435..>452034)
                     /locus_tag="LDBPK_151140"
                     /db_xref="GeneID:13393023"
     mRNA            complement(<451435..>452034)
                     /locus_tag="LDBPK_151140"
                     /product="tryparedoxin peroxidase"
                     /transcript_id="XM_003859588.1"
                     /db_xref="GeneID:13393023"
     CDS             complement(451435..452034)
                     /locus_tag="LDBPK_151140"
                     /codon_start=1
                     /product="tryparedoxin peroxidase"
                     /protein_id="XP_003859636.1"
                     /db_xref="GeneID:13393023"
                     /db_xref="GOA:E9BCF2"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:E9BCF2"
                     /translation="MSCGDAKINSPAPPFEEVALMPNGSFKKISLAAYKGKWVVLFFY
                     PLDFTFVCPTEIIAFSENVSRFNELNCEVLACSMDSEYAHLQWTLQDRKKGGLGAMAI
                     PMLADKTKSIARAYGVLEEKQGVAYRGLFIIDPNGMVRQITVNDMPVGRNVEEVLRLL
                     EAFQFVEKHGEVCPANWKKGAPTMKPEPKASVEGYFSKQ"
     gap             452356..452454
                     /estimated_length=99
     gene            complement(<453437..>454723)
                     /locus_tag="LDBPK_151150"
                     /db_xref="GeneID:13392965"
     mRNA            complement(<453437..>454723)
                     /locus_tag="LDBPK_151150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859589.1"
                     /db_xref="GeneID:13392965"
     CDS             complement(453437..454723)
                     /locus_tag="LDBPK_151150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859637.1"
                     /db_xref="GeneID:13392965"
                     /db_xref="UniProtKB/TrEMBL:E9BCF3"
                     /translation="MATAADYVGKNCPYCGAIDSIETDEARGEAACVNCATVVAMGLE
                     ENVATRFEKDATYADVDRGGDVGWDPENGGAIGRATARNAGLTREEAAAAAAGLLRHP
                     NAAASAFSAGPFGDTAKYAKTKLHPRMSAQLEVFFRLSRRHDEAILRDAIALAKHFVG
                     FRRERGMRVEHQTEVAAASVMLAAERLGQPIPLSEMRVLDGTLKDVESRRQEILDATN
                     LGEEMAQMAKHYAPNLIHYYVRLLQLPLIRYEMPCLALFRAIRQCESKPGPGASELAV
                     FVEAEKVVMAVLLARTEPRLRWPNKPPPPADPSAEPSRATLYSGFASSAHLQPVRVEK
                     LMRVAERAVPLIRPEFERLMQTPEFAMAAVHTMGEAVVSMTVKTEDTKSYAPVKSEPI
                     PTSAPSAPNIAGGNRKRSRSRSTTPQVPPSSASQER"
     gene            complement(<455640..>465110)
                     /locus_tag="LDBPK_151160"
                     /db_xref="GeneID:13393024"
     mRNA            complement(<455640..>465110)
                     /locus_tag="LDBPK_151160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859590.1"
                     /db_xref="GeneID:13393024"
     CDS             complement(455640..465110)
                     /locus_tag="LDBPK_151160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859638.1"
                     /db_xref="GeneID:13393024"
                     /db_xref="UniProtKB/TrEMBL:E9BCF4"
                     /translation="MPLIVQRTYKLGVGSATDADAPASSTSPSVVPSAPEEHVTTRTC
                     HRWSYVDASRHETCIVTLQAHYSLHVDVKGEGSTAATLSLQQAGGYPEGPSSDDGLCG
                     FAWEFIWIPSPCPSSEAAGAAAAVTSSSGVINDEADLEAQQPARARFFFHRTTSLAQS
                     TLQGIGGVLFLSSRHVLVATETLDAAGAATGPAATSRGAPNDQLRDAAHYSLMDSFVL
                     SSGDAAAARSASCACSWIRVAASASLPCPFASPQAPRHAGTTSAPPSRPSTVLLLVAG
                     VPLRLPHHTSAAAAAAPLMRLVYVFALLGSSTGGGSSGNADPEHRAWDVMACVADLCS
                     SGASADDPHSLQVRVRHAVTLPLLRLSVQKVSTEDGVHRGGGGTGWAHARDGAGGANR
                     TQSTSSQQQQSLDPHDLLWAFVEDEDTRTVHPLRGGQLCGSLVALLPCCCAPARTLVA
                     PPLPAAASSPVANSAPSPPAVLCMGFRGDTPYGVLGVSSAELDSYAKANQQRQQHPGR
                     ASHSSVQEIIEQLLPSPERAVYELAVGGLTKCICPAATIASRAAPMSMTALPAHTSLL
                     MLIVDGIHTRGSRDSAAQQAGAARVVAAPAATLPQGLYLTETLSYDALAQLASSGRPE
                     EAVEGQNSRVRVHHVPPTRTLWRGLDPLVLSVPSVPTSAAGIMDGEWGDEDSTTQGMA
                     QAAHRDVLAWDIADVGRWMEWLSETAGGSADGTYGKDHHTALMVGESAAEAEGTVTSA
                     SPSSMATVTAVASHTCASSSTATAASVVRSFPCFNELTHELTMLWYCCNGAAGHSSEE
                     EDQAATERAVALVRPPLWKPRTAASSHQEWEAHVAEWVAAEQVRGRLHSSTTPPSDAG
                     VAAATYRAMRMLWAYAVLHEARPALPQWPGALMEVLRSTAADAAEHQTCLYLYARAVQ
                     TFTVARLASSYGDDTAKLETEVRHMRRAAAVFLRLVLRTLAALDWCAGDVLGWMCCQW
                     MVRWFLGSGAGATAAEATRSPSPTTTTASVVQEQAAAVEGRAMQVLLQLGAAAREPVR
                     IEAAFSSTSSPQRPLDWLRRALLLFASRNRQLPLELTVEDILEASGVLLQPETAPEVA
                     LATVASGWSEASDEEATADAAPPWPTPDTAELRESMEYALLRLAKPEELYRVVHHLAH
                     VSPATYLERSSASTRTIRGRRLRGLQRLVVRGVLTVADLHALVCAGWASGRPHDAAPP
                     GGFTFVCYIVDVAMKFTSTVSPATTGTMKTAEAYERLVIAALDTWGVPGSYEDGGQAQ
                     GASHARTEAADATDRRPVYPLLNTPELDGFATAEATTAVPIPFPFTLLAPLLTVYLWY
                     HVTHRLCAALQLLPPAASEAAAGIQPEKTPGIDIADEQQHAPWLRRAKLRDGAHLQAL
                     HRGVCVLRCLTQEDATATEELFAAMRLVYSRPQRDFGHQSARQQGEHAGTAKVMNSAV
                     AVGGDTAVAAASAVGGSWVSQYLIAWHHLLPLEAPPLCSAGALLAYQERCCHAAAPAA
                     PHIGDVMRVLHLVYASAGSGRVLRAQVSRAMGLQQQVRKEAAAEGYAHSYAAFTRALQ
                     SWRTIAQKQHHHSTEKPSATTSTMRSGGVATGDAVAAWLVQIWANVLLCDSGAVTDVG
                     MYEHLFTALAHAKQQGEQLSTTAAAAAADLAFALLRPCLLYALPALEQLAVEEELESS
                     NGHSSRTPTPVPSYPQHNEPLTWGASGTSPDGAEGPRHGRAPERLCAGEVCERVRRQL
                     RRLVDLYGVPPSASPGTSPARCGDVRFSTLAQLMALQPTAWNLAAAQRRVALRSVKQS
                     AAQRGADGDEEPGQPSASRSLAASTGCSPRDSSSSSSSSSAASFGDGNESTLELRTFF
                     LSPAATYVAAAAAVAMRHTTSYTSAGQDEGSRNFPLWQSPSAAPPLPVGWLLVACEVL
                     RRELRCYILAELRMSGYVEESAAMHAAEAGIEDTPGCTAAEAAPHLPRLPMPCWRLVT
                     SEAQLKAFINALADAVEPLTGALVRAMSFAALQPLVLLLVLDVLHVLLYNNAHTHGVE
                     DAADGTTQRGPAAKQTTTSAVMCADASILRLLRQWIRGVAAPLYQNMEDSGKKAVLEI
                     ITDSFAREYLTAPRGEGATPSPGSTAPVSRSYLESDVHVGWRQWRKEAAARNVNGKGV
                     VMLECLSACVAADHQQLVRMALPTPSDDEAPQQAVSAVQPTGPGAKVAGSSAADAAAV
                     IGSTWLDVGSALRASLFSTLGASVAPRAAHQRQQQRAQTSSLAVSLSRGEARPASASA
                     AEAPLPFPTPQPLAAPTIISGDDGSSRTLGLAVGGTDELHLLRKEEAFKRRQCSEQLL
                     HEQKLLFASPAFQGSLLQLYVALRAEKRRKELVAFALDQHDLIFALAHREQQLRLDEA
                     REALRRSWCEWGERQRLAVRRLLQEERDARMGVQAIGYAAWSLLLDAERQERCVRVLY
                     EEGRAGVMALEDDARDELAVAAARAHLELTKLAAEAEEEAYWQAEEAAWARMQEEEQQ
                     ETSRHQNQSLPAVQRQGSRMSSLSCASSSSSVDSPLKPSADPPTAAAAVAHPRVVRGG
                     GARVVGEDSGPAARKHVRRGGRKERGGGAAAVVALRSPRSAVGLREAGDAVAPTPARA
                     GATAITSVAAEQHQQQVPPHSASLAAHSTHSEDEENVVPGWGGGLAQAAVQSAISGAG
                     GFFSTLSHWQTALRDTVAPPPPACGRGRAADRQAAVSDAPRGSTAGQLSVVAGIAKEA
                     APPAPVVVPDPARSREAQADDWGWSSNSDKGISPVEVKPPESKAEENESCAATTVPLP
                     SRSIAPLRKASASGEMSVAAAPAPKERPQQDATAAAAAARRPRKKKGFAAAAVLVEPV
                     SSASAHVAPLASSLLLPPQQSVKQLRGQQQQRHASSPDDPAAPNPVRNILSAIEAAAT
                     EMISEPKGAPSPATRPEHAPPRSQPQGFPSLRAARTGWSESSSASSSSSSSRHGVPSP
                     LGEPGTLPLTATAALDTYEGVKVRVGIEAKSDSAAVNDREDWGWRDDDDDAETGPGAR
                     IHSVQPAVGVGRAAAAADTVHEASSPPPMAGVKGDGWGWSNDGVHVGVAAEETREPSP
                     PPRTGGGVIATAAAAPPPSTPLSDVAKNVAKDGWSGDDDPFGSGVAVAAGGIGLSGAP
                     SALSGSAAEPTTRFTMLADLQEMYAAEMEMRAQLVQLL"
     gene            complement(<466423..>470187)
                     /locus_tag="LDBPK_151170"
                     /db_xref="GeneID:13393025"
     mRNA            complement(<466423..>470187)
                     /locus_tag="LDBPK_151170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859591.1"
                     /db_xref="GeneID:13393025"
     CDS             complement(466423..470187)
                     /locus_tag="LDBPK_151170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859639.1"
                     /db_xref="GeneID:13393025"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BCF5"
                     /translation="MSAHDNGSNDSNIRTCISSVSSSGSMHHTAGDAAVTGVAPGCES
                     MKHLDASAATRTAVPFPDTSAALTPDGSSSLARALGSSTNQDMPSTTSAVPPQPSSRS
                     QNSLLSSFRTSAPLAATPLPTSLAGGSVAYQHQSIAVADSIVRSSSALFSHEQAVALR
                     SAKRDVSTSPPSRHIGGDSSRSATPLTVSTTASLDPRGENTPIQQNALEVLQRAVNHV
                     RSNLQQSNVVKPSVASGTEDERTGHSIAQAVRAAVRAAEMIDQENVNNSLNDSDVDDA
                     PSEATTGTRRSHRAMDWRDDDDSIVSPSTFFHSDASLQVRSNRVMECIVAKGHAAQTE
                     EELTWLYRHALLTSLLDTEDLQRIVPLSLHREYTHGELILDFGAPVQHLYVVVWGSVD
                     VFRIDSVNNEQKAMEGAFRVASHQSVSMKLRSMSGSRDRHGSLSSYGLRLSDGQDAST
                     NSDIPSDAVYTHVASLCPGQVFGIENCVFNTTSQYVFRAGSAMSKTVVSLLPYEELQP
                     VLSGNPRFAQGVGVCITDSMDVFGPIREFCRYVFSPTSAQNEYLPLWSILESYTRIHN
                     VIHTKLFSHEVDTGAWGYALNRLPDNLTSTFCFDLVHALPPFIASRMKVEARAADTRK
                     TADGLARTRSMRTAITYIRTRERRRCTWHLGMEGKTLVLLRDGFTDLLDFLTMLCVHI
                     IESNKLRGRMQGMVHPPAIDVLDEYLRQREQEELEGKYLAADGVTRDTEMQRVQTILK
                     RMPLTEGEQAGLLRNWGHNTLLRLYEIMMHREEYNVRVDPSLSLKFQTNPFHEWALNL
                     RGCVLEKLGLDRFSALPDDLCIDVISSNTHCIKNLLCSFNRKYRNEILDYVRLSESKR
                     LGRPEEWHNMDDMLYAALTGFLQNERPDLKEEYNRSLEQSGITVLQDTAMTGLQVDVI
                     PVHLLNFNTIDEAIRDAMHAHYVEATKSYNGEGESEASSSQVPTWSQVCKPIWRRSSE
                     GSPIRVPGCMTTSGRKNISANAAAGAAPLDGDGDAGGELSPTGYDGSASANESLSTPR
                     GAPMSHLGRNGRRQQHFLINMDFAFGAQAEGICRVIFSAFGKRIRSVSVMGKAGGLTG
                     KRGDIQLASHVLLSKSSLILEDNQDELRNCRNQDLTAQRLQELAGPRVKVHHGKVLTV
                     TGTMLQNVSLLRYYQQVWRCIGTEMEGSYFARVIEDFYRQGIAHPGLTTRFAYYTSDL
                     PLAQNDAEMEARRTHRLPAGGATLSAPMSPQEGVPPLYAIARGILENVLL"
     gene            complement(<471075..>479180)
                     /locus_tag="LDBPK_151180"
                     /db_xref="GeneID:13393026"
     mRNA            complement(<471075..>479180)
                     /locus_tag="LDBPK_151180"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859592.1"
                     /db_xref="GeneID:13393026"
     CDS             complement(471075..479180)
                     /locus_tag="LDBPK_151180"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859640.1"
                     /db_xref="GeneID:13393026"
                     /db_xref="GOA:E9BCF6"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BCF6"
                     /translation="MDPAGRRLSGEQQQQQQPADRAKADADRGTVDMLPPLRTEASPF
                     EQASAITNRSSAASAPLSVAVKVMPTLAAAMSSLRAGDDNDGGGENEGEEEPFLTNGS
                     IALAEFTSLLKPAENNSILKEHIIHLLRDVDAEETLMRIARALEAQGTNETPVNVSAT
                     TCTGSSRDVASYTNASQSTVASMSTMQRRRSSAVSRRDATSLETLAGLSFLHSRRGAT
                     SPSAQESPSSAQPSEDVAPYNRSTRGLVGPLDTSFNSRSSLGTREEEQRQSKQQDDPL
                     SAFMAASASQLSDATPTLRESPGLPTGSQCRGRRVAVSAAPCMAPPMIGEDSPATALP
                     PLRVVPKTSAEEQQLRRLLRRCHSFSSLEADTLESVLKAMDKEVHAAGAAILEQGQAT
                     TEKLYLVGEGTCEAIKNGKSLGPLQPGGTFGELELMYKQAMCAATVRCVTRCVLYTLD
                     EASYHRAVMTSALQKRRKFEKLTMSVPFLRCLPDFERMKIAEALETRVYQRGKTIIRF
                     GSPGNYMHFIIEGEVKVVGRNSGRRVEVVRLRDGDVVGELEFLFNHLTVADVVATSRE
                     VRTACISREHFELIIGPIQDRLKEFVATSSTYEKYYVAEVADESVRTELNRIESSRKH
                     RRVASRDQRTAIGDIDPHGEVLLSAPLPLLHGKCDTAGKAGGVSGVVANSDSAAGNGA
                     NAQGQRRAAARGSAELPKAMLRFPFAPITGKDVAVLALREDGLIMYWNSVLERLTSYS
                     AGEAVGQNIYSFLLSEREQQCMYKAVNAARNYAGEAEAFLKRPSTKSIQFTLARSDGL
                     TKTTVRLTIVPPVVSAGGNAAEVVLGFGEEVKEGPQKMLEQPQWLSGQIRAILADGTQ
                     TFEERLECIAETLNNFESTYRAMTVSTERLRVVNIRQMMGHILMDFGSECVSRGISVR
                     QRFEGLPSERAYLDANLLPECLRYAMKLCLKYSDPGGSIITIMITVTEKNGLEFLVIN
                     FNLTGDGMPKAIAQFFDSPLKKHGDSVTTMSVDDDSGDGSGDDSDNDAEASMALRSTL
                     QPRLRRKLRRVQRAVEDQGGTLRMLRNPQDSNIAFLIPFMPASEQDAENASIEESLST
                     LADSAGAGQLASLAGMSSGVGPPTSVAAAAAAFSVSLVNTPAGESSGLSNMSVAGTVA
                     TVSGQPNFSYTTCLAEDTPTHRIMLSSFLWERHHAVLTAFTFEDIVGLVGVADILIID
                     LQQSAITFLHERDPITRLREMLRHMAVIITSTNFDLVSSDTYAAAGFITLKKPCTPVQ
                     AMKAIRRAEEKSAVVKLERLRIEQTRETLARNSRGAWRHGALLGKGSSGEVYEAYDVL
                     TGGKMAVKEMRLGNNDAKIEQFVQEISTMCNLQHPNIIHYFYCEESKEQKVIRVFMEF
                     AGGGTLQSLLKTKGRLEYAELRALLRDVVEGLAYIHSQHYVHGDIKTANVLLSNDGKG
                     KIGDFGTARTVNEGELLYVMQGSPLYMSPECMSAGEEDEDGNKIGYSFPSDIWSLGCV
                     AMEMATNKPPFAHIKTIKGPAGLTTFITSLTDVPDLSPLFKCHPSIVEFVSACLNPDP
                     SQRATAQDLLQMSLFSDSTHSDRNSAVMALKRAQLLHVLNKFVAFQEPEEAEKLEKRR
                     NRLKVSRLASDFFSSRSSSSDNASEPMSTVFLNAAPAAEVEEATREKRRPGAAVTTAA
                     AATAAVAAGNEDESDKDVTRRSGTVALAAGGASESPDGARPAGASAGAPLVNTVTSTD
                     GSLNQAASTFTRYLRKWDFSTSSSSSSSQLSANSKAMTAAGGEGAHRDPVTGVAGGND
                     EAEPDARNPQTEGAYDLSPTPKKRSKTRSRPRATLTPPMRKPSHQRCCPDSTTTTTNS
                     AEKDFFATSSDNSSSSSSGRALNEADARSEAPAHQGGTARLTGTATTARKGPRPTGSE
                     AVGYTPSFPGRRRNVRLDEAGNIVPFDRLSSMMSVAALLNNKGEQHGDDASAEGSPGV
                     AAAAATEATAASRAPFPALGDANDHVLSPSSAAGLANASFTQPPGNYSFFGFNRNISF
                     MGTNMDEVLNSAANDFLSNLAANWHTSNAACVETASSAGSMVQLPSRTFLRAEGSGSG
                     RSHATLSSNREGECRTDRVVGVASPLAVTGQSEDRGDVPKTPSRRRGGAISRSPSARS
                     PLEARGPGEPASIEGGNSGVQHGGTTLPLPQSPPPKPLSTGAAPTAASRSTHPVLSQL
                     GSASYTSDDGTTSMTPRGDSVPLVGAAASSHRQRRARPPITNQSFFVVEDGSSAPLFS
                     PHTGVTKSTGSMAGGPVSASRVSLATWSSVASADGSVTGGVAGETSSSTLLQQNYANV
                     AVVAPAPVFPTFSTSNARAVWQQRRRHVAGGGRGGVGGGNMSNIHLTAPPSNEGSVYL
                     MVADEQQGDGQRWRAAGASVSREGNDGDDDDLTSAAFGSMRSGFSRRSSAQSTSNLTA
                     ETLSATHEPVSERRPARSGDAAASASEGRRGAEVGDALPFSNLASEADSMVFTYLQRI
                     DASLQDVLSQLQVRRRQCRRKSGGSITGVQDGFDHAPSSTPITTVQATPPQSATQLTT
                     LQSSLSSALPSPASANSTSEVATTVTVSPQHHRSTGVSTSPAKLPRPLSSCTTPVTIS
                     QSRQGKPNPLSMRASPPLSKQCSNPRWPTEDEAEAEGDPVNHDATVWFDTPLSPSSSG
                     HRASSGCDDVNVEVLLRKMLWRVSLLLDEVSSFSPRGPATASVARPP"
     gene            complement(<481686..>482021)
                     /locus_tag="LDBPK_151190"
                     /db_xref="GeneID:13393027"
     mRNA            complement(<481686..>482021)
                     /locus_tag="LDBPK_151190"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_003859593.1"
                     /db_xref="GeneID:13393027"
     CDS             complement(481686..482021)
                     /locus_tag="LDBPK_151190"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_003859641.1"
                     /db_xref="GeneID:13393027"
                     /db_xref="GOA:E9BCF7"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9BCF7"
                     /translation="MSTKYLAAYALASLSKASPSQADVEAICKAVHVDVDQATLAFVM
                     ESVTGRDVATLIAEGAAKMSAMPAASSGAAAGVAASAAGDAAPAAAATKKDEPEEEAD
                     DDMGFGLFD"
     gene            complement(<483039..>483374)
                     /locus_tag="LDBPK_151200"
                     /db_xref="GeneID:13393028"
     mRNA            complement(<483039..>483374)
                     /locus_tag="LDBPK_151200"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_003859594.1"
                     /db_xref="GeneID:13393028"
     CDS             complement(483039..483374)
                     /locus_tag="LDBPK_151200"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_003859642.1"
                     /db_xref="GeneID:13393028"
                     /db_xref="GOA:E9BCF8"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9BCF8"
                     /translation="MSTKYLAAYALASLSKASPSQADVEAICKAVHVDVDQATLAFVM
                     ESVTGRDVAALIAEGAAKMSAMPAASSGAAAGVAASAAGDAAPAAAATKKDEPEEEAD
                     DDMGFGLFD"
     gene            complement(<484285..>486663)
                     /locus_tag="LDBPK_151210"
                     /db_xref="GeneID:13393029"
     mRNA            complement(<484285..>486663)
                     /locus_tag="LDBPK_151210"
                     /product="inositol/phosphatidylinositol phosphatase,
                     putative"
                     /transcript_id="XM_003859595.1"
                     /db_xref="GeneID:13393029"
     CDS             complement(484285..486663)
                     /locus_tag="LDBPK_151210"
                     /codon_start=1
                     /product="inositol/phosphatidylinositol phosphatase,
                     putative"
                     /protein_id="XP_003859643.1"
                     /db_xref="GeneID:13393029"
                     /db_xref="GOA:E9BCF9"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:E9BCF9"
                     /translation="MYPGLPRAFPNTEWQTVADIFRRRAPVSFLAPNSSAPATADPAA
                     AAEAWVQQEIGYYEANYTAVEDLNVCVTTFNVGCKKPALPLTSLACLTSGGGGADGAP
                     ARPTDLIVVGLQEVDMSATALFKQETEASAPWVAGLNAAIGADGSNSTAASSSSGADA
                     SPYYAFPPKQLVGLLLCVFIRRPLLSAVSESSTATVATGALGSMGNKGAVGFHLVLHR
                     TSICIITAHLAAGQSNVSKRNEDINTIFKSMDFNAARRAEMQISASASMPMDESAFLE
                     LYPRDHDIIIVAGDLNYRLRLPYETAVQLANAGQFSELLQYDELATEMKSPHTPWLNF
                     INFTPTHMPTYRFDVGTDVYDTSEKRRVPSYTDRICVWSRRKSMESRIRLDRLSALME
                     VRSSDHKPVQALARIPISVEVPAQKAQVLSALREKAAVIGLAQASSAKISLSTSKVNF
                     QAQSFHHCGTQETVTVQNNGDCVAVVRVVRQREGDYSEGTWLRATPLELAILPGESQD
                     VLIETAIDPRCMTWLAAWRPYQGRGRVSLTSVLLCCCRNGPVQAVECQCVLSPSVFGN
                     GLDSIALLQDKPCVEAYAQKADFEEVVRQVRPHVPKELWYLAHVIAQHPREGGLFTRT
                     TDKEVCSRIMELLDTKNAPLPVDTDVHCAAECLLTFLKSLLEPVVPYAQYTAALAAGR
                     AKGKAPLQFLRQLPTMHANVWIYVMSLLNYLLRPVHSCDNELDANFLAHIFSAVLIVR
                     PANAQGAIPTRLQQGGGVDQQVRQQLQQESDDALALVAYFLSTPPSMLAGVE"
     gene            complement(<487929..>489365)
                     /locus_tag="LDBPK_151220"
                     /db_xref="GeneID:13393030"
     mRNA            complement(<487929..>489365)
                     /locus_tag="LDBPK_151220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859596.1"
                     /db_xref="GeneID:13393030"
     CDS             complement(487929..489365)
                     /locus_tag="LDBPK_151220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859644.1"
                     /db_xref="GeneID:13393030"
                     /db_xref="GOA:E9BCG0"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BCG0"
                     /translation="MVKETDLYDELGISPDATEPQIRSAYRRKALQYHPDKNSGDPAA
                     AEKFKKVAEAYEILSDAERRKQYDTFGRNGLGSAAGGSGGVPGGGFGSSFGAGIDPMD
                     IFSSFFGFASGGGPGASRQQRPAKPSFILVELQCSLEELYCGTVKVLQVRRRRLCPSC
                     HGHGTSSGRPSPVCPQCKGNKTVTKALNFGGLTAYQQCRCDRCEGLGKLPIQSPCARC
                     GPVYDAHQRSPLSGTHKPDPLPRGVVVEEKMIKVSIEPGTEDSDALHYVGQGDELPGF
                     DAVGDVLVVIEQLPHPYYRRVNSTDLLLSNCRVPLGCLFRDAFSIPIELLDGRVVRLA
                     TPLRDGNVPHFLFDSQHVFVVDNEGMPLKERKRGGAAADANHNGSEAAEGVAHRKKGK
                     LYLCIDVVFPSSLTPAQVDIITKALGGSHERDPAATGGDAGRVVTLQSHRGPAPSWYT
                     VDAEGNAWYQPNALPTAKKKRKATSTAE"
     gap             492180..492278
                     /estimated_length=99
     gene            complement(<492480..>493955)
                     /locus_tag="LDBPK_151230"
                     /db_xref="GeneID:13392966"
     mRNA            complement(<492480..>493955)
                     /locus_tag="LDBPK_151230"
                     /product="nucleoside transporter 1, putative"
                     /transcript_id="XM_003859597.1"
                     /db_xref="GeneID:13392966"
     CDS             complement(492480..493955)
                     /locus_tag="LDBPK_151230"
                     /codon_start=1
                     /product="nucleoside transporter 1, putative"
                     /protein_id="XP_003859645.1"
                     /db_xref="GeneID:13392966"
                     /db_xref="GOA:E9BCG1"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="UniProtKB/TrEMBL:E9BCG1"
                     /translation="MDTAPDHREPQEQGESRKWYEMTASEFYVYVVAFMCGVSMMMPV
                     NAVFSAPAYIMTYYRYAMQDPEAVPLYTNFWNNVMTYYNLIGIVTSLIMEPLTLLSWF
                     RRIPMKVRLLGGLVILIVEIIVLMVVPARGTSEAGAVATICCTGFIGGFGKSIFESTT
                     YGMFGAFPSSFTSTMMGGVGMSGVLTSLLQIIVKAALPDSYEGVKKQSKIYYGLDVGI
                     QGMTFVALILLRFNSFAQNYFGDLGAVKSKVDAGKLSAEALCHTDEHPTHDKEGRNSS
                     SGKEVPALGEVQTAAAKSEGPDAVEESSWPHEVEGPTSNEILVATAIFSTLRRVKWMF
                     VACAFNFLITLFLFPGIAVGMFPDSKWFSTIAVFIFNVFDVLGRFSPSLKLMWPRSYK
                     QRWIIVAASFARVIFVPLLLLHSYHYIPGEAYGYVMEVIFGFSNGYVGSMALVLGPQS
                     KGIDNDGKRFVAGTLMGISILVGGTIGTVLSIMTQTIRERH"
     gap             494037..496742
                     /estimated_length=2706
     gene            complement(<496744..>497028)
                     /locus_tag="LDBPK_151240"
                     /db_xref="GeneID:13393031"
     mRNA            complement(<496744..>497028)
                     /locus_tag="LDBPK_151240"
                     /product="nucleoside transporter 1, putative"
                     /transcript_id="XM_003859598.1"
                     /db_xref="GeneID:13393031"
     CDS             complement(<496744..497028)
                     /locus_tag="LDBPK_151240"
                     /codon_start=1
                     /product="nucleoside transporter 1, putative"
                     /protein_id="XP_003859646.1"
                     /db_xref="GeneID:13393031"
                     /db_xref="GOA:E9BCG2"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="UniProtKB/TrEMBL:E9BCG2"
                     /translation="MDTAPDHREPQEQGESRKWYEMTASEFYVYVVAFMCGVSMMMSV
                     NAVFSAPAYIMTYYRYAMQDPEAVPLYTNFWNNVMTYYNLTGIVTSLSMEA"
     gene            complement(<499258..>499578)
                     /locus_tag="LDBPK_151250"
                     /db_xref="GeneID:13393032"
     mRNA            complement(<499258..>499578)
                     /locus_tag="LDBPK_151250"
                     /product="nucleoside transporter 1, putative"
                     /transcript_id="XM_003859599.1"
                     /db_xref="GeneID:13393032"
     CDS             complement(499258..499578)
                     /locus_tag="LDBPK_151250"
                     /codon_start=1
                     /product="nucleoside transporter 1, putative"
                     /protein_id="XP_003859647.1"
                     /db_xref="GeneID:13393032"
                     /db_xref="GOA:E9BCG3"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="UniProtKB/TrEMBL:E9BCG3"
                     /translation="MWPRSYKQRWIIVAASFARAIFVPLLLLHSYHYIPGEAYGYVME
                     VIFGFSNGYVGSMALVLGPQSKGIDNDGKRFVAGTLMGISILVGGTIGTVLSIMTQTI
                     RATY"
     gap             499621..503628
                     /estimated_length=4008
     gene            complement(<503631..>503930)
                     /locus_tag="LDBPK_151260"
                     /db_xref="GeneID:13393033"
     mRNA            complement(<503631..>503930)
                     /locus_tag="LDBPK_151260"
                     /product="nucleoside transporter 1, putative"
                     /transcript_id="XM_003859600.1"
                     /db_xref="GeneID:13393033"
     CDS             complement(<503631..503930)
                     /locus_tag="LDBPK_151260"
                     /codon_start=1
                     /product="nucleoside transporter 1, putative"
                     /protein_id="XP_003859648.1"
                     /db_xref="GeneID:13393033"
                     /db_xref="GOA:E9BCG4"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="UniProtKB/TrEMBL:E9BCG4"
                     /translation="MDTAPDHREPQEQGESRKWYEMTASEFYVYVVAFMCGVSMMMPV
                     NAVFSAPAYIMTYYRYAMQDPEAVPLYTNFWNNVMTYYNLIGIVTSLIMEPLTLLS"
     gap             504195..505164
                     /estimated_length=970
     gene            complement(<505577..>506092)
                     /locus_tag="LDBPK_151270"
                     /db_xref="GeneID:13393034"
     mRNA            complement(<505577..>506092)
                     /locus_tag="LDBPK_151270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859601.1"
                     /db_xref="GeneID:13393034"
     CDS             complement(505577..506092)
                     /locus_tag="LDBPK_151270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859649.1"
                     /db_xref="GeneID:13393034"
                     /db_xref="InterPro:IPR014806"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:E9BCG5"
                     /translation="MEPSVKESVSRIPLLKTKAGPRDGDKWTARLKEEYASLITYVEH
                     NKASDSHWFHLESNPQGTRWYGTCWTYYKNEKYEFEMNFDIPVTYPQAPPEIALPELE
                     GKTVKMYRGGKICMTTHFFPLWARNVPYFGISHVLALGLGPWLSIEVPAIVEEGYLKP
                     ASAATVPTTAE"
     gene            complement(<509189..>510412)
                     /locus_tag="LDBPK_151280"
                     /db_xref="GeneID:13393035"
     mRNA            complement(<509189..>510412)
                     /locus_tag="LDBPK_151280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859602.1"
                     /db_xref="GeneID:13393035"
     CDS             complement(509189..510412)
                     /locus_tag="LDBPK_151280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859650.1"
                     /db_xref="GeneID:13393035"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BCG6"
                     /translation="MLRRTGVSRCFGKVLYGPSSTLPSDFFRCCTAHFGVHLHEETFI
                     GTRSSQHRGLFLSRSRTTPLPANKPLATIPLSTLLTVSKISTKPNVLPHVTLAKVHDA
                     IADDEFRIMAPQFYLGLQMSAIIAAIPDITRAHSAVEVSEMTDLLRAGVTPYARMLDD
                     EDFNEEFVFGMYGMALDSWQRASYEEMTKKYHLALTAIHEAIDPPFKLEQFQRITRLV
                     LARVEHVPPADYYSGRLFLRRLRRRWRRLRKMPEPAEVALVPYLDLVNHSNRPNCTTR
                     IGPSSVLGGEGAITLVTLREVLPGEELCRHYNFALSRASALFRYGFLPFDLISIVEHD
                     AVDEHVMKSRDMFRAESEEQLEQRRREAEEVARLEKLFQDAKQSHGRSGAAASTPPGR
                     QPDPSLSDRVSRREE"
     gene            complement(<512394..>514022)
                     /locus_tag="LDBPK_151290"
                     /db_xref="GeneID:13393036"
     mRNA            complement(<512394..>514022)
                     /locus_tag="LDBPK_151290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859603.1"
                     /db_xref="GeneID:13393036"
     CDS             complement(512394..514022)
                     /locus_tag="LDBPK_151290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859651.1"
                     /db_xref="GeneID:13393036"
                     /db_xref="UniProtKB/TrEMBL:E9BCG7"
                     /translation="MPLPSSLLRLSPIRRAAVAVMTRALRATSTSMSSRTRVTMASAA
                     GDNGTNVLRPPYPTEGGSVPVYSMMHGQIDKRNWVFRNPQWCELCNEPVSRWLDHQGR
                     KDHALLDLHYSQLAEWPRRWNPEAVLSTFMEHLGIDSVEPYHALFSKLDSEGRTELYA
                     MLVKLEEAGMVHFGSSRDTYLSRMVGGMRGFDHQGALVLHECLMGPFLRLFPNGLIQD
                     YSNLLDFISCGYNMETVYDMCGMYTLDKVALRERYGPSSPAAMGLGGVATCSSASRGY
                     ENDLLASLSTTSSSSSAASDSAADAASAPGGGSGAKTRLAQLQAARAAKLQEKSEEEA
                     FSRKTAFVRQLLGQLRWLLMPEQEHPAGFTFPPHIITLGELCLKGLVVAIIEARLCEY
                     MVRAEPVWVSFGLERRKLKQSAIANAGDVVPQPVQYSYRPMARDLRDLYSTQPSALDA
                     MVQAGLLKKKLPTLKAFGKHEASSAHAKPVKGGAPAVDSSRESPSSASAHPAASRPLQ
                     PIIIGKPPQRKEAQDQEMVRRGGERRGAAEAGGE"
     misc_feature    complement(514705..514710)
                     /note="Short protein (LDBPK_151300, CBZ32944.1) was
                     converted to a misc_feature."
     gene            complement(<515097..>520706)
                     /locus_tag="LDBPK_151300b"
                     /db_xref="GeneID:13393038"
     mRNA            complement(<515097..>520706)
                     /locus_tag="LDBPK_151300b"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859605.1"
                     /db_xref="GeneID:13393038"
     CDS             complement(515097..520706)
                     /locus_tag="LDBPK_151300b"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859653.1"
                     /db_xref="GeneID:13393038"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BCG9"
                     /translation="MEIDSLKIQLTSLLALHHDDDANEDDIVFATLDYIRGAHTVAQM
                     LLLEGRFPELQRCLNLCQAAFGEIATDPAAASSEEAAATTAAAAPSTTQDTSGPLSER
                     VKAVGSELRPSLSPSSVDAASERRRTSVVLRSAEDHRVFSALASRTAQLQTQLEAAMQ
                     VRRGRDANYYLHKLGLGVKHNDADETLDKREAATSIRFFQWQLQQLPRAAPMASLLPP
                     APNQDAWGRSTQTSAARPPPPPARLSAPVQGERNRSASLCLASLNIPAPCGSTRQHAT
                     SSASVALLGDAPPPPSPPERGIAIGRKSYVNRWKAPKYLPPLVTEGRTFCMDRYQAYD
                     VAADALHNRLQSNNHVGTLADKDGDVEDDGGIRAVQQLYGTLSQDSMPLYSREVLKEP
                     HLWSLSGSLSSASSNWVSPPSSAAVTRPNPTASCYSAQLVSRVKCVDGADEHEEEGGS
                     LACGGGDVGGDAGGQAGFAPVQSTQARFLLQTASPLLESAANSPVPALSSCSCWCADD
                     DARHPAVNAFTSGSHTSHPAQSPSDVAEAFTPRRRLLPVSTSALATASSATNVIASSS
                     LLQSHVGRGAPSDDAHVAASATFTSMPTPRSASTAAPSRTLEQLHLPSSATAVASLPS
                     LTGLPATTSAAAAAAARAVQDVRHTMQFAMTSLKAQHQRSAQALEQCDELALSRLPYS
                     AREALMASRARQATHAYVSGSSSPGGGGGVNSVRSVSPISVGTATTPNCPLTAAQLTE
                     EQVLPPALPSVDAAAVATAEQHQLKYRRLPPPPPPSLLLSLSPSQQLSPDAEGQLREL
                     RAACEQHLAASESNVREMEALWLAQHRQLKSRVALTCLEDFAEWSRSPGRDLMHRSSN
                     GPQHRGSTSRRSAEQCSCVDPPCGGHARGAAPAHTTTVPPSPTLPASLKSDSPVASTV
                     SALAATGATGAGTRPPSGLPTCASAAPPQRRRGSRSPACTLPSATRGTIAACPFHTVG
                     AVSSEETGVSKDASEDNAVLLGAAKTMRSVATRAAQATQEGGDAARAEISVAPAAFSA
                     QSPQQARHSGAGDAAGLYTYSAAVEASGSDTVEETLVAWRRTLRAMDSPSTATEVVHG
                     SGAEAGELNAASACSFPSHTSCCLAATAVAPPPSRATEGVPRMWPSIRCAAAVVRCRR
                     TQRFVCETLRQVVQRVLPGDLVRPAWKTGAAARPQPPFVGLPSVSLIGMNGAEASAKA
                     SGCAARRTVGSMTRVMNLMSGSSIDPPASTGSARALNAAAPSPWLPPSGFTCAGPSKE
                     AVTSVIRHVNAAYRANAMLLSIEDWTTVAPDLLARSLPLSVRALRIQKWWRQRLAVRL
                     CRQRRAAQEAYLVEEERRDAAALRLQRQIRVHWAQKTVARRAAAVAARIEHRVAAEQT
                     TAKHSGSVDGLIDGSVAFGASSSLTTTPSSNRHLRRLVTPHGRGCSRGSSSSLQVRSA
                     RSVRTTSQAGTDCFLATLRTFKLAALPAATSGGVDKDASIFFRSARAAVAPDDVDRRV
                     RSHRPRSPSKATAVETDATMVQTTAAPLSVHSDTTSEQRRSTTRPAAVPQMQPELVIA
                     AAQRIQRCYRHHLARLHTARLRREVEVLSAVVTRRAPLAAIRVTLTAAPLSDILTAAS
                     ARELDQGSDTTVMRSLLDRCTGDVCEAHLQRGLAARRHGDYKAPLERVSLRELQRIRQ
                     EREDEAAQQRQLHELEQRRKLEQRKRRERQVLEASKTIQRVGRGCRWRRWLRERELKV
                     RQRADHHQVALLSCSSVKGIHSVQLLSSDGQGTQPVMSSEDERYLQLAGGEAVASRMI
                     LRLRATHPQWFGIATDPTSAQYIVSHCTPAQLATVPTIEAFVAAFASRAEVYNRYRHT
                     CAKSLQLAWRLHREKLHGRRMVSASES"
     gene            complement(<522298..>526008)
                     /locus_tag="LDBPK_151310"
                     /db_xref="GeneID:13393039"
     mRNA            complement(<522298..>526008)
                     /locus_tag="LDBPK_151310"
                     /product="mitochondrial DNA topoisomerase II"
                     /transcript_id="XM_003859606.1"
                     /db_xref="GeneID:13393039"
     CDS             complement(522298..526008)
                     /locus_tag="LDBPK_151310"
                     /codon_start=1
                     /product="mitochondrial DNA topoisomerase II"
                     /protein_id="XP_003859654.1"
                     /db_xref="GeneID:13393039"
                     /db_xref="GOA:E9BCH0"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:E9BCH0"
                     /translation="MTDASKYKKLTPIDHVLLRPEMYVGSIETQPTPMYIFDPEKGRM
                     VWETMRVNQGLLKIVDEILLNAADNINNSKGSVRQTYISIHISDTGEITVENDGAGLP
                     IVRSREHKMYIPEMVFGHLLTSSNYNNDSTSTTAGRHGYGAKLTNILSTKFSVVCRTD
                     GREFHMSWTDHMRMATAPRVNRVDPKEKNVTRVKFMPDYAHFGFPNASISLDMKRVLH
                     KRIMDLAAMFSKIEVRLNNVPFGFRTFTDYARLYSLPGLDGSMPPEPFVYTSPNGSVA
                     YVPQLTQSPKRIVGVVNGVVTYNGGTHCNAAMDILDSCLDSLSKNFKKNGKVVDTNRV
                     QRHFTVLVFLIQTQPKFDSQSKARLVSTVTMPRVPKNTLEKYLERMPFLEAHVNSMDD
                     QLANELNKEIGAGRRLSSKTLISAITKLVDATSSRPDGRNIRTLIITEGDSAKALALN
                     SLSSEQKKYCGVFPLRGKLLNVRNKNLKRLKTCKELQDLFLSLGLELGKEYRSPAELR
                     YQRLLVMTDQDADGSHIKGLVINAFESLWPKLLQNNPGYISLFSTPIVKIKVSGKSKE
                     VIAFHSFRDFHRWQRAHPSARYTAKYYKGLGTSTTAEGKEYFADMEKNIMQLTVDARD
                     HQLLDSVFDAAEVEWRKEWMTKANAFQGEIDIDRSKKTLTIPEFVHKEMVHFALVGNA
                     RAIPHCVDGLKPSQRKILWAMLRRHNSEASKVAQLSGYISEASAFHHGEASLQETIVK
                     MAQNFTGGNNINLLVPEGQFGSRQQLGNDHAAPRYIFTKLSRFARLLFPEEDDPLLDY
                     MDEEGTFVEPHHYVPILPMLLCNGAVGIGFGFATTIPSFHPLDVSAAVRAMINGESAK
                     QVVRNLVPWAVGFQGTVRRGPDNEFIAVGKYTAHPNGRFHISEIPWMTSIEAFRLHIS
                     SLASADVVQRIADYSGANHIDIDLIVRDGSLTTWAECETDLALAQRIYINGTVFSPTG
                     TLSPIDSDLSPVLQWHYDRRLDLYKRRRTRKIGLMEMDLARLQSTRKFVEHFRQGQID
                     FLNATDDTLHKTCVKLGLVRVDESFDYILKKPITFFTRTSTEKLQADIAKTQAQIEEL
                     KRTTPVKMWLTELDKFDKTFQEYERVLINSIQKEQRSSSITGGVELPALRQPLLMLEA
                     SAKGATAYRVHACQYEKPPPSKRRPGESVGGARPSDSAARTVGKRLVGSRSVFKNKKP
                     MSRKSNVKVSLSTRVAQFAGAQLGRLLPHVLM"
     gene            complement(<527898..>532139)
                     /locus_tag="LDBPK_151320"
                     /db_xref="GeneID:13393040"
     mRNA            complement(<527898..>532139)
                     /locus_tag="LDBPK_151320"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003859607.1"
                     /db_xref="GeneID:13393040"
     CDS             complement(527898..532139)
                     /locus_tag="LDBPK_151320"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003859655.1"
                     /db_xref="GeneID:13393040"
                     /db_xref="GOA:E9BCH1"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9BCH1"
                     /translation="MESTNVGDAYAEDRSSNGAEGNRTMDTCRGSSLCSQLSSDDHGE
                     DVHAQRSDRLAVTSSSSSGTTFADDEGDAHVSRRALRSRVGKAGSAADDAAGPSPVDA
                     DDDEEAETVPTAVGLINEGCTCYLNSLLQLLFHISYFRTAVYRIPVEGDDGPSVYKAL
                     QETFFQMQERTTPARTTVLTNAFGWGRKELYVQHDIQEMATLLRDNLEERMKGTVTEG
                     AINQLFEGRGEQFVETLDKSYVSRRADTYYDVHIPLGQHSTLLGSLTSLTARDKLVGE
                     NKYRVEREGMPVVYMDAEKGYSYTRFPAVTWFHLKRFAMDLTSPTLEMRKVNTPLEFP
                     VVLDLRSLEKPDAAAASGGVGAGSKLGSAVVPFSSDSPAIYDLQGVIVHRGTARSGHY
                     YCYIREWDPVGQRFCRWLEYDDENVRQVPEDVAVRANYGRGAGSVDSFRHDASLMGGA
                     NAYILSYVRRADAAAILAPSPTDIVSDRVKEAMRRAIQEEERQLREAEEARLSVTMYC
                     ITDAALSKYCDSVCSTELFSRDIQQWRRFADCVITVRKSDTLAAVYEALAAQPEMARQ
                     GVTAFNCRLWRCSDGSALRPSIALPTYAENMEHKGVAPQQPQECLKDFLTPEENTTAL
                     TMCLYVDQAKVPLPGLHGVTKECGLIRSIQQDDTGRCYTVEMSSPTEAKALHITLDHS
                     DYAATVEYVVTTDKETLPVAMAAVTDGCNTVALLLSESRRTMSVMLTCYMPNKRTVAV
                     RNVHLELPFGHPLLQPAPAASTVALPVLPVVGYDRALIFFKYYDYSANTIQYVGSRLI
                     DKAAKTYCCGAVYRDFLGLSDDAAPSSSDAPVARPQPPPPSMFRFFLERGDHTPVELN
                     EHLDLGDFKSGCVVVAQLRAIPASYRYLSILNYYRDTRNSLDVHIIEVERSHRANDDA
                     YRQTTLERQRCAVAAAAAASSSSAAKKARTSTGGAADVAPTTSPLHSAVPGGESEGAA
                     DASTTGVPQQGDSTALINSSESVASDAKKKTPSTGSTGDGIVTASTSTTCGVTSSVSP
                     TPTLAMDTTGSSATAVANAAVEADPIRIAATLNPYEAVQLSTLHEISVATLPTEHSCR
                     MLFSWNYEAVCAAIGRTIAFDPNRLQLYQCCSTGEPAPEVSPTPYSSRLTVADLLYLD
                     SYNKTSVLYYERLAEAREQHQNVGVVTATLRDHAGHALHRETYSVDLASITRQGLVRR
                     ICESVPAWQREADVWGTMQDTLQSPHFTLSFVDSARHVIAAMHEVAMSKTGAEESALE
                     ASALRKFEVDIQAAAPLQGTEQRIACCHMNYSTHDRSTLLGLQQQRSAFGQPFLITID
                     RTTTVREALDIMLQTTYLPKDALNNAEGFGVMMVAGQVYHFENWEEHVHLFWVHTKNT
                     SQYVASLMLNHAKPREKPGSRYVAQHSPQLKISNK"
     gap             533720..533779
                     /estimated_length=60
     gene            complement(<534562..>537066)
                     /locus_tag="LDBPK_151330"
                     /db_xref="GeneID:13393041"
     mRNA            complement(<534562..>537066)
                     /locus_tag="LDBPK_151330"
                     /product="MGT1 magnesium transporter"
                     /transcript_id="XM_003859608.1"
                     /db_xref="GeneID:13393041"
     CDS             complement(534562..537066)
                     /locus_tag="LDBPK_151330"
                     /codon_start=1
                     /product="MGT1 magnesium transporter"
                     /protein_id="XP_003859656.1"
                     /db_xref="GeneID:13393041"
                     /db_xref="GOA:E9BCH2"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR018649"
                     /db_xref="UniProtKB/TrEMBL:E9BCH2"
                     /translation="MSSNASTETPASLRAEEVTMTSPDRLTNLGTSTFLTPPSVEHPS
                     AASELGSSHAPLPPRVQNLANVVVPLASAEARVSNAHSYARRPLEIVESIRGLHELHQ
                     KGGLTREEFAQAKQQILDSAASSASTYKSKSKRSRGRRHRRRGRRSRNSSRSASTSTC
                     TRPSRDARSRATTGVDPRSASHRPSRSSSSSKSSSSSSSSSSNRFIIVPRSNVWRTLN
                     DPIEEGLLGHHLTEGHHLRVAYNDAPRLVRSPLLSRGGAVVGFGSRERGGQEECCAGA
                     HGRHGYQEVPSEDPLTSNLASGAAVPTPTLATAADTKDGPFASPSGSAIGAATAATGS
                     SVARYATSATVPDGRGKAKYGAFLHRDDGARAGGPAPHIHAVLNKEDVVCIQYFNSRG
                     GSGNHFRDVELHTSQLRDPIFVHKGQSQVIPAKPRTSVTKPGHDEPVMMAMPTRDSQV
                     FQLAEMTLEERRAWEEMTTTHSSSSKSRRAKSSYFEQSFNWYWVDVTGRDASRQQYNA
                     TLRYLTNRFKLCESFLVDRDHTLVLPQVCESPIYAGQYLLNLRVATEKIAISDDSVME
                     LTNRWIIVVDLKQHIVITLHRVDTHSMANLRSQWKRVIENSNVSFQEFLLKIIDDAIY
                     TYHLSLDVHTALLEKCEAKLFVEKPAVTTPEVSGHYIDKRILHHFAGSSRSPFLRRLL
                     DEQDRSPMNKGEMNSFLHHLHRRTSVQHRMINVTQAVLAKAFTKLRLCSREMAGQMCA
                     SCIEISDRALEVRDDAKTLLNLHISLQSFRTTELMAVLTRVTMLFTPVTFLAGVYGMN
                     FQKNFPELTWDYGYAFFWTLCIILVIAMHVLFVREH"
     gene            complement(<537975..>542342)
                     /locus_tag="LDBPK_151340"
                     /db_xref="GeneID:13393042"
     mRNA            complement(<537975..>542342)
                     /locus_tag="LDBPK_151340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859609.1"
                     /db_xref="GeneID:13393042"
     CDS             complement(537975..542342)
                     /locus_tag="LDBPK_151340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859657.1"
                     /db_xref="GeneID:13393042"
                     /db_xref="GOA:E9BCH3"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BCH3"
                     /translation="MEHAGRGVLLPARRCSSVPRNLEGSRSSPSSFYAFPSTLNDILF
                     GPRQRLTKYADGMQALPYASSAPTIEEAEVAAAGPRADARVEDAAAAAATEAVKSRSR
                     EATEKQAAKEEVVTVAPAEQEAANKPLEEDFAAAVVVAPAETESAATAQIGADAPDDA
                     AAPTAADEAESAAKEEEGGKTDASLDYVADEAPSRSFAVVTADEAEKDTATKDDAAAA
                     PAAEVVSSAGRADGKTVPEAAAAEQEEGCETAGEAQRSSDAATRVGAEERETAAVPQN
                     YGRDEATAVAAEPSAAPEDEPPAVPPQLRTTCEMVAFDAAHIAAWMMEYRHETAHVPP
                     GVQRFVHEFNERAAKFTPLRMGGTSPTPSAIGAAAKKGKKGSLSLSSVGSSKTGIGAL
                     ADLPSRDGGGFGSSAALRTGTSVAAKKSNALEALGDVWEGRQEAPISLAQGSLRRRGL
                     FGEVEKKKIHHMVVAVLNKVTTDPVKFREVKNELLRLPIPEANAEQMTKIVDAFFTKA
                     VREQHFSHSYADLIAALCKVPQGQHIVGDKTQSLEYRLRMALLKRCQAEFLQSIRAEE
                     TDASSPTTMSTAADDVSSPLTSAIEGAQAIGGETEKERRDRMCGNVRFVCELFLRDIV
                     AASVISVIFRICCLGSEFGEFAVPPSYTPTESQVDEIITVVKTAKKRYFVHSAEGRRM
                     LPQLLSQLEYWVKHYAISRCRFVLMSTVDDLRAMLPKEPASPMMSGTPSVAAFVTPQL
                     THISPTQSPPPCDVSEQGVVSAVSPAPLSVTAALPVVTAADASGQLSMSSTMVGGQPL
                     PAPRSKQVGSVSLSDSAGSINGMAATESPVTGAITRPTVTLTSRSTLQHVRPEAIAKL
                     MAAFSSGQCSADEVAVQLFDTYGNVLPALGAWMDRCLSVVKEEKTRKQTGAVLVACVE
                     QLTAHTNASSEEAAETVAMCREQLHEAAMEALQRAIEGKLYEDLHVFQFWAQLVLSDH
                     ARVVYDEELLNEGLELLVYTAPPAVRSYLVEVGKYMTHVLVAPEKLPWQASTEAQCFV
                     RYRPLLVLHSLVMSGGPSEAQALLDNIVGFSDVRQQSLELRLYHAFRTGSPSREVIFE
                     QLRTSPRTTSRDSTLAAEVLSALLIAELCSNGDALVEDSMDLLQITVDGVARAEREIA
                     VVTEVYEILRYTPRPMTMSAAARVLRKFVCMHIVSDETMERADRFYEAERDGAIEKPT
                     QEGGHALAAPPSAEYPRIMDRRGTDDILLSGSISMRSVNGAVATNSNGNGNNGGGVGG
                     GTGSVDGLQSSNASSFGEFRPRDSHPPRRDADSEHTSSRHSERQLSPRRSNQSNGSFQ
                     TARGDGGSSKRLYRNSYKNRRRSQGEGGNERHSRAGGSKDESLQQQPTGSLSTSSNYA
                     SSHDGSRHGGGGRYDRQHGGSRSGRGSGHFDRGRGGSGGSRGNGTALHRGGGGGGNGR
                     GILREDSRRGTGGGGGKAE"
     gene            complement(<545809..>547131)
                     /locus_tag="LDBPK_151350"
                     /db_xref="GeneID:13393043"
     mRNA            complement(<545809..>547131)
                     /locus_tag="LDBPK_151350"
                     /product="actin-like protein, putative"
                     /transcript_id="XM_003859610.1"
                     /db_xref="GeneID:13393043"
     CDS             complement(545809..547131)
                     /locus_tag="LDBPK_151350"
                     /codon_start=1
                     /product="actin-like protein, putative"
                     /protein_id="XP_003859658.1"
                     /db_xref="GeneID:13393043"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="UniProtKB/TrEMBL:E9BCH4"
                     /translation="MNIPLNTVKVLRNVPLPDEASVLHTNAAVLDMGSHTTRLGFAGD
                     TVPRMRQRTCVVKGKATFSDACDVLDHVDDPAAATTVLENGVIVDWEGYEELLSRVAR
                     ILDLENVENSTPLLVTEKALVPTHQRQKIAEVLFETHHVVATSFALSPVLSLYASGLG
                     TGLAVELGHDQSHVAPVFQGLSLFHATHCLDVGGADLTRHFTSLMSGVATTHVSVLGS
                     MTPTQRESMWEYIKERHCTVAEDAQAFSEISRVGIGMGSPSNGSPPGSPHGEEDRYRE
                     ECVLPDGTALPISGAARFIPGECYFQPSLSPALQQLRDQSTVVDEVLLRTTQTPVSIP
                     ELVVDAMQRCDHDLLPTFASHIVVSGGASLLRGLTQRVESDVQTCLASTGGIHSVGSA
                     RVYADVERRDAAFVGGSIWASLPAAQALWVTKADYNEVGSMAVVRSCF"
     gene            complement(<547794..>548909)
                     /locus_tag="LDBPK_151360"
                     /db_xref="GeneID:13392967"
     mRNA            complement(<547794..>548909)
                     /locus_tag="LDBPK_151360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859611.1"
                     /db_xref="GeneID:13392967"
     CDS             complement(547794..548909)
                     /locus_tag="LDBPK_151360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859659.1"
                     /db_xref="GeneID:13392967"
                     /db_xref="UniProtKB/TrEMBL:E9BCH5"
                     /translation="MPSLNNNTIREDVVFKRRVKDVLLRHGGTGGLVKVLIDFNAREA
                     VAARQQRQTTSTDSGSSCTDVGLSHAQLLLFLQDYGVELTPFEAAYLCRAFDDHGSGF
                     ISGETFTRHLTGLNERRLRAVKKAWQSLEKRNGAGGNVSRELLLSTFAAVAAGRAYAA
                     AGDLGSPADGAAHDMVAMTSFSPPVGGALQSTFGGADGVREHLKEAYMTSMMDRRGGF
                     MAKTNAAAGGADGESGEAADRVSYAEYLAFYAGVSPQFATDEAFVTHVLQSWAADDAT
                     RPALDETAREWGPDGDPLALDGPRYVKDALNLELGVSSKSYNYSHLQREHPYVEPLPP
                     LNRPDIMATTMQQTYVPFDKAEQMLADPLVTRRGQSK"
     gene            complement(<549447..>550559)
                     /locus_tag="LDBPK_151370"
                     /db_xref="GeneID:13392968"
     mRNA            complement(<549447..>550559)
                     /locus_tag="LDBPK_151370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859612.1"
                     /db_xref="GeneID:13392968"
     CDS             complement(549447..550559)
                     /locus_tag="LDBPK_151370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859660.1"
                     /db_xref="GeneID:13392968"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BCH6"
                     /translation="MRSSGPAPALMHRPAARLPVHFLVDIDHTLVHPIYRHVAGDNSD
                     TTRCSSASLPPASARGWWPLNYVGGRVTHVQLRPHVVPFLSHVLLDRSLDTSETQVHV
                     SLYTRQSAAYCAAIAYQVLLPALAQSKGEPLHEFRHQEVFHELFGGEHCVRGRFEAMH
                     WLNPSPGFLSEGSPADQRQLGEATASLEWRKTIFVLPSPLTTLLVDDHCVNFRVTELS
                     TGHGVLVPPYYADAVACAADDCFRVPPTGSLCDVIGMDLDRRGGCISSGRAMLGRVDV
                     DDVVVRLLDVLEAFVQCCHSHRSAIEAMHGGSAGMSSPDERTPCAACKSAGTPRPPVD
                     AALSNFNFFERSPLYRRQWNAFHAHRADFLHSYFAG"
     gene            complement(<551188..>552099)
                     /locus_tag="LDBPK_151380"
                     /db_xref="GeneID:13392969"
     mRNA            complement(<551188..>552099)
                     /locus_tag="LDBPK_151380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859613.1"
                     /db_xref="GeneID:13392969"
     CDS             complement(551188..552099)
                     /locus_tag="LDBPK_151380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859661.1"
                     /db_xref="GeneID:13392969"
                     /db_xref="UniProtKB/TrEMBL:E9BCH7"
                     /translation="MVSASPPQRDRGSPPTPPLPEPQDVDAPAASTVQALRQAVEAQE
                     AHVRLLRARQAAREALLRHTRRLLAANDSIESPGSVEQLVRQVETSLQKLQQAHSEAA
                     APAATAGDDVAPTSAPSLTPQNAAGDADASADPLARIFHSGVEAQLAAVAEPPHTLPA
                     STLASRSSMAKRKKEADESGLTNAGSTTSSPPDVPFPPRSTAMTALLAVSASRQEAGH
                     AAMLAALSALELPFMSNSGATEAGRDVHNAEPAWLRQVDGDGANDDDSAPEEQQQEKY
                     GNRGDIASSDYSDDFECGSSTSSGADD"
     gene            complement(<552756..>554870)
                     /locus_tag="LDBPK_151390"
                     /db_xref="GeneID:13392970"
     mRNA            complement(<552756..>554870)
                     /locus_tag="LDBPK_151390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859614.1"
                     /db_xref="GeneID:13392970"
     CDS             complement(552756..554870)
                     /locus_tag="LDBPK_151390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859662.1"
                     /db_xref="GeneID:13392970"
                     /db_xref="GOA:E9BCH8"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9BCH8"
                     /translation="MSQSTPLTYATLSRPSRDSATIQRSAVRASAAHQHQAQQSPSIA
                     RPTDGARYTAEGIAGASLSSLDTWTGFLSSQWAETVKVQLLMPSSAAPVIPPSGADLI
                     SSLHSVVSRQNKVVAQLQERLVAQRAKEENDWVAKKQLSQSTSAEGMPDSSKDTKYEA
                     AASVDDSVADSAAENTQVCVLLSHLLEHARFLWARAVSQHFRVAEVRKSSSGNDTRSP
                     KKVTAGVNAEAVMEEERVGLPPISLLFRCLVDGINSEEARQAIVTAGVLPASAWDSGV
                     LGVDQLGILTVFERHVQALRTFPGIVPPLEALREYFAELHPQQLSKYYPSGALDSTLE
                     LAETQMDAFLRFGDETEQMAALLREGLHPSVRRLLYARALQVPLVVTDGKPMFLAQGE
                     LMTNHLRHGLARYLTCSSRQARDKVKRRFHHHYSSSKEENRARLLQRLALDDMFISVG
                     DSDKYFVYTDDVEVLSTAMVVDRSLPDPKMVQALKQLGRPGDALDSYVTYLQYPEKNL
                     VHQKALPCGVAPLEGFTLLLGALCNVTSDTVEQYELAAAIVAQLWSRLQGPTPELFQC
                     CLIFESLVQQLALPAVLHATRDLQYPPLVLAMRWMLTGFADLLDAFEVLSFWDLVLSY
                     HMREMHRRSPLSLPTGLANAAPHDTSTPCALWLLPMYAAAIFVMRAPLVEACRTAAEV
                     DVVFATGHQLRTRSLLQGLLFG"
     gene            complement(<555489..>556403)
                     /locus_tag="LDBPK_151400"
                     /db_xref="GeneID:13393044"
     mRNA            complement(<555489..>556403)
                     /locus_tag="LDBPK_151400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859615.1"
                     /db_xref="GeneID:13393044"
     CDS             complement(555489..556403)
                     /locus_tag="LDBPK_151400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859663.1"
                     /db_xref="GeneID:13393044"
                     /db_xref="GOA:E9BCH9"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:E9BCH9"
                     /translation="MKRWRTANLFTPAEVQHAFAALHRNAETLYGVSGTSSPLRPFVR
                     RRGGARGHRRDHIELPLHHMYEASTVYEQLPVEVRLICGGLHEAALSYAQEALRERGV
                     SSAARDEILSNLGRNSVLRVLRYPAGSGCRPHVDPGLCTALLVGSAGGLEVSTTDAVL
                     TPFASRPGCNTAHVTSSPTSMRGEASNMPGTLPHWEPVLTAHTGAAVVMAGNMLGAVS
                     GGALPGVLHRVRRDWVAEIPRTDGQRSPSLHAACVVGGADAETHAGSGVFRFNVIVEL
                     RPAYAKRWYTATSGQPPLPSASSPSSLA"
     gene            complement(<556804..>558021)
                     /locus_tag="LDBPK_151410"
                     /db_xref="GeneID:13393045"
     mRNA            complement(<556804..>558021)
                     /locus_tag="LDBPK_151410"
                     /product="actin-related protein 3, putative arp3"
                     /transcript_id="XM_003859616.1"
                     /db_xref="GeneID:13393045"
     CDS             complement(556804..558021)
                     /locus_tag="LDBPK_151410"
                     /codon_start=1
                     /product="actin-related protein 3, putative arp3"
                     /protein_id="XP_003859664.1"
                     /db_xref="GeneID:13393045"
                     /db_xref="GOA:E9BCI0"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR015623"
                     /db_xref="UniProtKB/TrEMBL:E9BCI0"
                     /translation="MACSSCAASVVVCDIGTSTTRLGYAGNAEPTFALPTVCAWRDRM
                     SAETFAVGDAAATMVGPGVQRRRPLEHGLVVDWDVMEEYWRHLFNRYACVEPQDVGVL
                     LTEAAVTPYEQREMTAEIMFESFGVPRLCIGSQALFVLSSVGDGCDTAVVVESGAGVT
                     QVVPIVAGYAVAGAARRFPVAGRDITQYVLKSLREHERGIEAEQALEVAERVKTRYGY
                     TADDIARELARAESSLPSYVIHHTELHSRTGAPYSIDVGYERFLAPETMFQPNLLAAP
                     SALTASACGGLPAVIDSVVWSCPMDGRRPLYANVIVSGGNTRFAHFAKRLYHGLQRAL
                     DERSVGVGPAPGSTLGRQVKYEVNVRDHSQATHAVWRGASAFAASPEYATAAVAREAY
                     MECGASVMRQHRV"
     gap             558318..558416
                     /estimated_length=99
     gene            complement(<559210..>560427)
                     /locus_tag="LDBPK_151420"
                     /db_xref="GeneID:13393046"
     mRNA            complement(<559210..>560427)
                     /locus_tag="LDBPK_151420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859617.1"
                     /db_xref="GeneID:13393046"
     CDS             complement(559210..560427)
                     /locus_tag="LDBPK_151420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859665.1"
                     /db_xref="GeneID:13393046"
                     /db_xref="InterPro:IPR014903"
                     /db_xref="UniProtKB/TrEMBL:E9BCI1"
                     /translation="MFCGSRRVYRAALFHGASLPRKYISLGGWCGPALMLGKLGLRTE
                     AYPFDFSRVTLDGLMHFIRNGFAEGFYPPGPPPYRPECVGPWVLFRGQHTAFAHFDLN
                     DPHVQAHFQVKMRRFDAVLDSPERPVTFFRTVTARYPQEELALALDLEEAVARRNPSL
                     DFRIVFMVHDQGLRANAVQLAPLSPRVTLWTLQYRGLPGDTLFDRTHTAYRTVMMHSV
                     AESNWPAVNVGAATPPPATVASAEARDFESGALRCDGAIRTDDVPLADLTVARFPWRG
                     HDNLALINGVASVGGTCAGIGSTKMLEDTSAAPQVEERVRRKCRYCGDATYHAAGRPF
                     RTERPFTDEEDQLVLIHLYQILTGGDKVAAVEKLAHEMQRGTYEVICRIQHLTNSSTK
                     LMDSIDPASPSDS"
     gene            complement(<561986..>563323)
                     /locus_tag="LDBPK_151430"
                     /db_xref="GeneID:13393047"
     mRNA            complement(<561986..>563323)
                     /locus_tag="LDBPK_151430"
                     /product="nucleolar RNA binding protein, putative"
                     /transcript_id="XM_003859618.1"
                     /db_xref="GeneID:13393047"
     CDS             complement(561986..563323)
                     /locus_tag="LDBPK_151430"
                     /codon_start=1
                     /product="nucleolar RNA binding protein, putative"
                     /protein_id="XP_003859666.1"
                     /db_xref="GeneID:13393047"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:E9BCI2"
                     /translation="MVYALLELPAGVALFKVDGERRKLKALLHFKSTADALETTAQLV
                     NGELSKPVRKFLKKNYLEKEVSEELAVADAKLAKAIKEKLAIPCVSGEDTLPTFRALK
                     QNIDSLLEDVSAEQLNQTALGLAHNLNRYKLKFSPDKVDMMVVQAVSLLEDLDKEINK
                     YAMRAREWYGWHFPELGKTVNDNVAYCKIVLAMKTRFNARDTDFSDFLEEETEQRVKE
                     AAMVSMGTEIAEEDIENISRLCNEVVAASKYREQLSTYLSSRMQTIAPNLTTMVGEQI
                     GARLIQKAGSLLTLAKYPSSTVQILGAEKALFRALKQRQATPKYGILYNASVVAKAAP
                     AQKGTMSRVLAAKASLSARIDSFGEGDNTPALEYRSKVENRLKAFEEGITYGKSGNAR
                     GAGAGLEQRGSYGDSQGNGFKRPRMNTSGFNSDRGGRGGGGGFKRSRPENGGY"
     gene            complement(<564260..>565159)
                     /locus_tag="LDBPK_151440"
                     /db_xref="GeneID:13393048"
     mRNA            complement(<564260..>565159)
                     /locus_tag="LDBPK_151440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859619.1"
                     /db_xref="GeneID:13393048"
     CDS             complement(564260..565159)
                     /locus_tag="LDBPK_151440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859667.1"
                     /db_xref="GeneID:13393048"
                     /db_xref="InterPro:IPR026508"
                     /db_xref="UniProtKB/TrEMBL:E9BCI3"
                     /translation="MDAEVVAWCDYIVPDVFADVLTVIGDRTGMSWGVMPAHQYWFQP
                     PKLHVVLSAVALLFCTVLHRQSRGFRSAAIARLGTAGVGRSLKCPINRLIAYTLMACL
                     AVQGLTKASRPKPFVQLGWLLMPCHIFTGMWIYIFMSDRPHQYGSGCYLASLLVDWVW
                     SPLGALVQPDWDDHQYLWEGYIFFLHHVLLLLLPLYFVARYDTLGLDWAHLYHLTWVP
                     TFVNFAFLAPCGLLLGLNVNYQLAPPRLSSSAPAVLKTALYRPALMPVFVGLSIVANI
                     AVRMLGKVIGKLFTSARKLTKLE"
     gene            complement(<565753..>566640)
                     /locus_tag="LDBPK_151450"
                     /db_xref="GeneID:13393049"
     mRNA            complement(<565753..>566640)
                     /locus_tag="LDBPK_151450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859620.1"
                     /db_xref="GeneID:13393049"
     CDS             complement(565753..566640)
                     /locus_tag="LDBPK_151450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859668.1"
                     /db_xref="GeneID:13393049"
                     /db_xref="UniProtKB/TrEMBL:E9BCI4"
                     /translation="MLSTSQALLASLRYRRPYWMLFLKGADNWKIYTVIQQPDHQRTE
                     MLYQAWLGGLDRPYVRPKCMAHQPVWLSKKRHLLQKARLEGPETSMEKYVLEWYKKFH
                     SFQGTDRPTAEDLHTAFDLVERPLDLSYACQLLNQCRNHYYIRLSDDSFEIFLEACLR
                     VDRRDCANYALEHADELGFWNVSDNCRRYLAGEQTWYKRSPVDLLYYPLEENAERNAA
                     VTSGAVASAAAASDKVTGDDKVEGGPRTSATTSATVASAESEGEAEATDDEIARLQAE
                     LEALEREMGAEGVDGTDKD"
     gene            complement(<567460..>568896)
                     /locus_tag="LDBPK_151460"
                     /db_xref="GeneID:13393050"
     mRNA            complement(<567460..>568896)
                     /locus_tag="LDBPK_151460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859621.1"
                     /db_xref="GeneID:13393050"
     CDS             complement(567460..568896)
                     /locus_tag="LDBPK_151460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859669.1"
                     /db_xref="GeneID:13393050"
                     /db_xref="GOA:E9BCI5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BCI5"
                     /translation="MVGRTSVVAYVVSSFLACSLFLADYANTYREFYPAMVALANSSS
                     FRLLIVNTAIAFTVVLWMVLQWCFFGQLNASEETALLTSFTLYTVECVVVPLYMDQPI
                     ISAASFFFLFTLAWRVLHKLASERVTTLSTVQMTWISATRMPAYLCFAIICDVGLLTW
                     MIKTRPELNEEKASMHYSMILIYMLLLSSSLRSTVHFASLFVLRGQHTLLPFVADAVT
                     SIAESLLFVSVYAYIFYKAALPLLLLRGFVGHVLRIFEKTSGLAEFLVLARRVRNSMP
                     DATAEDLARDVRCTICYEDMVPGGGTKRLPCGHCYHIDCLERWLEGHSTCPYCRANIM
                     QMRGGDGSAVPPTAEAEPAPAGVVEGAAVPEAQEGTPAHQQPTDTSDDMEAEIREAYE
                     RYRQQLCPPPPAASSAAATGSHPVATGAGSGSPHRTTPPPSDGMTTPQTADQLKMKAY
                     QEYHKRLREAERELQVALQLAEEAGYPP"
     gene            complement(<569830..>572853)
                     /locus_tag="LDBPK_151470"
                     /db_xref="GeneID:13392971"
     mRNA            complement(<569830..>572853)
                     /locus_tag="LDBPK_151470"
                     /product="mismatch repair protein MSH3, putative"
                     /transcript_id="XM_003859622.1"
                     /db_xref="GeneID:13392971"
     CDS             complement(569830..572853)
                     /locus_tag="LDBPK_151470"
                     /codon_start=1
                     /product="mismatch repair protein MSH3, putative"
                     /protein_id="XP_003859670.1"
                     /db_xref="GeneID:13392971"
                     /db_xref="GOA:E9BCI6"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BCI6"
                     /translation="MSKRGRQNDQEDVAHAIEVLCCRSAVKGETEGVSLTPLEQQVVA
                     LKESISPHVILMVACGYRVKFYGSDSRAVSRRVGIMCIPGQPFEYSSFPYTRVDLYVH
                     RLVAMGYHVGFADQESAAMRAADGLKSGLFTRSVSQLYSRGTLLPTERVTNGGGNGCG
                     PGDASKVPAEESCAGAGEAEEGDGTGFSWPPPHAPPSSDAGASELFLCFIDAGCCGRM
                     RGTNDADDAPTAARPPLSVVLVSFVTQRCLRFDVRGALELEDVTQRYDIAEVIVLAAE
                     SPSRARGGRDVPLQRTTACFLKALPKVYATALRQGLPLNFGPTANGEEDGKNVSVSGY
                     VYAAGQSIDAAIEAYLKPYRLDQVYRSLCARGSSTEEALRENEEGAAAAAPPAHDGAS
                     TDARLRCLHLPGPTLRALDVFHSSVGLRGSLVGLLDHSVTPCGSRCLRRWLAAPLCER
                     ASIVARQEVLAYLMACKDDGQIEDLLHECARQGDVEAVVSKLYAERCQVVEFVRLLRM
                     VRSVSVLAAQLCDREGDAGLSSSRPPPLLTQLLASVHGPAVARLLERHAALLRTTATT
                     PLEYFTEGGRAVPDALLPHLKARQKAEAALQAELEAARKVLGLPGLEYRAICGTPFLL
                     DVPACKCARVPSDWVVQTRTKTNVRYHTPIITEQHIALTAATERLSLAATAAWWQHQR
                     DTVADVEVMRVLTGVVEAIASLDALRSLALVSQQPGYVMPALVALPECARQSTSASSP
                     VVLTIRQGRHPILDRLLPHGYVSCDVQLRAGGAWLLTGPNMGGKSALMRMVGTFVVLA
                     QIGCGVPADAAELPVFEGIYCRMGASDSILEGASTFLSEMDETSRILRAPQLPHSLVL
                     MDELGRGTSSFDGAAVAAATLEYLLDRRATTVFVTHYCYLCDPYVAQRITGSGENEER
                     RMDADEARDVTCYYMGFKESGPNPLAGHGMKPPLVFTYKPCRGVTPSSFGVAIGREAG
                     LPSGVTDTASRLSAEAEQQHRVKQDLYEVRRFLSS"
     gene            complement(<574865..>575152)
                     /locus_tag="LDBPK_151480"
                     /db_xref="GeneID:13393051"
     mRNA            complement(<574865..>575152)
                     /locus_tag="LDBPK_151480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859623.1"
                     /db_xref="GeneID:13393051"
     CDS             complement(574865..575152)
                     /locus_tag="LDBPK_151480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859671.1"
                     /db_xref="GeneID:13393051"
                     /db_xref="UniProtKB/TrEMBL:E9BCI7"
                     /translation="MPSTPLDSAQPADSCGEPTQTLTSAKQTHSLDRFSPVHDTPCEH
                     VQPNTVARVSDELLEMLAEDRRINLKHHLVVDKLFKAYLLEKKNFANVMRT"
     gene            complement(<576421..>578133)
                     /locus_tag="LDBPK_151490"
                     /db_xref="GeneID:13392972"
     mRNA            complement(<576421..>578133)
                     /locus_tag="LDBPK_151490"
                     /product="glutaminyl-tRNA synthetase, putative"
                     /transcript_id="XM_003859624.1"
                     /db_xref="GeneID:13392972"
     CDS             complement(576421..578133)
                     /locus_tag="LDBPK_151490"
                     /codon_start=1
                     /product="glutaminyl-tRNA synthetase, putative"
                     /protein_id="XP_003859672.1"
                     /db_xref="GeneID:13392972"
                     /db_xref="GOA:E9BCI8"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004514"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:E9BCI8"
                     /translation="MAGPAAAEVKEMETKRDLSILQNGRPVPGCRNTRELLEAHEKVT
                     GGKPYFRFPPEPNGFLHIGHAKSMNLNFGSARAHGGKCYLRYDDTNPESEDQVYIDAI
                     MEMVDWMGWKPDWVTFSSDYFDQLHTFAVQLIKDGKAYVDHSTPDELKQQREQREDSP
                     WRNRSVEENLLLFKHMRQGRYAEGEATLRVKADMKSDNPNMRDFIAYRVKYVEHPHIK
                     DKWCIYPSYDFTHCLIDSLEDIDYSLCTLEFETRRESYFWLLNELNLWRPYVWEFSRL
                     NVTGSLLSKRKINVLVRKGIVRGFDDPRLLTLAGMRRRGYTPAAINRFCELVGITRSM
                     NVIQISMLENTLREDLDERCERRLMVIDPIKVVVDNWKGERIFECPNHPRKPELGSRA
                     LTFTDTFYVDRSDFHTDDDNNKFYGLAPGPRVVGLKYSGNVVCKSFEVDAKGQPMVIH
                     VDIDFERKDKPKTNISWVSATACTPVEVRLYNALLKDDRAAIDPEFLKFIDEKSEVVS
                     HGYAEKGVENFKHFESIQAERFGYFVVDPDTTADHLVMNRVLGLREDKSKATVAEPVP
                     AKRK"
     gene            complement(<579777..>580658)
                     /locus_tag="LDBPK_151500"
                     /db_xref="GeneID:13393052"
     mRNA            complement(<579777..>580658)
                     /locus_tag="LDBPK_151500"
                     /product="proliferative cell nuclear antigen (PCNA),
                     putative"
                     /transcript_id="XM_003859625.1"
                     /db_xref="GeneID:13393052"
     CDS             complement(579777..580658)
                     /locus_tag="LDBPK_151500"
                     /codon_start=1
                     /product="proliferative cell nuclear antigen (PCNA),
                     putative"
                     /protein_id="XP_003859673.1"
                     /db_xref="GeneID:13393052"
                     /db_xref="GOA:E9BCI9"
                     /db_xref="InterPro:IPR000730"
                     /db_xref="InterPro:IPR022648"
                     /db_xref="InterPro:IPR022649"
                     /db_xref="InterPro:IPR022659"
                     /db_xref="UniProtKB/TrEMBL:E9BCI9"
                     /translation="MLEAQVQYASLWKRLVECINGLVNEANFDCNPGGLSIQAMDSSH
                     VALVHMLLRDDCFVKYQCERNIILGLNLASLSKVLKIVDGNDSLSLRHDDDSDVVTLT
                     SENPERTRKCEYQLKLLEIEAESMGIPEMDYRSTVTLNSAEFAKIVRDMQVFGDTVTI
                     AISKEGVKFSSSGDVGQGYTFLQAAGVSDRSAKSEVKSEVKAEARDEDEHEPISRRYN
                     KAEGGNGAIGVEVAMEEPITLSFALRFMGIFAKGSTLSERVTLKFAKDSPCMVEYGID
                     NVGYLRYYLAPKVDDAE"
     gene            complement(<581459..>582835)
                     /locus_tag="LDBPK_151510"
                     /db_xref="GeneID:13392973"
     mRNA            complement(<581459..>582835)
                     /locus_tag="LDBPK_151510"
                     /product="phosphomevalonate kinase-like protein"
                     /transcript_id="XM_003859626.1"
                     /db_xref="GeneID:13392973"
     CDS             complement(581459..582835)
                     /locus_tag="LDBPK_151510"
                     /codon_start=1
                     /product="phosphomevalonate kinase-like protein"
                     /protein_id="XP_003859674.1"
                     /db_xref="GeneID:13392973"
                     /db_xref="GOA:E9BCJ0"
                     /db_xref="InterPro:IPR005916"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ0"
                     /translation="MEASAPGKVLILGSYLIVESCTPANVGVSIGVNARFTTRIVKAE
                     STTAGASGKTTMHMNSPQFRQSFCFVADTSAPGIVAVKQTEGSGSPFIFNAVLYSVAA
                     AQSLGSSTDGEIWVELLADNNFYSQRNYLESQGKDVNVANLRALPPHLPLVGAVSKTG
                     LGSSAAMTTSIVACLCHHFNADGCSHEYVHRIAQIAHSVTQGKIGSGFDVYTAVYGTC
                     AYRRFPASRVSMMMDSAQPPSSVEVETLRRCVDMKEVWVPPEPFRLPPGVKLVLGDVH
                     QGGSSTPGMVAKIVAWRRSVADTPDNLWEQLRRNNEAYIAALRRMIDEAAAKPDVYAA
                     SMAALQQVPSLPLFKADGESMQCIVEASRCAARSRALLRDMGLAAEVKVEPVELTDLL
                     DDTATLPGVFAVGCPGAGGYDAVFALVLGDECAAAVEVFWEHYTKMNVCPLLVREDPS
                     GLLVQPPP"
     gene            complement(<584013..>584390)
                     /locus_tag="LDBPK_151520"
                     /db_xref="GeneID:13392974"
     mRNA            complement(<584013..>584390)
                     /locus_tag="LDBPK_151520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859627.1"
                     /db_xref="GeneID:13392974"
     CDS             complement(584013..584390)
                     /locus_tag="LDBPK_151520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859675.1"
                     /db_xref="GeneID:13392974"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ1"
                     /translation="MSCTAKCSGYASLRAECAREPCMASGMCTLLNPRISDCASWCCT
                     SRSGYVFFLVVFFCAGTFALCASYYLYRLHQINVEGGAVQENGEAVVVAEPPTEEEMA
                     AARRKKRAVVVDPALLKELESKH"
     gene            complement(<585830..>586210)
                     /locus_tag="LDBPK_151530"
                     /db_xref="GeneID:13392975"
     mRNA            complement(<585830..>586210)
                     /locus_tag="LDBPK_151530"
                     /product="ribosomal protein S6, putative"
                     /transcript_id="XM_003859628.1"
                     /db_xref="GeneID:13392975"
     CDS             complement(585830..586210)
                     /locus_tag="LDBPK_151530"
                     /codon_start=1
                     /product="ribosomal protein S6, putative"
                     /protein_id="XP_003859676.1"
                     /db_xref="GeneID:13392975"
                     /db_xref="GOA:E9BCJ2"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ2"
                     /translation="MTGEISEKAFPLSTDRLSQTILDLVQEASNAKMVKKGANEATKA
                     LNRGIADLIVLAGDTNPIEILLHLPLLCEDKNVPYVFVPSKTALGRASQVSRNVVALA
                     ILQGENSPVAAKVQAVKLEIERLL"
     gene            complement(<588864..>591686)
                     /locus_tag="LDBPK_151540"
                     /old_locus_tag="LDBPK_151550"
                     /db_xref="GeneID:13392976"
     mRNA            complement(<588864..>591686)
                     /locus_tag="LDBPK_151540"
                     /old_locus_tag="LDBPK_151550"
                     /product="cAMP specific phosphodiesterase, putative"
                     /transcript_id="XM_024473455.1"
                     /db_xref="GeneID:13392976"
     mRNA            complement(<588864..>591686)
                     /locus_tag="LDBPK_151540"
                     /old_locus_tag="LDBPK_151550"
                     /product="cAMP specific phosphodiesterase, putative"
                     /transcript_id="XM_003859629.1"
                     /db_xref="GeneID:13392976"
     CDS             complement(588864..591686)
                     /locus_tag="LDBPK_151540"
                     /old_locus_tag="LDBPK_151550"
                     /codon_start=1
                     /product="cAMP specific phosphodiesterase, putative"
                     /protein_id="XP_024329227.1"
                     /db_xref="GeneID:13392976"
                     /db_xref="GOA:E9BCJ3"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ3"
                     /translation="MYSAVFSPAAPYCGVAGSSHLCEAVALCQSILARYRRTGTSFSS
                     TELKAIQALRTELPDTAQGPAANSAGSPHQTTNDLLNILDDATDMPHNPHDDIVAFVE
                     ECCDNTKDPTVLFAAINERISAVTCSRNVRTYMVITNDNLLWDPVNGVAALIDDVTPL
                     GKCAQAHNMLTIASTLYIPLWFRSELVGCVEAPSGCIPRDKATYAQLLLRSVTVAVRN
                     SINISIRKSEANKIEAMVSMATRLARDTLEESVLVQSIINTAKTLTESDRCSIFLVKA
                     DGSLEAHFEDGNVVVLPAGTGIAGHVVESGAVVNIPNAYEDERFNRSVDKVTGYHTRT
                     ILCLPIAFEGTIVAVAQLINKLDMVTQSGQRLPRVFGRRDEELFETFSMFAAASLRNC
                     RINDTLLKEKKKSDAILDVVALLSNTDIRDVDSIVRHVLHGAKKLLNADRSSMFLLDK
                     ERNELYSKMADSANEIRFPCGQGIAGTVAESGVGENIMDAYADSRFNSAVDRQLGYRT
                     QSILCEPIMLNGEVLAVVQLVNKLGDDGSVTCFTPMDQETFKVFSLFAGISINNSHLL
                     EFAVNAGREAMTLSLQRNSITAQRAPKSVKVIAVTPEEREAVMSIDFGDAYDFTSPDF
                     NLFEVREKYSEPMDAAAGVVYNLLWSSGLPEKFGCREQTLLNFILQCRRRYRRVPYHN
                     FYHVVDVCQTLHTYLYTGKASELLTELECYVLLVTALVHDLDHMGVNNSFYLKTDSPL
                     GILSSASGNNSVLEVHHCSLAIEILSDPAADVFEGLSGQDVAYAYRALIDCVLATDMA
                     KHADALSRFTELATSGFDKENEAHRRMVMETLIKAGDVSNVTKPFETSRMWAMAVTEE
                     FYRQGDMEKEKGVEVLPMFDRSKNNELARGQIGFIDFVAGKFFRDIVGNLFHGMQWCV
                     DTVNSNRAKWQEILDGRRDSTRSSIV"
     CDS             complement(588864..591686)
                     /locus_tag="LDBPK_151540"
                     /old_locus_tag="LDBPK_151550"
                     /codon_start=1
                     /product="cAMP specific phosphodiesterase, putative"
                     /protein_id="XP_003859677.1"
                     /db_xref="GeneID:13392976"
                     /db_xref="GOA:E9BCJ3"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ3"
                     /translation="MYSAVFSPAAPYCGVAGSSHLCEAVALCQSILARYRRTGTSFSS
                     TELKAIQALRTELPDTAQGPAANSAGSPHQTTNDLLNILDDATDMPHNPHDDIVAFVE
                     ECCDNTKDPTVLFAAINERISAVTCSRNVRTYMVITNDNLLWDPVNGVAALIDDVTPL
                     GKCAQAHNMLTIASTLYIPLWFRSELVGCVEAPSGCIPRDKATYAQLLLRSVTVAVRN
                     SINISIRKSEANKIEAMVSMATRLARDTLEESVLVQSIINTAKTLTESDRCSIFLVKA
                     DGSLEAHFEDGNVVVLPAGTGIAGHVVESGAVVNIPNAYEDERFNRSVDKVTGYHTRT
                     ILCLPIAFEGTIVAVAQLINKLDMVTQSGQRLPRVFGRRDEELFETFSMFAAASLRNC
                     RINDTLLKEKKKSDAILDVVALLSNTDIRDVDSIVRHVLHGAKKLLNADRSSMFLLDK
                     ERNELYSKMADSANEIRFPCGQGIAGTVAESGVGENIMDAYADSRFNSAVDRQLGYRT
                     QSILCEPIMLNGEVLAVVQLVNKLGDDGSVTCFTPMDQETFKVFSLFAGISINNSHLL
                     EFAVNAGREAMTLSLQRNSITAQRAPKSVKVIAVTPEEREAVMSIDFGDAYDFTSPDF
                     NLFEVREKYSEPMDAAAGVVYNLLWSSGLPEKFGCREQTLLNFILQCRRRYRRVPYHN
                     FYHVVDVCQTLHTYLYTGKASELLTELECYVLLVTALVHDLDHMGVNNSFYLKTDSPL
                     GILSSASGNNSVLEVHHCSLAIEILSDPAADVFEGLSGQDVAYAYRALIDCVLATDMA
                     KHADALSRFTELATSGFDKENEAHRRMVMETLIKAGDVSNVTKPFETSRMWAMAVTEE
                     FYRQGDMEKEKGVEVLPMFDRSKNNELARGQIGFIDFVAGKFFRDIVGNLFHGMQWCV
                     DTVNSNRAKWQEILDGRRDSTRSSIV"
     gene            complement(<592970..>594970)
                     /locus_tag="LDBPK_151560"
                     /db_xref="GeneID:13392977"
     mRNA            complement(<592970..>594970)
                     /locus_tag="LDBPK_151560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859631.1"
                     /db_xref="GeneID:13392977"
     CDS             complement(592970..594970)
                     /locus_tag="LDBPK_151560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859679.1"
                     /db_xref="GeneID:13392977"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ5"
                     /translation="MMRHFRISSATQPQCAARTKMTGFNLFTQDMQQERKVLKAKSFK
                     GGRENMRIMAKLWGKLPLGQRVMYNTRALQRAALVTRDPEKKNNTFNLLMKLFCRDKV
                     LLKAGNEAFTALMAKSTMHAMSHRDNSRLMEKLNVKAFCTSKERSNESVTSAFKCFIS
                     PNMLLFSSFTEMQRSVAPTRKSAFTAITKVLSVSNVTVSGEEYVMKRYSSLSPELRNL
                     FAPISDAEAPFFEMFCADRCASFDRKRFEIIRLFALFRGIEVDLGSNAVQDELFRSLI
                     STDRSRDGIYFRARRSLERLEKLRSSDCGLFIAKRLPQSVTVPPEAYGIDSSLDDVSV
                     ATLLAETRCGHSVYDDVLNRAAMLRTKEKNKQLAVYNVAHMLTAETLSSRQVRVERLK
                     AKADPQLSAAMPELKLNAAPAPFRKKSPLPAPVPLKKLPAMLEPQRKRTLPIVTKAPA
                     TKATPVASPDRNAPPAVKLQLVTKRAAGVSRTKTKGVPAPCRASVKVSAARKVATAAT
                     KKALKRGTSTSQATSATDEGGDFFAEDFMAEGEGDDVGLEAADKFAGVTNAQVTVPTA
                     PVKQKRKSAGRRAARSHLLAPESMLPATARSQKVIVAHTPMCRKVPRPVRTSPSSSFT
                     PARRKVSLADNIRAQLASLLESPSCVRVAERGERLDPHLHAG"
     gene            complement(<595719..>596597)
                     /locus_tag="LDBPK_151570"
                     /db_xref="GeneID:13392978"
     mRNA            complement(<595719..>596597)
                     /locus_tag="LDBPK_151570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859632.1"
                     /db_xref="GeneID:13392978"
     CDS             complement(595719..596597)
                     /locus_tag="LDBPK_151570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859680.1"
                     /db_xref="GeneID:13392978"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ6"
                     /translation="MRVSPNSLSEAASQLEQDRERDFFRLLYIVDRARRFLSIPVGNV
                     DWRLTCDCLDDMNHRYADTGFLLGFTGGYVLRNRAGRTLLSRFWFSMYLGLVFYDWEL
                     RRATRAPALEYWNSICTVDTEVGRIARVLHTPARFYEAAPMSTAFSGVPPPLPRGSSS
                     SPSPAPHGASVRDWLWRYISDTMSSVLLTTLCSHLFEGSSWRHRTSDNVEVTALVINS
                     RFFHWKVFESCQVQRNEMTEYNISLKWFPSFAASDSLRRSFQCRELILERSTLGGRLW
                     YRTHFSLLRCLGLDSQ"
     gene            complement(<597344..>597940)
                     /locus_tag="LDBPK_151580"
                     /db_xref="GeneID:13393054"
     mRNA            complement(<597344..>597940)
                     /locus_tag="LDBPK_151580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859633.1"
                     /db_xref="GeneID:13393054"
     CDS             complement(597344..597940)
                     /locus_tag="LDBPK_151580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859681.1"
                     /db_xref="GeneID:13393054"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ7"
                     /translation="MGSKKQDASAELLSELRAVIVSGGSMGTLDEQKVRSVVEKINES
                     YACIQSIATNPYADMTQPYYVSSVNYYRSKCLRDKRCLLTYLLWRQKQVAKAWWSVRD
                     NLLEGSLSAAEAKYLSDYQGTMVEYMTSFDVPLDLRAYLWRPPSVRQLEVRGRCHYEF
                     RSSVSGKTIIINTGDQLFLSFEEAEPLIQQGIVALVGH"
     gene            complement(<599010..>599339)
                     /locus_tag="LDBPK_151590"
                     /db_xref="GeneID:13392979"
     mRNA            complement(<599010..>599339)
                     /locus_tag="LDBPK_151590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859634.1"
                     /db_xref="GeneID:13392979"
     CDS             complement(599010..599339)
                     /locus_tag="LDBPK_151590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859682.1"
                     /db_xref="GeneID:13392979"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ8"
                     /translation="MSSIFYRFYTLYLYVCVPTPLATSPRPIIYSHSFFLSSFLLSNN
                     LSHSFVLCDIPKMPPKHYDEKSDIVPPHDRAEALAMEYEDSHHERPGTKKHNETPSHQ
                     GKPKSVR"
     gene            complement(<599799..>600857)
                     /locus_tag="LDBPK_151600"
                     /db_xref="GeneID:13392980"
     mRNA            complement(<599799..>600857)
                     /locus_tag="LDBPK_151600"
                     /product="presenilin-like aspartic peptidase, putative"
                     /transcript_id="XM_003859635.1"
                     /db_xref="GeneID:13392980"
     CDS             complement(599799..600857)
                     /locus_tag="LDBPK_151600"
                     /codon_start=1
                     /product="presenilin-like aspartic peptidase, putative"
                     /protein_id="XP_003859683.1"
                     /db_xref="GeneID:13392980"
                     /db_xref="GOA:E9BCJ9"
                     /db_xref="InterPro:IPR001108"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="UniProtKB/TrEMBL:E9BCJ9"
                     /translation="MSSRPLLDDAHLSRGVGIRFVSLVVPVTATMLAVVWSLSCLSPI
                     YVNSQVPPLPVVVNENDAATAGEKFVYSLVAALIVVGCVVAATFATVLLYHFHLQFVL
                     YGWLAFSAVSMFFMLLWIWLDLFCTYFQIPYNVISMGIFVWNFGVVGLIALFYYSHPT
                     VTQVYLVIASILTAWSLTALPEWSTWSLLICIATYDILAVLWQQGPLHRLIKIAQERD
                     EPIPGFVYSSAHSIVPITQPATASSARVPATAAESFMWTVQHATPFKLGLGDFIFYSL
                     LVGRASFSGFVSWSFCMVSILAGMLGTLLSLLLFRNSLRALPALPCSIFLSTVVFVLC
                     RLIVESLSSFTSHHLLVL"
     gene            complement(<601491..>602741)
                     /locus_tag="LDBPK_151610"
                     /db_xref="GeneID:13393055"
     mRNA            complement(<601491..>602741)
                     /locus_tag="LDBPK_151610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859636.1"
                     /db_xref="GeneID:13393055"
     CDS             complement(601491..602741)
                     /locus_tag="LDBPK_151610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859684.1"
                     /db_xref="GeneID:13393055"
                     /db_xref="GOA:E9BCK0"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013917"
                     /db_xref="UniProtKB/TrEMBL:E9BCK0"
                     /translation="MKKGSTTGCRPMLSEKRREALGKMYSLVGTHSAVKLCRWQKSMM
                     RGRGGCYKWTMYGIKSHRCMEATPSMACANNCVFCWRLNSNPTAAEWKWMVDPPKDVV
                     EGMISSHQALINGVRGMPGVTDEALEEALAPRHCALSLVGEPIMYPYVNEFLDLLHAK
                     SISSFLVNNGQFPDAIRNLAPVTQLYLSVDAPNQKTMKILDRPVLSDYWERFNESVNN
                     MREKKHRTVFRLTMIEGFNMEPENLPEYKELFDRGQPHFIEVKRLTPAFSGNHNTILR
                     IKNVPSWDKMKAFAQQLCSAIGDGTQYTVASVHEHSGCILLAHQRFVIDGRVHSWIDY
                     DKFDTIVQDPSRAADMVPEDYLLPTPTWALFDSPAEGFDPAQKRHVSNKRRKHMESVA
                     AASPQLDGCCFTKAESTVVESAET"
     gene            complement(<603399..>604067)
                     /locus_tag="LDBPK_151620"
                     /db_xref="GeneID:13393056"
     mRNA            complement(<603399..>604067)
                     /locus_tag="LDBPK_151620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859637.1"
                     /db_xref="GeneID:13393056"
     CDS             complement(603399..604067)
                     /locus_tag="LDBPK_151620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859685.1"
                     /db_xref="GeneID:13393056"
                     /db_xref="UniProtKB/TrEMBL:E9BCK1"
                     /translation="MNPDEREAQERTLAKLQWLNERSKLDFRGNPAPFETKKTLRSVE
                     QAKRAKARSLAGTSDFLPFWHGTAPLALDATRSNYIQVDQGSKPSCMGSARASYGAQA
                     VDPSTGLTEVQLALSWSVPHPAVSKSRGAVGMSRGGASARGRCDSSYLQSLSPEERAT
                     ACRAYLLEHPKCTPESFQAHRSRWAASTQLSAPIVKLPPKRPQNAALQRPNSVRVVHL
                     LHSL"
     gene            complement(<604644..>605804)
                     /locus_tag="LDBPK_151630"
                     /db_xref="GeneID:13393057"
     mRNA            complement(<604644..>605804)
                     /locus_tag="LDBPK_151630"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859638.1"
                     /db_xref="GeneID:13393057"
     CDS             complement(604644..605804)
                     /locus_tag="LDBPK_151630"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859686.1"
                     /db_xref="GeneID:13393057"
                     /db_xref="GOA:E9BCK2"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9BCK2"
                     /translation="MPTKMAAADFEFGPPLGTGAFSKVVVGLYKPTNVRYAVKFISKR
                     SILDAPTDEERTRMAEVARRETRMLLMCEHPNIVKFHASMQTTEDLLYVTELCEGGEL
                     LKHIERWGHIPLEAARHAIAELFSAVFYLHHGEKKSNSGPSGPAMKPLTVIHRDIKPE
                     NIMLSADKHLRLIDFGTAVVCQSADDKATGEETGSGRAQTFCGTTYYMSPELLESSYT
                     CCASDYWGCGCVLYLMLVGQRPFDASTQYLLIKTILEKEPEFPEDMDPDAKDLIRKLL
                     VKDPKARIGMKEIKRHPFLASVNLSTVANQDVADFWLRETPWVDEASISACMACQRPF
                     GILRSKQFCHNCGRITCNSCIRDLRIIPESRWKAPQRVCTACAGTLNGVSTL"
     gene            complement(<606681..>610451)
                     /locus_tag="LDBPK_151640"
                     /db_xref="GeneID:13392981"
     mRNA            complement(<606681..>610451)
                     /locus_tag="LDBPK_151640"
                     /product="condensin subunit 1, putative"
                     /transcript_id="XM_003859639.1"
                     /db_xref="GeneID:13392981"
     CDS             complement(606681..610451)
                     /locus_tag="LDBPK_151640"
                     /codon_start=1
                     /product="condensin subunit 1, putative"
                     /protein_id="XP_003859687.1"
                     /db_xref="GeneID:13392981"
                     /db_xref="GOA:E9BCK3"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026971"
                     /db_xref="UniProtKB/TrEMBL:E9BCK3"
                     /translation="MSGVLEFFIPNHIADLEDAKKIGADCYHVEGVCEFDVPERQQLD
                     DLTRLFDALHHEKSPTALFTKQDLFFPLYSYVRAIREKSGQSTVVTRVARHKICHEVG
                     ERLKKLLQVAVAFLKKQRPGSAQNGALEVCLRSTLKMYAFLACNVLLSVAPPDDDESP
                     SGLSQQQSHRKRSRRDIDGSFGDDGSGVDMDGRELVLTALVELCSPDVMQLWPECHLE
                     DSTLNLVLKMCLHMVTLKQNIGGDAQSVGGALALLFARASNCILSKKSVANSTELVTP
                     LVELSLKSESASVFLSKLVSDIEQSETSVGFGDELLRAIFETMSRAALYEAANDSAAA
                     KNVACFFGEVAKQSVTVVVKMADLVIPALQSENYDIRKAVVTCIAEMVLQRYTGHARN
                     ANDDAVRNSYLKELLFRVMDVNAFVRNHVLHTWERLVESRAVPKRYHLAVMAALVGRL
                     EDRNYLVRDAAMTVISSVLRKNWFGNVLNSALVKSKLEEALRDGIVCFGDTSAMEKEI
                     ENTRAQFQPAMEVLGDPLDVNEEEAPRAVEVEGAYVSREEDAVMSDKQTVVINRIVFY
                     QNTLCFVELIKQALQYACVLLDSKTERDVIESIKLIVVCSEYRVQGGERAFLKVLVMV
                     FEGEIKIQFAVRDAFAEVVFNAFNRVAASSGTRVAASAQKLISLLRCASEGEVSAVDR
                     IFGLMKANPALARHLSAQFVEAMWSIAEGSIDADATDGDRRIAMRIYSLLSKYVWKDL
                     RARKDSIVAFLCSDSHKDNVLLSYVFAALQSEALDPQFRPIPADEDVRRHPVLRHVVN
                     HLCRRTEGMASWMILAEAGVNVIHTLCEVPVTVYNYILEYYGSCENLETQPNRKAQCL
                     FLLGHTALKQLVAVEAAEKAQLKALEDPTKGVAEVSPKVRDQTDSMHKELGLGSHELR
                     RHEIQELAQKRKQAIISPGSVWSRFADMIVATCRKKSSVYADKPFERVCAVLALCQYM
                     IVNEGFCSEHLSLLFAIVADKRESWVTKVNVVIALGDLVCVHPNLLGPYLSVPTTGFF
                     KLLVDEDVRVRAVTIQVCSHLVLGEMLRIRDHLYTIVKLVADPDETIANNAVTFVQNL
                     AMKEKEKIGNLIPPLATQLSNAMPFDKFQLAMRTLLERVEGDKPTDSLIDRLCQRFES
                     FSERSKKKLAVARNIAFCLSELNYTTERTIKRLTSESCYQQYRHWLRCADVYEYFKLI
                     ATKAKKQGRGGPERRDRAAVEEWEARMQMDSCAEADGEEKTSVAVAQEAPVE"
     gene            <614918..>616549
                     /locus_tag="LDBPK_151650"
                     /db_xref="GeneID:13392982"
     mRNA            <614918..>616549
                     /locus_tag="LDBPK_151650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859640.1"
                     /db_xref="GeneID:13392982"
     CDS             614918..616549
                     /locus_tag="LDBPK_151650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859688.1"
                     /db_xref="GeneID:13392982"
                     /db_xref="UniProtKB/TrEMBL:E9BCK4"
                     /translation="MPPKRKLPRRGRALEGELNLDAVSNERIDAVTAEPLDPVKFIEV
                     LSPDKTLRLFYNTSTLIRIAVDNGGFMQPPHFREPMSNALRKRIEDIEGKTFHFESRN
                     TVIRGDEAGDDGEIEVVHRHVYFDQIMDEFYLLNPAEVYVCPMCYEHYLNTRFLPARI
                     EEGRHVRHLHSGRPVVDPLDVLSHMHGEDPSTGDADNGAPIVLDTVWDNVLIHIVFRR
                     AAQWKTHMESHHWVRGVSAGDYRLRDVLCTYYNDYNQWNEEKHEEEVRLYGSARKKAA
                     LTLQRYWHINASYNRLRYNRVVAAAELAEGHAEAVTESAFPNETIAHHLNPEIEDEDD
                     FIDDDTDADDYVPPYSPEHEEFSDEEDFTDSSEGEPRQHFRKRNRERSAESEIVSSHS
                     SSSSTTTSSTDSDYVAEVEKQRALFKRGLLAERDCYFSRLSAEDRRFFEKSQRSNVAP
                     SQLYDPCMHLKNTPSSTLDDNIDWENIGEALPITNCVKLKKEMSASRPHVAADLEPIK
                     SKILLDEDDASPLSVAQPQLTPSRPSPRLLLDDGE"
CONTIG      join(FR799602.2:1..618357)
//
DBGET integrated database retrieval system