GenomeNet

Database: RefSeq
Entry: NC_018246
LinkDB: NC_018246
Original site: NC_018246 
LOCUS       NC_018246             757180 bp    DNA     linear   CON 30-MAR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 19.
ACCESSION   NC_018246
VERSION     NC_018246.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 757180)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 757180)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799606.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..757180
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="19"
     gene            complement(<1157..>2044)
                     /locus_tag="LDBPK_190010"
                     /db_xref="GeneID:13385993"
     mRNA            complement(<1157..>2044)
                     /locus_tag="LDBPK_190010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860134.1"
                     /db_xref="GeneID:13385993"
     CDS             complement(1157..2044)
                     /locus_tag="LDBPK_190010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860182.1"
                     /db_xref="GeneID:13385993"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:E9BDZ9"
                     /translation="MAGAKDEKESRDISGDPFQDLTNDFVRAATRAKNNINERNEGCR
                     QHGQDHMAIVQSNEIRKDLRLMEETLEEIHKLVLEAERRLAKENKKKKPKENKVHLLE
                     RDYEGRRSQYDNCVSALQNLKEMEAQRVELGREEINTVQEMQLGKRAQLRQQLLGMRR
                     KDNGNGETVGPGDVELVDNTLGGGMLQEHEESKEQMKTIAAQDAKIDAGLCRIKEGVG
                     RLHDLAVQIGAQIDMQNAMLDETEQVIDKNAEQLRGLNRRLKKFLKETRPMNCFLYVC
                     CVFLIIALIGFFLVQFNVI"
     gene            complement(<3305..>4078)
                     /locus_tag="LDBPK_190020"
                     /db_xref="GeneID:13385995"
     mRNA            complement(<3305..>4078)
                     /locus_tag="LDBPK_190020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860135.1"
                     /db_xref="GeneID:13385995"
     CDS             complement(3305..4078)
                     /locus_tag="LDBPK_190020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860183.1"
                     /db_xref="GeneID:13385995"
                     /db_xref="UniProtKB/TrEMBL:E9BE00"
                     /translation="MVRQRTSVGAGALAAKETPSPLKGAQSQVRTPPPPPEPPQSQPE
                     SVQQSVPAQPEESSEEEVVVNTVQAPAVMEMEPIPEPPAPVALVIAPHYVLEIERVVS
                     VKLPPRVTQTAETQRGLYMFSAQAGKPPTPPPTVQQHAVYRPDTANLGTRQWSLGTDS
                     RIQQPPQQQHAWPSASQFDYWNNAPERVQASRPFMGTQAQAPYNSYPSAVPLAHQRAT
                     GNAFPVRFRSSEVPESALRQQSAVPFNRASQPTNGGGVW"
     gap             5865..5963
                     /estimated_length=99
     gap             7032..7130
                     /estimated_length=99
     gene            complement(<7132..>7455)
                     /locus_tag="LDBPK_190040"
                     /db_xref="GeneID:13385996"
     mRNA            complement(<7132..>7455)
                     /locus_tag="LDBPK_190040"
                     /product="histone H2B"
                     /transcript_id="XM_003860136.1"
                     /db_xref="GeneID:13385996"
     CDS             complement(7132..7455)
                     /locus_tag="LDBPK_190040"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_003860184.1"
                     /db_xref="GeneID:13385996"
                     /db_xref="GOA:E9BE01"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BE01"
                     /translation="MASSRKASNPHKSHRKPKRTWNVYVGRSLKAINAQMSMSHRTMK
                     IVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAV
                     SSASR"
     gap             8331..8536
                     /estimated_length=206
     gene            complement(<10500..>11759)
                     /locus_tag="LDBPK_190060"
                     /db_xref="GeneID:13385997"
     mRNA            complement(<10500..>11759)
                     /locus_tag="LDBPK_190060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860137.1"
                     /db_xref="GeneID:13385997"
     CDS             complement(10500..11759)
                     /locus_tag="LDBPK_190060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860185.1"
                     /db_xref="GeneID:13385997"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:E9BE02"
                     /translation="MFGGMYGGGLSGMYGSSMYGGGLGGMGSSIYGGGMYGNSGLMGG
                     SSHGMSGGLNSFARNNPYGSNSNYSLGGFNSLGSNADGTQNNGMQSSLTLQQQADQPN
                     QLASPIHQHAASLPPLNESPEERSRRIQAEHKKERQLIRQQREQHRQARLQARMEIAG
                     HLTNVLVQGLRSAMELFGVCFGTYYSMKAVRAFSNAQERMPGMGMGMGTTYPYGAAVA
                     KTQAVVTGASGVQQAAKAASGGPSRWRAWLLCIAFFLLGEVLYGIATRQRANPPQRRH
                     RITSPAEDAYGNVISQDEYEVSIRSSDAESRLTEEDKGEEETLSEAWGHTYNANGVYG
                     ASQAVRPSGGTGARRVYYALYDYQAPQADGSRLSFKAGDEFVVENYAEGSWCEAMAVE
                     GGSYSSHARRGLVPSNFLRLAERITKL"
     gene            complement(<12760..>14058)
                     /locus_tag="LDBPK_190070"
                     /db_xref="GeneID:13385998"
     mRNA            complement(<12760..>14058)
                     /locus_tag="LDBPK_190070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860138.1"
                     /db_xref="GeneID:13385998"
     CDS             complement(12760..14058)
                     /locus_tag="LDBPK_190070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860186.1"
                     /db_xref="GeneID:13385998"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BE03"
                     /translation="MDKQDYYTILGISRTANKDAIRQAYKLKALQLHPDKNPNGEAIF
                     KLVVNAYQTLNDPTKRSAYDRELTRRDRGFGAHQFRQAAPQPSSPAAYPSSSYGADAG
                     ASRKPRYATDEQLFKDAYEQYKKSPFSATPDGGFRGVNSEGTFAEWFKKKQEELRRAE
                     EVTKAKAEYAKNLEREEKRRAEEWRDMQRRREEEREEEVRQAKDQREREREMLRRKRE
                     AEAKEQKEAEKKAQMEAYAEVQREQQADVERHLRDLASQKRELAEERRRLAEERAEVT
                     NLAAEHRFTRDMAHKQRGQELADAVRRADAKVREAQEQQMLHEANERAKAEERAREEK
                     LKRAEEERALEAERARERQRQKEAEAAEQERNRTTAELGEQRKRVIAQMMSERRRHEE
                     EVSAMRRETDRIEAEMKAKLEALRAAKNSGQTINLDEWKL"
     gene            complement(<14895..>16106)
                     /locus_tag="LDBPK_190080"
                     /db_xref="GeneID:13385999"
     mRNA            complement(<14895..>16106)
                     /locus_tag="LDBPK_190080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860139.1"
                     /db_xref="GeneID:13385999"
     CDS             complement(14895..16106)
                     /locus_tag="LDBPK_190080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860187.1"
                     /db_xref="GeneID:13385999"
                     /db_xref="UniProtKB/TrEMBL:E9BE04"
                     /translation="MKPKAAQVRQQQSLNRRVKLEESAARVQQDLLARQAVMRNMGGG
                     QQRNPMYGYAGHPARNRDPNRGVITQAEWSELVERHEDSGKCFRYFFGVLIFAAILLL
                     TISKYDEEYNLEVPQVESGKGFGEVLNPERAVDAKELEGYYHTLGVEGRLNLTHTAVP
                     PATDASEGNGSSRKAADDPDKARRRENYQVRQQIKRAFQDHQEKYGQLVHCGRTCEAQ
                     NKQVELAYQKLTSQVDRELFGVLLDAKDTKSLRSTTPAQLKMKYEEKRQKILETEEDE
                     EDRNMALEELKDAYEIIENPDARKYYLLYGAKPPEHMRHVSARHGGWGQEMALGTFKY
                     RIIIMWLEFLHQYIGVWGETAVLGCVVLFMLSRLPQALKDSQRLLDELDLEDEHAEEE
                     KRAAEQEVQRE"
     gene            complement(<17911..>18810)
                     /locus_tag="LDBPK_190090"
                     /db_xref="GeneID:13386000"
     mRNA            complement(<17911..>18810)
                     /locus_tag="LDBPK_190090"
                     /product="fibrillarin, putative"
                     /transcript_id="XM_003860140.1"
                     /db_xref="GeneID:13386000"
     CDS             complement(17911..18810)
                     /locus_tag="LDBPK_190090"
                     /codon_start=1
                     /product="fibrillarin, putative"
                     /protein_id="XP_003860188.1"
                     /db_xref="GeneID:13386000"
                     /db_xref="GOA:E9BE05"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BE05"
                     /translation="MRGGRGGFGGRGGGGRGGGGRGGGGRGGGRGGGRGSGRGGGRGS
                     GRGGGRGGRGGAGTPKGNIFHPHARFNGCYLLAGKDTLSTRSLVPGVSVYSEKRVNGT
                     VAGESESHEFRVWNPYRSKLASAIYAGVASIYMEPGSAVLYLGAASGTTVSHVSDLVG
                     PEGVVYAVEFSHRSGRDLEEMTKRRSNIVPILEDARYPQKYRMLIPRLVDCIFMDVAQ
                     PDQARILALNAQHFLKANGGFVISIKANCIDSTADPAAVFASEVQKLKDSGLRPKEQV
                     SLEPFERDHCVVTGYYKNVPQAT"
     gene            complement(<20176..>21051)
                     /locus_tag="LDBPK_190100"
                     /db_xref="GeneID:13386001"
     mRNA            complement(<20176..>21051)
                     /locus_tag="LDBPK_190100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860141.1"
                     /db_xref="GeneID:13386001"
     CDS             complement(20176..21051)
                     /locus_tag="LDBPK_190100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860189.1"
                     /db_xref="GeneID:13386001"
                     /db_xref="GOA:E9BE06"
                     /db_xref="InterPro:IPR000996"
                     /db_xref="UniProtKB/TrEMBL:E9BE06"
                     /translation="MDSGYPRPSGITVGSPGLPPGSLGSPFPEQMNSPHSSDAMQGSN
                     ASQVPLTMHADGGQHSKPHSPPLTSGAEVLSAPHHSHLAGVNAPWDEDDDWTTPGAPA
                     QHSASAAAPAKLPLPPGNHAAPPVSIAEQTNPGSPAEPHPTPVAMSPPPSDGFIASSS
                     PGGSPNRPPTPPEKPSAANVAKMDALKKQIASRTAAMDAATKEKETKIMTAAQEYLKA
                     LMAKREEEVMNAKASHKEEQQVGAEKINEYKRSGAVWSAVGLLVDLQKPNQYSKSTEQ
                     MRTVLSTLNAAPAKK"
     gene            complement(<22072..>22761)
                     /locus_tag="LDBPK_190110"
                     /db_xref="GeneID:13386002"
     mRNA            complement(<22072..>22761)
                     /locus_tag="LDBPK_190110"
                     /product="QA-SNARE protein putative"
                     /transcript_id="XM_003860142.1"
                     /db_xref="GeneID:13386002"
     CDS             complement(22072..22761)
                     /locus_tag="LDBPK_190110"
                     /codon_start=1
                     /product="QA-SNARE protein putative"
                     /protein_id="XP_003860190.1"
                     /db_xref="GeneID:13386002"
                     /db_xref="GOA:E9BE07"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:E9BE07"
                     /translation="MPLENGEVLSRCVQQVAKACSDAQSSVKELGTGRDAIARDRLRR
                     IRLLVQQCNSRVEELLSDAEPFLESLRQQYAQQKAVFELINAEATRRERQTFRQTDPA
                     SMREGDLDALEPQVTFCEARPLNVSEFHTEEAIQREKLQSAREVESDVMDLKMAYQEF
                     HSLVHQQQESLDRVTNNVTESRSLIERGHDQIQGATRRQRSFRKIGCISGAVVIVIMT
                     IVIIVVTVATR"
     gene            complement(<23770..>24531)
                     /locus_tag="LDBPK_190120"
                     /db_xref="GeneID:13386003"
     mRNA            complement(<23770..>24531)
                     /locus_tag="LDBPK_190120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860143.1"
                     /db_xref="GeneID:13386003"
     CDS             complement(23770..24531)
                     /locus_tag="LDBPK_190120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860191.1"
                     /db_xref="GeneID:13386003"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:E9BE08"
                     /translation="MSQNFGDWFNQLGLVTRASLVASVGLSAACSLNMVGVGSVILTS
                     EAITSLQVWRFVTAAFYLGNFSFPWLMTVAMFVTYVKNNEESDFKGKTADMTYMFLLL
                     VGALSSAGLFFNVYVTSFSFLMALCWIFCKRHPEQELTLFGFSFRSAVFPWVLMALHL
                     VMGQGLLADILGIVAGHAYVFFKDVFPVSHNQRWLETPMWLRRQFTQPTHRVASFGPE
                     MHPYDPRFQAAWRGEAQQRSSGLHNWGRGQTLGSS"
     gene            complement(<25667..>27562)
                     /locus_tag="LDBPK_190130"
                     /db_xref="GeneID:13386004"
     mRNA            complement(<25667..>27562)
                     /locus_tag="LDBPK_190130"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860144.1"
                     /db_xref="GeneID:13386004"
     CDS             complement(25667..27562)
                     /locus_tag="LDBPK_190130"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860192.1"
                     /db_xref="GeneID:13386004"
                     /db_xref="GOA:E9BE09"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:E9BE09"
                     /translation="MQPSSDNGASTGANVVVEGKYTIQDANIVGRGAYSVVKVCTPIH
                     PYVPPGSRPGMKYVVKIIEKEYLISLAKGDVDMAMAEIKREIDVLRHIPSHENVVTFL
                     EYVETEKQFLLFFEKVQCGDLCELILQSSSGKLTEEKSKLYTYQIIKAVLHCHLHDII
                     HRDIKPENLLVSEDDNIKLTDFGLAKRSRGVCTGDSPRDPLDVTALMMPYPGCERLLG
                     KRVVCSDVIGTPRYGAPEMFYAKFTQTHYDGFNADTWSIGVVTYITLSGSFPYSPGSN
                     ASEKEVFRTIMSTPLPKPSGISPLAWEFVQSMLNKDPSKRTPLYAALNHPWLADVVVQ
                     RGSVVAAQLRASVISADVESAAARFDEEARRLRICMAKLQSEVAALREERDRVREVQQ
                     PALQETHTQARRAQTPSGLSRPRSTRYPASTIRVSSPARVTNHRRTGSRDSSSAGSVP
                     RRASAPRGRSPLARSAGGAAVRRGTPARAGGTTPARSATPSRTTGARSGSAARAMIST
                     RGATPTRSATPGRSAHDRSRTPHRSAISGTSNGTTSGVSHSTNAVNPANELHLGDQVT
                     YKGCRAIVRFNGSTAFGAGIWIGLEMLEGNEGTNDGSSFIDKKQYFTCPKGKGVFVRA
                     SQVKKLG"
     gene            complement(<29875..>30717)
                     /locus_tag="LDBPK_190140"
                     /db_xref="GeneID:13386005"
     mRNA            complement(<29875..>30717)
                     /locus_tag="LDBPK_190140"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860145.1"
                     /db_xref="GeneID:13386005"
     CDS             complement(29875..30717)
                     /locus_tag="LDBPK_190140"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860193.1"
                     /db_xref="GeneID:13386005"
                     /db_xref="GOA:E9BE10"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BE10"
                     /translation="MAAISTKELMEVTLGKKLGAGSFGSVFVGVLPSGNFVAVKILEL
                     SDDAPSNTEVEIHRKMVHPNIIRYLYSRIDLESTPKKLYVYLEFVTGGSVTSLMKSLP
                     NGCLPYAVVRVYARHMFQGLEYLHSNQVAHRDIKGDNVLISMDTGTAKLADFDQAKIM
                     NTHGTLRKAATATLAGTPYWMAPEVITDEDGYDPFKADIWSAGCTVAEMITGRAPWTP
                     MPNVMHIMNKLALSTGWPDAVPKDAKELGSQDAYDFLDLCFQRDVSKRPPAATLLKHV
                     FLRV"
     gene            complement(<33007..>34149)
                     /locus_tag="LDBPK_190150"
                     /db_xref="GeneID:13386006"
     mRNA            complement(<33007..>34149)
                     /locus_tag="LDBPK_190150"
                     /product="aminopeptidase, putative"
                     /transcript_id="XM_003860146.1"
                     /db_xref="GeneID:13386006"
     CDS             complement(33007..34149)
                     /locus_tag="LDBPK_190150"
                     /codon_start=1
                     /product="aminopeptidase, putative"
                     /protein_id="XP_003860194.1"
                     /db_xref="GeneID:13386006"
                     /db_xref="GOA:E9BE11"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:E9BE11"
                     /translation="MPKNTDQEEWEDYGDEEVQDEEEEDTTINNSDVVVRYKKAATWC
                     NETLRVLIDATKPGAKVCDLCRLGDDTITAKVKTMFKGTEKGIAFPTCISVNNCVCHN
                     SPGVSDEATQQEIAMGDVVHYDLGIHVDGYCAVVAHTIQVTEDNELGKDEKAARVITA
                     TYNILNTALRQMRPGATIYQVTDVVEKAAEHYKVTPVDGVLSHMMKRYIIDGYRCIPQ
                     RRVAEHMVHDYDLEKAQVWTLDIVMTSGKGKLKERDARPCVFKVALDSNYSVKMESAK
                     EVQKEIDSKYATFPFAIRNLEAKKARLGLNEMAKHGAVIPYPILFEKEGEVVAHFKIT
                     VLISNKKIEPITGLKPQKAPALEPYTDEMLLATNKLSLSLEKKAAK"
     gene            complement(<35683..>40158)
                     /locus_tag="LDBPK_190160"
                     /db_xref="GeneID:13386007"
     mRNA            complement(<35683..>40158)
                     /locus_tag="LDBPK_190160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860147.1"
                     /db_xref="GeneID:13386007"
     CDS             complement(35683..40158)
                     /locus_tag="LDBPK_190160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860195.1"
                     /db_xref="GeneID:13386007"
                     /db_xref="UniProtKB/TrEMBL:E9BE12"
                     /translation="MARRALAALLVVLCFLLARSEAALTAPFGGCEAGTSGYAIHSPG
                     ENDKGAQYLMDNGIAFAILPATVTNGVVTWENGEVAAWMPPDFQAPSDAHYCLILRKN
                     GAWSVVSMPFTWNHLCIDGREDGETTTTATQMPNTTTTSTTTTTPAPTANPHLSSSSF
                     QSEGSASSSFASPITTTTLAPSPTTSTTAAPPPSVPTVSSVMQTVRSVVFAAVPTVNV
                     MDFTSNVVYLPATATLVESMQALQAASIVIAVRFGATGPVSALLTDATAASVSFHVPH
                     ELYNVSVVTSHALSLVTLNTADVLVVGSQLRITPVLIALQQMSMGVVLSDESILEGTD
                     ILATVRFAGAGTALLYTTDVSKVITSTLSFSMVNNGAVGSRCKPSTSSIPYFITRYDV
                     RFLVPGNYTARVHAGRKSVCATYNGKSVVVAPLAIQGIAATTTAASFPAATAIPIRLQ
                     GGTTTGIARGAYAAFASASSDCTSEGAKISLLPVNSFNSSSDSSAVPGALLVASSEVP
                     TGSYVCMRRTSTNTKFAVRYHGKPVTVGAASMPPAAAATAPVLTIFNGSCGSLNLLEF
                     VRPPASEDDIAAYLSAASNVSEAYRVFRFVAVKAGATAADKADACRRFKQEATRDAAN
                     GAMQFSFPFYLQQTNGVLCADEEYVRIDYTVIQPTNWLMSMAGVSDFASRMLVLSSGP
                     EYDAVPLSVRSSRLASVGSGTAVRISQDGSCAFGYTARIQSYNTQQYIAVPTASVGVY
                     TLCAGLYNETGTSMFVSTGSQVDLASYVRGRRKWMHEAGIERTEWTPCGSASTCGLHT
                     QQAYIEVCNGAVRRNVWPQRLDGAFVGSDSAMVLMAGNLYKTQAIVLMNDVYVPVAAA
                     FAHCQQFSLLQLSTDDGATYGPAAVVLGNHPQIALSPVTDVSGVIVGFVPWNAMCRGV
                     HTGADVMVARTAAGISVIDISGLLFTKSEGYYAVCVRNGVAWARVTDTYIKVVIGGVT
                     VYQAEAINTGDALANQKSIHLYQTQTATWGVAGTFSPSVSLLLKLVWMDSTCTMDAAY
                     TAALRYISPSSAHATVEASLIAAAPAGVASPTLYPCYMANTFGNTAAPMPFEEHRGRS
                     ITVTQLTLSSLFYLPYLELSVSAPVDTRILLTEPQDPPITRVSLRVTSSQSDVPQCGA
                     AATYATVLTIETDDLGRRWMTVPAWVPQTLGGSGATNVYLKMCATASSSANPEFVAVE
                     AYLVLSANATNLAGNPMSLRLTFLPLNSSTDLLDYKAAQYALVKYAATELKVPETVVL
                     VASLGNNAFELFIDDALQTGAAPQSTLTPTQQLYQTLAKGTNLPLFLNGRDNATAWFA
                     LAKAEAVHLVDQTSVDDYPALALPVSGSAGKSFNYTGLSIALFCVVVAPTTIGFVAFS
                     VQQTIPTLSHSRFGKKTAVCVETGDSPPPRNPCSPMDLEADGGAKKDEARDVPLVVPR
                     AEDTTQCPLYDSDDEGATHEMKDMGTSPPLRNDTFAMAHRKGVSSRSSVEDEERS"
     gene            complement(<44913..>46136)
                     /locus_tag="LDBPK_190170"
                     /db_xref="GeneID:13386008"
     mRNA            complement(<44913..>46136)
                     /locus_tag="LDBPK_190170"
                     /product="mitogen activated protein kinase, putative"
                     /transcript_id="XM_003860148.1"
                     /db_xref="GeneID:13386008"
     CDS             complement(44913..46136)
                     /locus_tag="LDBPK_190170"
                     /codon_start=1
                     /product="mitogen activated protein kinase, putative"
                     /protein_id="XP_003860196.1"
                     /db_xref="GeneID:13386008"
                     /db_xref="GOA:E9BE13"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BE13"
                     /translation="MERYTVMGQLGDGSFGTVSKAQNTSTGEIVAVKKMKQRFHSWEE
                     CLQLREIQSLRKVQHPNLVKLKEVVREKTELFMIFEYCEKNIFQIQRQRANEMSGTMA
                     FSDKEIRSIMCQTLLGVQAIHKAGFMHRDLKPENLLISGDLVKVADFGLAKEIRSRPP
                     FTEYVSTRWYRAPELVLHSTHYNSPVDIWACAVIFAELYLCRPLFPGTSESDQLFKIC
                     SVLGSPAPNEWDEGYQLARRMNMRFPTVAPTPLRHILTTAPPAAVDLMAQMLRFNPAE
                     RPTATQCLQHPYFTGSGGSSALYAGIATGQPHNPFQLAASSAVAAQSTSNVGLTSNSS
                     PPPTTSNASLFKYANLFNQGNRSPLSVSSTSAPFSGSSALQGGVTSSNMVRSVPTQRK
                     TSVPNAVDSDDEFNF"
     gene            complement(<47718..>48209)
                     /locus_tag="LDBPK_190180"
                     /db_xref="GeneID:13386009"
     mRNA            complement(<47718..>48209)
                     /locus_tag="LDBPK_190180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860149.1"
                     /db_xref="GeneID:13386009"
     CDS             complement(47718..48209)
                     /locus_tag="LDBPK_190180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860197.1"
                     /db_xref="GeneID:13386009"
                     /db_xref="GOA:E9BE14"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR013729"
                     /db_xref="UniProtKB/TrEMBL:E9BE14"
                     /translation="MPRGAIPTGQDWEEQRFNFQQRGGGGSAQPRKVTERDANRAVQS
                     GQNVQVQRKEHQRFNQQAVSAGANAKKLDEDNETLKVKKVDPHLRVRIMKERQALNWS
                     QQDLAQRISERVSVVAEYESGKAVQEERVIVKMEKALGVHLRGAKAGEPMGKTRPTPK
                     PQE"
     gap             51310..51825
                     /estimated_length=516
     gene            complement(<51827..>52135)
                     /locus_tag="LDBPK_190190"
                     /db_xref="GeneID:13386010"
     mRNA            complement(<51827..>52135)
                     /locus_tag="LDBPK_190190"
                     /product="ADP,ATP carrier protein 1, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003860150.1"
                     /db_xref="GeneID:13386010"
     CDS             complement(<51827..52135)
                     /locus_tag="LDBPK_190190"
                     /codon_start=1
                     /product="ADP,ATP carrier protein 1, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003860198.1"
                     /db_xref="GeneID:13386010"
                     /db_xref="GOA:E9BE15"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BE15"
                     /translation="MSANNNSAAAPRKARQDMPKLGFWEEFMISGVAAGAAKTAAAPI
                     ERVKLLVQNQGEMIKQGTLDRPYSGVMNCLTRTVKTEGLYALWRGNLSNVIRYFPTQA
                     L"
     gap             56973..57071
                     /estimated_length=99
     gene            complement(<57225..>58178)
                     /locus_tag="LDBPK_190200"
                     /db_xref="GeneID:13386011"
     mRNA            complement(<57225..>58178)
                     /locus_tag="LDBPK_190200"
                     /product="ADP,ATP carrier protein 1, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003860151.1"
                     /db_xref="GeneID:13386011"
     CDS             complement(57225..58178)
                     /locus_tag="LDBPK_190200"
                     /codon_start=1
                     /product="ADP,ATP carrier protein 1, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003860199.1"
                     /db_xref="GeneID:13386011"
                     /db_xref="GOA:E9BE16"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BE16"
                     /translation="MSANNNSAAAPRKARQDMPKLGFWEEFMISGVAAGAAKTAAAPI
                     ERVKLLVQNQGEMIKQGTLDRPYSGVMNCLTRTVKTEGLYALWRGNLSNVIRYFPTQA
                     LNFAFKDQFKRMFNYKKDRDGYMKWFMGNMASGGLAGAVSLCFVYSLDYVRTRLANDT
                     KSAKKGGERQYSGMVDCYIKTFKTDGLVGLYRGFCVSCVGIVAYRGFYFGLYDTLQPM
                     LPVDNFIVNFMLGWIVTIVSGLISYPLDTVRRRMMMTSGTGKNYRNSFECFMQCVKNE
                     GAASLFRGAGANILRGVAGALVLSGVDAIKPYYISARAAKN"
     gap             58857..58955
                     /estimated_length=99
     gap             59647..59745
                     /estimated_length=99
     gene            complement(<60210..>62438)
                     /locus_tag="LDBPK_190210"
                     /db_xref="GeneID:13386012"
     mRNA            complement(<60210..>62438)
                     /locus_tag="LDBPK_190210"
                     /product="polyprenyl synthase, putative"
                     /transcript_id="XM_003860152.1"
                     /db_xref="GeneID:13386012"
     CDS             complement(60210..62438)
                     /locus_tag="LDBPK_190210"
                     /codon_start=1
                     /product="polyprenyl synthase, putative"
                     /protein_id="XP_003860200.1"
                     /db_xref="GeneID:13386012"
                     /db_xref="GOA:E9BE17"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR010791"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="InterPro:IPR023374"
                     /db_xref="UniProtKB/TrEMBL:E9BE17"
                     /translation="MSEDWPQHFPPRGTVPDAEVYDQLISASTLQWWYANAHLTVKGE
                     DDSSLAFFASFFRQAGDNCPTATTKYYDACVWALIDLENMKCYADSALDPESIDQLKL
                     RLDPAVMGRKLEHVEVALLELLNKGRVPRPDRLLKGKAVYTQQPFSIALDDSCVMRIA
                     QEGSARRYTFSMTNAADEVYVEVCLETQQQPVLHGKDGRVNGMYYYYFPSMSVTGYVV
                     VKGVKREVTGLGWYDRELGGSTSEVDKEAKYSWSWLSLHASNMSQLSIFHIAGNNESE
                     AGERAAVETRADGSRHYHDDVIIETNKTWSSLVTFMQYPSEFRLCSASMGLDVTMHTA
                     FAAQEIGTVLVGGAGFYEGVVEGSGVCGGDAVTLRGFFEHKKKTSPYNNTSELLKYVG
                     SYVHGALEEIYPLTASDSWVSENVLGRYAMNRGAPADKICETLFRPVRSIIDRGGKSW
                     RSLILVSCCNALSRQYFDCRRYIAVAELLHVGSLIIDDIQDNSVVRRGGKCVHVEYGV
                     PTAINAGSACYFMGPRAARIQDLPPEKASRIYQLYFDVLLAGHAGQGLDIYRLDYLMP
                     KVVESGDASTLFDALDAIHTYKTGGAVGALCSMACVLCEAPTVLSEAVERFGLALGLA
                     FQIVDDALNIRGFEGNLKEEAEDIKDGKITYPIAIAMGRLEAVDRQTLWAILRKPTKE
                     AADILQAVELIMKVDATSECFLIARHRLQEMWNALDPLLEDSFPKLLMRTFCSFLVER
                     TY"
     gene            <69989..>71950
                     /locus_tag="LDBPK_190220"
                     /db_xref="GeneID:13386013"
     mRNA            <69989..>71950
                     /locus_tag="LDBPK_190220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860153.1"
                     /db_xref="GeneID:13386013"
     CDS             69989..71950
                     /locus_tag="LDBPK_190220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860201.1"
                     /db_xref="GeneID:13386013"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:E9BE18"
                     /translation="MDNAPGLYAEKPSSTYCEEKYPNKMEEVGSLKPPTYDVPHGRSD
                     NIKTPEFNTSLGKFDQAPYFTGGPPAMRYHGYKRDPAGEGVDYRDVLPKTPIEDHHPH
                     MEFLSVTGRREGSTFLLANAGVNWELKAAAMSLYRTILKSLPMIKHYYWLLVPLPEMK
                     DKIRLRFLQNQHTKDPDAIRHLLHNGWMEFQESIMFRRPRATIEKYFEHESMDELSKQ
                     YTKEEGLMSSEREFWNGEEQRREGPHNGHWSWLGEQCEKEFTKIAGRIPISWTASRGY
                     FEKGQADGTNYWEKNLDYEGWYIKNVDPDRQNARREMQGWVESGYNQPKHYASKNRRG
                     YRRMVKDIETLMETSMEDLYTHNREQLFQYLIRESSPESNRINAERTLAYQDDDFYST
                     RFEEYEKCLKQAMREMPNPRLWKTDAFYFRLRYLLAPLEYNWAKLPVGATQEKLFNEW
                     ISDNCNYAIYTSDVFTQIKADKTRNPMAKTWADFYTEFDPDVPETRNLPWYHRDFDYD
                     RRHKWDERCMRMKRWVQSGTIDGKHAYFDSIVAEWEQYVNRPERFRAPDSAERRYAAP
                     RMVQLYRALNRVMDVALADQMRQTIEKGRDLSKMSVEDVQRRLAAADFTNFRFEVPVI
                     IYPDGAAQPQLGLNGCSVATAAASATAAA"
     gene            <73629..>75647
                     /locus_tag="LDBPK_190230"
                     /db_xref="GeneID:13386014"
     mRNA            <73629..>75647
                     /locus_tag="LDBPK_190230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860154.1"
                     /db_xref="GeneID:13386014"
     CDS             73629..75647
                     /locus_tag="LDBPK_190230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860202.1"
                     /db_xref="GeneID:13386014"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="UniProtKB/TrEMBL:E9BE19"
                     /translation="MVKVKASKSKRMSSKQRHKIDRKKREHKRDLKKAAKALKKTGMA
                     PKRSKKSRDMAKLALQVSNRHPDKEQILSHVLQARETARVMKAERRARKGTDAETDGG
                     EENQTVRVGACASNRRQLLYISAKDSNHFRVQFNRALTELIFPAAATAEVSADAPTLE
                     LPAAAYVVTLDARFAVQSMPWTLLDAIIDQAADYTGGRKVLLLFTLTKADVVSAPAMV
                     SQLALVAFALQQRYPKGLGANIVATVTPFSVHSERTQRQFLRVLNQFRQNEGCSSKKM
                     ASNLTGKICAFVIGLPNTGRRTLCRTLSREANESGVSTVPLRAAQLQLIRSGLTEEEE
                     KVHTKFAMPNAKAVTLVQLPEDAGMMKELHAPVGGDVLFRSLAFVERAPEPEAMGCVL
                     FDGVADKTTMAQAFCVPAVGGAEGDEKKPLKVAEKFLRELGRAVRRDGGFHVSPLFAS
                     DAGTMGKVTSSGLTGHGGFNSGQQCSQSTLLNVTYSNATPSKLVHISTVMKKGKGKAS
                     RYQKVSRADAHNALRLGARTFLREMSEGRHVPWAVMRAPGDVTLTPAQVGAASEIFSV
                     AAAEGKRLAGTDELKGTDHLNALVDVLATAVRDIAVILPNGVVEMSPDFLTPPQYKLE
                     KDEATVEETDEDDVEEAAGEQGGSDAEESCEEAAEGSEEIDLEDDEES"
     gene            <77361..>79988
                     /locus_tag="LDBPK_190240"
                     /db_xref="GeneID:13386015"
     mRNA            <77361..>79988
                     /locus_tag="LDBPK_190240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860155.1"
                     /db_xref="GeneID:13386015"
     CDS             77361..79988
                     /locus_tag="LDBPK_190240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860203.1"
                     /db_xref="GeneID:13386015"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BE20"
                     /translation="MFHSEAKYGPRLHMYLCHVSSHDEVHPADALRAQDGYSCGWVSR
                     KHASYPQEMGFRFDGIVLANTLRILANENKISSCMVVYVAEPTAQEEQDGVCGPYSKA
                     AFKRLGHVSFSNNAASNYQARELKTVGLQRCCTYLKLVLRNPHPNGYNIFQQVGVVAL
                     AVYGNLLKKLRDWIDTPLAIHVGECATVPLDEMMPPTHNEYTPGTPARVTGKLVTRIS
                     ELAAMKQKAVEEEDFDAAEALRQQIITIENGEREVAQLELEKQRAVALENYKLAKELK
                     LRIETLRVENEKIAAAPPKTAPSAMAATDAFPSPPQHRSPTVGASGSAAAQEKGNDTA
                     SSRPVQGGWNAHDEVVVGGKGYYDLSDATGGLTGKQPSARNGADEDEVPLSGDGAAWE
                     VALNTAIKRVSTAPAGPSPLTGDAAAAAKPYTKDLGVYCVACLFSRKGQQREAALRGA
                     VSSDGCQALASHSIAAWTQLVLYMSVKGYGVGDQVAGAAIAACNALTKIVQGKLPGAS
                     ANQVAESVTKVLPELTARLGESNARVQESVEKTVVAVARSPLGHRRIVELLLVDPDKQ
                     NKKPASVRAHVSRINILSTFVDEFGLARNAPDGLDTHSLCSMVLLPSLQHFNADVRLA
                     AVDLLAKLLFLDPSSTSGYLEDIKPVQQALIEEQLEQYKQSQLAAGSIARKVSDMQVD
                     TVAVQSRGRGSPVSPQAQPQRSSAPRAREASAAAAEEADPRVHTAPLLQQAPALIGAI
                     EYRRLRTCQFCGEYNSSFNEHNLDLHYVSACPMLCPCPLCDQVTEICQLQQHLVTECE
                     KRRLVRECPRCHEAVRATEYNEHLAAKKCIEAVPTYSVCPLCHERFKNSIDEWRHHLA
                     SSPGCPNNPRCYDGSGLAM"
     gene            <82460..>84985
                     /locus_tag="LDBPK_190250"
                     /db_xref="GeneID:13386016"
     mRNA            <82460..>84985
                     /locus_tag="LDBPK_190250"
                     /product="C-terminal motor kinesin, putative"
                     /transcript_id="XM_003860156.1"
                     /db_xref="GeneID:13386016"
     CDS             82460..84985
                     /locus_tag="LDBPK_190250"
                     /codon_start=1
                     /product="C-terminal motor kinesin, putative"
                     /protein_id="XP_003860204.1"
                     /db_xref="GeneID:13386016"
                     /db_xref="GOA:E9BE21"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BE21"
                     /translation="MSLSPSRGGPQAAGTTAVETEVQELLSRELSSRNADGDPDATAL
                     LVEHIRRGNGGAVLEGIRQNFKYNPPATQICMVTVMDQCLMHSGPQFAVMLSSEKWTD
                     RLFKVAKTTTANEVREKIICTVIKWYQRYHTSGHQRLMQRFQQSRVLGEPFQRIFTRM
                     VKDQQQPRSTKAPQRDFTTLNAANRNEILDTEETILLECQGDLASLEYALEHPQILPD
                     TEIANECKEHKLVCMRMLESGQHERIATELMSLIERFSEALSLFEAMTGIDVGEGDAA
                     KRRAMADKDLEETDSDDDDEQRLLRQRRRGVKRADATAVMMQAQQETENLVNRERTEA
                     LQLRAQLEELRQKHEELQNKYKDAKAKNKEAVGMLEQYAQRVEMLETGANGANSHLSP
                     LPVLGATSLGALGSAAGKGSMSPALTANMRSFLAAVRKSLREIKEVYCTDLSQQGRYY
                     SAQISNAMAAMIQASDMDREADRKALQWTQELYRREVKLRKQYYNTIQELKGNIRVYC
                     RVRPMLPKEIEGGYSDVMSYPTQDEVRFIDASGRPKLFEFDEVYPPTAPQARVFEDTA
                     PLIDSVVDGFNVCIFAYGQTGSGKTFTMNGTEGENKGINTRALERLFEIIEERKETEA
                     STVTVSVLEIYCEQIRDLLATKKEAAGLTYEVKQGGPYGTYVTNLKEVPVTSAGDIDG
                     IMATAQTHRSEGMTNMNEHSSRSHMLLYIIVRTTNKQTNMQGYGKLSLIDLAGSERVD
                     KSGAEGQRLKEAVAINKSLSALGDVIAGLAQNSKHVPFRNSALTFLLQDSMAGQAKVL
                     MFVCVSPASYNASESSSSLLFASRARGVAFGQIKKNATTEKVS"
     gene            <92650..>95532
                     /locus_tag="LDBPK_190260"
                     /db_xref="GeneID:13386017"
     mRNA            <92650..>95532
                     /locus_tag="LDBPK_190260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860157.1"
                     /db_xref="GeneID:13386017"
     CDS             92650..95532
                     /locus_tag="LDBPK_190260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860205.1"
                     /db_xref="GeneID:13386017"
                     /db_xref="UniProtKB/TrEMBL:E9BE22"
                     /translation="METNRPPSTAKWVSRRTLDSQANNRENNAGLTHPRGSNSDKNPN
                     SANHHHGAEKRRYGHAPDAVIAAIGRGSGSGNAGGAAAADNSPSAPFHTNGGCGNNRF
                     GISGSGHGGGWGSNAPNSHATNNELNHQGNTFATNTVNAHGPHSNGNNNANGGSRRGY
                     GAGGGYGEATEPTIPPPPRSVQMGQGALAAQAAAATSRDFIPQPRHAKANSSASSHSL
                     KSMEASPPPPGAVPSVPPATHSPSSTPALRWGFNATPTPRSANGGAATPNAPPLAYTA
                     ASHFDALAGLLAPKSATPSPLASAADGGGPEATVAAQAPPPFTAAPLAFTTTVPSVNA
                     SLASTAPGAGAPAPLRSFAATSAVNVEPSPLDSFHIGENLSFGASAFGGSLHSQPSEI
                     ETLLGQVERSAGTLPAGAAGERVIGGSLRERRSVTDWGIEEAIRTVLPGMDEDESSDN
                     MQGPNFSGGIAAITGNWHTSGDVEAQPVASGGVSGLLADFPTSFAASFSEPASTLLQS
                     PFAADAASNTMDNLSRAFSTAARVDSCSFTTSPATTTATPLQRPPTSPGVRLPNRVTP
                     VESMSMPPSMRDLAHPGGNPYTAPTATQPPPPRSAKSEVSARVEDLPGAGQGGSSEFF
                     NLYTLPPPATTSPWLSSGIGESAAPMAPVNRTSDSMTAKLPGHRSPRTTAARPERLQA
                     IPLKEGSMNSNGGLTTTTGSTTSPALAAARQSSTSSHGGSAPNTPSLRKELSTPLSGS
                     RSQPYTPGGSRPQRPSLSAPLVNRHTITHIFRETPQSLRRRERMEHNHYHSDQALCKD
                     FHWPPHDEADAEHMLRERNATKLLRHLTIISFSRQHVSGVQELFDTWAKNGIPAPDMG
                     FGAYYFYVKEKSEKLLCMKHNGRGASPGHGYGRCDFESRRPYSTCRYEHVCLFCRSKE
                     HGWFEEGKCQGYQQLLTEMEELGVTEEDVVTLLNAMERPAKPTRSR"
     gene            <98963..>100858
                     /locus_tag="LDBPK_190270"
                     /db_xref="GeneID:13386018"
     mRNA            <98963..>100858
                     /locus_tag="LDBPK_190270"
                     /product="sarcoplasmic reticulum glycoprotein, putative"
                     /transcript_id="XM_003860158.1"
                     /db_xref="GeneID:13386018"
     CDS             98963..100858
                     /locus_tag="LDBPK_190270"
                     /codon_start=1
                     /product="sarcoplasmic reticulum glycoprotein, putative"
                     /protein_id="XP_003860206.1"
                     /db_xref="GeneID:13386018"
                     /db_xref="GOA:E9BE23"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BE23"
                     /translation="MSISGAAPPEPLCGRESGGNVPGSMEALIKKLHPLYTQRVQPLE
                     EMYSFDVFRPSWYEETILNERPFISLFGPWSAGKTTFINYLLQSNHLWTGPQPTTAEF
                     TVVMYGKEPGPVAGQALANSKHLPFKGLLDFGESFISNLKGFQAPHALLERVTLIDTP
                     GVLESSKDIHQRKYDYVNVCRWFAERSDLIFVFFDPSKLDAGGELRQLFQTSFKGIEN
                     RLRLVLNKADTISTQELMRVYGSLFWNLSNFINTTEPPRVYVGSFWDKPYSPNSFSRL
                     FAEEKLDLLHELLDVIPQQARDKKIASLIRRAKEVLVHAAIIGGIRADLPVLFGRSKA
                     KKKAAEQLPRRYELIGARYKMNHRDFPPVQAYRSFLERFDVAKFPPLQKAEKAGLIRG
                     IQELIDTILPSMLRPVCNTRAANPFEEDKQTGLLSMYRDHVFLQRDGRSGMQGGTDKV
                     AATMGEGMRDSATTGLSSSVAAAPASGPSSLLGPGTAVTAPSASPSFTESPSLAMAAS
                     STAAAAPSPPPPPSSAAATSSPADMQAMMAIMQQMVAYRQQQQQQDRQSSSAPATVNS
                     HGTLSSSSPQTSGNPVESSVPVTPQESDLNSEPCPPTVVPQPGLSNNCATQVNAWAGE
                     DVPKSQH"
     gene            <102750..>106853
                     /locus_tag="LDBPK_190280"
                     /db_xref="GeneID:13386019"
     mRNA            <102750..>106853
                     /locus_tag="LDBPK_190280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860159.1"
                     /db_xref="GeneID:13386019"
     CDS             102750..106853
                     /locus_tag="LDBPK_190280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860207.1"
                     /db_xref="GeneID:13386019"
                     /db_xref="UniProtKB/TrEMBL:E9BE24"
                     /translation="MCSPHWGHLCAVGFRVRMSLHGGRRVVLQKPHLLLARARQLQDC
                     TMQDSLRIPSKSTQPHSASSAKTLKDSRCMETRKRRPAALFQMWGWSPHLQQTLGATL
                     CSAPLESVAAFRAAVEANMLTGGFCKGAQLIPVAGARGSRAVMPAPFSLGQRTTSVRD
                     GTREGQAAARCPWNTRCRVLQPPSSLRLGCSSTSAAASWVTASASEPMGSPPKLPHPW
                     HAWTEAHTDRPTLRLFGLPASVRAAFLDVPFPSPSTSSSSPTPAALMEAACGAALSQL
                     AGQVQDAVEQGQLAATSRLYFCPLAHAVDYSGTLDLRAFSVEWGRRHCDGGGASAAPR
                     ITAVLSDSCPVLSLGAELPIGDDADPPDAAAGRAASTPPLRVVFFSNAHMLSKRAIRR
                     LLDQWTRNGASVRKLRQQQQRARAGPREWRTLMGSRLLLPLDAAAILPHVRSLSTPFG
                     DVQAVFIGYTASQGPVEGAKVMNPPSDVGKHAPLPLPVLPSSTTPVGFPVRVELAVSA
                     SAHSDLLHVEEPLSAALLRASTLYRRCLDAAQRRELVEAVVQSTVDGAPAGAVFAKRE
                     SQRLSSGRILSETSKVPLTSTQGRLQLHEACEAALSLLSPLEGFLHPHLGTEGTGGNR
                     PARDDDVVSLLVMYPLLSTVRIRHVLLSAFHVRVTPTSTAGDEAPSTVAAAAAAAAVD
                     GPVAAGEMVCVRVGSDSGPAGAATAPPSNPRVRFVASRRRANENEQREFHALLQAAKV
                     RAAAEASVTATPSCVPRAPLLFQAYAAHVEPPVLLGLWTPTLLFRAPTLADMMALRCF
                     LLEPLRASYAASHRTPTDALHRAGFADGGGGGDMIALRVDDVDVIHFDYADGATRHRR
                     THRLFGVRASLCPASAATPPPRTGAGAVGEESLRDASGRNPIARELALLETLLQQCLK
                     ECARTAAFFPLWTEHRRYDDAAPCATTHQSSVAGPMTNHGDGGPAGLNLLPFPFFPSS
                     TNHRPFLDFPGVMESLASWAPRSTELRLLSLAAAQRPSLSLTIRSRVVLLESVYVPES
                     DEVDAPDDDAEKVAARSGRKGPNRVVVRRGQVCEVAGFVPCGLLLGCGAASTASEGAG
                     GSRSRDESATRRMSLPPLVRQQVAGWSLTERRLIEHYMAQQRHASALPLLRCCAASQR
                     SWEDHLRQPGTSLFVLAPRCTVVGGYRSLHYYGLPLLHLPLLILAGDLARSQPSHSAV
                     SPSKLSKTALGSCIASRASASDSDIGVPPALLTATSPSASFDYALPHLFHPHHADPAS
                     CRATLCLTSQERQQALDLLFAQLRSATATVSDGPKAACGNDTSPRSPISFVEDILFSE
                     MPDGTRNGKPADAVTAGDRNSSDAHAVLTPPVCCPLLTELALYSRVR"
     gene            <108390..>109298
                     /locus_tag="LDBPK_190290"
                     /db_xref="GeneID:13386020"
     mRNA            <108390..>109298
                     /locus_tag="LDBPK_190290"
                     /product="RNA binding protein, putative"
                     /transcript_id="XM_003860160.1"
                     /db_xref="GeneID:13386020"
     CDS             108390..109298
                     /locus_tag="LDBPK_190290"
                     /codon_start=1
                     /product="RNA binding protein, putative"
                     /protein_id="XP_003860208.1"
                     /db_xref="GeneID:13386020"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BE25"
                     /translation="MGPYHGNGMMAPAMSANEPMQVVYNRTQKRVPVFRDSLIMYEQQ
                     MVRVMEELRTLTMDVNALRAHYEEALQEKLYIENLAAQAEKRVQDVKEIVDRYVGVKD
                     AVVASDGFTYERETISSYIEGCKEAGGTPTSYQTEKPLTSLLIPNRSLKTLVDRLATL
                     QKAEPTPPAPADRNPVQHHSKSMTAGRAGNVSINQHEGQRRNMHGGGKDSSGPVELNA
                     KGERVHPCIRVYGYCNYNESCAYAKYPYDACLSNLKNKCRFKNQCHERHVEFRGPLDD
                     YGNCASTNQGPNQEIIASEPVGEANK"
     gap             111070..111168
                     /estimated_length=99
     gap             112362..112488
                     /estimated_length=127
     gene            <114678..>115856
                     /locus_tag="LDBPK_190300"
                     /db_xref="GeneID:13386021"
     mRNA            <114678..>115856
                     /locus_tag="LDBPK_190300"
                     /product="RNA binding protein"
                     /transcript_id="XM_003860161.1"
                     /db_xref="GeneID:13386021"
     CDS             114678..115856
                     /locus_tag="LDBPK_190300"
                     /codon_start=1
                     /product="RNA binding protein"
                     /protein_id="XP_003860209.1"
                     /db_xref="GeneID:13386021"
                     /db_xref="GOA:E9BE26"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BE26"
                     /translation="MNAMSPFYGRTYPTRTTPLMWEATQTLQSSLVDQSSDMRRSLDL
                     AMSLHEVLERNREIYNNIIAERNEAYRRLQDADAKLQQVEHVVRRYAEVKDPVVASDG
                     YTYERTELSRYLSDCKKSNSKAYSQQTKEELTDVMVDNVSLRRLAELLKGVHSVEVPQ
                     LSSRPLLAGGVVDVNGPRSHWAEEDPSMSGADHTEMGHGPVGLAGGAGGRGGNGMAVG
                     LGHAGLRYDRSGGAKYGKPSNGNEGKGGLHPCLRVYGFCNFEDDCTFANYPYEACLNH
                     IKGKCRFGSTCKELHVDPRDPVYQNTRSFANHHHQGGNSANTNHAHNNAAACANNANS
                     SQAADVGAEASRQSGSKMPDSVAEREAEIAAAKKDGKSKETEEPASAAGADAAKAKDE
                     "
     gap             116456..116947
                     /estimated_length=492
     gene            <118803..>119561
                     /locus_tag="LDBPK_190310"
                     /db_xref="GeneID:13386022"
     mRNA            <118803..>119561
                     /locus_tag="LDBPK_190310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003860162.1"
                     /db_xref="GeneID:13386022"
     CDS             118803..119561
                     /locus_tag="LDBPK_190310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003860210.1"
                     /db_xref="GeneID:13386022"
                     /db_xref="GOA:E9BE27"
                     /db_xref="InterPro:IPR001727"
                     /db_xref="UniProtKB/TrEMBL:E9BE27"
                     /translation="MEIHKSTNLLDGFLSSLSMILVSEIGDKTFFIACLMAMRHPKLT
                     VYIGALGALAAMTILSALMGVVVPNLLSVQVTQVLAVVLFMVFGCKILYDELIRKKAD
                     DEESEDEMTEAAAALRRRDPNDPAETGSMASSAYVSAPARRWRKLLNPVMVEAFTLTF
                     VAEWGDRSQLATIALAAAKNPYGVTVGGILGHALCTGGAVVCGNLIAQRVSMKTVNIV
                     GGVLFIMFGLVTLYELTYGEHEISKTHERPARTE"
     gap             120534..120632
                     /estimated_length=99
     gap             121402..121500
                     /estimated_length=99
     gene            <122897..>124918
                     /locus_tag="LDBPK_190320"
                     /db_xref="GeneID:13386023"
     mRNA            <122897..>124918
                     /locus_tag="LDBPK_190320"
                     /product="intraflagellar transport protein component,
                     putative"
                     /transcript_id="XM_003860163.1"
                     /db_xref="GeneID:13386023"
     CDS             122897..124918
                     /locus_tag="LDBPK_190320"
                     /codon_start=1
                     /product="intraflagellar transport protein component,
                     putative"
                     /protein_id="XP_003860211.1"
                     /db_xref="GeneID:13386023"
                     /db_xref="GOA:E9BE28"
                     /db_xref="InterPro:IPR019196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:E9BE28"
                     /translation="MAEVASPYRGRVKEMWSAPTADVESEAAAAAAAPPPTQQRKVCF
                     NVCRQEPYHPSKGYRHLARKLRQGGTVEINKEDITLDRLSTSDIVLFPAPQTPFSEED
                     LTVIRQYVEGGGSAMILLGDGHGGQYSYLNKTLDDWTGITINEDCVVRTVLHRYLHPK
                     EVCVTNGITNRAINKAAGKKVFGAVGGSTSSGFGGGTGSIGAKGVTTMGIGSTLMTLN
                     RTVGAGQATNAARLAQSATAGSAAAIAVDEAEQEATSLVFVYPYGLTFNVQRPAIPLL
                     SSGFMAYPLNRPIAAAWECPKVAEHLGRRKQGKLLIIGSAQLFDDAWIEKEENSTLAS
                     ILFDYLDHKLKLNQIDADEPDITDYHHLPDTASLSERLRVAVEQHEELPRDFTQLFEL
                     DSFKIDTDKIPDVVDTYSKLSVKVEPLTLIPPEFQTPLPPVKPAVFEAIHRDPPPPGL
                     DLFDLDEEFAPERVRLSQLTNKCKADDVEYYILQAAEVMGVTKKLRSPRNRDPRALLD
                     YVFRQVVEYKKVNSGPVAPQEARHGDAASRVAAADNAAAAAAAENMMRVIRVSNDGTG
                     DATPFDENPLWNLYLEADFAKGTIEGNLQLLQDSSRFGAQEARIEGDIKPPGEREYPM
                     EWGVVLDAADGEQIIYVFLGMIQGNQLRGVCEQGGGGNTRNFLYTLEEL"
     gene            <127024..>128808
                     /locus_tag="LDBPK_190330"
                     /db_xref="GeneID:13386024"
     mRNA            <127024..>128808
                     /locus_tag="LDBPK_190330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860164.1"
                     /db_xref="GeneID:13386024"
     CDS             127024..128808
                     /locus_tag="LDBPK_190330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860212.1"
                     /db_xref="GeneID:13386024"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BE29"
                     /translation="MKKQIKWKAHKGVVLCADWSRMSGMIVTGGEDGAYKVWDPCGCS
                     IFVSAAGEHPITSVRFAADGESFAVGSFMNVRVCDKTGWSHSYERTTEGSAMALDWMP
                     DGTQMILGNGTGALSIAQIVDRKVSWGPYTVTLLDSRRLTVQDVVKDTVQEIELADKV
                     IKLELGCGYLVVCTTTQCCCYPMDRLNAPVQFDLRDPVISIILGPRQFLLADCSQGLQ
                     VYSYEGRQISVLRLQVTLKPEIMTTNLLSLSPDTVAMRNPADANRILFFDVNSGKPFD
                     AASVAHHLDIVSVHLSQSGSLHDRKIAFIDRNNDLYFGPVHTQLGFHKLSTMTTSVTW
                     HDAHETLAAIADGHLATWYYPSTIFTDRDLLSLTKTVRDGGHTEFTRNDRITHFHHTR
                     VLVRRGGDGALLTLPVSPYTVMIFQLVTQKNNWDGATRLARFLKDPLLWAVLTALALR
                     AGELNVAEIGYGALSDLAKVRYIHYIKGIPTPEARQAELALFQHRPAEAERILLQAGL
                     VYRSIDMNTRLFKWERALEIAKERKTHLDTVLGRRERYLQEVSQKETLAPFKDLSGKI
                     KVDWAVIEEKVKQEVIKESERPNAKPYA"
     gene            <130222..>131598
                     /locus_tag="LDBPK_190340"
                     /db_xref="GeneID:13386025"
     mRNA            <130222..>131598
                     /locus_tag="LDBPK_190340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860165.1"
                     /db_xref="GeneID:13386025"
     CDS             130222..131598
                     /locus_tag="LDBPK_190340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860213.1"
                     /db_xref="GeneID:13386025"
                     /db_xref="UniProtKB/TrEMBL:E9BE30"
                     /translation="MIGGEYKKERFSERLTMAQNQPKNRGYLPGTHLKTGGYGTGTLM
                     GNWSEERFDAGYYDGKAVVASSLRPVWSTAYREMVQNVTAPPGFGASASAAGSSSCAR
                     AGRTPAVTTCDRTQFSQQTFMVIEDRTGRSYPSHQPQLDPTWQEAVQSSHHSTFQSSY
                     IRPDVRRQEAKAYVPPVLGGKPSSQSTGVLLRLRRQLELAQESLDGPAGTCTVVSAFP
                     GNVIRSVRKALAKACTDPNGNVNTDELQEGFAAAGVTAAPAECVALLRYFDHEGHLTA
                     PYVSIVEAVRGEMNGRRADLVESVYGLLRSFSPDGVVRLDKLVEWVDVEQLPAVQSGS
                     VSADAARAAFAAQWDARTPTAHITQARFADFFADASFEIPLDNTFELTLRNIWHMSGG
                     RGNCENTSCRRVEVVHTNGRVTKEEIKNDLLIKNNDDEAALDSLLRANLAMQGIKDVK
                     SVRVVPPI"
     gene            <133832..>135070
                     /locus_tag="LDBPK_190350"
                     /db_xref="GeneID:13386026"
     mRNA            <133832..>135070
                     /locus_tag="LDBPK_190350"
                     /product="lipoic acid synthetase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_003860166.1"
                     /db_xref="GeneID:13386026"
     CDS             133832..135070
                     /locus_tag="LDBPK_190350"
                     /codon_start=1
                     /product="lipoic acid synthetase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_003860214.1"
                     /db_xref="GeneID:13386026"
                     /db_xref="GOA:E9BE31"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:E9BE31"
                     /translation="MCLTAAPSRVSPIAAAAAAAADVAGSSESTVNLMADVDKKDPQY
                     KQIFLERFRKKLQSDKTGMNDLESFVELPEGVAPSAASIGPIKRGSEPLPPWLKLKVP
                     KGMTHRPRFNRIRRSMREKNLSTVCEEAKCPNIGECWGGSDDEGTATATIMVMGSHCT
                     RGCRFCSVLTSRRPPPLDPEEPEKVAAAVHEMGVDYIVMTMVDRDDLPDGGASHVCRC
                     IHTIKEKNPALMLEALVGDFHGDLKLVEQLAVTPLSVYAHNIECVERITPRVRDRRAS
                     YKQSLQTLEHVTKSTNGKMLTKSSIMLGLGEEEKEVRQTLRDLRTAGVSAVTLGQYLQ
                     PSRTRLKVSRYAHPKEFEMWEKEAMDMGFLYCASGPMVRSSYRAGEYYIKSILKQRQS
                     AEGGKATAAATAANAGAAIA"
     gene            <137897..>143473
                     /locus_tag="LDBPK_190360"
                     /db_xref="GeneID:13386027"
     mRNA            <137897..>143473
                     /locus_tag="LDBPK_190360"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860167.1"
                     /db_xref="GeneID:13386027"
     CDS             137897..143473
                     /locus_tag="LDBPK_190360"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860215.1"
                     /db_xref="GeneID:13386027"
                     /db_xref="GOA:E9BE32"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BE32"
                     /translation="MPSSNLVTDAYHNTELAINVFFSIHTDANPVMGRKATKASVVPI
                     AASLLPANAAVMIDDDLTPGVADFGATTEPAVRSPSSVEREAFENSIADIGGGGALSQ
                     SVVSRRDMSLADISRMRLEGCRARHTLFAATTSLRGSMASSLRSTSGSPMLPLTGRVR
                     DHAGICGETTSAAISAVSQAPAWSSLNGLGRSFNRRSSMLSVRTNALDTSIAILQHMA
                     HDTAARAEAACNAQSLAGTPSTATSACGSVALPSLQPTQPYPEDTHAGARGYKVVGSG
                     NTASVEDSCSGSGQHTPVLHTVHTRQFTSASDSSSPLNSLSESELCSGHLRAGGRSHL
                     SAQASATHLTGSGGVAKAASDLQHSSPRSHPDGSPLAARRQTIATADHRAPHHSVAVA
                     ATEVALPSAQNQTTDVSVYNHDFQHLVPLEVKEALQRNMRPICEDDDDDDDDALLHDG
                     LSAPTPPPLTSFANVTHSMYEDTCHLDTPSNYVRTRGTGSVGGAGAAIADAPFSFPPS
                     TLHAPSRLFASPNAPALQTATSSMIAWQTGGTGGAKSIRPFDSDTAETLAAGLSISGT
                     GVPFQAWKFPSLGKPNSASSLRKTSLGENGNAEALPEGAVGGAAAVHQPTVPLSEHCS
                     HPTRETLMPGSPQRQCSESPPLTRNGLQATSKHSTLKTAATPCSSVAVGALSGSGDVG
                     PRAASLLSGVDGTHRTSSVVHGTPMRTNDGAGGRFVQPAVAQGSPSSAAGSLSAAADS
                     SNTRKLEMMYTVYERLLHARPPDNSFPEATPRSLQTLTSRSLTEEVTPPLDTSPSPPA
                     AQQAPQSGAAGAGFEAMSQGDCSPSMSYSGALSRSAGYYSFGKRISLSHPNKQTLPHQ
                     FLGSAANLHAMSSPPRVAMLGTPAVADMIVASNGNSSGSAMAFSSTARARRRSLDLSV
                     LQRIDSRPLLQSTLFLQNNLHSICEAQARFARKERAEDAGSAEQRNAISLSPSKAAVS
                     VAAKPVPQYTVPLEEQSAAGVPSLASVADVETCEGVEGVSQGRMTGRTAIAETASPVV
                     LGSAAASATAASTARELNQTSSSCRGTQVPSVDSVLPSSVSPSIGKRSNASSLPVNCI
                     QEGQGKQEEPLRKQAEMHVNPTAAAAVSVAHESNGISPHRYYRALTEAKCLVRHVHGV
                     DGVEREVDNDSMDLVVYAGMHLMGWLEVVSLLGCGSFGQVFLCKDLRICDGHFVHPSE
                     IEGEDYEYWNCSHAYLPFSSVDAVPTHRPLVAVKVVKSVPLLEQQSVLEAEMLVLIGA
                     QTALPPANAAEEARESATPAFAAATGDRIGVNEPPPADPRCANIAKVLADGICYGHHC
                     IVMERYGANLYEYIAANDHRGLPMYQIRSIGAQLFSALSLVHEECHIIHADIKPENVL
                     LTLDSGRGTLRVTDEPSPITAATAAATPPAEAVSNSNASTTAVATKTPRSVPQQNAFA
                     EAAHRSPSSTSPNAEPPWHQQRTESAASSSASPSLPAESSHTARVGPGAVARQRLGFK
                     GKRRNSNTLLDLSSSPMTLATYKGHSLCHLRSSSASRATIVEQTDMPTPEPRRMHMLS
                     QSSALVTSAASGMSLQSLGGGGAGSYSRHMMQAPAAPVEEAPAVPVAPAASHLHVRLI
                     DFSSSCYDGGPFYQYIQSRYYRAPEVIIGAPYNSAIDVWSTGCLLAELLLGMPLLPGC
                     NDHHQLSLVEEMIEPLPDYLVENGDNADLFYIVAAPGGEGSTDAALPRAPAAAAPGAT
                     ASATLQQPRSFALRTRENYLEVTGSEPLQYRRYFTYQTLQELVRHCPLTLEERRMSNG
                     LHPYVSANESSAIPPDATPSLSVRSDMMKQRYLLFDLLRRLLQTDSKLRPTAAQALQH
                     PFFSSLPPYFKTFALD"
     gene            <149554..>153003
                     /locus_tag="LDBPK_190370"
                     /db_xref="GeneID:13386028"
     mRNA            <149554..>153003
                     /locus_tag="LDBPK_190370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860168.1"
                     /db_xref="GeneID:13386028"
     CDS             149554..153003
                     /locus_tag="LDBPK_190370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860216.1"
                     /db_xref="GeneID:13386028"
                     /db_xref="UniProtKB/TrEMBL:E9BE33"
                     /translation="MPALSSGAVEKRKSPLPVDSVQLAKDSVRHSGSRRGSAASWLHP
                     LSSTEVPVSDLPHNPLFSRHGVQLTNSDDIVVGGGGAGSSSLLSATEISPMQIREASG
                     CKSRLDGSSITSSGKREARSCRGYSRLTGLLTRRGGDGKSRKNVAVSSTSHSTTTCSG
                     GAPQGTVIASPSGAAARNPLQRSGNTSGEADLSEDMRLDDGGCDWPSTPSPKTASVSH
                     RRGSNSPSGAVSVVPWTSAVNSTIQSRSRRELCASPLASQSSRASPHATLRLDGGSAT
                     NGAGLDSSGAQFVPLGSSDLANRNGSPNRLQRSYCSGADDDKTTTSSTLRNRSHRQKL
                     ISASSLSTSASQSLLQLGSTRASQGQTPRNMGDPDASVHVSKNARSLRDAKVALLRRT
                     QHGNVHSLRSSRTHSFRRSQSNASTGGGDPLSQRATKIRPSSREKRSTNSTAGALAGG
                     GRVGSAHSIAAVDDDVVRISVPPADLNSPLRHWDMDFPLAAAVPDMGSGKSEHNISAS
                     GAQRRFSRPEDNPLLEVMETSSCASQGWCEAGNGAPWCPSTAEQATRSRIAAAASSLS
                     KSMDRRTTALSRGGSPFQRSSSTRRGTFYPPRMPSGFYSLSPNGGYSSSTDSEEEIRL
                     RERHRNRVDEVLRQLNAPMRSTTVDDRLAAASMRNNSSYPSARDASVGADASQVDNNN
                     SSAWAGIGGLDWGGGLVAFCASATGGANANMSTTVNANGGDGGGWLGVGGAATTEDWY
                     TRMRKKLEEEKAEAAAAAVIASDANFTSAAPPSESAPTDTPAATSRIHNKDSTQSEMH
                     MPAIDRNTTCKGPLPLLRSTRSSRASSAAPSHSSLPPGAPQAAPPMLNQTFKPKTSPA
                     VSSVGERVVRRLQPGIPMRMQLSHTCAALGSADGGAATAHPRPPGASGAEEDSAAARS
                     PSKRLSLKTTAVTVPASAVQTADSPRAAPLPELEVIEPRHRLSALDPDDGSVSSMGGT
                     STVAPLMSSASRQPSESLIPMPSRNASMVDPSHSQSDLRRHGSLPRIVPRVSMTVLKP
                     SPPRQHPHSTIATSAPSRVHNGVRLTLVPSSVAAQSSGGTSATLTREGSVSGIGATTR
                     DSACTGADGNGGLRCNPSAPAPRQGTTARKQPTAGARSTENPASSSGAPAAILASARL
                     TDS"
     gene            <157020..>163076
                     /locus_tag="LDBPK_190380"
                     /db_xref="GeneID:13386029"
     mRNA            <157020..>163076
                     /locus_tag="LDBPK_190380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860169.1"
                     /db_xref="GeneID:13386029"
     CDS             157020..163076
                     /locus_tag="LDBPK_190380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860217.1"
                     /db_xref="GeneID:13386029"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BE34"
                     /translation="MPGSSAPWSVSGRCPSVQSFQSRATSHSTTVARGRTGSLSSQPA
                     AALSSPRLSSFSHLRPLPSSKEADYLNLAHQRSFIGRFRCATPVVIRTPAAATSHELA
                     ALSTIDGSTPSHVRNGKTHEETAAASVCVAAAAAGATAEGGRTSPSAAADGCAQGVET
                     EAQHAVDVPSLHAVAAGHPSSLTAPGRSPRQLGRRVSGSGASMASSGTAGPGAGRGRP
                     LSLLNGARPRGLVPSSSASALVRSTGATASAGLQRRSFAAHCGLLAANMEPLVKSGLH
                     TSLWLAQQDGGLEVRSMANPNQVLASLPRRDPRAVITSLTEVCGSRVVAGYTDGTLCV
                     YDAVTMKLTAEHRAHTAAVTCLLHVQGAPRFSLHTGADAETHGKHGSTPTQSLLLTGS
                     LDRSIAVWEAASMSYLHKLKGNLRSIGALAATATGGYAFSGSDDGTLRMWDAVQGDQL
                     AITKEERANAVKRVSEMDVAAAAPLLQRLVVASTAAPAAAGHASISVSFHGLHRGETE
                     AATGREVRAGKSAVPSPRVFQRPSLTSVPASTSGFAAVGPPRLSTPPAVADGRHHRFR
                     EGHSAIKKSSLGRRAGAHIVPVAMRGARLLAKAANGGGRVSSLSASPLMPSAEVGPFE
                     PTETGMTSSAYREGSVLVDPEGGMSPLRGGLEQEAELEDKDDERAMIGSAAVAGGRYR
                     DAGRRSFATSRTPRSLKRGLKKRAKGLLAKRGAGVASSNSGRAATKTKAKSASAAPAA
                     GMWARHKKGAQKRTTKSATLEAESTPVRTRWLASSLEQRLESWLRLYQQRVLLSAASM
                     QLTQRISAGYDAVTAFNWPIECAHTECVTALAVVEDRLLVSASRDATAKVFALPSGQY
                     VRALDSSRRMPLSSVLYDASVGRLYTAFLDGGLAVYDTHGTELPLLSQMQSPYAILSS
                     TFVQLRMTPMRRFVWMAVVRGEEAPGTSLNGSVGLSSVVMGAAQFDRTTMAHGPNQTA
                     TSYRVGQPSLRELNAAVSLQPLQQQRARNLAKQARQAANDMLEEMELSDMRRCGLVLE
                     REYVRRQSYCVFARWRQWAQRRALRSDSKGAIAARAESCAMTLLGRYTQRWLNWTRAR
                     KRTSASEVLRKVQLQASEVVLLAVCSEVREGRRRVWALVADAMGRQQQITRLACAYSR
                     WREFLRARQVRLRQCVSFNKLLLSMNASSHTPASCTLAQLTRKATRVATQSTALWLLT
                     EKTQSSQAHARRRRCFDLWRVCARQRRRVAASAAADREWAVVEPLSSSLVQPWKLRRR
                     YFALWQNFALYVTRSERLASERDTLGVEWATLQKTLEKPMSVRKLEEKLSAAESSMAA
                     AGAEAKLLEARLEIVLSEVAVLRTEAVLNMLIAGYRIPNVVQAATPLPPSTASAVTEV
                     SSMASLRRGSLASSASTGLSNGGVFSGAVACSYPPSITDADWTEEERAQRQEEDKVLF
                     EVSAVLRALKGKAMQYDRDDKLLSTAHTLALRLPIYEPAHRAQASLESSTGRHLCLLA
                     QQPRTPRMLSAWSVSNAKSGGSTAVPALSSSSQQQQQQKHRPNRFAAGSAGSATPSSA
                     TVALPTTSATARSVASAAQMWAAQPAEETYACLADAFTAVYANLSALLRAAALECGAP
                     TRMVAGTTGATTGDDSTAHVGASWITQVPLKQRRVMIGEVLKLVTLFDSFTAHNDLPV
                     ECAGSMSKRGSTNTRAMPLCSLCSRDTATALLENASVLLELVDPHLWPRQIKLNHLQD
                     AYAAAIADLNAAVSSAGFSDAAPHSSTVMTLNSAGSGEQGGSPAPTPLVMRPPALRLS
                     DEVLQEARAAMLQHDTTTLAITNPFGPLSVERRTNRSASSVHSGLMQATPLSSADGYA
                     PARVHSSEEPLNTSKSLEGGNATPTAEPQHLRHRSTSHHSCLGVSTSRSYTPRTATLS
                     VAGAMLNGMLVKPYLGFRVNVNRDTQTLRRTTISIREVTPQYVNAEGEDVDGPAQVAG
                     LQVGDQLVRFAGYAVTDLAAFNAVVSRHVHAGAELPVVILRSGEQLCKTIVVGSRAAA
                     DA"
     gene            <166114..>166956
                     /locus_tag="LDBPK_190400"
                     /db_xref="GeneID:13386030"
     mRNA            <166114..>166956
                     /locus_tag="LDBPK_190400"
                     /product="synaptobrevin-type transport protein, putative"
                     /transcript_id="XM_003860170.1"
                     /db_xref="GeneID:13386030"
     CDS             166114..166956
                     /locus_tag="LDBPK_190400"
                     /codon_start=1
                     /product="synaptobrevin-type transport protein, putative"
                     /protein_id="XP_003860218.1"
                     /db_xref="GeneID:13386030"
                     /db_xref="GOA:E9BE35"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:E9BE35"
                     /translation="MAANGCFIAALIARTHDRLPLCSYTDDNYSNANVIRQQEQRIVE
                     RMESPAGGTDRAAAKGSYYESFDHKDNVYFAFQDAATDLTLVVAVNKLLLRNSGDING
                     MNKLACGLLDLIFSEFIQMYTPAEIGAPNVRAYQFIKFDATLRKCVTRIMQQDRTTGD
                     RIVVGSGTSGGSSGSGAGAGPSGGGVGATGMIRRQVNPQYDALRQEITDVHMVMRKNL
                     EDLMTRGEGLDTMTNYSAELVDQSSRYYKKTVQMNRMRLLKTYGPPAAIGLFLIVFFY
                     LYFF"
     gene            <168194..>168568
                     /locus_tag="LDBPK_190410"
                     /db_xref="GeneID:13386031"
     mRNA            <168194..>168568
                     /locus_tag="LDBPK_190410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860171.1"
                     /db_xref="GeneID:13386031"
     CDS             168194..168568
                     /locus_tag="LDBPK_190410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860219.1"
                     /db_xref="GeneID:13386031"
                     /db_xref="InterPro:IPR008012"
                     /db_xref="UniProtKB/TrEMBL:E9BE36"
                     /translation="MTSDISLPRPQAREERLMHPVEFIQRSARRQEEALRMHNIRTTH
                     GLGAATEVALTEVTLLGSRRLGAMPTSNTLYNAYRGNFTELAPCDLYGLPENDPNVQP
                     TPRALVEKQFHGHELTMKTLGL"
     gene            <169993..>170448
                     /locus_tag="LDBPK_190420"
                     /db_xref="GeneID:13386032"
     mRNA            <169993..>170448
                     /locus_tag="LDBPK_190420"
                     /product="RNA polymerase III C11 subunit, putative"
                     /transcript_id="XM_003860172.1"
                     /db_xref="GeneID:13386032"
     CDS             169993..170448
                     /locus_tag="LDBPK_190420"
                     /codon_start=1
                     /product="RNA polymerase III C11 subunit, putative"
                     /protein_id="XP_003860220.1"
                     /db_xref="GeneID:13386032"
                     /db_xref="GOA:E9BE37"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:E9BE37"
                     /translation="MFFCPFCSTLLLVVPHVEGNALACATCRYVHSVASASPQVPRNA
                     FGEPILTIQHSFVSHNRQLMDAEEDPAMEAAASSSAAACHTTAAFAPVGKAETSAEGG
                     QITTIPCQNEDNPCQSTKAYFIQIQMRSADEPATVFFKCVECGHQWRQD"
     gene            <171135..>174944
                     /locus_tag="LDBPK_190430"
                     /db_xref="GeneID:13386033"
     mRNA            <171135..>174944
                     /locus_tag="LDBPK_190430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860173.1"
                     /db_xref="GeneID:13386033"
     CDS             171135..174944
                     /locus_tag="LDBPK_190430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860221.1"
                     /db_xref="GeneID:13386033"
                     /db_xref="UniProtKB/TrEMBL:E9BE38"
                     /translation="MPAVRRLLRLFELDETDGKITALDSYGTNTHVGTSCGQLVRLSI
                     SSLPSTRSRTAASVLVAPEEATAIGATLPSGEAGAAAPASVSTDESAVFTTVTRRCAV
                     SASGAAVQQLQHSRSQNLLFVLCGGRLQLLHADTYAVLSTIATEVSSFSVAPPLPVVG
                     SGASGGVGGDSSVVPMTGAFPSAHTRGRTSRLTVGDDDGANQHSRTTSHLRTPSECSY
                     GSSSARTLQSTLATMPAASPLESTISNGGNLHQHHGNAHHHSRDGRGGAAPLFCSSSS
                     SSGSRAHVVCVAEKQKKELAVYVVDRVSTSASGAVSSVWPSANEPIEDGALGGSAALS
                     NATARSSPPPPRVVLRQRYVLPERAQCVLMCSPAPAMRRGTALPFAASAGALTGDGVP
                     LLAASVEAGLSVCVGMRREVSLLSLIGGSTWCVLRLDGTRPPLLSVGSDHNTFLVRTQ
                     APNTVMEVGVPPAAAMAGCAQDDDAGWRTSAAAAAGANPILLRTGTARGAAIASATTS
                     AAARGSALRSKDDDLVMGDVFQADTVVEFVLARFPHIFLFTAHHCDVVSLLEYGAGVG
                     ATSRSQRVPLPGIRYGALRGQGTSVCVASDRTVWMLQLSPLRVQLAEMVTGGNSEAAF
                     QLLAFHRRRAAAVARNAAAAADADDALRAVESDLHCMAGFAALHRGEVAEGIRYLRNH
                     VDPREVLLALPDCIPPTTATPAAHDLVSGAPVQQAGVDVYVLDHVVTISAEDAYDELL
                     RQSAVSACAEAAAARDTTGTPPSSYWDSWRGPCVYNSFGGNVAEAWRVAFTARSSSST
                     SMGTVEDFVASRFDLLKAEVRAWFAEELLQPVSDAGAIPSAAASPTAATRTSIDRESM
                     ECSGASLPIATTTTSLLPPPTLLVAHRRAMEYASLVLAWEARDYRMAHQVVASVSQAL
                     RVEDCADMLRHLREYRLLAVLQFRTGQGEACLSTLRNMVSVSAVLQLRHGHAAAQTTP
                     VASQLSHWRQCMATLTAQRRCNGVAAPQPTCGCGLLMLPSLAAVARVAHTLFDIEVPF
                     NLARDDSSREALVRGIISYYETHHSRVAPASAAAAEHGEASYCELRFSVCGTHSSSLL
                     SFPHTGPLLSTVVNAAAPAPVPPHAAVQSHCEAATEPGSTAARRTVVRAVPSALTAFF
                     YLVEKLDVVGVKQLLSRHPSLAQLRDEEGGTALHVAMSQLDLVGPARTCDAHLPDSPA
                     PAMSSLQLLCSLNGLLVHFGCPVGLLNRYGWSCLDVAAVACAGNTTAFDIVTAALLAA
                     VEVRAVA"
     gene            <175708..>176760
                     /locus_tag="LDBPK_190440"
                     /db_xref="GeneID:13386034"
     mRNA            <175708..>176760
                     /locus_tag="LDBPK_190440"
                     /product="nucleosome assembly protein, putative"
                     /transcript_id="XM_003860174.1"
                     /db_xref="GeneID:13386034"
     CDS             175708..176760
                     /locus_tag="LDBPK_190440"
                     /codon_start=1
                     /product="nucleosome assembly protein, putative"
                     /protein_id="XP_003860222.1"
                     /db_xref="GeneID:13386034"
                     /db_xref="GOA:E9BE39"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:E9BE39"
                     /translation="MPPKNQRNAPVVIPEEDDEGDMMEMDNMLDFQKYLDSDFSKNFM
                     AGLPEKIRQRAQVLSAYDKDFSAQQKAYKVKEMDILRRYDALFEPLLQRRKEIVTGAA
                     VSDEEVKKGMPEEHVNVISVEVDDTDEAAKAADAFGLEGFWLRVLRHHTVIDSTIEPH
                     DEDVLKHLVDIRSSVAEGEYGSFQVIFTFSPNDFFEEETITATVSIKDDKPELTVSPI
                     TWKPGKNVMMHTVTKKQRAKRTGQVRTTTRDVPQLSFFWLFKKKTEAVGDDDGEEDGE
                     EDDEEQRISMLEVLHTCIVPNAVRYYTGEAPNGFSDVDEEDEEDEEEEEEEEEIIPRG
                     RGGNRGGRGGRGGRGI"
     gene            <178406..>181255
                     /locus_tag="LDBPK_190450"
                     /db_xref="GeneID:13386035"
     mRNA            <178406..>181255
                     /locus_tag="LDBPK_190450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860175.1"
                     /db_xref="GeneID:13386035"
     CDS             178406..181255
                     /locus_tag="LDBPK_190450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860223.1"
                     /db_xref="GeneID:13386035"
                     /db_xref="UniProtKB/TrEMBL:E9BE40"
                     /translation="MSSPPLAYPSSGEFNVLVQRFKLLNLVQRVAHRDVSEMLDTVGL
                     EGLSRQGMLTRWACSGAEGDDGDASIDPKVLGQEGTPRYRFEESRPRASPSTRRVSST
                     ATGRPISPPRMQFGRPASGFDARIAAARWNSGIEEGSSAADSIRRSRTSNRPNAAGEA
                     DAAARLTTKRRRYVVRRTHHVLHRSRSERETFFSRLAEPRQRPGALVEEVLLCDEAVP
                     PAHSRRGDDDARWLRDAADRNASEFAEHDRRGRYGGDTYGGRHGGAFTSASPARVQRR
                     HSLDAYAYHHQDLRAHYYAPLQPSASPPHWAAAGASDARPGEKSAGELDDYEATLPSP
                     TDRLHSQRNVSTDGDPHAVAFTSPPLRSRPAGAAPSSLGGPARMRSMNFASLAQGDAA
                     TASPAEGQRHEDQPTAEAFVRKSPSAPAVFMADDGVVKSPFTGGDVKSFAATAPTVAL
                     PRSGGSGAAAGDAPTVPQLHLPQSRAGGGDGFVLVDAGQGSGSTSGRMVFTDSESLRA
                     AAGNSGSTSTSQVLKSPRAVRGLAPKAKPKGAVEGARVPLEAVRHASALLSRSGSFHP
                     SPTIGSRGGSAYNSYAAATPQLQQLHPSGARTPPTTSGFGGGVPRSPRPHTVTVQAGT
                     AGDVGDDADYDMPKSVTPLTVFRTAASPLGSLPHSGDVAFTASPTGYQVSAATKKSFE
                     ELSSAIDHMLLDHQQLLRQVYKDTHATSCGAARQPDSSPAASRPSERAGKVPASDEAS
                     SHSSSFEVDSEGLVEETAKKARYADGVDTTIGADPVSDGATGDVDVSLHAMSAEVEDE
                     MLLYTQLQHQLTQLDADMVRLGLENANDAAAEGSDGAIGDRAGGASPLGRGAPMLQPS
                     SSTTVTVQQPARPPHARGEVPEAIVQRLCAYRMKNFQYIAYNERLWNTSSISQFVFAQ
                     RLTAALTEECWGEVMAEVGSIMDEYVDGLVDHELQ"
     gap             181374..181385
                     /estimated_length=12
     gene            <183024..>183911
                     /locus_tag="LDBPK_190460"
                     /db_xref="GeneID:13386036"
     mRNA            <183024..>183911
                     /locus_tag="LDBPK_190460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860176.1"
                     /db_xref="GeneID:13386036"
     CDS             183024..183911
                     /locus_tag="LDBPK_190460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860224.1"
                     /db_xref="GeneID:13386036"
                     /db_xref="GOA:E9BE41"
                     /db_xref="InterPro:IPR019309"
                     /db_xref="UniProtKB/TrEMBL:E9BE41"
                     /translation="MATSALPLNSTTALVSANAAAVAEADADAQAVVDLVNRFVISTV
                     QFLNRFSDECESRLVQTEESLQQLELQTQLLEHLLITSGAADPEADEAEEEGGDHSND
                     DDGGTSYLADGDDQDMVRDDGSEASAAYDYRQRRGRGRRGASENGDAESVLGLPAPPP
                     KDRRSGGPPPPPGNYRKGPPRPPPGVARAAAAAQEAEAARVATLAMVGAPVLMPQLSG
                     DAPAPPPPLELRPGRLLMRNHPRLHGYFELLSLRVPATFVKAKMQADGFQGEWLDTPD
                     APAPSGLSAAVRAFVDEPD"
     gene            <184568..>185647
                     /locus_tag="LDBPK_190470"
                     /db_xref="GeneID:13386037"
     mRNA            <184568..>185647
                     /locus_tag="LDBPK_190470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860177.1"
                     /db_xref="GeneID:13386037"
     CDS             184568..185647
                     /locus_tag="LDBPK_190470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860225.1"
                     /db_xref="GeneID:13386037"
                     /db_xref="UniProtKB/TrEMBL:E9BE42"
                     /translation="MSSSSGQYSGSGGNRGSGFVHLNTPASIHYTVGKTLSLSALRQR
                     KSRAECVVLPESMSVWRDAFQRYSKEEGYSSFAADIEDERTGNGPILPPLVPQRAGPV
                     RRRAGKALVRTDAFFCASSSPAPLGTSASAAHTGADRPPLTGGAAATSSTITADSASS
                     SSRLSNNGTTATSADSVADGSTGPTAKQQQDGIPIVSHHKLLGRQQFVYPDYDGVLSA
                     GVVPQIVVTAEEKAEEAAAKAFYISPLTMTEEELAAFEELQGLWKSRARSHSFLGAQH
                     RKAAKGVVDPSSSADVLGAGGAGLPKVPRREGVAGGASLSSRRGNEVDVPAYAEAETA
                     VEEESKLDKELSEALRMADDLLRFA"
     gap             186823..186921
                     /estimated_length=99
     gene            <187107..>187877
                     /locus_tag="LDBPK_190480"
                     /db_xref="GeneID:13386038"
     mRNA            <187107..>187877
                     /locus_tag="LDBPK_190480"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860178.1"
                     /db_xref="GeneID:13386038"
     CDS             187107..187877
                     /locus_tag="LDBPK_190480"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860226.1"
                     /db_xref="GeneID:13386038"
                     /db_xref="UniProtKB/TrEMBL:E9BE43"
                     /translation="MLRFCPLAHAGATTATTTAAVAATAALQLQTRRAYATGARSTAR
                     ERRYYTQPLRTPQYGTSTIVGRQKSDADAAATWSGEASSPVAEEIVTDLHRRLEVGHP
                     RSTTRCRTAHQSPKVQLIDFITSRCRPVRYNDAGVPVEGSLLLLPWREQLRLCTAILA
                     AFYITKAFFEMVRFELLYYGVWKVGYRNDGSLMKRLLYYGSTAMLAAGLLFSFNLSFF
                     LSACVVGRREIALHTLCNVFAYVMPRRLLQPLVRRTVC"
     gene            <192123..>192761
                     /locus_tag="LDBPK_190490"
                     /db_xref="GeneID:13386039"
     mRNA            <192123..>192761
                     /locus_tag="LDBPK_190490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860179.1"
                     /db_xref="GeneID:13386039"
     CDS             192123..192761
                     /locus_tag="LDBPK_190490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860227.1"
                     /db_xref="GeneID:13386039"
                     /db_xref="UniProtKB/TrEMBL:E9BE44"
                     /translation="MLARLNLNRIMTPSAGASLCRARSSLTVSAHQSLRAAQRRCATK
                     AKASTKAEQQATSASGGAAEAKVTSQHPISHGPQRKDWRTHKEIVYVKGVPAKGSLFK
                     LPLAEQLIICLVFSIAGSAAVYLVRPQIRYLCHHGFLGLTDEAGWMNGPWLYRLMYCL
                     IMFPSYSLILFVVGGLFGRRIWFSFMIHKMWSRFLTRNASRRLEHLLDLQHY"
     gene            <193913..>194812
                     /locus_tag="LDBPK_190500"
                     /db_xref="GeneID:13386040"
     mRNA            <193913..>194812
                     /locus_tag="LDBPK_190500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860180.1"
                     /db_xref="GeneID:13386040"
     CDS             193913..194812
                     /locus_tag="LDBPK_190500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860228.1"
                     /db_xref="GeneID:13386040"
                     /db_xref="UniProtKB/TrEMBL:E9BE45"
                     /translation="MEDTINVFGRGTPAGEAIYRCYVAPSKPSTLDPQLAALLARRRQ
                     EREAAEAVQAHPKPIPKSKAPVRRPRVGLGRRPTEEEYARWRLQHIPHRRSKAAIEAE
                     EEAHRWVPQPVSDRFARPAITDAEKDRLADVMAYGAELPKPKEFTGAQRVRLHRLEPR
                     AELEDRFAKLRQTAQEVQSELAQLRQSAPGIVASLPSGGRVAESVLDPQTRLSQRRSC
                     EGGSDSATTSPCPLVSAASPGAAAARDVLSIGGTRVSHQGDSKMSTIERCRQERELQS
                     HLGTVIAEMEAVDRELNRLPIYS"
     gene            <196111..>200928
                     /locus_tag="LDBPK_190510"
                     /db_xref="GeneID:13386041"
     mRNA            <196111..>200928
                     /locus_tag="LDBPK_190510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860181.1"
                     /db_xref="GeneID:13386041"
     CDS             196111..200928
                     /locus_tag="LDBPK_190510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860229.1"
                     /db_xref="GeneID:13386041"
                     /db_xref="UniProtKB/TrEMBL:E9BE46"
                     /translation="MTHTSDAESLLLRFLEVEGGLHRPTARHQSSPLLVQMTSSATPV
                     DEAVTLNGHQARRSCSVSEAPAQATACCEMATPPSSHRDLRRSSTSSSSGSSDTQEEA
                     ATPPRRSSSNQHVINPTTLEDTVARPSAPRNSIPGASPSPPLSLSHPVVQFLTSVQLQ
                     GYADRLMCDLGIQSLPDLVRRSATLKDVAALLGPSASLQQHNELLRGLRRWEREEARR
                     ARADAAEERRRARKEDRSTNGATKALGTHKTPSRTTKASIQRVTTASSEDSGGRASGR
                     GSGTGGGRQPAPLLATLDSCVGRCASACFRLSDVCDRVLQPHTSPAAFGITEAAPHEL
                     SSDSGNVVASSLETPPVPASSSMSSSSRPSLTTSATQLMRQLSYRCSHARLAAALRRR
                     AGWSRSYHNGRDGQGEPLDTTSRTATQVAPYDVDAEDLDAVTTSGASSRSGSNHRGVS
                     HTSEASCHLEASVPPAEGDVGDDADAAPSDDESLASCVQQASIASAAGVERCEAVEGP
                     SNAEALLPPATLSSACYSCESHLSFILCSLREAAEEQPVVPDLIGSDGADGEGPASTQ
                     WASAVSDTPCGAFGDALTGDGCATAESHHPVRNDLVTTNNISLSALSARAELQVLPPR
                     EPAVTLTRPRGSPAAEEAGRTATADAHTTAAKYPVLDSDATCNASQHHQRLSPVALTH
                     ESATQPRQSRETDTLLATTGASAAPGDAPEACALLERRLADAQRRLNDALQEALQSYN
                     AEVKAVRQATAVPLTDTAIVNKWVPLRAVLQPIPFSPRASSACARSAAAAELGTPAER
                     VVWALGAEGDIDSGETHWCSFPAPNASMSAGADTEVFAACSPATGAALDCVCADDRKA
                     LAAMATTATSAPTTMRSTAAPVAPSCRSAVAPAATVEGVGLASTGSLDAPTAAELMES
                     RSSRDKKSEEDGSVSCESVGRLTAGTQRLSTYVNMGDAGKAAEIAAAAPIDKFAAEGR
                     DDSTAAFLWVSQDSPSTMRQSPYADAAAADSDRKEIASTSDEWWAAYGIDALECTQNS
                     ADGGAGGRAASPSTNAVHPHTTSNGSGAVSTSRVCTPSPAPVEVIELTSGTDDEDADS
                     RGGGGDNNNEHDARNRPSDASSYRPPRAAPSLPLRTSPPPRDDLGGGITIPPRTGSTA
                     PMHSWRPLVLDRRLHADAWTHMTNAELRQLCFEFGLMAPSPTKGDTTSPFPAAAADSP
                     PVLARRGRSAPLPSLAAASPACARKSAVSHESSPERDLFGLPTLTTAVPAACREPSHT
                     AAKTGDGAPPPPEPSSPVCAFTQPENGSGGARAAVAAATAGAASEHVDIRQRYQRRAT
                     LLERESLLEALRLLATRLRFRHTVAPFFLHRVARLSGLPYKRMRAADLLDEGAVLTRD
                     DLKQTRRRYKAEEQAEVERCIVSALVAEAAEAMEQDAQRVASRWAVLPLFAAEGGNST
                     KMKATPARSALASLPDGGVRCCYDQILLREPVNVFAAVAAVQRSFPHIAHTRVQQLLA
                     ANEVIAEAVVTVSGRSPSPLPQLSTTAQREGGQAIAVPRPSGELTDGSTPSMQETLGG
                     GISLHRGSGAVHSLATTTPLSQEERQRANARHYFAQRGYMTRRQPGGWGRGRR"
     gene            <201630..>203111
                     /locus_tag="LDBPK_190520"
                     /db_xref="GeneID:13386042"
     mRNA            <201630..>203111
                     /locus_tag="LDBPK_190520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860182.1"
                     /db_xref="GeneID:13386042"
     CDS             201630..203111
                     /locus_tag="LDBPK_190520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860230.1"
                     /db_xref="GeneID:13386042"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BE47"
                     /translation="MMDSSVATVECALVLAESNKCGAVVVAHPPATFPGLYKDVKYSV
                     RTLFAPPKPPSEMPPRVKRQPRRGPVYDNDIVTAGERQHRAQREVSRMWRGVLCRRRL
                     RQARTLAEVLNNRARCIQCWWRSLQARWRLRQLRAIRKEWAKELTARYTADRVENTKN
                     IIFWQHCRYEGAAVLIQRVLRWHLREKQRYLYQMEGVPESEWPPALERPPTRKRRPCF
                     AWRYPRPAADAGGDALAADELSGTDDDALHHRTLLQFRKVRDPVPPPTQTEVEAINAK
                     TRERIAQRESALAAPEVLSRAEWKTENIRHEDLDFNAGVLQRLYRSKQATIKARTRQL
                     TGEYFDKTARIIARTLRMQIFIRRMRRHRARVQSEVKARMARHDAEKIEALKVEAVWQ
                     RELMDASAACIQRCYHWYRFERDGVVPASYAAINVVPTAPPYGLINEHIQRERAMRWD
                     SMNLMEQHELEKQRHHMYLRYVPAKTIVCKRTGRFATAPQAEL"
     gene            <206137..>208365
                     /locus_tag="LDBPK_190530"
                     /db_xref="GeneID:13386043"
     mRNA            <206137..>208365
                     /locus_tag="LDBPK_190530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860183.1"
                     /db_xref="GeneID:13386043"
     CDS             206137..208365
                     /locus_tag="LDBPK_190530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860231.1"
                     /db_xref="GeneID:13386043"
                     /db_xref="UniProtKB/TrEMBL:E9BE48"
                     /translation="MGPAGALHAHAANGYNSVASEGTAADDSISSAAGVTELLSAAES
                     TAAVPLMHSIGRTKRHRMASSADTQHSLASSTLPPPRCHRTSGHGSVDAESAPQRDVC
                     FGASMTGALPSSEGLYLSDGHDEDADGAPRRCGSGSNSSRGEVSYRASSIRASVAGVP
                     GKLDMITPRAGQRAFDDSAAGAQCLVIDDSVDTDAVVTPAQLQQMKAEAAGGGVHRRT
                     SDELSTLYESRLVTADVLRDWTGWEDLDLVLTAQLRVDADAMIGVDQIGAQLSSLSSL
                     KLNGSRICRVRQLGTGFHALKYLWLNSCHVTDLCGIAACCPSLVELYVPFNRVRDATP
                     VMALSATLEVLDVEGNLLDDATDLGAVLASLRGVRALSILGNPLTCEYQARVRDAYRD
                     LLVEGGRRACANTAASGDVLSPVPPPSEHKPFSHVLAAWVRLLMPQLETLNDAAIDVS
                     ITSSCASFPLHGSSSEEASRRLAMPVSTHVDPLDDALAEELRLVEECVRDADAFDALL
                     AAVDEANRHVYTRPSTSCSGAQPRLAPRTAMGAARPFTSRWSRAPVRLGSCGGSTTDA
                     SVLTTGAVLAGNATASLRRRLAASSMSFNDAAQDDPSATNGSAADPAGCKGTSVQRSG
                     ICEKDSGYCASVTATSAIDLDEDARIAALLADDSEEEEWEHFKASLLRSKSTSAASMP
                     RLGDPMSTSAAAAASYHQLLYTQNEEAAATASTVQADGFEKELRTELTRLRMRIAKES
                     RE"
     gap             210796..210894
                     /estimated_length=99
     gap             211618..211716
                     /estimated_length=99
     gene            <212880..>214085
                     /locus_tag="LDBPK_190540"
                     /db_xref="GeneID:13386044"
     mRNA            <212880..>214085
                     /locus_tag="LDBPK_190540"
                     /product="methionine aminopeptidase, putative"
                     /transcript_id="XM_003860184.1"
                     /db_xref="GeneID:13386044"
     CDS             212880..214085
                     /locus_tag="LDBPK_190540"
                     /codon_start=1
                     /product="methionine aminopeptidase, putative"
                     /protein_id="XP_003860232.1"
                     /db_xref="GeneID:13386044"
                     /db_xref="GOA:E9BE49"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:E9BE49"
                     /translation="MPCEGCGVSEAGLQCPTCKKLSLPPSFFCTQDCFRAHWGTHKLK
                     HTEMKNLPATIPTMTEVDERLFNFTGPLRPGKITPRRAVPKEIARPDYAERNDGVSES
                     EEKDRGSHRVVAHNLKNLHEDYNNAELRRSSDILKIKRVNALSREVLDIACAAVKPGV
                     TTDEIDRIVHEATIKRGMYPSPLNYYNFPKSVCTSVNEIICHGIPDNRPLEEGDIVNI
                     DVSCYLDGFHGDLNETVFVGKPDEESVKIVHTAYACMMAGISVVKPDELYRYIGDAIE
                     ARAEKSGCSVVRSYTGHGIGKFFHTAPNVCHYKDNKSPGLIKPGHVFTIEPMINLGTW
                     QDVTWPDNWTSATKDGKRTAQFEHTMVCTPEGVELLTDWKDGIPFYQKQLREWGIPIP
                     AEDPSEIKI"
     gap             214556..214654
                     /estimated_length=99
     gap             214776..215279
                     /estimated_length=504
     gap             215859..215957
                     /estimated_length=99
     gene            <217575..>221729
                     /locus_tag="LDBPK_190550"
                     /db_xref="GeneID:13386045"
     mRNA            <217575..>221729
                     /locus_tag="LDBPK_190550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860185.1"
                     /db_xref="GeneID:13386045"
     CDS             217575..221729
                     /locus_tag="LDBPK_190550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860233.1"
                     /db_xref="GeneID:13386045"
                     /db_xref="InterPro:IPR010441"
                     /db_xref="UniProtKB/TrEMBL:E9BE50"
                     /translation="MQREVIKWVQSLDLSAPIQNPKRDLATGHLAAEIVARYSGTKFL
                     DLQRLPMGVAGATKRDVWSQVYRALQQLSCTTVTRPLIDAVLRREPNAALTVLEYLYE
                     HFTGHALLMHGLDAVGTSKDAYVQPRNATSTERLLKVTSGKPNNDFSSGVEEATLTAK
                     RKLFDPVTRASQLTSAARSSSTADVRYSGQDTAADWSDGGGDASGNNSTRALQHRLAL
                     IDNSELAGGANALQAYPRYARPTASSLVHTASGSRKDVVLDKPKYTADEVLQQQQNKR
                     ILHQHAVVQRLQEESDEATVEGPSRTRTGTSAVETTASSLPASPLREKAALHANRGAA
                     AAAPLTTLYRGRFYRQPDAPMVTGTAKVSNGPRKAKKGKREEVGAKAQRGAAAASSKD
                     HAIDADGKLDRRAAAASGDILSTPEFAGSTRGGGSTDGTRVVPVLRVNVHSASLQAAL
                     ALRSDHAELQERAAALSLEHFAKHNYALRPGLSDILVDVLAAHKQLQRLLDCCVEDGN
                     SEVLDNVLGHLLAHRDELPPACIRACWQALVQHADGIVSLLQKNPDEYGYLMESLAFA
                     FSREAAQVPLLHISQTVPVSDEADDAEQEERAAATTGGSPLLPFFGSTRRSIALSSGI
                     VAGAGHAAAAAASAARRCSPFPGAGPAGEGDTASPRHRHSLSEALLTATHRAASVAAG
                     SFNASNAASSSSRQRAIVDTCDGLPVACAFGFLYRIARQLDVRTAAYVLERYVLRSAK
                     PFLLRHGTVAVREAVARVMSASFVPAPPKNAAAAVDAESNGEAVAAAAADSEEAFAQF
                     LTGQLARTLLGPFSTACNTHRGAASTPLRDSPDDSAANHDTHSTLPLQLSLQRAYWLI
                     VFHAVADYPCPADHGMATSSGADGPLAACVRNAAVTCLSCTDADLLTIGVGLTIEYSK
                     RWLPRDASPIDAAVDDAVARGLDLLSHVLPSLDAAADQLATPWWHTRSANTWECRLMV
                     LRLCNALLAHPLFAGAGSPKASAESRSDDGKAASCNWRATVDAAAAECLGTFAKDSSW
                     QLQLALGVAAKSIDQTSAPTLTDTWRQLLCSIPVASLPMQLLPYDEAPVRLRLLRPLR
                     SAASVREAAESEMSKGAQPSARPQQVRMSSCQNDRAAPLHSATSAFAGEPASWTWTPS
                     RENGDSWRSPGTSTAAPATAEAALHFVWGRVLSVYAVVPLNQTWNGQGVVDAVLPPLA
                     GSGAATAASSPPAAPAMAPALQLLVMAAALLSPPATATTAVAAAPSMASPHKLPSVSP
                     ADAEPVDVGELSGAFWLVALRRAWPLFQACGVSHEPMTQGAEINIAEDAASLLGGVAV
                     DRAGSGVNLEDLRTIVLSLFLRFADDAAVASAMAAADGDGGNLCGSAIRWAEALCSDA
                     HATCAQ"
     gene            <223635..>223898
                     /locus_tag="LDBPK_190560"
                     /db_xref="GeneID:13386046"
     mRNA            <223635..>223898
                     /locus_tag="LDBPK_190560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860186.1"
                     /db_xref="GeneID:13386046"
     CDS             223635..>223898
                     /locus_tag="LDBPK_190560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860234.1"
                     /db_xref="GeneID:13386046"
                     /db_xref="UniProtKB/TrEMBL:E9BE51"
                     /translation="MAKTALLVGALLALVMCLAATAVSAQRSLECQMVWQGPSSNNSL
                     LECLGNTDRIRSQWPYYLYPAFAALVFIFTVIGLPILFCCHCCS"
     gap             223900..224436
                     /estimated_length=537
     gap             227849..227990
                     /estimated_length=142
     gap             231558..231656
                     /estimated_length=99
     gene            <231925..>233097
                     /locus_tag="LDBPK_190570"
                     /db_xref="GeneID:13386047"
     mRNA            <231925..>233097
                     /locus_tag="LDBPK_190570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860187.1"
                     /db_xref="GeneID:13386047"
     CDS             231925..>233097
                     /locus_tag="LDBPK_190570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860235.1"
                     /db_xref="GeneID:13386047"
                     /db_xref="UniProtKB/TrEMBL:E9BE52"
                     /translation="MAKTALLVGALLALVMCLAATAVSAQRSLECQMVWQGPSSNNSL
                     LECLGNTDRIRSQWPYYLYPAFAALVFIFTVIGLPILFCCHCCSCCEAYVKPKAETDL
                     GVARCCLWMWIVISVLVACGVCVLLVYGSVLLEQAAKQIIHDTEYRTLDYFNDTRANI
                     TMLLTNYSADPPTPPSIDLSAFDAVNDNVTYYVHLARNNYLKYFRAAEIVVCCVGSVG
                     VFLMLCMLIFALCRCSGICPIVWSCLYFVFALAFALLAVLFTICIYVMSAGCGEVDLQ
                     YSREPGVFQWYLVPWCEKQFDFQALRAQVQSQEQQVSQSACGALLNFCDNDPNYSLEN
                     KNHIFMCGNSITDKSQCNSLDDVVDVVLSTYVKPMLTNTLCANQTGMEYLEKCTLIS"
     gap             233100..233198
                     /estimated_length=99
     gap             234500..234598
                     /estimated_length=99
     gap             235291..235389
                     /estimated_length=99
     gap             235814..235835
                     /estimated_length=22
     gap             236650..236748
                     /estimated_length=99
     gap             237691..237789
                     /estimated_length=99
     gene            <240814..>250080
                     /locus_tag="LDBPK_190580"
                     /db_xref="GeneID:13386048"
     mRNA            <240814..>250080
                     /locus_tag="LDBPK_190580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860188.1"
                     /db_xref="GeneID:13386048"
     CDS             240814..250080
                     /locus_tag="LDBPK_190580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860236.1"
                     /db_xref="GeneID:13386048"
                     /db_xref="GOA:E9BE53"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR027684"
                     /db_xref="UniProtKB/TrEMBL:E9BE53"
                     /translation="MQFSDSMSSSSSAASPPPSRGGGCPVAVNASTPLASAVRAFHAT
                     YSSELRGTYDDDAQRLYGENSSLRIQLAAGLSRGGSPVSDAAVGHHGGERAHDGDPRM
                     PSTQQAPPFFAKASAAHSAAQSFRGEDSAAERDVRAFRMTPSSSSSTFSASSASSLTP
                     EQPEGKRPTVSSIVGKRLQLRRRSASETPFVASTTSPPMSCAPAARRSGSSQSSLSES
                     SASDVVFHRLPLPHATLAVSSSSAAAPPAVSVPPPAHHHDPLCAGMTATSPNITVPAA
                     SLLHRSAVEKSTMAASASTLTDTERTCTAGASFVTSSASPMTPNPAVSYTRTSKSPAA
                     VWSAAAAVLPASQLPTSPSPVSSLPSDPLLPHIPTAAAGHANAVYSSFEAASGEEVDE
                     HDLNSSAASRAAQAALDAEEQLHGHEGPSDSSPVLTALTEHSFSVTPLLTPVPKKASA
                     SPRPMQVHACKGEMDTSTIVFNLDEGKDCDDSMAGMLARSSVDLVHTTPSEKRQLLSR
                     EERNDLDGAVANSSDDAGAVSHMAGWRRQPLPPPTPSTVTKKSPSSSSAMRRAVESDD
                     TTSTRSGGSPPCTNLTVEQRSTPVMAQGAATALATSVDAAQAVEHYTASALPPDRSSS
                     SGIDSLVFISGKNAGDPAHKTRSRADDTHALSLQRQRAMECGGRPEEAAVAEHVGSAM
                     MPSTIATEGGAVRVRGSGSEGVAAAASVPGLEQHPPHHAVKTLSTYQMNDETKTRAAD
                     PAVLTTGGETSASRASAVLMPPSPSQPRAASMLDNSSFSSHSCGDATAAVAAALAGQS
                     DRSRSGQALLAAERDAAAQPSKSGVVRRALVMRCMQDSSTSSSLSSSSSRSISGHRKE
                     PRQALVNPGTRTASGEQTSVEKKGGSNDRPVSPSSSALCVDAMCAKDPSATHACALQY
                     TEALDGADVGENEEAEETEEDGTPPIKWDGAQDQESNPLLLQEAGRWDAVLEEMELVD
                     CTVVSRVYQRPMPLGRTASHSDGEDAMENMGSEEDDELCLFKVVSLFPIAADHSERWE
                     RRTRVQKRLLALAEEMRATQRALDEAGLTAAEAELGSSASQHVGASVKAATKGEERAG
                     DRRDDTGDVFAERRRRTTCAGVSEVYVDSRCRLIAQLEAVPYMVPLRHLVAASSGTGL
                     RENEVLALIRTVVCKAATMHNAGFVHGALHAGNVLLSSYDGDAVLTQPCGLMSQSSWL
                     PTDLSVISVARANAMAPYLSEVWGARRLQVGGATSTRLGPPQRPDTAELITYHNLAAL
                     GWLDDSDARKAGGSADRRDSAELCMAGTAYTPTAADDLHAVGMIAFLIYVGVPPFQMA
                     SLWAVVERLRALGTAYGTAMQSSSSSSSAAARQEARRLVEEFCFGTCRRGAGANDCHR
                     HGDEGASPSSGAPLQRHGVARFQPDFEQALQSFIVDCVEASCSAATLEQESGTPYRSG
                     AAPHVYANAQELLTRHPLFRRFALPAHAGQDDEEEHENGGGARSSGDKESDQSVDDKM
                     RDTVHRVAYPAFCTWARAREDCGSAPHLSRLHSNALFTARCTALCECVSATVSSHDDE
                     RSESWNAAQDGEPWSSLSVISPHVAGALQAWQFPFLSAEAGTSCLNDRETGTCTCTVA
                     SAEAAAAIRRRQWRSDTHAVTDAARLRCLPSLVRPTASAAPTGRAAAGDGDDGADGDV
                     SATTLAQQEEDVLEAQLFSGEQRQFDGDFAHQPHLHALTLAGKQESAFSLSRDFVLSR
                     VLPVADTLVLQHLTDCTVTVLAPFRYVVLDGLQRCEVRLGPCESCVLRDVHDCPLIAV
                     AALQLSGNNVTETHLSWSRQGSGRPLLKCSRGITASLYGLMYEGLVEDYSRVGLALEH
                     AACFVAAADVNSDSGEADGAVTFRGPAPACPRAVELLATTATSASRSQREMGLCLAPE
                     APYDLALLLSNTRYVHSGRRSGGLQSPRIPSPDVFHFFGELAEKDVVVCDVRGDTRNG
                     DARPVVFLVGALGDIVIERCSHCTILVSGTPSNLQASQCHDCQLIFMARESVVEDCAR
                     VECVALVTEYLLVRQCDAVRVRPLFLDCPFSDEVLRRVVGGSVGGDEEEIVVGAYEAG
                     RLDELNAVLRGVGQGVLVEASENVIIEDIGYYYHRSCRAGDGEREDQEGGADGDGFSV
                     LSVAYASMQSPTAAASSSGNASRFMAEAAQSLAEHLSLPCYLEPLQRYGGGERAAVSH
                     AGRPTVSFHDLLNCSVLRLRGSLCPLESQASPTSGDSTVELADICVERVHGGVLYVED
                     AVHTLRLRHCVGPLDIVVCAAARVFMEACVGVQLRTACVDFRATDCVHCHVALHVNNP
                     PQYQRCRSVQTSALNITARDFSALLSAAGVDLATNLYDEPLLLTEEWKPTVAAGSSGA
                     LLEGRRVHALHGGCVDTPTGPHSTADMCAVLLSSVPREQLHPRQGGPRDSRLRVQPDQ
                     VPRIMAVLRQPVMVVAPLPGLCASPNETPFLEELEARVLVWAKQPLSVSREEAVAIAL
                     YALADLAEVYASVTEWVEATDAVQPTEAPKRVAAFGGSLNSDAPPHLLSTRAPPSLPA
                     TSSASSTASNVPGLALDAVQQRLPPTERVLLQQAEQPRTKDGECAAQDASAAPSSSPS
                     AGDASGAGIPAPAKPMLVEAGVVEIGPGTEGFVEEVAIHSAPAPPLSLLLTCYTDPPP
                     APKNDGAQTSPAEGPHADPVALHRPSQSESLPMRAQHGRLAAAGLPTLPCTAASAFAS
                     SAAGLDGAASGVEDDTSVNSSVAAPPLPPGPAYALNPTNVGASSTMDVFYNTQRDAAS
                     VVTGTAGPLMEEEGGAYSLTARTLDDEGVGFTSASPWPDGIRSPVVTGGRRALKWAMG
                     SGDNHEGARSGRQASPVAETIDVLGAQAQAQWPSSLERSPHVMESEERSSRDGDELLV
                     ATTAVCTKELQEVFLKEEVEPHYARNAAHSSLRTSTSSVAEYPWRGVMSHENSAEYVA
                     GGSDNGTGESTVPQTNFLHVSQDSSARRLELNSQAAMETLVMAMGSEEGGSFSTVQRG
                     VLEPPASGRAVVPKTEPLGRISPEVMAMHEVDANVKEVLRQVEQARQLFARNQRSWES
                     SAGGGLEARVRAAVAKLTALKAAHAEAA"
     gene            <254850..>259874
                     /locus_tag="LDBPK_190590"
                     /db_xref="GeneID:13386049"
     mRNA            <254850..>259874
                     /locus_tag="LDBPK_190590"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860189.1"
                     /db_xref="GeneID:13386049"
     CDS             254850..259874
                     /locus_tag="LDBPK_190590"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860237.1"
                     /db_xref="GeneID:13386049"
                     /db_xref="GOA:E9BE54"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BE54"
                     /translation="MLPSSAPPWGPGPPDPAPYSTIAAHNCTAECVDGSTSGSATHNR
                     STSPRGQPAGGDTASPTPASVEVLGRKTQHRRCSTSPPLKPLMKEAFLARAPEKPRCT
                     LASAAMESTGDPPHPSKDSDAETSACIRATCTGSRTRVDHAPPLSLSATVSSVQQHLG
                     MIPQVASSNSASYQASASAPSTPSNRKEASKMRRRSSSAFMSRLPSDTRLRTSLLAAF
                     GVHVETHGRCDAPSHAPLPVRGSLSMTNSTDVTPVASDTHFRRSVNEGCSTVESHCTA
                     TAAASCVVVRAPSGAFRALPHPSIWLNTSLAGIGGVPSFNSSTPSTNASVLKDRHSSG
                     AGTCEVPSESSLLPPFRTSSFDRDGVGAEDCGSEASGTASTSATVEVLHSGDANPVTG
                     DRCSRLPSGRSINTSVSGEVGGFAPDASGTSTAHHTCAESNSSAGGGAELQGAGCSFG
                     WRMFSSLTSQRGGGGGGAPAPSLGIFQSGLYLSMDEGDVSPAPALEVPMTPQSFSTML
                     LARESSEGAQHPVRAGSATSATTTNGARSSSLAVQEGNDTMLRQSSQQVPIVSQLAED
                     AWSGGGVAANGIEDWCVDGGSRDSREARTTSTTHTSGVGSHPCLVPGSGSGRCVIGGC
                     CATPLSSFQLLGGSSKQEMPTSALDTDEIPSTPTDISALPHPPPPPLSARRRRQRRAC
                     HHCDGGNAVSSNSRVDLETGVIETDTLERARAVSKDGSRAYEIVNGKYVMYDYELGRG
                     SYATVRLCYNMADGHFYAVKVLDRVRLKRRQLGSEAGLCKIDQEIAMMKQVQHKNIIA
                     LHEVIRDPSMRYVYLVLELAESREVLSMRDNGDVLPRGDDDGAATAYPEAAAREMVKG
                     LLQALMYIHYLGVAHRDIKPSNVLRTADGTVKLCDFGVSVLVGDAPMQLSREGSVAFL
                     APELLLSSEVEVSRFLTPDDSSLGSTRNKSATHMLADSALATATRNARTTVTSTTTAT
                     SATELASTGGPASPKEEGAKWTQRLMSSFAGAALQPNARAAASRAPGREIASPGGGAP
                     SAIPPWPSSASLPKRGGGGGAARRASFRTLSLSPCGAAARECAAAIATAAASPCAGGA
                     AAVTPPTGAYSPSTPAAQPFSDLSKSAGNAPVDLLKADVFALGVTVYTLLLGHLPWRA
                     SSAVSQRAAILAEPDPFLRLYKAAYGDAYVGPPQVREACMPRCDVLGSDAIPASSHAS
                     TSASGKDGRGASYGTANAELSDGQWAIAAEKDDVVTPAPVTALPCKWRHLSNTGTTPD
                     ECTSEQEKCTPTAAKLTAAPQPHRNAPTRSDRNSAQPVGERSTAAAALPRPATQLLAK
                     KATTSESRAPKDLAESPSDDHNPRAPFEAPPPPMPPQQERHLHRFQWRPFMDVVLGSA
                     PIKTATAAGTAITQQAQVTVRHRRGGGGELVDGDLQQTNATTTCIRSRAPAVKMLLSR
                     AATQPRFGSVVQVPHSLAICGDERATWEAQGAAMSGPAVAPPLRPRGPTTTPDQLYPY
                     RGILDVDDDDWMKADESDVVQGMKESAINAEQWVPGSSSDLLRTVPSSAVTGTRSNDS
                     EADSASDCDSSTTTVPCSAAKSTASSLPSDDDEDLESCESIYERLFEMEQPCRAYTVV
                     EHMPLPTMSGTSREISGEAVDFVRSCLCLDPAERRTVFELFRHPWIRGGEGAMLAEAG
                     TSAGSP"
     gene            <268110..>270443
                     /locus_tag="LDBPK_190600"
                     /db_xref="GeneID:13386050"
     mRNA            <268110..>270443
                     /locus_tag="LDBPK_190600"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860190.1"
                     /db_xref="GeneID:13386050"
     CDS             268110..270443
                     /locus_tag="LDBPK_190600"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860238.1"
                     /db_xref="GeneID:13386050"
                     /db_xref="UniProtKB/TrEMBL:E9BE55"
                     /translation="MYPRARAKGGTQGAGHGDGDAVPAAAQPTAAPLACDAASSSATA
                     VGHRESVHSLPSSAASHHASAGSGNRKSVHASQQQPSPLPMPHMQSGIYGEAMQDAGA
                     SSLTPLPPPHFNVGNVHHHGSSLGGSAHRSTTSSSYDEQKQPLPRPSPLRMNGHQGDW
                     LAGASSSPTMSGAVQCGSPAGMATASATAQVSSSPHSRADSSAVVTPIIGVAATSSSM
                     TAPPMSGAAPGGADYRPPAVYGEVNLGSSIGAGASITNSSSLTSLNRASASLSGSLVN
                     TVNATRRSSCMAASMAGVSVGISTAVGVAAPLPPSNMGAGVPIVQVGMTESSCPAAAP
                     VRAGVPGVTSLKITVGGSTSVIAASAPLSPLMNSPLPAQQQPHSQARQPRSAERSTRP
                     LHASSDARKGGGASGKGDTPVPVGGVDNIDVESDEDRSCSSGMGPTKPTVAQAEARYR
                     YLYDEFRKVSGLRAKLVEESERMKREQTGLREALDFYRRKIASAAEEREALLADYRED
                     VHNALRLAQELAADVAAAHNSGDGASRPALATNGGEHGIPVASAQQALDAAISRVLAS
                     KAPIAAAAAPSVPPTGIPVPLAPLQGTAGFSGSPLLSIGEQLGLWYGRWMAMRAAAPC
                     LPMMDDEASYPDPSERHRSSAGPRYEQGILLRDEIRDVYCNTHAAISTYMTSLDYGFA
                     PMSSQDSYPPAGWQGQRHQQQQFSSEYRGLHFHVDIPRFHAHTVSGLSDPGNAVGDCT
                     GGQSTPVHSASSQPPPLPEPPSSCLAPQNPRMAPALT"
     gap             275059..275157
                     /estimated_length=99
     gene            <276310..>276591
                     /locus_tag="LDBPK_190610"
                     /db_xref="GeneID:13386051"
     mRNA            <276310..>276591
                     /locus_tag="LDBPK_190610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860191.1"
                     /db_xref="GeneID:13386051"
     CDS             276310..276591
                     /locus_tag="LDBPK_190610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860239.1"
                     /db_xref="GeneID:13386051"
                     /db_xref="UniProtKB/TrEMBL:E9BE56"
                     /translation="MNTTALVQMWALVAVALSITAAQVASADSKTYVAPHPTVGLSSK
                     DEEYLIGVVSFAAVVVACFMGIASMVKIDYDDDTLLMVEVLGDINHEKE"
     gene            <277992..>280226
                     /locus_tag="LDBPK_190620"
                     /db_xref="GeneID:13386052"
     mRNA            <277992..>280226
                     /locus_tag="LDBPK_190620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860192.1"
                     /db_xref="GeneID:13386052"
     CDS             277992..280226
                     /locus_tag="LDBPK_190620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860240.1"
                     /db_xref="GeneID:13386052"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:E9BE57"
                     /translation="MQIEVKLSLEDAESYQRTLNTLANHHLKDECYYDLFFDFPYPAL
                     QERSSVLRLRVPCDPASVYARSAASAPSASAGGNGNYDPEAEYEALLRACRGEVPPGF
                     GAAAGSSTFGCAHAATVIPQTGGSGRSDHGLPLPIFIPGAAGKLILKQKNTVEHGHQM
                     SFVVEDAQVPAAVVEALVRLVPDSLFTTGVVPASTATDGGASNIFTVLSAYAQQRPHS
                     DDGAGDSAIVRILSHLSAIARAYAPSNDAGASAADPDSSDAHFTQVRFAAMGTHTAYT
                     QQQLATSQRTLSKEGGKLEDGGGAGAVAVVPQLEAVAGFMTLRKVFSYAPLIALQQGL
                     VTALELTESEREFREGLRVRVDASYLLPGLTIYELEVPKCGVAVDDVATEVGNFLRQL
                     AVPFHMGSESKFSRYTQYLAATREAERDANDVKLRLTNVNGYEEVRRNLQQLLVSTST
                     ATAQSSQDRRHLSNTEVNPVEGEEAGADDTWWHTNPNGYLQETNEDFFFDSPEQTLRR
                     GKSFLRLRKQLHSNKYLLTLKAHQVFSGGQQNSLSSKVDVSEVVARALIDNPTQFLHE
                     YAERFAVVKTMWKEFGVRELCRTATFTTERLTVPWWAAQAQQSTLQRSWAAGTASALA
                     KQSQPTYTSTSYYLSQQEQQHRGYGTAGKLPPVPPLIIHLDRTLYKLPADAQAPRIPF
                     TQCRSRGDRQCETYEIEVTNIVAPTEPKDVVAELTTVLNGLGVEWTVGVRSKLEQYFS
                     LMDM"
     gene            <280900..>281337
                     /locus_tag="LDBPK_190630"
                     /db_xref="GeneID:13386053"
     mRNA            <280900..>281337
                     /locus_tag="LDBPK_190630"
                     /product="histone H3 variant, putative"
                     /transcript_id="XM_003860193.1"
                     /db_xref="GeneID:13386053"
     CDS             280900..281337
                     /locus_tag="LDBPK_190630"
                     /codon_start=1
                     /product="histone H3 variant, putative"
                     /protein_id="XP_003860241.1"
                     /db_xref="GeneID:13386053"
                     /db_xref="GOA:E9BE58"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BE58"
                     /translation="MAGVTKAAVVASHPKKNVASRKMNKKSRSMAKKEAKAMRGGTAD
                     SKRRRHWRPGTVALREVRKYQHSTEMLIARSPFRRLVKEIMSTFKDTMHMRHSALEAM
                     QDATESYLVSLLSDANLCTIHAKRVTLYPKDLQLALRLRGERT"
     gene            <283420..>286176
                     /locus_tag="LDBPK_190640"
                     /db_xref="GeneID:13386054"
     mRNA            <283420..>286176
                     /locus_tag="LDBPK_190640"
                     /product="extracellular receptor, putative"
                     /transcript_id="XM_003860194.1"
                     /db_xref="GeneID:13386054"
     CDS             283420..286176
                     /locus_tag="LDBPK_190640"
                     /codon_start=1
                     /product="extracellular receptor, putative"
                     /protein_id="XP_003860242.1"
                     /db_xref="GeneID:13386054"
                     /db_xref="GOA:E9BE59"
                     /db_xref="InterPro:IPR001828"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:E9BE59"
                     /translation="MPALTSAKPRRSAVVLLATAAFVMLVCLLTCSASGAATGNSSGL
                     VWVILTDLSRTTMTEASLSEAITAFLTNTSATHQYLNTLFRPAPIILDTGGNLLTALT
                     QITVLLSNPLTFPSVLFLAETADVSASVVDMLRQNDTTSDILIISAHSSNTRLCDPKT
                     NLRTMCMVPRDMINVRGLLEVVSNQLNWYSMSLALSNDDYGDGVAQAVTSEGQTASTT
                     ATIVAHAFMNGAASTTDDDAVVASLIKYRARGVGCFLREAETRRLHAAVERNRRAANS
                     VFLIASRESLNVLPDLTSDVNGTAKPWGAIFVSAYTPPAELVSQGFFPTTHGTAVDEY
                     GAFVLSHLLDGLLMLDAAKGAIDNMSALRAARFRGYTGNVAFDSIYYQRVETVFSLIT
                     ASHTVRNPLVTWTLKNYSSDAAQVNANPNVTSALIKTSPLRTAKICMASPSNCAFTQM
                     MISMLFVLTAHNENVADNDSDSVFNFYPVAVSTGASGVMGLASLIPIARSCTVLTGPG
                     SDAVVMAVTPVVNEFHIPQLDYAVSNDYFTDNVHTYPYFSRSLPKNTFADVAVTQLCV
                     HYGWERVIIVTSNDQFGISRAQSMATRMQQQNLYVEATYYLSDGNNATVADCMEKIYA
                     KLVSRIIILINPFTAAQAETFFRLSDYLTYMRQYIFFMDSALCHAAAASANGAALRQK
                     LPSSICIYPNVTQTRLAALNTLYTSSDYATTRQEMRKLMSDGGFLSSVESCDISSISP
                     YAGFAVDAGYVLIDSVSRAVAENVSLNVAAHLLPYIRSTSIDNFAGDCTIDSTGNRLY
                     AAYSINIQLLNGSSLFIGTWNSKASPALEITEWSFVWLTNSTAVPLDTFRDASFVLST
                     AFSASPGAIVISILGFILTIAVFYFCYRHYRMQKLVEQALEANQFPVTDEELRCLRGI
                     KDDV"
     gene            <287482..>293280
                     /locus_tag="LDBPK_190650"
                     /db_xref="GeneID:13386055"
     mRNA            <287482..>293280
                     /locus_tag="LDBPK_190650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860195.1"
                     /db_xref="GeneID:13386055"
     CDS             287482..293280
                     /locus_tag="LDBPK_190650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860243.1"
                     /db_xref="GeneID:13386055"
                     /db_xref="GOA:E9BE60"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BE60"
                     /translation="MSCSLSTFPTTRQACPIAPVSALRAAVERLQQPDATAAGAVDTR
                     RPNYLLDVPVSAIDVDRWEKRWQEAMSAVSSSLPSLGVGTKGQLHFQHASMAYAALMT
                     ADEASAPTNAPSSRHLAPLPPFVFATVKTLPMTQLLKMRRQWLPHRQRFAVHQQRMGF
                     LDAVLSHAVVALVGPAGSGRTLQVPIVLSETEVLKRRRLIVVSANAAAARLTTLRLRE
                     ERGEDVQHSRTVAAAVPNHNETTESTSVVVTTAEVMLRQLLCDPCLEDVGCVVFDDAH
                     LRNESTELCLSLLRDLLAVHQQWEHQRGAPARSAVASSSNGSAAGPDADTAQGPDAAR
                     RRRLHIVLNCPDEACATTLLSFLAPSRCTATTFVLQTAPTLVTANTTLYLEEAVQWLL
                     KTEKEGSCLISDSAAMEATLVSYAENVDAVARIMAAGDADFAHPAAFRRYWLPLIQQC
                     VDEFDKADRGVAGATAAQGRSPLSAIVLVAPNNHYVHVIANAVREAQRTSAERDAAAS
                     RVCTALAEDSPFSSFLTVAQRTAVRDACQRWIIVATSELSQSVLPSGLDVGLVVDCAR
                     NGYTTVDTTTMADTVVIEYSTIAQLRHRRKLAKMTATASPAAGGDGSTPASPVVIQLI
                     PKSILHGAHHRRLSADPAQHIIFRLPFSRYVQVYQVLQAREEAALSQRAAFSLSAAGG
                     ANLSSAVGGGPSIASKVSTVLASQLIGVPAATATRYEAVRRIMASVESYLRAAGHLAV
                     DHTAGSPAMGQLVLQPMAVLSLCLPVPLQVGRLLIVGSLLRSSLAAVTAVGALWCCSD
                     LLSLQGAGAVRVADASDAAREAAEEQAALLTEARLFFSRDSLSDVVSAFHVYQMWCST
                     KANPEAERDFLAECGVAGEVLQAVFDTQVQLCMLMRTYGLLLQPGEGGERGRAGAGES
                     EAERTLRVCVESVQQSTSESVAQVSSALGGAMAALPPEVATSRALHACVTAALYPSCV
                     VPTGEEGIGLVYDGVSTSSIGGAGGGGESSGSGSPAAGTGRRVASFSSDCVLADAVQC
                     AKAAGRPFLFLAKSIADVAAREAAVMGASSTVAATVVEQVDPLHEAAAVVFCGHFHER
                     PRKAPTRCRGWSSVLTSRWRETRRARALPPVSQLPPTCISVQSYDTVHCNHVICTMDQ
                     NLSLTMRSTSAKWLQQLRTHVGAYLAALACGVATSNSNGSLKEASSAVAAELAEAWEW
                     WERRHEQGRDWLREERLVVAHQQQQTEAAAAGYDKQEQAASAAKVAALRQRLFGYYEW
                     QIRPGTPAAVVVPSNAERQAFAKSAAAAAAKGSGEVDNGDAGAAAEDDDPIAEGAGGV
                     QATYSGKVPPADIDHIFRLCVKSVAAKGTREAEAQLLRDNPDMFGFLNPEDEFHEYYL
                     YLLRQAAPDMEVLGDNLEELIAFLEDLEAELRGELGLPHPNAAAQEDAGGVLGRHGNG
                     EDGAYGASAAGIWGGDMNADANGQWNSGPFGGGYAVHDVPVGEGDVDGYGDGDSGGLQ
                     LESAAINLKKSAGPTLAEKIEEAKRAQANAASTTGKSADVAPPMMIGTPAAPVQMSVP
                     AAPSPASVNTPFVSTNAGETLADKLRAMQMAAMGGSAGNTSDLAPLQFSAQPNADPTS
                     VQPESAAPCGVLPPPPTAADLLAVINGGDSADVAPPQASLDLDFQQAPPTAEELLDLL
                     GPALPTAAPDDPFAAGSSLGSSRASATLPSAAMAAMMMGMPTTPLHRPPPAIPAKAVE
                     ERPPSVLVYPVPDIRKYGNVRLLLAKSLSESLNMRVGPTTIVGHVARIDVPNRNVEAR
                     ALALKKFTCGDTKITVHLFKNDRIIDDPEREERERRKRREELRQQEAELHLERRRRTG
                     AAAGGDTQARAKASRRAGNVGAALTGSAGIDPTSPDAFNDPSAYSADAPVLSAKVDVA
                     KAAPMRIGVLSSSEDDDDASSSADSSSSSSSE"
     gene            <294342..>295670
                     /locus_tag="LDBPK_190660"
                     /db_xref="GeneID:13386056"
     mRNA            <294342..>295670
                     /locus_tag="LDBPK_190660"
                     /product="DNA-directed RNA polymerase, alpha subunit,
                     putative"
                     /transcript_id="XM_003860196.1"
                     /db_xref="GeneID:13386056"
     CDS             294342..295670
                     /locus_tag="LDBPK_190660"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase, alpha subunit,
                     putative"
                     /protein_id="XP_003860244.1"
                     /db_xref="GeneID:13386056"
                     /db_xref="GOA:E9BE61"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:E9BE61"
                     /translation="MSKPRRDVNKVQIGYHRAENTETVSSPHTYAYSSGKSVPSTTKP
                     DKPTVSNIRIASAVAGLPPSRFAANAPVKREKNDEESESATAAASSASSSLLHGAASE
                     ARTTVDGFPWSTRRVERMSFEMQNVSPPISNLFRRVLTTEVPTLAFDRVLIEENDSPV
                     LDELLSHRLGLVPVAGPVMKMHYITESNQASFSNLDPSRVLLFELDATGAKDAAVTPV
                     YSRQLQWVPLPGQDKKTGAVAGACQTGREEYAGAAGATEHSADDDDDAVFLVHPDILL
                     SKLGPGQRIKLKAIAVKGLGAVHAKWSPVSACYYEMKTSVELCERLTGSAAEALVKSC
                     PAGVFGYEGGQKGAAATVVAPEKCTLCRECLRSDGKGAEAAASEGDRVRVQKEKTHVL
                     FHIESVGQLHPAQILRFGLRLFAERCRALAEMVQSTEVRVADASAKSLEL"
     gene            <297212..>297772
                     /locus_tag="LDBPK_190670"
                     /db_xref="GeneID:13386057"
     mRNA            <297212..>297772
                     /locus_tag="LDBPK_190670"
                     /product="U3 snoRNA-associated protein UTP11, putative"
                     /transcript_id="XM_003860197.1"
                     /db_xref="GeneID:13386057"
     CDS             297212..297772
                     /locus_tag="LDBPK_190670"
                     /codon_start=1
                     /product="U3 snoRNA-associated protein UTP11, putative"
                     /protein_id="XP_003860245.1"
                     /db_xref="GeneID:13386057"
                     /db_xref="UniProtKB/TrEMBL:E9BE62"
                     /translation="MMRQHPAVRGRIRVLEKTVMPEEILMSGGHQMKSAAQKRKERRE
                     VQEKMRRSGADATPETRAAFVERLRAKKELKQYQFTDLLEEVKRENEATASSSKGTPG
                     DDDEHEEAAAQDEVTRLLEWRREQERQAAIATARHVREVEQRIQRSKSLSALAKRIRK
                     QSQGIKRQMEQRRESRFKPGATRRAR"
     gene            <299522..>300277
                     /locus_tag="LDBPK_190680"
                     /db_xref="GeneID:13386058"
     mRNA            <299522..>300277
                     /locus_tag="LDBPK_190680"
                     /product="kinesin, putative"
                     /transcript_id="XM_003860198.1"
                     /db_xref="GeneID:13386058"
     CDS             299522..>300277
                     /locus_tag="LDBPK_190680"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003860246.1"
                     /db_xref="GeneID:13386058"
                     /db_xref="GOA:E9BE63"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BE63"
                     /translation="MNRSMSARSLHDNTPLSISSARRTARRRSSFSARSVSASTSTHA
                     TPIRDRPPVAQSDRRPRNGCSTSMAEYPMPTTQTQSNAMKVYIRVRPFSEREIAQKVA
                     PHSTVRIDAQNPTQLTILDPSRGFRPLTTHPFTRCFWSVFAKGEGELLSKVDTYLTGG
                     MNSARRSRAQSLVTGQPVVNSVRRGTRTGVDSDATSSTTAAYDGAGSAPVMVDANVSH
                     PPYAGQDQVYMHVGKPIVGNTLDGYNGCVFAYGQ"
     gap             300278..300376
                     /estimated_length=99
     gap             301523..301621
                     /estimated_length=99
     gap             306913..306986
                     /estimated_length=74
     gene            <309408..>310232
                     /locus_tag="LDBPK_190690"
                     /db_xref="GeneID:13386059"
     mRNA            <309408..>310232
                     /locus_tag="LDBPK_190690"
                     /product="kinesin, putative"
                     /transcript_id="XM_003860199.1"
                     /db_xref="GeneID:13386059"
     CDS             309408..>310232
                     /locus_tag="LDBPK_190690"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003860247.1"
                     /db_xref="GeneID:13386059"
                     /db_xref="GOA:E9BE64"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BE64"
                     /translation="MLAPTSARSTSRRASFAEPLSGRRTSSSARSARPILVSVPRSQR
                     SDSISATPTRYRSEASISARQMRSEFYESPATTKANAMKVYIRVRPFSEREIAQKVAP
                     HSTVRIDAENPSVITILEPARAFRPLSTHIFNRCFWSVFENAKDGTESDQSDIRNGVD
                     TFLNGGMNSARRSRAQSLVTGQPVVNSVRRGTGAGLEPEGMETVGEAAAYDGAGSAPV
                     MVDANVSHPPYAGQDQVYMHVGKPIVGNTLDGYNGCVFAYGQTGSGKTFTMLGYAPS"
     gap             310235..311955
                     /estimated_length=1721
     gene            <316579..>323421
                     /locus_tag="LDBPK_190700"
                     /db_xref="GeneID:13386060"
     mRNA            <316579..>323421
                     /locus_tag="LDBPK_190700"
                     /product="kinesin, putative"
                     /transcript_id="XM_003860200.1"
                     /db_xref="GeneID:13386060"
     CDS             316579..323421
                     /locus_tag="LDBPK_190700"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003860248.1"
                     /db_xref="GeneID:13386060"
                     /db_xref="GOA:E9BE65"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BE65"
                     /translation="MNGDGASSTGTTLSASTASHRLLLGNETSATKVFVRVRPFSAAE
                     RGKGDAEPMTIVTVSDEHPSHITTLDPSKGYQPKATYVFDRCFNSATACVAEEAQRLL
                     LGNGKDMGMAPTALTALEEVSAEGSINPILLECLKRDQAAVYGHVGRPVLLNALAGYN
                     GCVFAYGQTGSGKTYTMMGPPGVFGATFGGAPAQVRTVAPAKKFRRAATAYNSQLRWT
                     PEASSDDVMDSRFQSFLSVTPRAHVRTPCSGGHMDTMSMAGDAPLPMDCSLSVSSDVL
                     LQRSRRGSRRDSNALCLGEEENLQGIVPRLVRELFAELHQKREQDSSHSFRVEVEYYE
                     IYREKVMDLLSSSSAAAAGANGSGSVELRVRHSKSAGPYVENLTKKHVDDEGEVFRLL
                     RHGNLRRHTASTAINDRSSRSHAIFVLHLVQMRISDDDSASAKVSSKVNLVDLAGSER
                     TGAHSVEGDQFKEGVVINSSLTVLGRVIDALADKSSGKRNVFCPYRDSVLTWLLMDSL
                     GGNSKTTMVATVSPHSSNFDEACQTLRYASRAKQIVTKVVVNEDPQVRQIKLLTAEVQ
                     RLKARLSAEGKAVDNDDDVEVLQERIAALEEELNETRNQLDQKSSELAAICASRHTSS
                     TLPSTLKAGNAGAAGTAKELAKARSDVRRLEAENLLHLQTEQELRDTMERLKTLERKY
                     GQLLSESKEAQETVKKRDREIQEKDRRISELQHQLQQQAAQMQADSPLTSNPSALSPR
                     SVWGKSGETVSTATAAGIPPMALTVNANESGKAAGKKTKKAKAGAASASTAAAPPGSP
                     QRRESEWLNEISRIRAQFEEDKKQLVTQMQERNDAFRKSQLEVKRLKSELKSEQDALR
                     TVEKSLHDQHAEATRRLQEEVQELKRALKDERRNNKDLRQSLTAPEEVQPPFSYAYVA
                     QTVYDEERWRGDVQQQEASAWQHVMQVWQLSQVEAAKMAAVEQQHAAQLAALSEAHRT
                     SESIVSTIRQELEEMRAVQEKANALRERISELEDAATQQREREKHLREQVSDLEGQLC
                     QEQERGKTALQRLEAELKDQRRAVATAEEAAASLKAAHAGEKQQAESAMRAEQEQHAT
                     AVASLQAQIRQAEDKLHNSEEAHRAQVRRGLEQASEHEAALAMLRSQLESSKKAAATA
                     EEVHRGERVALEQRLKQQEEAFASRASVLEQELAAARMQLDRDSRASAKALSELEEQL
                     TAAQAAHNASAEALRLKVERAMAQAADHEKAAQLLRRDLDTERAAAQTAAQEHAALAA
                     NLAEELQTQRKQREEISASLTQQLAELQSRLAVAEETRRTERKRAADAAAAQETVLAG
                     LRAELESVQAAHTAAAQAHEEQLREVRGTQARLTQEAQSNADSLAAQVMELQTRLAAA
                     GRDSENALRKLTEEMEAIRTQLHKSEEARRHQIQRSIERAAQHDAALAELRQQVAEEQ
                     AAKAAAAKRHKEELLKAEDKFSAHHLETSETISALKQQLEQAHHSAQQREADAAALQQ
                     ILQRELDCTRAELEASEKARAAHIQRSVEKAAAHEQTEAKLRAEISCLAAKADATDAA
                     HSTWVAELQERLHEQQCAAAAQLADATAALESERAKAQHASEDHKKVLAAALDKVASL
                     QAALAKSEEAERVQAQRLVEQSAAHDSAIQAARRDLQRQQAEAADTAAAHAEELRGWE
                     ARWQQQAASSKVEIESIRQEAEAQRRAEVDAAVKAHTSAVDALEATLNEMRIRLGEVE
                     ASRTAEAVRREQQASEHAKAVSALQAELQGAHQASAAAAAAHKAAVEQLNDVIAEQQR
                     AKIEEVAAIKQKLLETQRKLTRSEEARRRGVTERAEVATAHTQSLDALRRSMEAEHQQ
                     KLDALTATKARELEAVQMQLDEQRVVAQQLQRDLRDTRRQVQQLVETQNYVGKQVEAE
                     KQANAELRRNLADTAAQQAASAAAATELEATLEQAKASLTQLVAEKTAVSTELTRAIE
                     TAESTRAHLADVEKISQQRHEELEAQGSALANAVATVEQLRAEVSALHSKCADMEKAR
                     AALIEQHEEALVAQQVDTVTEMETQFRAMEREREALVSKARQTEEALRSVVEKQGKQL
                     QQLREDLEFRASLDLCEAEVVERDSAAGAVGSSAGLALAGSGTGVATSTNTSFSGASG
                     SAAVVGGGGFSTILSSLFSRRNSTAAPSSSPAPLGSGIGTDGAHGLPHPLPRPFSNDR
                     GTATTPLRRNASGNLYSMSAYRPSSMMPSSLLFGKSNPAGTVAMGTSAGVSPASRTPV
                     QDAVIPPHTSEQESTLPTRLGSRAPNIALGRK"
     gene            <325061..>326029
                     /locus_tag="LDBPK_190710"
                     /db_xref="GeneID:13386061"
     mRNA            <325061..>326029
                     /locus_tag="LDBPK_190710"
                     /product="glycosomal malate dehydrogenase"
                     /transcript_id="XM_003860201.1"
                     /db_xref="GeneID:13386061"
     CDS             325061..326029
                     /locus_tag="LDBPK_190710"
                     /codon_start=1
                     /product="glycosomal malate dehydrogenase"
                     /protein_id="XP_003860249.1"
                     /db_xref="GeneID:13386061"
                     /db_xref="GOA:E9BE66"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:E9BE66"
                     /translation="MVNVCVVGAAGGIGQSLSLLLVRQLPYGSTLSLFDVVGAAGVAA
                     DLSHVDNAGVQVKFAAGKIGQKRDPALAELAKGVDVFVMVAGVPRKPGMTRDDLFKIN
                     AGIMLDLVLTCASSSPKAVFCIVTNPVNSTVVIAAEALKSLGVYDRNRLLGVSLLDGL
                     RATCFINEARKPLVVTQVPVVGGHSDATIVPLFHQLLGPLPEQATLDKIVKRVQVAGT
                     EVVKAKAGRGSATLSMAEAGARFTLKVVEGLTGTGKPLVYAYVDTDGQHETPFLAIPV
                     VLGVNGIEKRLPIGPLHSTEETLLKAALPVIKKNIVKGSEFARSHL"
     gene            <327846..>328760
                     /locus_tag="LDBPK_190720"
                     /db_xref="GeneID:13386062"
     mRNA            <327846..>328760
                     /locus_tag="LDBPK_190720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860202.1"
                     /db_xref="GeneID:13386062"
     CDS             327846..328760
                     /locus_tag="LDBPK_190720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860250.1"
                     /db_xref="GeneID:13386062"
                     /db_xref="UniProtKB/TrEMBL:E9BE67"
                     /translation="MEDAIDFIQSRPLIGYQMDGSHLNNVLVSLARQQQQLMDTQNRL
                     NDRLADIADDVREIREHQKQLESVIGELGGPEQLHQVRSRIADVERAVDGLVSNVQDA
                     KVVANAAGRDADQAGRLADDANRAALSLRDAVGTLGGDMDRVAHQLEAHRKSISKALG
                     DLDKDRHDLEHQVHEAMQEVLQRAERMERESGVERLRQMLDELSDRTDENFRSVEESA
                     RAVDAELSRQGANQAALRTEISALDERARTALAALSSDIDNKHHTLLDAFRQYEAGWT
                     DLEEHMVRAGQMLASRKQRSPGSTSIRR"
     gene            <330741..>331898
                     /locus_tag="LDBPK_190730"
                     /db_xref="GeneID:13386063"
     mRNA            <330741..>331898
                     /locus_tag="LDBPK_190730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860203.1"
                     /db_xref="GeneID:13386063"
     CDS             330741..331898
                     /locus_tag="LDBPK_190730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860251.1"
                     /db_xref="GeneID:13386063"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BE68"
                     /translation="MPSPLVLTRAAPARGLNVKMFDRKVKGLQRSFVSSPACDIHKLC
                     AQQMLDRRAFVKRDTPVVLEVGAHTGWYLRHMIERKELHGLKQYIQTDISEDRLNRNY
                     EEIKDIIPPEVEFVQICCDEEQPSPFGIPDKSVDMVVSCLSMHWVNDLETSMVNVRKV
                     LKRDGFFLNAMFGGNTLYELRGCFSMAQTETLGGVSPHVSPMIDGAGLSTLVLQAGFN
                     IPTIDLDRHLLLYETPFHLMEHLAVMGESACHYMRQPMKRDVLLCACAIYDTMYKQNG
                     LIPATFEVFHTIAWSPSPTQAKPLARGSGQIPLSSWNSKSRKQLQSVLDEYALNPNDE
                     VLQNKAEDIFKKLREESAELMAKKGLDSRGFERDRDEEARRLDEKPVPPFQ"
     gene            <333845..>335188
                     /locus_tag="LDBPK_190740"
                     /db_xref="GeneID:13386064"
     mRNA            <333845..>335188
                     /locus_tag="LDBPK_190740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860204.1"
                     /db_xref="GeneID:13386064"
     CDS             333845..335188
                     /locus_tag="LDBPK_190740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860252.1"
                     /db_xref="GeneID:13386064"
                     /db_xref="GOA:E9BE69"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR021648"
                     /db_xref="UniProtKB/TrEMBL:E9BE69"
                     /translation="MDYWEWKTDGAGLEVDEVCITVQHGVTLYNKNEKTQRQNGKLSL
                     TTHHLRYNDEADISTVLQLPLELVRRSGQAPSISSGFSPFSSAKIIVPLPQNAYVKLS
                     FRSGGVDNFYAALVGALEKKAWLQTKTKAAASGGGSSSGASPASATPVPSPSPSPPVP
                     RGFGIAGVQQASAQSAAMSETLKDIDDVMNKASKLVNDIRRLRERSEAAAAAGSDAGS
                     ETAVERTTIESIESTLGLGAIVTRNHSNGSDSRFHRDLAVEMHTWMTHENNSKLFNDM
                     PVVPLIELFALYNKARGGDLVSPLDVLHACTYMAAKMSGSCYDLVTLSSGRKALVNRD
                     DSLLLAKLTTVLGPQLVNAKGSSVQDAWKKTSSHRQQQRSGDTSSLVRVPTTSDFPKA
                     SRDLKSVSDVSLAEKMQVATEVAADILTLLMQKGYLCCVDTGFDCYVYTWNIFVF"
     gene            <336059..>337633
                     /locus_tag="LDBPK_190750"
                     /db_xref="GeneID:13386065"
     mRNA            <336059..>337633
                     /locus_tag="LDBPK_190750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860205.1"
                     /db_xref="GeneID:13386065"
     CDS             336059..337633
                     /locus_tag="LDBPK_190750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860253.1"
                     /db_xref="GeneID:13386065"
                     /db_xref="UniProtKB/TrEMBL:E9BE70"
                     /translation="MERVASMLSALKPTLEKHQLGSWKPAEVDRLCAMLREYGKQERR
                     EKCSTRCLNGAATALASLPSSSGAPPSLPSGGDDVEGENDTDEEAFAGAVSEVDRCLN
                     LVRDFLKRRMPFGAVVEPTLPAGTAERQAPQSSCADTTSWKRARSPSGEASSSAPTSN
                     SVHSGAAVVAAPVYAVDAFLYAEGDIEKLVEAKKLAREYCCRCGSTDLGLVEFITHSF
                     SQDQLVYLSCFLLPHLLDVVVASDEASRPLSIADVGSRLGIVLWACAFALQRGLLAPA
                     QAVAMDAAAGDAAPEVNLVGIELDVTFVKISQDVARRFFAQRRRHAPKLDSTPQPAAA
                     DGVDAKLPDVSSSIQLLLSDCFEGAAASALSDSSLVVMHNVFEYFCTTAVEHARCWLK
                     LRRLVHRSGQFLVCSPALEVTLGTFTYEVWLQAWQLENGKDARGTSTPLAWLASYVEP
                     FDTADVASDFLAMRTLSCEGCDNGSDGDKHDEDHHRGRSRDHYHHHGSEEDEEEGEEA
                     SEMAEQIQRIHVYRVK"
     gene            <339518..>340993
                     /locus_tag="LDBPK_190760"
                     /db_xref="GeneID:13386066"
     mRNA            <339518..>340993
                     /locus_tag="LDBPK_190760"
                     /product="transporter, putative"
                     /transcript_id="XM_003860206.1"
                     /db_xref="GeneID:13386066"
     CDS             339518..340993
                     /locus_tag="LDBPK_190760"
                     /codon_start=1
                     /product="transporter, putative"
                     /protein_id="XP_003860254.1"
                     /db_xref="GeneID:13386066"
                     /db_xref="GOA:E9BE71"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:E9BE71"
                     /translation="MGDLYLGMMLITATTVGKIILCALAGMLVSRYFSNPKETLTGLS
                     YISARVFLPCLLFANLSMNVTWEQLSKFYWAPLFALLPMGIGFLSSMLVRAVLRREYH
                     FVVILASSFQNGLTFPVSVLLNLKGIEWFTGAAVVDAQSYIFLYNVVCSIGLWALGDP
                     MIAYAKTKEVESEEANDEELVARRRPYSMDGRVDGEAEGKEKAQSSPHTAAAAQQGHA
                     TAHEQLEWYRPAQASDKPIMLPPGSPGILLDDEMRITNSKLKPRDDRLKRLGRIALTS
                     IQSPTVLSSIIALIISLTPPLQRLAKSPFGEPFVGGMALVGKGAIPLHLVVLGSSVAA
                     SRPKAHPTSSAKRAQVTISSPTTSAPLPTSADGTVFDVSASQPGTGVNALRYWITSRV
                     QPQILFTCCAVVTRLVIIPCICFLALHILVKAGLMPSEKPFLLSMLVAIISPTAINST
                     LICTMREYHVRDYSHMMFFMYLSSIITSSVWLFCILLYLSD"
     gene            <341940..>342647
                     /locus_tag="LDBPK_190770"
                     /db_xref="GeneID:13386067"
     mRNA            <341940..>342647
                     /locus_tag="LDBPK_190770"
                     /product="SNARE protein, putative"
                     /transcript_id="XM_003860207.1"
                     /db_xref="GeneID:13386067"
     CDS             341940..342647
                     /locus_tag="LDBPK_190770"
                     /codon_start=1
                     /product="SNARE protein, putative"
                     /protein_id="XP_003860255.1"
                     /db_xref="GeneID:13386067"
                     /db_xref="UniProtKB/TrEMBL:E9BE72"
                     /translation="MAAVVDASGTVEGELRQAKDTLKTLCTLAEQAERGAMVDYGLAQ
                     RLMHEVSDRVRPLAQGTMNSFAGTTAVSSSGATLHARAGAGCSQNVTPLQRRRAEQVL
                     SEVKLIETTLHRYAKKAEQQATYVSDLKSLVGNGTGAYRQNYEAMDHLEREKKSLQYA
                     RQRMQAMESESRDVLAALQDQGRRLGGVGSKLGNLLETLGVSNMTILQIVRRNKADAW
                     LVYGGIALLLFFLWYIW"
     gene            <343346..>344104
                     /locus_tag="LDBPK_190780"
                     /db_xref="GeneID:13386068"
     mRNA            <343346..>344104
                     /locus_tag="LDBPK_190780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860208.1"
                     /db_xref="GeneID:13386068"
     CDS             343346..344104
                     /locus_tag="LDBPK_190780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860256.1"
                     /db_xref="GeneID:13386068"
                     /db_xref="UniProtKB/TrEMBL:E9BE73"
                     /translation="MELGQTQRPRAPVEPFQEYEPRRKCTVCCGLRCAAFVGTTTFCV
                     SLVCNAVVLGGRVTDGRGWRGFLNRNGLIALPAAAITFTHQVLLSESLWSKNKKTVTQ
                     VNTLSALSNMSLWAIGTVLCTTTARRYLPARSRAYRLALWEYHRARRGCANPWMPTIF
                     GRVTEDLDWYNVMWTLTLYHLLWGMVSVMLEKELGSHYAMFYRNWQYSRWCSPRWREW
                     RELEVRRHVDTEQAVAPNRWGTFITNDKWRTRHF"
     gene            <344837..>347062
                     /locus_tag="LDBPK_190790"
                     /db_xref="GeneID:13386069"
     mRNA            <344837..>347062
                     /locus_tag="LDBPK_190790"
                     /product="signal recognition particle protein, putative"
                     /transcript_id="XM_003860209.1"
                     /db_xref="GeneID:13386069"
     CDS             344837..347062
                     /locus_tag="LDBPK_190790"
                     /codon_start=1
                     /product="signal recognition particle protein, putative"
                     /protein_id="XP_003860257.1"
                     /db_xref="GeneID:13386069"
                     /db_xref="GOA:E9BE74"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013699"
                     /db_xref="InterPro:IPR026270"
                     /db_xref="UniProtKB/TrEMBL:E9BE74"
                     /translation="MSEVLKLEKTLRKQTTSDDVQASKIASTAERILSLQPNHVYAMQ
                     CKSVALLHSGRFAAALSVLENLQLEATPFKNSATFHLHKAYCHYRLMQYTEARAELQE
                     RQQRGPMSAAARHLLAQIHYNLEEYAEAAAMYAELVADGAYRDDVEKQELLTNYTASL
                     SACAPEKVAAVVRDEADEKTPDLLFNLATAQVEAQNYEAAQATLLQAEQLCAAIFPKS
                     KLRSLKDALAASSEVLQAQLGVQLGAPTSIGGSSSIATSPERCFFNEVCSNWVQQAYV
                     AFMRHREDDARRIVDLILTCKPSSAVTSAVAGILYTALQRSADFFDSHRKLKAAQHVK
                     VLPRLTSKQLIAVQYNTALLQLSAGALDRCTRTVEQMEKAHPNNELTHSLRLVLAVRE
                     LKKKKPLPANSPSSASRPTRTATDSARDVQECVRNYEAEATRHQGAGSSEAGNRKRHR
                     FLQLITAQLFLEQGDLAHAVETLKALEDSTVARRPTTVMTMAAWEAQIGDVNAAMALL
                     RERLTATTCGYSIAVKKAVLLWAVQDLAMARGHYAAVGQLLKAVQAADASLEKDREVT
                     ALLVICLAETDLAAAKRVIATLDADAAAALSGAGSNSHTAPSDKQIEALVRGNPGAAA
                     MSELGYRRVTAVDQEGAAADGGRAASGAGLPQRRRRAMRRPAKNMDGKPDPERWIPMS
                     LRSYIKDLPERRKKELRRLRAFDQEQKRRAAAAASHKQKKDEQLQRQHVAEASPVASA
                     A"
     gene            <347915..>349753
                     /locus_tag="LDBPK_190800"
                     /db_xref="GeneID:13386070"
     mRNA            <347915..>349753
                     /locus_tag="LDBPK_190800"
                     /product="ATP-binding cassette protein subfamily F, member
                     2, putative"
                     /transcript_id="XM_003860210.1"
                     /db_xref="GeneID:13386070"
     CDS             347915..349753
                     /locus_tag="LDBPK_190800"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily F, member
                     2, putative"
                     /protein_id="XP_003860258.1"
                     /db_xref="GeneID:13386070"
                     /db_xref="GOA:E9BE75"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BE75"
                     /translation="MGKPKYLKKKQAAAAAGSEEGADKDVGDNTESTNGSPTTANALG
                     KKSEAAKEEPHSSGAMVSFANPVYRQGVNDILVEKLDISYQGNAILENATLNLVSGHR
                     YGLVGPNGCGKSTLLRVLGCHEIPFPSHVDRYYVSQEVEASDMSALDAVLAVDKEREK
                     LESEMEDLALGDQEDPHVLSRLDDIYKRLDELDADTAAARAGKILFGLGFTKEMQRRP
                     TKAFSGGWRMRISLAQALFINPTVLLLDEPTNHLDIEAVVWLENYLSKFKKTLFMVSH
                     SQDFMNNVCTDICHMHLKKLNCYDGNYDQYCITREEKESNQIKKYQWEQNQIKNMKDY
                     IARFGHGSAKLARQAQSKEKTLAKMTRGGLTDAVVKDSRINFEFPCAGPLPPPMLQFR
                     EVSFNYPGRPSLFTNLDLGVNMDSRICLVGPNGAGKTTLTKLMCRELEPTAGYVAKNA
                     HCVMARFHQHFVDQINMDLTPLEWMSQEYPEVTQPPILRSALGRFGVSGKAQMTPMKT
                     LSDGQKSRVVFAWMAYKRPHFMILDEPTNHLDIESIDALADAINSFEGAVVVVSHDLR
                     LLAQIADEIWIVEKGEAKRFNGDIADYKEHVQNEVSRMMQSYAASL"
     gene            <352515..>355124
                     /locus_tag="LDBPK_190810"
                     /db_xref="GeneID:13386071"
     mRNA            <352515..>355124
                     /locus_tag="LDBPK_190810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860211.1"
                     /db_xref="GeneID:13386071"
     CDS             352515..355124
                     /locus_tag="LDBPK_190810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860259.1"
                     /db_xref="GeneID:13386071"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:E9BE76"
                     /translation="MPVHYSEAVERAMAEVCPPRDALDAADFDPVVYLNSRFPDEASL
                     GALPAFLDEANERLRKTENQLLKAVEQQASNATSAESDLKGAKEAVAQLYVRVSEIRT
                     QASDSEEIVKDLCQNIRELDVAKTNLTSSINTLRSVQLWMLQLQVLSSSFEKRRFSQA
                     RDALQEALKYSAMFAKMKDIPKVKELNDKQTQLCRQAEYYIRNTVFGEVNLEAMDDSR
                     MAEACAVVDLMEEESKKKLRDRFIDKLLECYSLRFKRGTDEAKLERTERRYVFLRGLL
                     ERYDSVFKNVFPRHWCVPQELCVTFCLHTKQELDYALREAANKIDVVVLTYVIQKTID
                     IERDLTQMMTWKDEFAIKRKLPVYKYNGMILSAFKAHMGLLVQNEDRLMREALAQPLI
                     GSGDSLCPGWNSIDEETRSGTYLPIAEDIFVFIKESLKRALRIAQQDVLLEMAEVWRR
                     HLIELAQAVSALLPNPASSPLERRRACIILNTADLCQSTSQDLGDEVCARSEAPPREV
                     AFDQVKEAFSTVYTKSIQSILQGLELQLAPMLVDYGNGGFLPKKGTAAHGANGGGAAD
                     ESKLVRDITATVHDAFLSCAAVMPPTALRFLLDKMAATFIPEYGNTLYRLRRLPDDGI
                     SCMRVDAAALEKTFLQLPNYNDPARFPASALTGYVRLVRKEFDQLNRALKVLQVDART
                     DAFIEVYYEVVLPENRSIHNFVRLVELKGLRREDVRAWVATLSKRGVVEATKRDFQRE
                     ASLGLSTGVSSGAAGGGASIASGVSLNFAALFTRDASASLAPPRLPNASSAVLPATGG
                     HFSLSNLVSTIGGGGMNGAAASSDGAGGTAATAEDGAAEEERLGSIFTTMARSTATSM
                     NFLNKLKRGDGKQ"
     gene            <357514..>357636
                     /locus_tag="LDBPK_190830"
                     /db_xref="GeneID:13386072"
     mRNA            <357514..>357636
                     /locus_tag="LDBPK_190830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860212.1"
                     /db_xref="GeneID:13386072"
     CDS             357514..357636
                     /locus_tag="LDBPK_190830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860260.1"
                     /db_xref="GeneID:13386072"
                     /db_xref="UniProtKB/TrEMBL:E9BE77"
                     /translation="MVELAGMKLGIVVGNRLVRDLVHGQHRPVPKEHPKPPETS"
     gene            <358394..>358804
                     /locus_tag="LDBPK_190840"
                     /db_xref="GeneID:13386073"
     mRNA            <358394..>358804
                     /locus_tag="LDBPK_190840"
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /transcript_id="XM_003860213.1"
                     /db_xref="GeneID:13386073"
     CDS             358394..358804
                     /locus_tag="LDBPK_190840"
                     /codon_start=1
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /protein_id="XP_003860261.1"
                     /db_xref="GeneID:13386073"
                     /db_xref="GOA:E9BE78"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BE78"
                     /translation="MSMYQSLIPSDARRAECERVCREHPEQLPVVVESANSSHVRFLA
                     VPRDATVADLEAEVRQTLGTTNKKVALAIEGCSPAATTVVGDIFDACKQVDGFLYVSC
                     AREPSMGAKDFCCFGNTGKYFADIENNPNLLGSL"
     gene            <361567..>361836
                     /locus_tag="LDBPK_190850"
                     /db_xref="GeneID:13386074"
     mRNA            <361567..>361836
                     /locus_tag="LDBPK_190850"
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /transcript_id="XM_003860214.1"
                     /db_xref="GeneID:13386074"
     CDS             361567..361836
                     /locus_tag="LDBPK_190850"
                     /codon_start=1
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /protein_id="XP_003860262.1"
                     /db_xref="GeneID:13386074"
                     /db_xref="UniProtKB/TrEMBL:E9BE79"
                     /translation="MRAVLVRSARARRISFMLSSPHVVAPFSHFSLPRPRVFVPPSRS
                     LSADALDLPFVSDAPPVASVQPTTHILRIPGILLPWMARVCFSFH"
     gene            <363299..>365320
                     /locus_tag="LDBPK_190870"
                     /db_xref="GeneID:13386075"
     mRNA            <363299..>365320
                     /locus_tag="LDBPK_190870"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003860215.1"
                     /db_xref="GeneID:13386075"
     CDS             363299..365320
                     /locus_tag="LDBPK_190870"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003860263.1"
                     /db_xref="GeneID:13386075"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BE80"
                     /translation="MTSESHLEEADDNLHNRHADTQVLADVDNEYSDEYVHPGARRLY
                     VKLPFMQHIPIFSEAATSYGPGCIGSLGICYLLCKGIANSIIGYAKQPLFMNRYGISG
                     LRYQRLSSITSMGWSIKAFTAMLCDAFAAFGYTKRWYMFASCLLGGVFALILGLLPAK
                     ESSANTACAFIFLTAFSKANVDILSEGLYSRLMRRRPKAGAALVSWIWWFIMVGAIIA
                     AAIQGPLSDSSMVQVGIFIAAGLQVVCALIFFFNLYEERTNRVERWEDALALEAEMRA
                     ELGMDVAAAQARLRAQMQLAHKSPCSTSTEVEPITMPMKDVAPHEGQRLKVSGALVTE
                     LADTAEQDDEDLQSLEAAARARVGEPITCLFGVFEVNRDVFGRNWRIFAYSVIMTCAV
                     VAMTCGNILADTLGLLILCVIVSVVCCAASFWALPLVIAKANVFGYLQMVFYLQLPGA
                     LDSFYLADEECLPGGPHFSYTFYNTVSALIGNVGGLAGITVFNYIFSKHSYRLTLVVT
                     TTVQILASVFDIIMVKRWNIAIGIPDRAMYIMGDAVVFQVCYYLTWMPVVILLSRLCP
                     RGSESMVYALMAGFANLGETMATSIGSLIMEYAWGIVTTPPCDFSNVPMLLLVGHILA
                     PILIIPLSLLLPAARVCDDINVDGEAVKREAKKYISHDDSDSSSAAGKH"
     gene            <369357..>372074
                     /locus_tag="LDBPK_190880"
                     /db_xref="GeneID:13386076"
     mRNA            <369357..>372074
                     /locus_tag="LDBPK_190880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860216.1"
                     /db_xref="GeneID:13386076"
     CDS             369357..372074
                     /locus_tag="LDBPK_190880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860264.1"
                     /db_xref="GeneID:13386076"
                     /db_xref="UniProtKB/TrEMBL:E9BE81"
                     /translation="MDVLLHVVQTAAAPPASASSFCCDRTRRTSLNVPAVPSANISST
                     SFTVGSLWLSHREALLGSNVAARWSVALCPLAEDENANGSDGDPPVCVSAASPGCPPA
                     SPIPSSFVSISAASVDITDLRGRRPPDGHATNSTVNLLCEKLRHLKDAIVRAGNADTP
                     PVARAETVFFCGSRLGTRKDALYLTALHRLLVESLLIVKGRAFSPPSPPLDVDVSLVD
                     YDEGWGAGDVLAADVVTASADGTQEQRSQIAWMPLANLLVYAPRPRSTMAATCTSTIA
                     RSASPTEPSADSDLSVVQVGNLVRQRLQVWFDRIDSATSAFPSAPASPSSPPAAADRL
                     RHLDRNVVLFTLRLRSYTNSSTPTLQARVSAAYFTLVLLPEYGAAPPYGEAGAAGAAD
                     GLSSCRASAALWREFEALSAFMRSLPQGRHRRDDEHKRGGVKEHGRVTAAAVQGKMRA
                     AALRRSRWLTIIARIHDPQTSLMRTRVTGTGERGADDFMGCFLKNSTVRSFSWIGCIA
                     AAANHQRATRSTLAFLSRLQPSQTAQRGWLASVEERAPESAADAHVGRHHRTHKNVAD
                     NTKERVAPKAEAASSSSATSTPPHPSPRPSANVPQPCASPRLHGGSTTDINSSGKVGT
                     AVASHLPPVDELSTAAVSVAAPSRAGHARCGADNDDDASSADAGHEPASPPAQVDALI
                     ASVRVYASVLEEEVRRLRRRLQRYEAPSCDCRVSISDPPVHLTLQEVQGCESANRLIG
                     LSTPHTTSPDICDSLPQSVRAAIDDLRTDARFPQALHVKLDALTQRLANLCTAAVRVR
                     RSGDADVPTAMQQRNEKSDDRDAYVAQLEAKVALYEQKLVLMDYYVAPTLMQCVDDLD
                     QWQKHQHRQQRTRATRTGGNSNPFTTAANAASEVTPIRSVGAAEHAFRA"
     gene            <372865..>374865
                     /locus_tag="LDBPK_190890"
                     /db_xref="GeneID:13386077"
     mRNA            <372865..>374865
                     /locus_tag="LDBPK_190890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860217.1"
                     /db_xref="GeneID:13386077"
     CDS             372865..374865
                     /locus_tag="LDBPK_190890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860265.1"
                     /db_xref="GeneID:13386077"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:E9BE82"
                     /translation="MSHFGADRSSAQPVPPIDSFVEVLPVAPQVERRRGILRFYGLTD
                     FAEGEWAGVELVGCEGRNDGTVKGLFYFKCAAGQGLFVRPNLIAPYAPARPAPTLEAA
                     SAKIEALEEELRVVRREAVEQERLKDSLEASLHSMQAELEQLRVAAVQAAAKGDAKTE
                     DDDDKLAVQVQLESVRLEFQRQLETCEAELKAAKQSAIEAAAACAAAEKREQQAESAR
                     QCSDAAQAALQTRNDELQTELTRLQAEPATAVTQQSQLAQNSSEAAAEASAACAELRA
                     ALRAKEAELLQLRAAHAEMSRTHEQLQERKAEEQERVQAAEKRCEEQQRWQLQDTARE
                     DVLAAHASEIARLHAEIASVKTEKEALAKAQRDKEELQELCQLLEEELNEQKAQSDAL
                     TRLVQELGAAKAAAEAAVEGAKQSAAQERARLLRELEAARAPEVQVTAAGAVSEGGVT
                     GRSSTSSTATAEKPSLEIALQQCRGELDEARARILQLASSQQVVQELQRRCEELEETM
                     RVQRAEAQKSDDVARATLAAAQQHHAHQVALLRDACEAGRREAASMAAQLNLAAIPRE
                     ASGGHSTAAAAPFVSPLDAFREARYEARIRSLEQLLLECDATRMSSAIWDVPASQTRT
                     WRDSEVPLALLKEPVGRLLDFSTRDACAASAKALFQTPTASP"
     gene            <375854..>378274
                     /locus_tag="LDBPK_190900"
                     /db_xref="GeneID:13386078"
     mRNA            <375854..>378274
                     /locus_tag="LDBPK_190900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860218.1"
                     /db_xref="GeneID:13386078"
     CDS             375854..378274
                     /locus_tag="LDBPK_190900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860266.1"
                     /db_xref="GeneID:13386078"
                     /db_xref="UniProtKB/TrEMBL:E9BE83"
                     /translation="MPSSPSAPQRKQQQQQPWTFSAYHTVVLTNFVSALQAEVRCQQD
                     AYDHAVEVLHTSADTIPASGMLKLGIPLYDTHEEQIQALQDKYALATLETGALVALGP
                     YRLLHTLKAHVTRIEDERRAGAVAAGNGGGVRKMRVGRAPFVRKSKTSIDTATLDGGK
                     AGQTPQRRGVPPMSVRIKEERIDDDKRSGVAQQRQSLSEHSPLVSQSPLSTAATVAKA
                     ENPSAKGASVSSAGGAGGGGWGDGCPPSWMTLKAEAAEPPPSSETYNGAYFVPCPTPA
                     GAPIARYVSSSVCLLSANNAAQSPSAPLPPLVAPVNCGTKVMSSASKKKRPAALPSQA
                     PKRCRSVTVSQANAVATDETPFLSQAQRAKMVRMQEHVQFLGQASPPSSPSKEKLEGD
                     RALRLWWRVWPSSPSLLPPDAEESGRQQRAAAAPPPAQHACVRPTPAMVAALIQVAEQ
                     NYKRDCERCAAQQAYLATLLVAAESLRVGGAAAGTGDTGNAGQAPMEATLESLHPKAV
                     RQLQDELSSKQSKLGSAYAERLALLRELAEALRDESAVCVDEATASEAGEVKHAAPSS
                     TPHSQYRAASPSSNRKRSRRASSTRHATRSSPTAVDVEVLDADRRGGEQAVANASTRS
                     AAAGASALELLHSSLTDPASLMRKVHKARESLAFFSSETSSAEVTLGSRSQASSEEAL
                     DLPNGIVGVNLPSLEHDRNAPELAEYLWPEDLDARIRHELRGVVSVKSRNPEASSIHV
                     VLSAARVQQLEETARAVSTVDPVSQLRTVVPPLVVGSIMAHPKFVENGWLYVHGRGET
                     IVAGVELN"
     gene            <378962..>379300
                     /locus_tag="LDBPK_190910"
                     /db_xref="GeneID:13386079"
     mRNA            <378962..>379300
                     /locus_tag="LDBPK_190910"
                     /product="dynein light chain, putative"
                     /transcript_id="XM_003860219.1"
                     /db_xref="GeneID:13386079"
     CDS             378962..379300
                     /locus_tag="LDBPK_190910"
                     /codon_start=1
                     /product="dynein light chain, putative"
                     /protein_id="XP_003860267.1"
                     /db_xref="GeneID:13386079"
                     /db_xref="GOA:E9BE84"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:E9BE84"
                     /translation="MSGTRVLIKESAMPVDMQQDCADCAAHALFTLKLREQTDLAQFI
                     KKELDVKYGGQWHCIVGHSFGSCVGHDEAYFIYFEINGIFFSMWRMDVTLEAKQVPIN
                     SAGRTVPASA"
     gene            <380213..>380818
                     /locus_tag="LDBPK_190920"
                     /db_xref="GeneID:13386080"
     mRNA            <380213..>380818
                     /locus_tag="LDBPK_190920"
                     /product="peptidyl-prolyl cis-trans isomerase, macrophage
                     infectivity potentiator precursor, putative"
                     /transcript_id="XM_003860220.1"
                     /db_xref="GeneID:13386080"
     CDS             380213..380818
                     /locus_tag="LDBPK_190920"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, macrophage
                     infectivity potentiator precursor, putative"
                     /protein_id="XP_003860268.1"
                     /db_xref="GeneID:13386080"
                     /db_xref="GOA:E9BE85"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:E9BE85"
                     /translation="MTRFSSLHSVLATAATLLLTLCVLSVEASYWSEEVNRVRTYAAV
                     NYLERIAKQPNVSALPSGLLFTIERRGFGDRAPAAEDKCEMHYTIHYRFPGIVESTRH
                     HPYPVRRSPSQLIPGMAEAMQLMREGDRWYLHVPYQLGYGKEGCKEKKVPSLSNLRVE
                     IELYKCESASGKTSAEIDAYLAKYMKTRIPEKAAPVDYTDL"
     gene            <384477..>386768
                     /locus_tag="LDBPK_190930"
                     /db_xref="GeneID:13386081"
     mRNA            <384477..>386768
                     /locus_tag="LDBPK_190930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860221.1"
                     /db_xref="GeneID:13386081"
     CDS             384477..386768
                     /locus_tag="LDBPK_190930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860269.1"
                     /db_xref="GeneID:13386081"
                     /db_xref="GOA:E9BE86"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9BE86"
                     /translation="MTGVLPEMQRLHVRLTQLVRVLRRRVARLCVLRERARLSGDDVS
                     EVVPASPLLPRRPSPLATASPVPSGVHRHRDTVASNGSSSIHGGVAAASLTNAEGTTG
                     DVDAIGTSADGHQSQRQTNPMHEPGGVMPSPRNGISSRLASARRYTQQQILDNDSEWC
                     DAGTFRSSRSTTAQSTPSLQPCLPPPSLQFFEEDELDDDGRASLLTCSSMAARRSYTA
                     RFRPESTPPSVQTTPNMLPAYSAPYARSDNGGMLSLPPSTSAVGRMSLQQQQQLTSSA
                     KPFSGARTACGSATSPLEGSALPPTLTPAAPESGLSLSKATPPTVVDDTQQQETRAAL
                     SAGAPQPLALTDEEKKELRRLSRRVAELYSRRGLLLQQADRLLCRHAQQHERWEGNEE
                     RRGCYRCRRLFSYLTRRHHCRRCGRLCCAECSRYVGKKQDTSYVAAPQDTGRASVGVE
                     HRVIIKSEYTAHITAEDTHELVEERFDEHTYPRRGYGGAGDSPNLQPEKEAEVQDTVL
                     VLDDDGQLRDPSLEHTEDAADKLHGRSRQHKWVRVCAPCYQNCLRARRNNVLQHLKSA
                     NLCILDDGFYYYHVMTTEELCRLSTALNKPDSFKKQVELMSHVVVERSADYVAAAPGY
                     SAHTLTAAAQHTPDVLRTLGSISAYAFRSARQTANDYVGGYFAGSRTILPDNHMGTAA
                     TAHSLSAGNEADGGGRDDDNDEARSEVSLMSVDDACSDMQAPLKGGTEDNAYEHEDRP
                     DKNTDEDARTEDPCDDGPIDVQT"
     gap             391882..393157
                     /estimated_length=1276
     gene            <393410..>395248
                     /locus_tag="LDBPK_190940"
                     /db_xref="GeneID:13386082"
     mRNA            <393410..>395248
                     /locus_tag="LDBPK_190940"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_003860222.1"
                     /db_xref="GeneID:13386082"
     CDS             393410..395248
                     /locus_tag="LDBPK_190940"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_003860270.1"
                     /db_xref="GeneID:13386082"
                     /db_xref="GOA:E9BE87"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:E9BE87"
                     /translation="MRKVNRRSATSGFACGLAAPVGLHQPRRWYFMSTAAPRAAEDMR
                     IYKSKLPSVMDKVNRETTLYGYLMKRMAAADPKKIAAVQAETGKTLTYPELMKATEHA
                     AKALHQHGVRKGDVVCLCMLNTIVYGPLVYGTLRLGAIASTVNAVATASTLAYHFKAN
                     GAKVVLGMHFFQKQLAEAVALVEQETGRKVQVLYPEEFFKTDAPEIPADYDGLKGATP
                     NDTVAILFSSGTTGMPKGVQLTNRALIACSEQSASAFGVGSQDTAVTVLPLFHVFGFT
                     ACMNCMFAYAATQVVMSKYSVEDYVRAIEKYKATVNLVAPPILISLVKNADKVKRHDL
                     SSLKRFCSSSAPLGADVVDTVEQLIPGCAVTQGYGMTEMAPTVTAPLWGQRCTPGCCG
                     SLIPDTELRIVKVDDSQQSGADKSCGIDAEPGAEGEVWVRGPQMMKGYLRDEDTAMCM
                     QDGWYRTGDIGRMLETDELMITDRLKELIKYKGFQVSPASLEALLLTHPWVKDCVVIG
                     VPDPRDVSFENPRALVVLQPSVSPEDAVRASDELYRFVMISMPPHKRLHGGVRVVDEI
                     PRNAAGKVMRRQVRQDEVALLKGQNSDSGAPETTKEGTATTTTAAA"
     gap             395262..395360
                     /estimated_length=99
     gap             399248..405210
                     /estimated_length=5963
     gene            <405413..>405571
                     /locus_tag="LDBPK_190950"
                     /old_locus_tag="LDBPK_190960"
                     /db_xref="GeneID:13386083"
     mRNA            <405413..>405571
                     /locus_tag="LDBPK_190950"
                     /old_locus_tag="LDBPK_190960"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_024473461.1"
                     /db_xref="GeneID:13386083"
     mRNA            <405413..>405571
                     /locus_tag="LDBPK_190950"
                     /old_locus_tag="LDBPK_190960"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_003860223.1"
                     /db_xref="GeneID:13386083"
     CDS             405413..405571
                     /locus_tag="LDBPK_190950"
                     /old_locus_tag="LDBPK_190960"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_024329232.1"
                     /db_xref="GeneID:13386083"
                     /db_xref="GOA:E9BE88"
                     /db_xref="UniProtKB/TrEMBL:E9BE88"
                     /translation="MISMPPHKRLHGGVRVVDEIPRNAAGKVMRRQVRQDEVALLKGQ
                     NSDSGEGK"
     CDS             405413..405571
                     /locus_tag="LDBPK_190950"
                     /old_locus_tag="LDBPK_190960"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_003860271.1"
                     /db_xref="GeneID:13386083"
                     /db_xref="GOA:E9BE88"
                     /db_xref="UniProtKB/TrEMBL:E9BE88"
                     /translation="MISMPPHKRLHGGVRVVDEIPRNAAGKVMRRQVRQDEVALLKGQ
                     NSDSGEGK"
     gap             406533..406631
                     /estimated_length=99
     gene            <410957..>412768
                     /locus_tag="LDBPK_190970"
                     /db_xref="GeneID:13386085"
     mRNA            <410957..>412768
                     /locus_tag="LDBPK_190970"
                     /product="4-coumarate:coa ligase-like protein"
                     /transcript_id="XM_003860225.1"
                     /db_xref="GeneID:13386085"
     CDS             410957..412768
                     /locus_tag="LDBPK_190970"
                     /codon_start=1
                     /product="4-coumarate:coa ligase-like protein"
                     /protein_id="XP_003860273.1"
                     /db_xref="GeneID:13386085"
                     /db_xref="GOA:E9BE90"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:E9BE90"
                     /translation="MALTQQVRFASTTSTPSATATATSAAADAGTHVYKSRFPSVMDK
                     VNTERTLYEYLMKRIKAKDPKKIAAVQAENGKELTYSKVIQATDWCARALYHHAKVRK
                     GDVVCMCMLNTIIYGPVVYGALRLGALVSPVNAIAEPSLLAYFMTETNAKVILGMRYF
                     RKQLEEAVAIVEKDTGRKVAIHYPEDFFKRWYIWPVPRSYDGLKGASLDDTVVIPFSS
                     GTGGLSKGVKLSNRALIANSEQLGAAFEFSPDDAGITILPFFHIYGFTACLNAGYAHG
                     VMQIVMYKYTVEDYLKASEKYKATINLVAPPILISLLKNADKVKHTDLSSLKRFCCGA
                     APLGPETVEAIEKMLPRVSVTQAYGMTEMAPAVTVPNGLRHKVPGACGVLVADTELRI
                     VKVDDSQQSGTDKSCGIDAEPGAEGEVWVRGPQMMKGYLRDEDTAMCMQDGWYRTGDI
                     GKFDAEAGELVITDRLKELIKYKGFQVSPASLEALLLTHPWVKDCVVIGVPDPRDVSF
                     ENPRALVSLQPSVSPKDAVRASDELYRFVMSRMPPHKRLHGGVRIVSEVPRNLSGKLL
                     RRQARKDEAELIKAQMEKASAARTKSAKEAANASASD"
     gene            <415726..>418158
                     /locus_tag="LDBPK_190980"
                     /db_xref="GeneID:13386086"
     mRNA            <415726..>418158
                     /locus_tag="LDBPK_190980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860226.1"
                     /db_xref="GeneID:13386086"
     CDS             415726..418158
                     /locus_tag="LDBPK_190980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860274.1"
                     /db_xref="GeneID:13386086"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BE91"
                     /translation="MASVVVVSASYDKQIRLWDATSGRTVKSFVFQDSQINSLFLLPD
                     TGYLAVAGFGALRLYDLGTFLHSGGGAGTGSGAGTGCSSSSSSTNQAPPVYSSFESQS
                     SMNFTSLAAVPLAHNCNNDEQSSTMSGSSRQLTDSTTSTTLNDQLLSTVAMVDTAALL
                     GSAPCREAAFLLIATSEDGHIRFFDTRSAVTLRMLKDIATGAAITCSAVSPDRRYLLT
                     GNQMGQVSMWHLPSIVASVALEMKGLSHHKAAAASKISDCSPITASGGAGTKAGEAQT
                     AKAAAVASAEEERAKAFGRAPLQDINFANDYSAIRSIAIEPLGRWAAVATNVGKVHFI
                     RLARDASVRGSKAATASSRSATQPLIIGVATSNDLPVTPPGQQDPHAMSLSGSVQPSP
                     YKSPGKISASESTSGVPPLRLTLMGSASSYGEGGAANNSYHGPREAIYRSALVVNELS
                     SNAQRASDMSGDGIGGELANTRSTPSGAASHLNSMGAVLLDHVEQQQNSNRSRSSCPG
                     GHASAAQDAKHEQLAQPSAATKLAEQLEMEVFDTIQAHYKYILRVLISPNAELLVTCS
                     ADYSVGRFLVPAALRISSSTAASARTDTNAGSKSSALAAANAPSQPASTRPSGTRNGD
                     EGTGESENVDSRMPCFVPTQALAPTTVSHTGSGDDQQVQVQVQQHQQGGTTDSKTDSS
                     SPKETETAAAAAGNTNNAAAPDAAASGPLIHSFDGIASPGLGDGVSDESPQPCMEFQS
                     LKPLTGHNRWVWDGVFSDCSNFLFTASSDNTLRMWNGLRTERPQSVSFVGHTKPVVAV
                     LLCYDKRRLSIG"
     gene            <420461..>422038
                     /locus_tag="LDBPK_190990"
                     /db_xref="GeneID:13386087"
     mRNA            <420461..>422038
                     /locus_tag="LDBPK_190990"
                     /product="tRNA pseudouridine synthase A-like protein"
                     /transcript_id="XM_003860227.1"
                     /db_xref="GeneID:13386087"
     CDS             420461..422038
                     /locus_tag="LDBPK_190990"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase A-like protein"
                     /protein_id="XP_003860275.1"
                     /db_xref="GeneID:13386087"
                     /db_xref="GOA:E9BE92"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BE92"
                     /translation="MFADSARHSRWMQEQLQQSRRSSVYTEETAAPRLVRSSCSAVNA
                     NQRGYAVDEDEDGSAVSDAADATAPTALAATAGADVLEQELLDDNFLYYPPLAAIGEA
                     GAAEATHTLPSGEPERYVPGQQVIPPGMTRYRVDVQYQGSDFDGWYKSVQRTRNSKDA
                     APAGNTATAAADYGTGSRHFAKVVLEEALAVALDVPTVSVVAAVIPETGVSVRRLTCH
                     VDVPSEVELQPRTILQRATLWLHQRRQPLAVLSCHPCRNQDFHARHSGVRRVYCYRIL
                     NRIAPPLFDAGLQWHVDRYLDVPRMQRMARLMEGTHDYGFFADSKMANALRRAAASST
                     GSGRGGPVVSSAYSAEHERLTSHGLRRGEAPAAPKVTVERGLSQLERAAALPTFNEYG
                     QRVITYQAKPHEYHKARTNLPTIRTLDKIEVVRQEDEVLIWFVGQSFLRHQIRNMVSA
                     LKAGGHGLWDDQELQHAFQSGFEVSRKKFKRERLSPAPAHGLTLWDVEYPTQHRSDFV
                     PYVDAGPYEPVDVSTQH"
     gene            <423081..>423968
                     /locus_tag="LDBPK_191000"
                     /db_xref="GeneID:13386088"
     mRNA            <423081..>423968
                     /locus_tag="LDBPK_191000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860228.1"
                     /db_xref="GeneID:13386088"
     CDS             423081..423968
                     /locus_tag="LDBPK_191000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860276.1"
                     /db_xref="GeneID:13386088"
                     /db_xref="UniProtKB/TrEMBL:E9BE93"
                     /translation="MYRAHSKDINRNKSFHPLTYRNLRRVEQLKEEAELNKQKAEERQ
                     KELQRDQEERRYDELVLTNSADSLSGELARYRQTRSIFAAEYEADAQAAKDAPVASPH
                     SPQVSKPEVQLKTSTGASFPVNSFLRKFKKEESYGSTCVMVKSEARDDTAAAASRTVA
                     SVEAETSMRKRPRDDAKSNSPSSTHNGSGYGAGATKRRGDGDESAPATGFVTSAEAAQ
                     LRKELNLAQKQRHDPLMRVKEYQNSCVAAAAARQLSHEQATGAVAKHEDDKDKLQSRI
                     RELLALKKKKGEPRGGRYA"
     gene            <424837..>426738
                     /locus_tag="LDBPK_191010"
                     /db_xref="GeneID:13386089"
     mRNA            <424837..>426738
                     /locus_tag="LDBPK_191010"
                     /product="phenylalanyl-tRNA synthetase, putative"
                     /transcript_id="XM_003860229.1"
                     /db_xref="GeneID:13386089"
     CDS             424837..426738
                     /locus_tag="LDBPK_191010"
                     /codon_start=1
                     /product="phenylalanyl-tRNA synthetase, putative"
                     /protein_id="XP_003860277.1"
                     /db_xref="GeneID:13386089"
                     /db_xref="GOA:E9BE94"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:E9BE94"
                     /translation="MPTLAVAKDYICRLIGKSYTDEEFNDLCFQFGLELDDITSEKEM
                     FMREQGKSAKASVAPAEAPAHLSEEKLYKIDTPANRHDLLTAEGMACALKVFMGTMPL
                     PNYRVLNRANPLYRMTVEKSVKNVRDYVVCAVLHNIRFNERSYNSFIDYQEKLHAGLA
                     RRRTLASVGTHDLDKVNTTDFIFACRPRETIRFVPLRQTRELNCSGNGLAQYYAEDRH
                     IGKYVPLISSFPTYPVVYDGTGQNVLSLPPIINSRYSAISVDTRNIFIECTAPDHYKA
                     QVLVNQLVCAFSAYCEDPFTVEAVQVNYEEPTPDGTRSLVTPTMETKEMTMSIARLNS
                     IIGIEMKSGAECAQLLKKMMYTIKETTESEVTVTVPPMRTDVIGVADVMEDVAIAYGY
                     DNIAYVECKTHGPVTQTPLSKVAQLLRTEMACAGYTELLTLSLCSRADAFESLGRVDN
                     DVAAHIANPQTMEFQVCRPSLLPGILKTLATNKSKPLPQRFFECADVVLLDNERNFPP
                     VLELKADYASCGARNQRHLAAAHCNGSSSGFESIHGLTELALLKLGVPSKAEIAEDYE
                     GDYYTLEKGEDGAFFPGRAMDIILHRAGQAVRIGHLGVIHPNTLKAYDIPSPCSYMEL
                     NIQFLCVPL"
     gene            <428935..>433038
                     /locus_tag="LDBPK_191020"
                     /db_xref="GeneID:13386090"
     mRNA            <428935..>433038
                     /locus_tag="LDBPK_191020"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860230.1"
                     /db_xref="GeneID:13386090"
     CDS             428935..433038
                     /locus_tag="LDBPK_191020"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860278.1"
                     /db_xref="GeneID:13386090"
                     /db_xref="UniProtKB/TrEMBL:E9BE95"
                     /translation="MLRRTFFRSSRLGPMWPPGVEGPGKLSSSVLHTMGCAKCDGCAV
                     RRVDVLFSPPPIAASSISAAAVAADSVSRAWRRSCGTVSLARTCAVACQRRAISFSYG
                     DRVPCIRFNMSTERLARATAQPTLPTNANIFMMDVRKGQRKSKRVNPKSTMASIITAH
                     RAEAQKAKEELDKDDAYTPPLIFLFRTDDTKKQAARRQEQIDAQLDALGAFGEFRACV
                     LDGIKSRHWTRYIDSPTTPDRPAPDKAESASSRDAPPTASVAAAAAAAVDPAVVSANG
                     AGDAPASPLPISGDFAGREGKSSTGAAEAPAAAVSPRVSAAGAAEGATGAAEEADDLE
                     GEDEEVWEEVELDEGEEVVEGGDGGGGGTNSAADGNGAGASQCWEAATYVDRAATPSM
                     RAKEARTTTPADEKIITAPSTAKRSVNTVWAHVKSQTCSGGSAASAAALVAAAAVSPS
                     KHDNPVEEESVDVADLDGDGVAADAASPAAPGPADHTDSADGVNIPDTPRRSGPERNN
                     SGSVFLATAHAPPLAEADAKAAALTRSTDAEALLPLEEFEEFDIDGPLSESVTAEAPA
                     AAAVPALTDATPEALSAATAKGAESWATEHAAAGSVSGDDGISAAEEAAGEESASAHT
                     GAPAALGTAAKSLTEVLQEDAAAGAAGDGPALTASEGDSADTEVEGKDAEEDAVATTA
                     AEDNSDAVAFTVAAPATPVSPPKPSISMPVYTQVVSRLYYGATTVYLSDRAFIELPAT
                     ANVLVIDHLDWDDAHLAAIDAALEQVDPVAGHVLLYPDAYAPQSEHVIGNINAYRRSL
                     LPFIFVFRTQLSNEAAMAVQHRLANALHVRPTLDSTAQQSLVAGQNDRTSVCVLSAAE
                     SEKGGENPMLAPQPRKATPASPKPSPAEPAPARTATATKVAGAPRRAVTAPVGESGTA
                     ATASAPPLPRTPPAATEGKHRDASTRGVADDAVQHLWDLLNSVSFDASSKKSAASAAA
                     LSAQVEVQRSHHGGCNGNGRAAAEWQQRISAPGASSVRGNADQAEPVYRCPAETTTNI
                     LTRTSDTRETGNGHITASTAVDDAAPSQPSRLAYVPSLLNSEVTAPFLNASARADAAG
                     GAGPAHRTLPATTLQAESAEVNESAAMIKGGLFNFGAIAFGRDNGYCAAEVPRLRRAS
                     GSRWGMNDDDDDVDSEHNATDAADGAATSSTFGSVSDLGLYPVSESVAAARAEAARIS
                     SQCGGGSPFTDEEIAKIEEEIILAQLREKERKERRSEARRAMRAKAKEAKSQFSCKTA
                     SSSSPVSSAPSATKGSRLWKQQFQGSRSVSDSFKTTATAREQELAEDGLLEDFISSLL
                     VNRNRSKKLKADKVRVSVASASSRGVVRSARRTLATATSSTGRGIKQ"
     gene            <434404..>438174
                     /locus_tag="LDBPK_191030"
                     /db_xref="GeneID:13386091"
     mRNA            <434404..>438174
                     /locus_tag="LDBPK_191030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860231.1"
                     /db_xref="GeneID:13386091"
     CDS             434404..438174
                     /locus_tag="LDBPK_191030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860279.1"
                     /db_xref="GeneID:13386091"
                     /db_xref="UniProtKB/TrEMBL:E9BE96"
                     /translation="MLRLVGCRLGGRVRRRSKSVIIDAAVNAVLAELRAKATKAKKPK
                     RAAASKPPAAVKAPAKRAGQLELPPAGAPPPPATTAAPAKAKTRNAGKNLVDTVLSGV
                     NCTLLKHVLSSSSSSSTSTDIPDVGRVLRLDYTTIARKHQLAHLADILLVNRIHAAVV
                     NDTHERTADGTSGAAADASSPLVVLVETTLPREDAEVQEFIIRNALSMHPLPPEVATE
                     DGQSVHTPPLTVLVLGDEQTKRVRTLAELPPVPPRVPAAVPLATAPATNSHDSAQAVS
                     AAPASDRSAAAEAAPSTTCSSPARCSLSGAPAQVAPQRRGNPKEANSSTPPKADVDET
                     ATAAKAVLPSASSPVAAAASAEPVPTLAATAAAANTAPPAKTAASEANTRRVERVVRR
                     VARVSLKALAAQKKKRRPATPSQARLVASIAATVSGKRAAVARPPRLLSVDSSKEKLL
                     WASQPGRPLPIRILEPLISPAVYEEMRTAAAADVSASSAASPLTMHMVVYGVSKESSA
                     STVWLGALQAAADLTSAMSSGASQLPAEVAELAGLDPARVRRVSERKSSRKRYAMKAA
                     AASSVADDGAAGTATTAAPMSPKPYVYILIHTRLSREDAAVLQQELQYQLTQLKATPA
                     GAEVAGMSVLTADDVSPAHLSYVLEHSMVEGGGNSVKMSAVRRGSKSGMVPSAAPTLS
                     AEAAEVSNTFQEVYRLLSEQPWLLSPPLQWETPSSSSPRQQHPDTLVADAIRIAALTQ
                     VLVQRKEAQLRGHFEAAQQSSAMNADSEAVARAAQRVEMKTMVTEAVEEVSVRHEQAT
                     AHLVKTLSSIVGQWSLEKLSDTLEAIVRDEVKPIMDVLGERLASTPGRNAEAANGEAT
                     PIAAAPALMATPASTSPTDSADVASSVLLERQDEIKSTMSQTLAQLRELSERLSALAA
                     ATTAAAAAKTEGLVDSAVAHPPETAAAPLKSEEEVRLLRDLHELQEQHHSKLSEELES
                     LRSDLRYFASQERAAAEAQAAAPAAAYAATLSRESLDRAVADTVHEITHAIRRDIHAS
                     VVEQLDAYCDVHRSAQNSAREDRRDEEPSTPVLPVTSFELEEMLTRVVDHTVRTSTDK
                     IEDHVRAAMENVYRNERAADPASVTAAASTTSAAESDEALKAALEGLWAQVRAEAAEE
                     EAVKVSQHNRQLLRLLRRQQHLQRSVPGRQPASAPASASSPASPLSYVALEEAMRVVL
                     HPYMAQMQATVAAAAAAAAAGSPRTSVETSSSITSAGDGVEQDHVARPTSRK"
     gene            <442965..>445865
                     /locus_tag="LDBPK_191040"
                     /db_xref="GeneID:13386092"
     mRNA            <442965..>445865
                     /locus_tag="LDBPK_191040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860232.1"
                     /db_xref="GeneID:13386092"
     CDS             442965..445865
                     /locus_tag="LDBPK_191040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860280.1"
                     /db_xref="GeneID:13386092"
                     /db_xref="GOA:E9BE97"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:E9BE97"
                     /translation="MALALSSRKADAGALAAMTRVAVSNPTAHTTALPRSLLYVWVVG
                     NPTSGGERGAALLDQVETLFCQSFGRDTVHTASSSNLLHILSLHQPVPGSSSEGMESG
                     AHGHRPEASSASAWGPTAGSAPPYSSAVSAVWNATAAAMPATPADCALSSVASSVSGV
                     ALRTLIIRTNRCGHLKLLSQSLSQLILCSRLDDNRQRPPQGPMLSSTPHSASASATLG
                     NDNDECESPPLGIKRTSATYQRASRSRPEQPSTHHVILVVGGDGTLSEVTNGLCEGTL
                     AGFAQLALRGGSSADTAAATSHAHVEREAAVLSHLLPAVLYVPAGTGSDFAKLGLCCR
                     TPEDALRVVRDGLARELCPVASSRGGDDGAHVDSESCRSMASSSPAARQTISAPSRLS
                     ACAAYAVDVGRIEFLRTGTRHFFINECSAGMSCDVIQRGERFKHCRWISMLSGLVLFA
                     ASSFVSLVLMKPKPLYICKLPPRVPLSAASAARAEDVDTDGGATETDASQEQASKESI
                     GGSDNYAAGVRSSDTDCTSISTSPLSDAASSSPLGWSHSLASLAPFAPLSKQLGRLRA
                     RLRRSAHVEPRTDAPGHCSDGSRDTSANYCAQLAAPAAPAKNGATAYTLHARTPMPPL
                     HAKKVRCTLQTPSHQILQLLDISPDELEMHRMQQEQRDTGAPAGTSSTDFATATSIKG
                     MGRVATSKGTAAATSSGEDEVQHEHVHRKRNAQIGSDDHIGEHHCRVNSGALYVDAAP
                     GKGDDAWPRNVGDDHLMSLTWVELPSSMVAFANGRWYGGGMLVAPHANPTDGLLSCTN
                     WVATILPFVFSAFSLYTGWHVRWRSTSVFDGERFLVTGGTPPSAAKAMTASLHSLADA
                     PLDAEEALYMEADGEVLEAAPAIVELAGKLIFLVPSTATVCLGSAAPGTTRERVAAQQ
                     QQHDGGARLLSADSGVALHPPGRRLGGLLDGLGSLLRRLASCAKQRIGERRS"
     gene            <451418..>459076
                     /locus_tag="LDBPK_191060"
                     /db_xref="GeneID:13386093"
     mRNA            <451418..>459076
                     /locus_tag="LDBPK_191060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860233.1"
                     /db_xref="GeneID:13386093"
     CDS             451418..459076
                     /locus_tag="LDBPK_191060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860281.1"
                     /db_xref="GeneID:13386093"
                     /db_xref="UniProtKB/TrEMBL:E9BE98"
                     /translation="MGSEHAHVDIDDEEEQVRAPTPSATATSVRIERGGIALTFDAGP
                     AQQRKTPSSSATGGAPTTCRRRTDPATTSARYPAEFPRDCSRYEDDVMKGKDDNEESV
                     EVASDFSDGNGDDPERRLLPSCARTPERTPRALARTPPRGNQVARELAAAEDADSERR
                     RGGGSSKISERVSGAITAAPKSYCAGTRGSPQAATKTINWADKLLPNAKATRAGSRNC
                     GSLRFPSVLHTEVEDKEQLDANRSVRGRGAALMPTTYGAAAERRAGVFGISGSNNIRR
                     SSGPLPASLPAPRSNPFLMQTHKTPTANSNQPYDIDAGTSPRPSPLSRCFAGYTPFQP
                     ASGLPQHVPQHQQQTPIPDSRPTSVSATPTPTPTQCFSVPFTPFGQGAGSRYQTTAPT
                     LQQQLLPHTNQHGARATGFAAVAAPHSHVPPSTVELSASGVSLSSSSSSGSGSMCLSF
                     RQHPSASPPPPPQECFFDDLVTLRTTCETREPRRGTAFTASTATPTATSDGGTAPHGA
                     QSAASPPAYFAMAWNARKTAPQQHGLSGGIAEHPSSSASLSPLPRHTTHEQAQAPQSR
                     PCISFYPPFAAARSAPSLSAQLLSPSAYYTPPARQTIGAGRLSLFSSPLAPRRGSVGG
                     GPATLAVDACGLSRSLFIDEYDDGAATAGSASHLRGDGRAASRVRPRGVSAMDAAWWQ
                     PIRELTSAPNLRHGAAAPAAGHSRSSTSALRLSVADQPYNLPLGSTSNPHNHHGSRCG
                     DCGGCRKGCATAAGDPALQQRSRHSYYHEEASSLGRGTATAPVHPGRAAVPPLPSSRL
                     GGLQIDARNAENQNVDDAYVEELSLSPVTPHRTQMRTPFAVRRARRAAATTGHSFRLS
                     SRRRPPLAPRSVGSDAARGSSCDCAEANAPDKFRSHYGAATPSSAAAWRDGLSVRERV
                     QLRRWRLDKEERLASYQAHLQANYLCGSMPKRYCFERQTGGAAADARPAPLGGGVARE
                     SGVTGSGEQPQSAAGGYAVWTPRTTAVPPVGHETAAVLQVGKSARDFSLGVHSSAPVS
                     TATSAPRDASSLLLRPPTASASTASGAGGPDVDAARVCQAEAHRRQQASKQSQIEARQ
                     QMEALADGAAAARLATGVNVSFTLRDVATVFLRLPSTSLHASRTPGTEPWHVSGGAGL
                     DVLDVCDAVRRTEGVSCFLSRKPTQLRGGWASYLERINLYQEPFFLRDQAFVLVLPVP
                     HVPTLKVCVAIHNINDLLALVCQTPVARILPTAEETWMRQHEYGFEDANDDAEGRQDG
                     AVMAVAERRWLFGLFTTRRLVPAAGTHASRKAHQQLPSPEDNDVARREKCRRLRREYQ
                     VDGLCLTWRHRARLWYALLRAGLSCLALPTCTSPLLIDPVACKARCALLCDRIAAYAV
                     AHRRLEALKAVRQSRLVARAAEVSKERVLKFCDRAHHGTARGIQLGRTGDSSSRVAAS
                     RSRCTPSPLLLSVPTRQQRRVSGVGDDGVDSTVCQGRYPVTWGRACDSTLRTDLHNRF
                     SSTDEAARDPQVARGGVASTLETPSTVWGRPLFAASTSAAPLHSGHFETSRQRFEDRC
                     DERQQRAGTPIPPRLSAMGGISHTYPSLRQRTSSGDRWATPRTTRSMQLRLAANQRVA
                     AGDAPVSSLRHATHASVLGEGRLTSNDGERFSDAFGLHSRRSFTPPPRPPPNRPPPPQ
                     QQQLQPRWDGDFGGGATSTWTANSRDGAVDVAWRHAHTCGDAVATSCRRGSTLARTVA
                     GAPGIASVNVPYDVEAGSHPYASDGALGAMRAARSATVAAGHERHASSAASHGLFAPA
                     ASTVAPYASGTSIAPSSDAQATAAAENGPQRVILSPTTASSLALSAAAASTNLDLVLR
                     VDRDDALAGALARLTEHRAVNIAPPLVTVLSIVPLAAQPVRGAGAGVVEDSDAPTISP
                     ADTGAASPLYPGFIPTPLEVQQRLAQPFNLSIAQVQQLLQWQWEHHQHCYTLMPVPLF
                     TGAAAGPTEVDFSLRFWSSPQGVDSVSRGGPDERASAASPSYAVSPLARELLLHLLRW
                     SWLLPIDYEASRRSRRHRLAATTTSSLASLFRCLISPSPLRCPRWRMLALIVLLVTAA
                     GRSARCLQALLFGGVGYCALSGVAVGLLARLPSHRGASSRHSRGGCLPWQWWWGRRST
                     GAADVHSQGHRRSASRLVRRPLSALQNDVPPIDDRVSLLYSLGESTTHDMLERRRVHF
                     AAQAVLVRVLCLQSAAASLLSRLQLFFYGYSTALSFWVALLLFAYALLCAVYLEAVLA
                     VQQSLGGAAWSAECDGCASAGAVSAFWQVARRIPHVMWWGTNAASTTSFHPSQSAASA
                     LTGAAWREVLASARYILFQRQRTVVDGGGEAAAAGVASALEVQPFGDSDPAVEATARS
                     GGSAGAGAAHGHHRSPSYFYQNGKYFAYDAEPPAWAKSEAAAAIPSNIGATPGAHYER
                     VSAQPQRQEPSPSARVVQSLSEWFSHIVQGGGSDGNDGGGKHRPSVLSNHSADPMGSN
                     STYITANSSAAYVCSNKSAGSSVGDPSVLWFLVVAYVVTVCLPWSPYRWLWRRVWSVL
                     THDDALVRRPLLTV"
     gene            452140..452213
                     /locus_tag="LDBPK_05_snoRNA6"
                     /db_xref="GeneID:13386094"
     ncRNA           452140..452213
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_05_snoRNA6"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966698.1"
                     /db_xref="GeneID:13386094"
     gene            <459481..>459636
                     /locus_tag="LDBPK_191070"
                     /db_xref="GeneID:13385994"
     mRNA            <459481..>459636
                     /locus_tag="LDBPK_191070"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860234.1"
                     /db_xref="GeneID:13385994"
     CDS             459481..459636
                     /locus_tag="LDBPK_191070"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860282.1"
                     /db_xref="GeneID:13385994"
                     /db_xref="UniProtKB/TrEMBL:E9BE99"
                     /translation="MHVPALSLVARCAGDLGRVRVYELTVAIIGVFAARLSACMGWPL
                     GCAAERC"
     gap             460614..460712
                     /estimated_length=99
     gene            <461930..>465859
                     /locus_tag="LDBPK_191080"
                     /db_xref="GeneID:13386095"
     mRNA            <461930..>465859
                     /locus_tag="LDBPK_191080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860235.1"
                     /db_xref="GeneID:13386095"
     CDS             461930..465859
                     /locus_tag="LDBPK_191080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860283.1"
                     /db_xref="GeneID:13386095"
                     /db_xref="UniProtKB/TrEMBL:E9BEA0"
                     /translation="MNDYDELYEDDFEDDELGSVAAKSASCRAASMSTPHHSVPATHG
                     TASKGGVVNSTAAGHSGAAAKPGMESAPRRPMCSLGSSFSSYQSSSADPLLRSAHELC
                     SSSSHSSSTSSSRHHTNPKHPTKDSGSTPSAAESVKGHRGSPGTDGANAVVVASGFVR
                     TPTSPSNLSAVTRASARPSVAQMPGQREIASSGAPKAYAKLDSDDGAQVVASMGGKQL
                     LPTSPSEASATETAASSCTSFHSTSHASLSPGRAESSRHGMPSAGSGSVSETGAKHLQ
                     RVKFAGHASRSSSDSSCSSDDDGGSGCGRRHGTSPPPFASAAAPPAAAVEPGIEAPVT
                     RNVSAERRHSRSGSTTTYSRKKLLHQSNYTSVGVLEEDDDRGHRRTPAEIDAAAAPVD
                     DEEEGEEGHEDANASDTMSLVATVAAQRQRLASSPSGARSDFFTSLTPSTSAGSSLTS
                     HQTPSLHTTTATPSSSMAPTTRSSSNRVPPQSGPDSFSAHSSSSPKNSASAVALQTSS
                     SNASPPRSALPEAAPKTRAASGAALRGAIQRRQVATVCKDAMDARLLDGVSDSQRSYD
                     DSSGIGTDEGHVKKKPQRDARSKQLSPPLPPSRTSQLSTTTSEDASLSKVGTAKTKGH
                     TKASTTAAKDGDAPESGERAALLARVAQLREEIATWDSRIARQRALMRAEAGRSGGAA
                     ASSPKCRSADGTGVARRRGGSNGGKRRSESVEQALHTQADAKGDGRPANARLTKLRQE
                     NEQLEAQYARQGAGGAEMNVQALVVRADIQLQKVRLRLKEVTAVRRALENRDKRAAHT
                     IKEVHRRMPTADELEERQHNEGIYSRKGLLRTVKELKENLERTRAATKMMKAMCAELE
                     AHVRRKHLSSITPKEYEALCATRDANAKAIEKHKNAISVYTIAFAHELRNGSKAACGG
                     DAGVCATQSSRSSCTTSPFKPAISPARAGAIVKEQQQIIAEHEANKADRLLQQKRTLL
                     DRKQELQASINTLSQRVEKYNEQIKANHAQAGLSYFDANSATAANAGAPLYAVGGSGP
                     TRSTPATTSAVSARDGGVLAAGSGAVAARKGSLRDVLRSPVKRRIQAMAAAAEAKGGG
                     GTARKRTRETANGPAALSSLGFDALPALVQTGKRAARAEHRASLPALTAVLDSPVKGA
                     AAQMGSSIEAGGEMSTSPRDAIEEEADDRDSIEAVLRKIDADNERLGYDVFGLEGRER
                     AAPPAFLQNLHDADAVKAAGNAPGDGGTFEEESVPHKVKEGYSGGYAGGAGHHDHATS
                     AAERRHGVYDRAVQGEPPMEEEEAEEELSAGKSDESGRSTPEWLRDG"
     gene            <468123..>469157
                     /locus_tag="LDBPK_191090"
                     /db_xref="GeneID:13386096"
     mRNA            <468123..>469157
                     /locus_tag="LDBPK_191090"
                     /product="mitochondrial carrier protein, putative"
                     /transcript_id="XM_003860236.1"
                     /db_xref="GeneID:13386096"
     CDS             468123..469157
                     /locus_tag="LDBPK_191090"
                     /codon_start=1
                     /product="mitochondrial carrier protein, putative"
                     /protein_id="XP_003860284.1"
                     /db_xref="GeneID:13386096"
                     /db_xref="GOA:E9BEA1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BEA1"
                     /translation="MSSSEKKHAAWVDVVAGGFGGALAKSLLSPFQRIVVLQQLGQHK
                     SYSIAQLVRHIYAQEGLKSFWRGNLTSMVIRVPYSGIQFLLYTQLKFFFQDWLDRRHA
                     AAALSGHQADGSSDNDNASSAATSRGLGMEKFVMKCGAGGISATIAGAAVYPGEVVRL
                     RLMSGEKKFTGIAHTCGLVYRETRSLRNFYRGLGASLMQRVPDILVSFATYETIKYAV
                     LDSPDPLLFKDNDAARNVLSTMVGGSAAAIASILVAFPLDVAKRRIGMSGQGTDKTVY
                     RGVGDCLRQIYAKEGVRGWYAGAFVEAVRCVPQVILMWMFIEVIQKKLSPYARVASAE
                     DEMAKRKKGP"
     gene            <470391..>471629
                     /locus_tag="LDBPK_191100"
                     /db_xref="GeneID:13386097"
     mRNA            <470391..>471629
                     /locus_tag="LDBPK_191100"
                     /product="proteasome regulatory non-ATP-ase subunit,
                     putative"
                     /transcript_id="XM_003860237.1"
                     /db_xref="GeneID:13386097"
     CDS             470391..471629
                     /locus_tag="LDBPK_191100"
                     /codon_start=1
                     /product="proteasome regulatory non-ATP-ase subunit,
                     putative"
                     /protein_id="XP_003860285.1"
                     /db_xref="GeneID:13386097"
                     /db_xref="GOA:E9BEA2"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:E9BEA2"
                     /translation="MSTPEARAQVYLVNLRSRLEEKNNASAAATVSRALDYFEQRFWY
                     ELSSELLQLIRDPMVLEDAYELYADVIVAVRADISPIAYVMIVRSVCFAPHSTTQKAL
                     ELVEGACASLIHSSSEQGHYAALCIRALLLLESTSPEESAALAAVPGSPPHTARKLLE
                     QTEMYLHGLKMHEVEPVLVALYGMARGRDYEIRRQHTSYYKNAFDIIIFLEKADLPMR
                     DEDVTALAYKTVVAGLLSDKIFNFGKLLNFDQFVSRLQRESCPQRWALEMMRLCNEGD
                     VANFEAFFRQHQQQISQEPQLVSASATLHRKVRLMALLHLIFYTPLSERTFAFHAVAQ
                     RCGVPDSGAEPLLLEALAHGIIKGRMDGLRREVRITWVESRVLSLEEVKALAQHVSQW
                     REQVVGLTNSVKEMTKKIPQ"
     gene            <473894..>491179
                     /locus_tag="LDBPK_191110"
                     /db_xref="GeneID:13386098"
     mRNA            <473894..>491179
                     /locus_tag="LDBPK_191110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860238.1"
                     /db_xref="GeneID:13386098"
     CDS             473894..491179
                     /locus_tag="LDBPK_191110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860286.1"
                     /db_xref="GeneID:13386098"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9BEA3"
                     /translation="MHTSMETAPKMALREPDAVRCAPQRPFNESLQAEAITYLMHERE
                     ADASAELSKGGLHSLAMRREQTLVPPELLMELKDGEQADASVALPEKLNPCTCTTAAF
                     DEWLRAVVKSIPAPAEAADAVQLRNCCGSRTICGRARPGGVTEVSRQQALYRALEVLE
                     AATRLLQRHAVLCRGRSRLLHAYYDALEEDIHQHAVSVSASTATRGTVQPTAEIQLQQ
                     LLPPEQHKYSPFHYHLRLYKRGAPLHHYTQEQEKLQSRLEKVYYVLLKLEEVEGLSNS
                     ILVEGQATSLLAQQRRQSTDAMQGGSTKAGSIMRANVRKDGIGAGSSADLHDALTLTG
                     GGGGGGARGDGESEPAMNEPTLQFSRRLVGMERRVRRLRQQLRLPLPVSEVTSRLRNE
                     LILSFSARVLALREPAPFTSEIYVTSAAPAASPSPQAAPRPPGDGAHHQSSHSISAFV
                     EWYVQRVMDPLAISQLLSIVPREYVVTTTCRLVYACEAHASLRSSRALPDLGPVLLRA
                     VAEGRADAVAQLLLSSSVSYGSVLSHPVDCHTCFFAGLLGGQIDVLTRLVEQQSWNVN
                     ALHVLLFMSAPWNIAAAPTAVMSSRGCYVYQQALVERVQAFLSVAEQVLAARSQEPAY
                     KLPLSLEENATDAASMSTIAGGADYEADESALAALRKAQLLDVSAEGEKLLAALGCFL
                     GSAAASASINDDALRGGRHGSQRSTHAGKPVTTANASMARGGGMKKKAEDASDADDDG
                     ITGSTGVSAFGALSMSAASRAAPPLPPVFLKGALHRLQLFLAVRNAMLQYERQRQDAQ
                     WETLLGKVKARPSSGDGASSAAASTMHGLGSSGKNLARLHAKAPPLLQGAAAANPRTD
                     HREAPLASAVAAPYSFVQILQQHQLDALTAGALCPLRCQMCPAFTTPQLQRVDAWSYG
                     PLQPTTAITTALGTARGTGNEGGAKHSSRELISLAERVNTLIGIGEDDCRPDENLRGR
                     LNRSLSSLSPRSRPITALLMRSDTAIDMMASSWYVHANISQANFVEEHGHYGSSSNSN
                     GERQTARGAHLHRLMNPWQARSATGLLMSALPFRYSLSMPLEDVRRAAQDAKQRRALR
                     TLYGSSAAGAADKSVSDHDDGGDRSDDHHPWRGGTGTAAENLASLYVHRATPPPAKPS
                     FYYEVQMSVEYLVAMHAADYLGATPLAIGSEALARGASSPLSEDAMHRLCENCVIVGL
                     CNPITAAQANGCTHSPSQPYVVTHLGHECGAGGAAQDKERGGSGSGAWSAGVSVSVIA
                     HEKVAASRLLSACVTAHASPATATAAVVEPGEASTTPSDDDADIDVLYLGVWKHQRNS
                     VRAVTAMQASPHHVDGDAADACANAAPVYLRLELPRWSHPAPAKEAGTTAAQDAPRDR
                     VAAANGNPAHAAETNAATAAATASTNMWLPIITRACQDDVTRAVAKARQQQQAEAAQG
                     TAANQASERARKSRCGATSPSLPASPFASLTRVRCEVAATLVLGLLLDPSAGTLRLRL
                     NNYTDFEEITLGLWLGSVAEATAATASAPPPPPAPKPRLYPAATLSLNDCGWRSWRDH
                     QTRKWAKQQQQQGVQPTGLTSGERRVRRAPVEYSAPPSSASSPSSLLSVSNAVLRFSF
                     DAAELLFGPPPPRQAVRITSADAIMPAGKAARMSHQQRRVSEPIGAKAPHSAVPPFQA
                     SQPIALLDSTVKFTEMLSVLTDVSLLAATKRSGDKNQQQQQLHSLGHGDDAADEDEEG
                     EVDGVDATAPQGAAPPAHSSLLLIGSRDRRTHAAMMRVQRLLNTPGGGATGTTAGSSS
                     AFNNSDLADIFYPPVRIYRHSCHCPAHELYPLPSSSSLGAADKDDASERSRRTQKCQR
                     CLANRRIGLSSAGETSSLFSANVYWHDIIPENARLTPLCAALASRQRAMAYVIATHPL
                     TCFCNLSVDEESACGAYARQQQPQQRRAALYAACALGYMEVVQVLLERIPVEELLSYF
                     GLVIESEARAALQRCYAVANTVFLRNYRLRSLATQSPSSPSGGTAVETSAPAVPYLSN
                     ESQRALLDASAIYSSSRSTYTPLHVALLGVVLENGDQDDEGVEEGSYVDVDTEEARMS
                     SLNARLGKQTACVTVLLNCLYDLLCVASASNTTARKAQNTAELVHPPHSTKSHGREED
                     VLGGEAQARRPSSAGRELLVDALNLQSPTGEAALLIAVRHNNVAVALRLLKLGAQPAC
                     MDRITRLLSLELACANRCTPIAEALLQSHNGGGAVYATSPVLLNHAGIATALCWCAIN
                     NMPAIMQKLLECDGIDAESGFEGSSPLHLAIAFGSEAAALTLLNGTQPRKTATISARK
                     GSGGRAEAPPAALVAAATAAPDTKTASLAAKHVNCGSSQRGTAAPSASPARPTETVSA
                     AETHKKPFMDVNILHERTHCTPLHLACERGQLRIIRTLLQSWHAQLNIAAAYTNYTPL
                     LTAVANGQEEAALRILEYSKDELRRGRAVLDLCAIDQHGDTALHLAASRGLNLAVEYM
                     LVQFSEEEVARLVALHPTLRASPAYQAATCIVPLHAVNKHGKTALLVALQYNQADTAE
                     LLVSMLIDSAETLEVGDAAAAFGGDGGSKAPTAITDAGEASCSTSAAAAASAPSQIGG
                     PLIEGTCMALHQAHRKHLDSVVQLMLSAPPSLFPCTAAFCKSVQLYKQQQADGRRSGA
                     LLRSETCDGDVRPAFVADASTVPVLASERNENASQRSPAMAQDRGSFVRLLLTRAAGP
                     TIAPNDALRVLLRGFALPELCVYLSEVAAESAVLGVQRSAAMADAELVIGYLQEHAGS
                     VVAPTRAVLFCRDVWLCLQQWMYIEASAERERAAVSRAHHAFSSRTTDSTYSQLSVGI
                     EKGGERRQKQQQQCELEEAPMGWLCRMLLVPKSGVGSHAHGKAAQPKSALPASASNSS
                     ALSADASSAAQEAEHYRHALEATLNRKTLSLEVARMIRLYGRSHGGARAIEEIKSIVA
                     AYVRAHINEPAAHVRLTTAAATAAAVATSATLSSSSKHSSFSVRTRSRAQSFRDVVEQ
                     HATWSRDGTVDLDATEREFSDRNSIDVIGNEPLFTTPMGFTVLQLAATLGLPEVVAFL
                     VDTYNLNPLYAPAQGMHTCVPQSTTPPPQANRSKEGTRKEEAARVRNVVVHSVRAVVG
                     VASPCAGRGDYGGANGSAGKSREDAGLWICWTPYRLAVRSGNLHIVKTLLLAGSGAAP
                     AVAEINPRELCGTSTLARLSHSDRHVEDGVTFSGAGATVSTAICPTASLVDYKEPAWL
                     DPYQRTALQESIVVATRCGSGASGSDSLVDSLTFTASAGLSSSSVVTKTAPSLSEALA
                     LVRLLLKHGAQSNGLFDSTGSDAWLLAMAGSGAADLPITHYSYAADCKRRPYSAGSEA
                     SLSQLSLTGASLALIRTTAGEAAGQRCVDLLLRLRAPLLGCAPVTLRRADTHLDGRRL
                     DGPQESAESDCFNEQLLRHPRRLLHQWRRLPCMQLAPTRAAAAGFARRGRRAAGTVGN
                     VHDGSGSDEGNDAAGEDGDGAAAQGYSVFEQADALCAQYEKVQQTLHPSAAMAIPRVG
                     GGVGPCTPSPQATALATTVSFASLLTITSAEEVTLLPSAVAPGGAVTLNRRVLAGGSV
                     SRTNSVAERETGTSPLTPSFSADSLKTRLIAALRLCYRVVLLYTCVEYTPLQLLRLVR
                     AFGAAALPVSARHPLSGDSVATRLLRKTHAHLLARTSGGGGGGDSSTSNTLRGELGSD
                     AASVMMHGADDMSQLPLSVLKEPPCTDDPAADAETRALVDTCVALVHMLRDAALRLPS
                     PPSAPQSQAAATAAGQALRSVLFQPSCDGETALSLAARIAHAPLISVLVQSGAAVSSA
                     SHNRSQGGDESWRCSRTTCSVPRRGDGSDTEAGGEGGVGVYDVSGIPVTSNCSLSTNL
                     ADVVVRVLLATRVYYPAHEIGTVRALLTHMPNEPARRAFLRGVYPNIHPLPALQLAMD
                     NVSIASGFLTSPDCMNALWTNLLYAHFTGQLDTAVRTTAKAWSELLHVVLPGAPAVPI
                     YLVMCAAVREEVSAEELKASHSGVRAQSPQVTPSPPQSLAGSTRSLSMVKKRSKERTV
                     PSAIPNWSHVVRRTNLFLQLMAMSAAETLMSKGSKPSSHVSADARTLSSTAAAASGSG
                     QRTKSASSPLHEVTKKGSFAALTDVGEPPSHGLSGTLLWDTIELAVRYDDKDMLRHLL
                     QLRLPDIVLTHIGNIQSQQQTLSSTGTFGRAYSSMDVSARAMEAVSKTILDSYPSFAG
                     VSTTSQATLVLERLQRLLWREALQERHVDLLAVAAGSIETLRFLYTSSPPEVRAQMTP
                     MRYDRVDVKSGMPEGVSPAPDIVAPAAAVPAGAEELLGSFQKLRKSSSARVGSGVMSP
                     SPQVFVVSSKVETHATAAHQLTKTPFSASTASATPSADGVARLAVLTPETPTSPVSPA
                     AKRTSPALAVDIVETPDERSLTLPLADAPLLQPKASEDKEEESAAAVADAELRFMESC
                     VQNGRCRLAPGEERRRCVTAVTWGLGAAACSVKLPMVQSSARAVSASTADTAEAATAP
                     GTRVEVQPRRTPSLLPQLPRPPAQRRITLDGKIGDVGPVKDSHQAIADGEKTAARQVV
                     QRRGRAKTSLPTKASAAAKEASGPAPSSPTPPAVVEPEPVYFMYLQLDWALHSTRLLR
                     SPRPSSATLETIMFLLDQRAALSVPVLDLFLAGTVAPSSAEAAAPQQHSSDAYARQEV
                     ALSLRYQTRAHLDTLLHLLVLHDQCQLAEYYLEYCHFWFVSNELDPEPVSGRPGRFPI
                     DQPPASPDGDSSEDDLNDDDAHLCSDVRYIGHDKQKRSTRSSQQLRHRSRGSSSSGYA
                     GTVPREFLRCMLRVNAHGLTAFDYAHTPAMLQLLEWYGCVPPTYRPNPHAFRRVVFLN
                     RGGHGDVREAYTFADNMDDHDSDEAVDRRQSASVRTSMMARRKREVLRFFPVPRLVLA
                     TDNFVALLDPTGTELASTVGSVATAQARTAASGTADGRRCNGEDDADESLAKNEVLVS
                     TRTQPLQLSDRRIDAMISTERRQLQVSERRHHQQERARALLFEQVAAQSQALVTRRGG
                     KSGGADESVRDGALPYLTRAVTAHRRQQWELQRHPPCSEMTLWHNALEAQRLSGSAFT
                     ATSSRGRLKRRAEGGARGSNGGGAGVLPILLSEEVSLLHLGLCSFEDELVRLYGELHT
                     ASASASAAVNEDTSGAARAHRTVGEEGGAISDGDNAASVLSAYSRLLLPPSVTDKPAT
                     HPHQGLEEVKRSYGMMSGDAPPETDKSNSSPRTKASRTGCTVLPRVSFPGGSIGGALS
                     PTQQGNKPSSVSAANAFVAASQDFRSCGRAPALPPRLSQMDVVFLLECQQFVVYPLSM
                     PSTGDAVEVVNDGGDDTYDESSKPRSSAKGGGGLSDSIGNSSRTPSNDEGNVAPPRLS
                     LGKGAASFSELPAVIERCTGGSIGTDEQRVKGAGKDAPRQRAPALATTTRDIAGRSPA
                     SPHRSPARREHGDRIRDAPPSDLPLLRSLLARKAADDLSSELIDVSAHRYEAALLVSL
                     TPMLLSGVSGDGAPGARVSAAATMRNLAAKLMHTRWKQFGSRPIISGTNTDAATTATE
                     AVALLNVPPFTLADAPALYPSGAPFSASPAADEPGSVASTTALGAAAARVPTVIAARL
                     EEWVARRWPLQRQAPPSPKSHRKAGGRAGTTSSRSPPTKTIKACRQENEDENTQDRNG
                     VDADGYDDESAATSVLDRIEPVGGVATAAQQVLMRALLKRFTAATGAQLSEQMGLVIT
                     PNYDVAEVGDTAAALRDIEAKVAAPAAARKKRR"
     gene            <491899..>492255
                     /locus_tag="LDBPK_191120"
                     /db_xref="GeneID:13386099"
     mRNA            <491899..>492255
                     /locus_tag="LDBPK_191120"
                     /product="hypothetical protein, unlikely"
                     /transcript_id="XM_003860239.1"
                     /db_xref="GeneID:13386099"
     CDS             491899..492255
                     /locus_tag="LDBPK_191120"
                     /codon_start=1
                     /product="hypothetical protein, unlikely"
                     /protein_id="XP_003860287.1"
                     /db_xref="GeneID:13386099"
                     /db_xref="UniProtKB/TrEMBL:E9BEA4"
                     /translation="MLLRCPVSALRLSFVVWLVHPAWVGVILCVCVCVCVCVCVCVCV
                     CALLFGGRGRTPLVELALDVLPCASASPPSRLIFFLLEVGGWCCGPVCETACLAAQGH
                     TPSHPTQHLFLWRQPG"
     gene            <492385..>494814
                     /locus_tag="LDBPK_191130"
                     /db_xref="GeneID:13386100"
     mRNA            <492385..>494814
                     /locus_tag="LDBPK_191130"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860240.1"
                     /db_xref="GeneID:13386100"
     CDS             492385..494814
                     /locus_tag="LDBPK_191130"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860288.1"
                     /db_xref="GeneID:13386100"
                     /db_xref="UniProtKB/TrEMBL:E9BEA5"
                     /translation="MELQTQPRFCPPRPRPYAASLVWMCLACGQLAPYEAAPHYSMES
                     IDGLDNSLQGTSSAMNAMPGGFDVTTALSDCEAAAHAYKSSPPNTAQHLFGHSQCGGV
                     TGSTAAAAATSASSPTASRSPRQEQRHSCVNNASDSYLSQAASFSHRQREQQQQQRRR
                     PSSVSWRVTGATAEMIHPDSVGSASERRKRREGELVSAGISSLCADEKTLGDGEILVC
                     DGISSSHCRRAPTTVSTTLGSTSNESSTLAVTPCKPAVAALPQLSAASSSLWRDAGVR
                     GVQNLSSSGARSRQQEDDAACSLAVLLMEEHLMGSREMRFCRCCGEVRCAEIRKVTER
                     LPSPLSARVADKVSYTDEEGDEVEAAAAQATVESEHEHWKAILSHSCRSTAIRRDGGA
                     AAVYGPFTSHALYSGNESQPLGVLAPAAENGCKPPETAQAETRKEIPSVHLAVALFLA
                     RLLSKVKVMAVTALGNFHPLSPALPKTYFSSHGSEHGDKAAIRGYGNGVLASDSAPRS
                     ASSISRLPRRAQEGCRPSYPLYNPSEGMRTSSDHWKSLSASTATSRTSPPACASAEEC
                     TLPCLASLLGVTGGGASEDLYGISLDSSAQPSWVFTAPDEEETYRAEDDEGLVIQHQR
                     GGVQSDEDASAVGAEDAHTCARMLYDDSTAASNIMGTTAAAATTMRACKDKWSSISVS
                     EALWRLVLPSFSAPFLSTTSMPSTAAAAARATSVHRAFSAGGSRPLESLMGWIASAPR
                     RGAVESTASSAVVTGTRPYRGFRGDVEEAVRQLDAAQLEVAKLRLQQVLAAVMAEQLR
                     REGQSEGEYPT"
     gene            <496493..>504523
                     /locus_tag="LDBPK_191140"
                     /db_xref="GeneID:13386101"
     mRNA            <496493..>504523
                     /locus_tag="LDBPK_191140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860241.1"
                     /db_xref="GeneID:13386101"
     CDS             496493..504523
                     /locus_tag="LDBPK_191140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860289.1"
                     /db_xref="GeneID:13386101"
                     /db_xref="GOA:E9BEA6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BEA6"
                     /translation="MAGLQSENISINSTRLPEQSTSDKDICVFCLRRATSSASDPHAP
                     LFPFFSLVDCRHYACQPCALVHCDNAGRRIFCPKCHCVSRLAQSGRRRTRSAAAATDA
                     DADRVSIDDGVSSTRSRRTRTGTTPHRSALKGKSGTLKRRASSVQFPANPTTSIVPGD
                     GVSVASGAVAVPSEGDSAGEQHHQRRASSPLTQEAVDALPLDPVEARRRRAREQQQQL
                     RAAEAAAKAEKAVGLYAITAAPPPKVAPHPPSATAASGLATNEGFKKVKDRSRSQPVP
                     KLPHTILEPKEEYPVPPPLVLHTVEEEEAHAPAATGESGRDAKPVLPAAAAGATAAAT
                     AEEDVKAEKSASALAPAWKTSVTPRQMEDEVEAAMAASADKSQTTGVLPPPTGTPEEL
                     ARPHQLLDDCENTEAEERGVVGDLEAHERAALMQRMEEEDTAIRARRGLVVEFDSTPI
                     LSQQQHPTLQNQHSHHDNTGSISLVDFSDQVSVTSDDELSQRASGYKSATRSDSASRR
                     RRRTSVNGASELRAQSHENMAGESDARPEKGGQAAAARTPGDALSSAAKSVAGSGSAE
                     ITLSPMTAARQGRVLASEEVDDGGKLIATRAALAEADAKAKAEAEAARAAAEAEAHAE
                     AIRTAEEARALAEGQERARQRQLQREAVEEAAEQKRQQQRQEEEVLRQRQQHEERAAF
                     ACQALQDREGLAREALEQAEAAVREHYERGADEWLTAALPHELEAQRLVRAAAERRRQ
                     QEQQQAHLAAEEGLDRDEVEEAEANAWSWLLSGARVDRVVAATEEGDRVQREYEELRF
                     ERLQLQLREDTAELVHEEAHGRASFIEYEAATRSLLQSHHAVQRQALAEGERRQEVEL
                     LKKAAARREAALRQRFQWELDELDAEEVSGRAMLREVEREERRTAHLVFLQTLASIRR
                     KEVLAQHAAAVAAAAAADEPGGTSVLSEASTMIAAQVHRRVQQRQTDAAVPLMIEGDG
                     DGVDDNTADMVGAATPPQFRTPLITAKELAELRAREASYAAELQAALERLREAERRVA
                     EEAAIRAQAEQERQAAHAESQRLLQEAEQRAEQRIREARDAAEQLLQAQLADLRDEAV
                     RRAEHAAVMQALAEEEQRAVLEAKLQAAQRQLDEAQQRAQEEVRRARADAAEMAAADA
                     ARAAREAQRRDEEWQERCRAEHLLRLAEQEREKEEAVRRLAEIEVRAAEAVRLAREEA
                     ARTAAEAQERLAEMERRQQAREAEVQSAAQRVRSVRDSLREFDSSTQSSRYATPFRAV
                     LPGQRPPTSSSSYRAPSLVAASSTHATHTAGAVATQASVHTPLQTPPLVPSSSRTSSA
                     VRRQPSAQSPTPRVAARVPAAGAAASLAPSDATPPKVIISSQHTPLSSAVAPGLGRSG
                     AAVPSSSASAAGATSLAAMDPADIIRAAIRSAVQEIVEAQRRTQTLQDRAEQNVELSE
                     RRYHRRQSDRLRAARDVAAIESSYAASEVDESEERHQRWRAWSQQPHQRTRQRQPVRG
                     YERDSRVASSRMSEERLRSVRSSRGDYAQEVSESPWTRSSSSPASRLSPTGAPLSTAP
                     PAPAARSVSSNTLLSTSSVYFDNSYQPSAAAFGAAHQHFRRNGCDYAAVQQQQQQQQR
                     LASFAPYSSASRVLFAPRVAHQAREAWAAEDGECGYAQRMHAGVGARAYSRVASEQQQ
                     RYATGAAQPPPRQPLLQTVGVAAALPSAAHAYNEPEPLPPAPAAMEYSPPPRRSTTRA
                     AAEVVPQQQSRPAGVGANVGSGGGIAALPEPSRMCPRCYRTDTTSPCWRCGEMICRHC
                     GLPPGSARKLCCTAHHRAQLREFTRRKTYESGKAATTVGAGKVPSPPPPQQQQQQQQQ
                     QRLRGEQQVQTSFASSAASARSHDAAHFADEPAARLDVGTSPLTSISPPSMISPSAYR
                     APEQRQRQQQQPQAQPHYPSSYQAFTMAGPAAPSQQPIYSPGYHSAATTYPYAYSHPM
                     SQPHQLPTHQLPFYADSERPHPMPPPLDPYVQPFGQPQPYAPFGYSVRAATAALGSAA
                     TGADFAAPMTVSEAQRQQGTTAVAAEAWATHEVPPPESRAAAFGAVARHHASPAELTQ
                     SPPPPSALPPSQQEGASEVMGLRAAEGGAMIETVAPAAAAVDDTPDAQVQRRPSTSSW
                     VDDRTHREAEQTVAAENRTLPNATVAAAVAGSAAADASLPDSAPEKQGGTTAPVDARS
                     TPDGGAAAENDGDGTSAATAGATAAAVLEEPKTERKKTFPAFFVSLGDGDDAAEPRRP
                     KPPTPRNFVPSQLAPPTPPRKQQRRTLPSGMLLTSQNRSGRQSAHHQHQCRKLSPLQA
                     HETNCARNSRKSVSPCRGFGAHRRQRHTSPSPYEQVPKASGARDGPRKTPSHPSSKQR
                     QRQHAHANGTATSITKSIKSYIKSLSPMVVVDESGTPVVYEDVRKVESNNPWMQQQPQ
                     RPQGWSATATPAAHDIYLSSGGIRSVGAEAERNRPESSHGHSKMGRYYVNVPSQPHDS
                     SPQKHQHHQHQRSSHSDSYYPYFTSSGATSETQSQPPQQQLQQHLYAPPQSHIQTDIT
                     YAAPFVDRRVPTLAELEKRLQQLRIVDEYEAAQYHRRQAQRAHQQQQQRIHVLLHSPG
                     AVAAGGNTGAFVTASSWATRELAQPLQRRHSSATGRHPQQRTVSPPWRTDLNSSPVRP
                     RWDISQPRSPIYHPAPATMTGN"
     gene            <506257..>507372
                     /locus_tag="LDBPK_191150"
                     /db_xref="GeneID:13386102"
     mRNA            <506257..>507372
                     /locus_tag="LDBPK_191150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860242.1"
                     /db_xref="GeneID:13386102"
     CDS             506257..507372
                     /locus_tag="LDBPK_191150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860290.1"
                     /db_xref="GeneID:13386102"
                     /db_xref="UniProtKB/TrEMBL:E9BEA7"
                     /translation="MTALITKQRYNWMGYDGIESVECDTALLRSDVSSANNYNYMHRQ
                     QVIMELKERLYRIKRDLGLIPEEELRAEEEALQRRRMEKKRREAEERMRKEAEEAARA
                     EEMERRRLELEEAEERASAQEAAAQASAERKRYMDDSDEDSDGENGIDDEQSASLVAM
                     LRTQAEINSAIVGFTKGTRMLLASSGNGYVSYLDGSMHFTIAKVEKYNASKRERVMEA
                     VAGTNVAVPTAEEYSLEEVRQAMNACDTARKKLDVLRALQDPTYTARIRSAEKDTYGT
                     PVQQLTEEDGDMSALVANCEDAKRFAESVRKAYNKKAAASGHALACALCMCPFTAEQE
                     STSEAQAAAGEERANAEEKVSKTAGTKSPSSSAMSAQ"
     gene            <510061..>513033
                     /locus_tag="LDBPK_191160"
                     /db_xref="GeneID:13386103"
     mRNA            <510061..>513033
                     /locus_tag="LDBPK_191160"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860243.1"
                     /db_xref="GeneID:13386103"
     CDS             510061..513033
                     /locus_tag="LDBPK_191160"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860291.1"
                     /db_xref="GeneID:13386103"
                     /db_xref="UniProtKB/TrEMBL:E9BEA8"
                     /translation="MSYTTSHLFNFPSSSSCTRPLAHLSAGAPVSPMTSTASLASPPM
                     QPSSPPAGPSVGPQQLANRRQIVPLLSSSAGDGDAVVPQPSAGTPGTVPRKASYTANL
                     EAQVRVLEQEVRLLRTGLEQNEKLRHASATAAPLPQRSPSSKRVHFGPSSVVVLSQPP
                     RPASASSTVATEVDGRPRLAFGQRVSATHSRIAACGPPHADTLQSRRMASLGKPARTS
                     TRSASVSSSSPAPATSTTSVNLSPAPASLRGGNTNGIPLQGAATGGTLVTPVTADAQP
                     PASSLTGPSSVSPAAATVWASTDPSLLWPRAAAAATGTLANASDLSRYPFRAMTTSSP
                     AAAPTPVIPEPPVMSSAQVVSAPVGTASAAASPIVVAMSSEGHPLTSLPQRATPASGP
                     VTDATPSPAAVPAAPPATPPPAADIALAAASPLARATALPPSVSATATPAGSSSPAAG
                     PATVAQLETEVLSLRDALAQREALLHRVLLELHDRNGSGGACRQGSPARGETPPRQRQ
                     GTGAAVAAPGERERQQSRQAMRILTEELFAVQTQLSHARASHQLVVAELHTCRQQAHQ
                     VPPLQKQRAAAAAPEETPPAGTSQPSSGPLQKQLDVALKKLKAWEDWYATSATAAGDE
                     AAGVTAGNSNAIPSAKDAFSSSRQQPPSKANNAEQSAGAAVATTGPHNRKGSPEKEKR
                     AHKTTAPGWCPHCGIALPAAPSVLKKSSRVGSGVVPCGVGLPGLAPASATSDLPAYYA
                     SLSSPSALLPQRPPAAAPSAPYVSAYALDSAMFHHLTSQFGGSGAGVNGSAGAEPEAA
                     NKMSGGAATPPPPPPEAASSPSSPTQANETKGKSRSAHVSEKAYAATAHQNSHTGACG
                     ASPMWAVPISGTSTAGVSGVKGGARERAMQAAFMGGRAASVPYVSPYCDRLDHAQQQA
                     YRAQRYVTQLAREAAVRELAEAERQVAEQRLSFWKHHHPSSHDLSATSPTPPSLASCS
                     STPGGPPSAAVCKQEVVE"
     gene            <514611..>519920
                     /locus_tag="LDBPK_191170"
                     /db_xref="GeneID:13386104"
     mRNA            <514611..>519920
                     /locus_tag="LDBPK_191170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860244.1"
                     /db_xref="GeneID:13386104"
     CDS             514611..519920
                     /locus_tag="LDBPK_191170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860292.1"
                     /db_xref="GeneID:13386104"
                     /db_xref="UniProtKB/TrEMBL:E9BEA9"
                     /translation="MSDGRSFWFSDLLRHGSHEKSELRGGGHSDSSDSSDRATEVFYD
                     HQSGLPQHEPTGPSTARSGDSLAHQSLRLIPGGQQQQQQQPPTKQVPSASPTSSLDDA
                     RKGSVDSFPASTFASTASGATSSALVGTVDEAVVTMDHAVRVPSALRGAGRRTMFDVL
                     VDVAARQRRQEQRQSQPQESAEGKSLASKPSTTTRDAQVLAPHPSGTAASSLVVASSA
                     REVTYQMLFPRAAVAAAAARMSSSGPTTPPAVGSTRELGKAYTLAAAPPAAASAAEPP
                     SPSRSERIHRYTSPVSHRSPPLSSPPPPERAKPDRRLRHLLPAHLRGCPAASQSADDN
                     SHRHQLQTARQHEANCPPARHAGHRAEVSALDVSDISSISSCSEDDTATPGMRHPPPH
                     RGTRRNAAEPSAAASTSHPQAPTAVARPTLLSRLIDGGAEELVRLSHHREGRDRGEPD
                     RPQGAAKEPKTRWALLEHVLMGTAGAAASSSHAGRPKLAGDRHRRRRSRHHRVGRTTN
                     SGSSERSTTHSRTTDASASDPDSTSSRGEDFGHDGGGVVDLRRDLDDEVPQWVRQHEA
                     ARERLAQLQQQQQQFSWASPTFSNAHMLATARVAAADKARAQVATTAAASQAFFGKPR
                     IFYPSSMARRTPSAASYAASGLAGGVAAWSTVSDVGRGRHDTRSALTAVATAAGVPRS
                     LLAFWKEGKRLLKQRSSNATAVAVVEYLWQRFQAWKPCGLRLLHRLHSGFCSCEAAAP
                     PAGSSLSRAEHESGPGRLLVNPACDDAVEDAGGPIEDISGTTSSDDDGGHASAVQSKP
                     ARKPRRVSKQASPQRRSRGTTGGGSDATDGASAQNKDEGKAGDAAAAVAAAEAGGGSD
                     EGIELQMKVRYMESAFNVVAVHGELTYASEGACARLGLAYPLPPSPPCWSPRISGRAD
                     DAETTPAEQQRRWTFLVPEPALTQVPVLLQEYLYLAPPYTVLREVQTVLSSYNFTTDA
                     LLRQHAAEEKAAQEERQRRRALDASNVAGVAAQKTNASLTTAAVAGRAAADAFLEGHI
                     LDRGDGESGGRQRGVSPTRSGSLRNSAAASAPTRWWAALEGNDETSVVREAASIHTRA
                     PADHADAPVANRSPTSLRREFGGEPVNLGPTRPGRATPLKHPQRRQWPVEDEEDTHLR
                     IQSADGVEGHTPTAVRQCGSGCAGASPEPHQPPVSRFPPPLPPPLSDAENGCDAVNDE
                     AQWLQGVPSEQPTVSPSYVRASTASVNSISIDGFYDPLAMPALPTTGAKRGIAAAWGA
                     NERRGDGGGSGTNGLAIATADVTTVLTRESRHGAGREFVPEDALERGLAAGPRQLPIP
                     PQMTARPSNSLRSPGEVEPAAGVFGAVVGEDARGRGGNALSNEMSTVTAAAISADPLM
                     DHRVGGGFPRGPTADWDIPVEVLFALSGGSGQWRERSEQPLRHTRRHRDAEVGSVRKE
                     DEDDDDGAPVVQQGLAGARSQAITSARFAQKPVHAHKRHRHETRTSDGAFEFTARGGA
                     SSALGSAAASQLASQRIPPSATFSFPTPRWRSASAASSLVSSAAPSSSSPSSLSEPED
                     GDDDGVKGGGTAHAARKPCWKVNVNGAVRWPRHGTRRSERDGVFVRRQQQQQERWIRE
                     LWGRGKQNSEPSVSPAAPSSVSAPAHALAGPSPCSQHQQQTSQWHRQAIMCTSKPLSS
                     AVDASISAMRAASASARAAPITSETGGNAAMNSAPRSSPLPDEDSAAIASHADPLTSL
                     SSLEAIVRGVPSVPVLHQAEDADASTATASFFALEDVYLSDTD"
     gene            <520914..>521306
                     /locus_tag="LDBPK_191180"
                     /db_xref="GeneID:13386105"
     mRNA            <520914..>521306
                     /locus_tag="LDBPK_191180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860245.1"
                     /db_xref="GeneID:13386105"
     CDS             520914..521306
                     /locus_tag="LDBPK_191180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860293.1"
                     /db_xref="GeneID:13386105"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="UniProtKB/TrEMBL:E9BEB0"
                     /translation="MANGVTANSMRVTAKPPDLGSFPLDHYRECKSEIEKYYACLKEN
                     NYMTPMCRDPVREYLECRMDRGLMKKTDVKSFGIPETEFVPTKQHRIDLKEQWLRQKM
                     NQIGVVGVENYIRDDLDTPDGYEKEKGA"
     gene            <522915..>524093
                     /locus_tag="LDBPK_191190"
                     /db_xref="GeneID:13386106"
     mRNA            <522915..>524093
                     /locus_tag="LDBPK_191190"
                     /product="actin-related protein 2, putative"
                     /transcript_id="XM_003860246.1"
                     /db_xref="GeneID:13386106"
     CDS             522915..524093
                     /locus_tag="LDBPK_191190"
                     /codon_start=1
                     /product="actin-related protein 2, putative"
                     /protein_id="XP_003860294.1"
                     /db_xref="GeneID:13386106"
                     /db_xref="GOA:E9BEB1"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:E9BEB1"
                     /translation="MRLHRAQPLEKKALCGDDLAATGALAMVELTYPMRNGVVHNMDA
                     MQVIWDYALCERLPALVGPSGGSTARWRYEDGLAWLQDRPLQLSEPPNMSLRQRCDLL
                     GLFFEKYGLSAIQTVQQGILSLFANGTERGVVVECGEGLSHCTPVFDGFVLATAQRLV
                     DVAGRAVTERLGQVLGHQQPHRRYQRRVPTGSDIGAMSHASWLFNDMNTLRQIKEHYC
                     FVAHRRNGLEDRLTRETSALHRDCVLPDGTSCRLGPERFAAPEVLFNPQEIDHECDGI
                     ATALWKSIEAADIDVRAALYENIILSGGSTLLPGFGARLQREMKSFYLTEKLNGDPAR
                     MARCPIRVKEPQRRQHMVYMGGALLAELSQDQPERWLSRSAYEEGGTSAIIARYHGAN
                     "
     gene            <525102..>525731
                     /locus_tag="LDBPK_191200"
                     /db_xref="GeneID:13386107"
     mRNA            <525102..>525731
                     /locus_tag="LDBPK_191200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860247.1"
                     /db_xref="GeneID:13386107"
     CDS             525102..525731
                     /locus_tag="LDBPK_191200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860295.1"
                     /db_xref="GeneID:13386107"
                     /db_xref="GOA:E9BEB2"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9BEB2"
                     /translation="MGKVKRQANHAIKKILMKEKSLAMKKKREAESYHETPESNTTKQ
                     ATKDYAAVLFRKALVTQAAPTRTAHFLSYNTALGPPYRIWLDTNFINFSMQNKIDIVQ
                     GLMDCLLAKVIPCICDCVFAELEKLGKKFRIALKLARDKRFERLTCDSKYADDCVVRT
                     VTQHPIYIVATCDQELKRRLRKVPGVPIMYIAKHRYTIERLPEAYGAPE"
     gene            <526860..>527558
                     /locus_tag="LDBPK_191210"
                     /db_xref="GeneID:13386108"
     mRNA            <526860..>527558
                     /locus_tag="LDBPK_191210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860248.1"
                     /db_xref="GeneID:13386108"
     CDS             526860..527558
                     /locus_tag="LDBPK_191210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860296.1"
                     /db_xref="GeneID:13386108"
                     /db_xref="UniProtKB/TrEMBL:E9BEB3"
                     /translation="MNLDDPDATRRRIEDDLDRLASDEKKNTTAYLHSLLNLALSHYQ
                     RGDFISARDMADYTHQRALVHNSKSSLIYFTATTCARCAEALAKEYEAHLQRKDEQSH
                     VSAALTPEPSVVFSARRAIKKLRADAERYRAIAHRVYHRPDMAFMRGSGDGGGGRWRS
                     SARHTEGRDTRHTWADDSSNNGVDEEYMPYIYGPRWQDRRKRPEHAEMKHYYKHQCGT
                     SPSSRGETRWNVPK"
     gene            <529820..>530851
                     /locus_tag="LDBPK_191220"
                     /db_xref="GeneID:13386109"
     mRNA            <529820..>530851
                     /locus_tag="LDBPK_191220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860249.1"
                     /db_xref="GeneID:13386109"
     CDS             529820..530851
                     /locus_tag="LDBPK_191220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860297.1"
                     /db_xref="GeneID:13386109"
                     /db_xref="UniProtKB/TrEMBL:E9BEB4"
                     /translation="MLYGGSRVQYLVQPPFKLHKIRSENLPPPSLYAERHDLGLEMQL
                     PRDMHVYNSINMAIQRQVGADSSTLDGEQQQQQLQDGHADGFDMGAFFTEQHHPERHH
                     NSSLPYAKHDTNNVLAMRLFPVNIGVRARTEAIRIRTEDCLQRLRDADLCAKMRIPLE
                     YPLPLSHRSQYAAVHRARRERCYDAPTEKAGESAAVAAEEASRTAHLRGAAAHPPPSE
                     LSILTRPVDRLGRHSGSSAAACTADADHLSFPVHPFAAAAVSSGCHSARSGSAARLAS
                     QRWLPLQTLKPMGHNWSAATRSSGVRGPHMQLMQERLDQKGFGWKRKSRSLWQQDVAT
                     AGFRPHRYF"
     gap             533450..533548
                     /estimated_length=99
     gene            <533683..>539058
                     /locus_tag="LDBPK_191230"
                     /db_xref="GeneID:13386110"
     mRNA            <533683..>539058
                     /locus_tag="LDBPK_191230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860250.1"
                     /db_xref="GeneID:13386110"
     CDS             533683..539058
                     /locus_tag="LDBPK_191230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860298.1"
                     /db_xref="GeneID:13386110"
                     /db_xref="UniProtKB/TrEMBL:E9BEB5"
                     /translation="MKDSRDYILRLWSLAEDMVIHSGKPLHAFLLLHHVLTKPPPSLR
                     RASGTTAGEPSINSSGVGASTVTLPTAATSEAALPLHVTAFDAEWKCEELVTRLRAAE
                     YLLLADVPAARTAVSSASTAAPAASSPRTLSCTAGLEALELAEQVLAPVFATTSLSVS
                     TDTVPGAAPPPPPYQQASSTASWWHRRCRASKDSAGGGDKSRGSCSASYSLDDVLREV
                     ADVSRSSASAAARSSSDSLGASIDGTGAGVQSRVASMYFLNHATVTALAWPLSSFTLA
                     WPMREAAGDGADRSHRASGDGEQHLRFGPASETITISVSLVVRAHVLQAFICHRRAQH
                     KRALQCLAEARQWIAQQYTDAARARTVRLLWEDLQERWAPPSPPPPPQQQQQSSGTSS
                     SSSATAISAAQLPPLPAFYRLIERLIAEEGRSCAAMVQVEECKVHYAILQACGSLPPP
                     PPLPVRTSSIAVTTTLADASAQMQAHAADLRLHYRRYQESLQLLHVLSRAYMTVVRWI
                     EEEAQGDVMTATAAEAPPPNGSMDVPEQGVAWREALRCVRSQLSPFCLCALQYTCNRA
                     TPVAPRGLATDTAATTTTADVSPCYALGFDVRLAAEVLGLYHCLSYVYLLYQQSAAAS
                     TLQPLSAKHHESLSVVELMARGTGGGGCSGQQPCNGSAMEERTKDRHASRGDDTFEAT
                     KEEVAFLRRYRSDPAYVALFGDHQIRPQARQTLSSLDAALDTDAADDADVLAITRDLV
                     HSAVEHAKINAFVFGQWRLGDAAVTATLRAPSSTSANVKGEKRLKTESAHNDETGGAR
                     DQCEGVQVAPLLRWCAPKDAEASTAPATAHEAALLWCLVELGLRDNYPFVIRFLRELS
                     GALSRVTGITYASGEGAADCVAAPPQLPEEAAEGEVGVGDALPTCPRPEGASLPGIRK
                     HSRSPSPSPMPLMHRASHGATSRLQPPPSGNWVFPGFRRALQLYLELVTVLMRSAATM
                     HATSSTAATGAEEPQSAAAFSSTATSSTAPSIPILRLGLHDAEQLMAQVLFTVDAEML
                     HLTGNTWGIASGASAREGGCTRVTGATDYRNRNGKGTSSGDISLSHLRQRFLLADQLQ
                     CSAPAQLRGLVQIKAAALVTMARHHLTQLSLVRAVHYLREGQQFARVFHRQAKLTLVP
                     EMHVLLACLATCMSLRRLPDLPEPAVKKGRRSEGRGHSVSSGDGEAATDVALGTAHDA
                     LYASAQGWISAERATSIHAGSDDGAAPHEPHSLSGHHSSHVGNGTGAAAFAVPPREES
                     TVAQDVGLPYLHLLAAERAACTTLHTPPSLSLLLYILKAWTVFHLVTAGEELVWSDVG
                     CNVSSLLTTPPHAPTPLQQQQSIRQMNGSPSMSAAVPRSLALKPASPSPPFLPLPSPS
                     HATTTLNTTVEDQQRRVARLDSLTSTPTSTPTLRSRHATVPTEMHRIQLEPAIMSAAT
                     ARATVQAVKGEGNDDEGCGVGRAATGVAYVNAKGANDGSADGKVTHSLQSRGSSGVDK
                     SSAVNSESGIGGTHVRGICTSFRGASAMAATASCPVGAHVRALPHTQRHRAGDVLQRM
                     MAVLLDHYETHGVYAAPITAAAPSLSTEAERATLQQVPAAAWTPQNVALFRLLRGAVL
                     LCENKDEPAAARELKEATHIAKRHLGVLHPYVADGLALLASAYASLDVDAVPSGDSHS
                     HGEPSGSATSPSPQQVTGGAARTRKVAVQVAMRCSCMALASLYATSAANGSDSVDAAG
                     TTTAQQQQQQTAPFSTIGARLQEWWGSQVLHGLCGSGSGGYNANAVQHLRLLFGWLPG
                     SAEYCFS"
     gene            <540228..>541613
                     /locus_tag="LDBPK_191240"
                     /db_xref="GeneID:13386111"
     mRNA            <540228..>541613
                     /locus_tag="LDBPK_191240"
                     /product="peroxisome assembly protein, putative"
                     /transcript_id="XM_003860251.1"
                     /db_xref="GeneID:13386111"
     CDS             540228..541613
                     /locus_tag="LDBPK_191240"
                     /codon_start=1
                     /product="peroxisome assembly protein, putative"
                     /protein_id="XP_003860299.1"
                     /db_xref="GeneID:13386111"
                     /db_xref="GOA:E9BEB6"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:E9BEB6"
                     /translation="MFESNLLSQINTSSPLPTVVEVQFTTSINQTLYKAFQFAHTLLA
                     EKSDRAAVLLPWSDEIYLALSGMMERLMLEHADTTFSEMIFALRRAEVDGPLAAAPPL
                     SSSSAAASGPSSPGLRPGARGRYLRWLLLGPPPVTTPEERAMNFINDGVSSQLRVHAS
                     APADAAVAAIVSPDMATPTPLMDAGATDSTAAVGSAADAAALSQLKSVELLKAEHAPY
                     GYLRFKTLSRRNKVISLLLLTLKPYLERKAEQWYVRNTDTSVDAVAMRNAYAYRYPHR
                     AALLHFLAKYVYPIYHVMKQGSRFLYMMCFLLEMTPYTSPLHRVFGIALRRSTLEDSL
                     ATGPRAQRALLVARVVLILVFCGFRLLDFTRNADGASSPRQIREEGLPIPPPPVLGSD
                     VPLPEDRSSLPKAGECPVCRRHVTNAAVCLISGIVGCYPCLQGYVQEQRACPVTHQSM
                     GVEQIRRVFEC"
     gene            <542895..>543410
                     /locus_tag="LDBPK_191250"
                     /db_xref="GeneID:13386112"
     mRNA            <542895..>543410
                     /locus_tag="LDBPK_191250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860252.1"
                     /db_xref="GeneID:13386112"
     CDS             542895..543410
                     /locus_tag="LDBPK_191250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860300.1"
                     /db_xref="GeneID:13386112"
                     /db_xref="UniProtKB/TrEMBL:E9BEB7"
                     /translation="MSTMGGIKGGVGSFLLRRTAAKSIRQKHFTGPQFYKRKTFNFPI
                     GHHQLHRRVAPALQTGSPTHQREHQRYAHLPGDARTRPSEDFTFSRSPSPRDSGRSRQ
                     RVDKAMYAWAKRGSLQLYQMGGKRETFVCYRCGYPVRSALVAIKDDNWDYRMCYNCYT
                     KTVDTGMERNT"
     gene            <544010..>544693
                     /locus_tag="LDBPK_191260"
                     /db_xref="GeneID:13386113"
     mRNA            <544010..>544693
                     /locus_tag="LDBPK_191260"
                     /product="RNA binding protein, putative"
                     /transcript_id="XM_003860253.1"
                     /db_xref="GeneID:13386113"
     CDS             544010..544693
                     /locus_tag="LDBPK_191260"
                     /codon_start=1
                     /product="RNA binding protein, putative"
                     /protein_id="XP_003860301.1"
                     /db_xref="GeneID:13386113"
                     /db_xref="GOA:E9BEB8"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="UniProtKB/TrEMBL:E9BEB8"
                     /translation="MADYNAAGDGTAVVDDNVPPGITTKQDEIIQYVAKYVVASCDGA
                     RYQDKVRTRTKHNPYFDFLNAKHPYHQYYQYLLESYRHWMRNSEAVGAGTWGGGVDAM
                     QGQGQQQQWNEEDYYQYYGAYAGQASGIEFQGNAAAQLGERSSYVDASSSAHAQNASS
                     GVDPTLYEPESVTVTGYGAGYDPSAVGPEPAQAATTAGSGEAQAEEDEDDEYELVMEN
                     GQWVSRKRM"
     gene            <545505..>546338
                     /locus_tag="LDBPK_191270"
                     /db_xref="GeneID:13386114"
     mRNA            <545505..>546338
                     /locus_tag="LDBPK_191270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860254.1"
                     /db_xref="GeneID:13386114"
     CDS             545505..546338
                     /locus_tag="LDBPK_191270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860302.1"
                     /db_xref="GeneID:13386114"
                     /db_xref="GOA:E9BEB9"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="InterPro:IPR028512"
                     /db_xref="UniProtKB/TrEMBL:E9BEB9"
                     /translation="MGTCPSISQSEVGIVETCGRFSYTADPGIHCLWCGSILVRRITL
                     RLQEYELKVESKTKDNVFVTLSLVIQYQVAPDKLAEVYYACDSSLECMRDYVLNSIRA
                     KIPLYKLEALYVERGTISQQLKDEVDAIINTYGIEIVSALISDIDPGAEITKAMNEVQ
                     KFQRLRVASVDAAETEKLKRVRAAEARCEARRLSGEGLAEQRKAIVAGLMQSIEDVQS
                     EVRDLSSNDATNMLLMNQYYDTLQAIAANSSSSVIMLESNGGLEKVAAQLRQGVTHMM
                     R"
     gap             548406..548504
                     /estimated_length=99
     gene            <549377..>550228
                     /locus_tag="LDBPK_191280"
                     /db_xref="GeneID:13386115"
     mRNA            <549377..>550228
                     /locus_tag="LDBPK_191280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860255.1"
                     /db_xref="GeneID:13386115"
     CDS             549377..550228
                     /locus_tag="LDBPK_191280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860303.1"
                     /db_xref="GeneID:13386115"
                     /db_xref="GOA:E9BEC0"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="InterPro:IPR028512"
                     /db_xref="UniProtKB/TrEMBL:E9BEC0"
                     /translation="MTFCGCGCVSTSEVGIIENCGKFDRTANPGCFCMVPCVESVRGV
                     VSLKVAISTVRVETKTRDNAVVNIETRLHYKVIAEYAEDAFYRFSNPSEQIASFAASI
                     VRGEVPKYTLDELFLMSDEIKKVVSAELTEKLCGFGFSLESTLLTRIEPSASVKTAIS
                     QTQINAYRRTAAEHESELNKILAVKAAEADYEEKRLSGVGLAQERQAIMKGLKSSIES
                     FVNAVPSMRAKDVMNLLLLNQYFDAMKEVGSGKSNKLILMPNTCGAAPNFMADLVAAQ
                     AGEARMM"
     gene            <551942..>554506
                     /locus_tag="LDBPK_191290"
                     /db_xref="GeneID:13386116"
     mRNA            <551942..>554506
                     /locus_tag="LDBPK_191290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860256.1"
                     /db_xref="GeneID:13386116"
     CDS             551942..554506
                     /locus_tag="LDBPK_191290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860304.1"
                     /db_xref="GeneID:13386116"
                     /db_xref="GOA:E9BEC1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BEC1"
                     /translation="MPFHAHVGQHLLRETAAMGLPELLVPPFEWPLVITALDVLESTN
                     RASAQPPATDVNDVAAAYEDIRDDVMEPECVAAPWEAQRHHRGAVCCLVQQLAGPQFR
                     VLPWDPDAMQQRVVASTTPSRGPPLTLPALPPRRVFLAESTDFAGRGCVVKLLPAPAL
                     QRSHAHLGAISSATGPSTPGSPAFTQRWSPYCPVEEPAVAGEVAALLHLRTATSPRDG
                     RDGVLGRRVLEAHPNVVTLFGVVTAEERVCCCGYAGGIETPIATAAMTHGAGLVEGVD
                     PAAVSLCQVRAVLLENVSGGAWCDFLATYGKFLTPLCVMRWFRDVVTGLAHLHSRFIA
                     HGNLTPANLLVRLTAAGPQGVCGGAGAAAQGYDCVKPLLEALTPSADIVEITGANGSA
                     TVRCEQMIVSALLERTQLVLSGFRCAARMSNDDGGWAAAHAAETEDDVLFGRSAADKG
                     RRSLRTESREPRTDAVGACAAAADLWNAAFAFYLLLVGGATAVARGWGALATSDTGLG
                     GAGTPKHLRGFVASRLPRLVSMRFPGALSTDPVQSVDGRSESACEVAQGYSGPEMVAR
                     LVSHTDASGAVPPLNAAQMGLQLRLLWTALPREFLEILDSILQGDGDAANRQTAAETA
                     RLVDQIMASPPVLQRCIVCAVPPPALLLEQWLDYLQDSWSDSFVCRPMARMPLERALQ
                     DAATRMLCLRVASGVCDAAPRWLQLASWRARLLELEGLLRQPAEVLEEWAAVSNSALL
                     LQSALRWLSQLRAGTRQLELPRADVTILLGNSVLRALDEVTFAYEEQPDRSRGTTLGF
                     HDAFRCFVARCVAGGQPPSPPLLEELILHVVMAVCSHLPRTFNAREGRLACKYVRG"
     gene            <557882..>560812
                     /locus_tag="LDBPK_191300"
                     /db_xref="GeneID:13386117"
     mRNA            <557882..>560812
                     /locus_tag="LDBPK_191300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860257.1"
                     /db_xref="GeneID:13386117"
     CDS             557882..560812
                     /locus_tag="LDBPK_191300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860305.1"
                     /db_xref="GeneID:13386117"
                     /db_xref="UniProtKB/TrEMBL:E9BEC2"
                     /translation="MDAVQTGGGHLVSGAATAGFTYAEYWQTLMATAEHTGQTLRADG
                     SHEPAPSLQRPTPTPPPPSRRVAPGRQSSAAANVTPRAPPSHLTEAGTYRLNLALTPS
                     PHQAQRSPLLQHQEPLRTTTMSNHVGERERGEWIARAMRAGKEASAPAGQSVRKPSSA
                     RKSPPPAERARSRGPPSSALDTAADPSVEDAGPTRATDSIREQRARATVIGGTRQAGS
                     SVGDQRDSSAPSADKDLVDSPRQHSSAADSTSAQHAFSLTAGTPPVDAVYAYTPDDLV
                     VKAAQCYEEWRRCVMEGSIDTEDDNDSTRECCFSGEDSSMAGKGEPGDAVHRIGPPES
                     RAREGAESHGAAAPNYTPSALSRTPTNNRRGALNPDRSKVRSDGKSLLSPACTRGKQT
                     PSRAEGTQSRIHSAETATHGLTSGRRDREGDTDSAITAAVTLASLFTWMDASPAAKSP
                     SPHVASAASTVFRSVRALDEKVAERLTVEDEVETTVAKPGARSNGAIRPSQQQRHKHP
                     LIQARHCLHQRAERIPKMAASTSRPEPTHRTYMSKDVRSVDEASGSLQSSPVAEADVD
                     DAHNAAPLSFVYRRLFADEVEDCGGGVAMWRDVADARHPERGGVTNADGALSLDTPSS
                     GKEGQERLPAGALDVLAECESEVTRMMSSDAAHNLTTLAEVDHVRETLIELSSCCSSI
                     EDRSDPVGEAELNENEIASHTEANLHQGASNSSHGAPSLNGSRSNPSLPSVSRLSLPS
                     SVPPVDKGKRDGPDRAEMTDSEAQVPPAVAARPLLCRDHPLWCKHHASVSMLYASRLL
                     PSEQANDELQLFLCWAQEKAERQSRWRQHHHNSDTGGSSETVLVRSELGAGPHVSCAA
                     AEVYKGAYAMARRGKWVGAPLSRVQRDSVSGNSERDAAVGALPVGFASAQATSPSRQQ
                     APPLPHPVVFVAAPVQRSEAARPSTPSEDVDWTVTPSAAPSRFVEWIATEVDPYESLL
                     FSPL"
     gap             562948..563046
                     /estimated_length=99
     gap             566393..566491
                     /estimated_length=99
     gene            <569323..>569418
                     /locus_tag="LDBPK_191310"
                     /db_xref="GeneID:13386118"
     mRNA            <569323..>569418
                     /locus_tag="LDBPK_191310"
                     /product="glycerol uptake protein, putative"
                     /transcript_id="XM_003860258.1"
                     /db_xref="GeneID:13386118"
     CDS             569323..569418
                     /locus_tag="LDBPK_191310"
                     /codon_start=1
                     /product="glycerol uptake protein, putative"
                     /protein_id="XP_003860306.1"
                     /db_xref="GeneID:13386118"
                     /db_xref="UniProtKB/TrEMBL:E9BEC3"
                     /translation="MRRAGKKQHRLIFDPSRSRAILIPAERDATG"
     gene            <572975..>574054
                     /locus_tag="LDBPK_191340"
                     /old_locus_tag="LDBPK_191350"
                     /db_xref="GeneID:13386119"
     mRNA            <572975..>574054
                     /locus_tag="LDBPK_191340"
                     /old_locus_tag="LDBPK_191350"
                     /product="glycerol uptake protein, putative"
                     /transcript_id="XM_003860259.1"
                     /db_xref="GeneID:13386119"
     CDS             572975..>574054
                     /locus_tag="LDBPK_191340"
                     /old_locus_tag="LDBPK_191350"
                     /codon_start=1
                     /product="glycerol uptake protein, putative"
                     /protein_id="XP_003860307.1"
                     /db_xref="GeneID:13386119"
                     /db_xref="UniProtKB/TrEMBL:E9BEC4"
                     /translation="MEPEKAFNEEPEATVQDPSLVSPSSLLQGSALPLLSPSTSVSQP
                     PRTAPSWSCRLHFVSPTTALDIGAADYSTVYPRLCSIEYLVTAATCLGTMLYGFAVLQ
                     SFCYKNFFSYQWDTVDPNPFFERMGSKGYDDSIDDQWVGFITHYNELVCLALLLAGFS
                     GLYRALLSYSTSSASPVPSDSTACSSPSASSECSGSLAGHVKVWMPPRWLDKLRSRAR
                     TLGSPSGARRRCTAFLQRSWILPAFYTVVGVVFVIFVHGPHFFLPLLIIIANYVIFSR
                     LQRWCPYWLFMVIMWAAHVTLLYLIEINDGFEQTPWLQYYTSCILSHLQAIQGDAEAI
                     PWEQRMRWCVAFRMSTLRLIAFNYDL"
     mRNA            <572975..>574051
                     /locus_tag="LDBPK_191340"
                     /old_locus_tag="LDBPK_191350"
                     /product="glycerol uptake protein, putative"
                     /transcript_id="XM_003860260.1"
                     /db_xref="GeneID:13386119"
     CDS             572975..>574051
                     /locus_tag="LDBPK_191340"
                     /old_locus_tag="LDBPK_191350"
                     /codon_start=1
                     /product="glycerol uptake protein, putative"
                     /protein_id="XP_003860308.1"
                     /db_xref="GeneID:13386119"
                     /db_xref="UniProtKB/TrEMBL:E9BEC5"
                     /translation="MEPEKAFNEEPEATVQDPSLVSPSSLLQGSALPLLSPSTSVSQP
                     PRTAPSWSCRLHFVSPTTALDIGAADYSTVYPRLCSIEYLVTAATCLGTMLYGFAVLQ
                     SFCYKNFFSYQWDTVDPNPFFERMGSKGYDDSIDDQWVGFITHYNELVCLALLLAGFS
                     GLYRALLSYSTSSASPVPSDSTACSSPSASSECSGSLAGHVKVWMPPRWLDKLRSRAR
                     TLGSPSGARRRCTAFLQRSWILPAFYTVVGVVFVIFVHGPHFFLPLLIIIANYVIFSR
                     LQRWCPYWLFMVIMWAAHVTLLYLIEINDGFEQTPWLQYYTSCILSHLQAIQGDAEAI
                     PWEQRMRWCVAFRMSTLRLIAFNYD"
     gap             574055..588333
                     /estimated_length=14279
     gap             588959..590041
                     /estimated_length=1083
     gene            <592998..>595202
                     /locus_tag="LDBPK_191370"
                     /db_xref="GeneID:13386121"
     mRNA            <592998..>595202
                     /locus_tag="LDBPK_191370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860261.1"
                     /db_xref="GeneID:13386121"
     CDS             592998..595202
                     /locus_tag="LDBPK_191370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860309.1"
                     /db_xref="GeneID:13386121"
                     /db_xref="GOA:E9BEC6"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:E9BEC6"
                     /translation="MAAAATSSSTSLASLPSKSDGVCGGGGGKNDDTGTVLPLNRATM
                     ADAEASVNRAYLSRTSLEYILCVAFVVVGIFYSCVYRIACIGREHHEELKENLKPPWA
                     LYRWLGSKGVDVTDLQCYYFVVAMPPSIPYMIGFLLLSRRLRRHAASKTATAVKESAI
                     AAAGDGKERSGSMASIHHPEHVIGDSSVGRGSVSPTLLIRKDVSTLQFLHIIAGMLIA
                     LCLCGPGFLFGVVMMLLNFYLIAPLYKRASFRVSMTVMWVMHVLVLFLNYHAGGYQFA
                     WFGLSFLDNLWSPLIQWTTQYNMSVLRMISFNSDLWESVSCGEERRQKSLAKHARTCI
                     ACAQIRDQHRHAVTSLPPEALSCYKCRTECSRHVEEFTLSAYLGYIFYLPLFMAGPVS
                     SFNAYVSYQHYSARSIEGKAIWRYGFRLLCHAILLATLMHYVPIMAILLTPAPSASGA
                     AEAVPAAGAIAAEGAALARSSGAMAVTTSSSPAGNALQNMVSTTTATTTPTAAVVTLS
                     VLDQMGVTEKASLFVLALAFLWAKFDVVWRFFRFFALLDGFDPPEDMPRCFANTVNIQ
                     SFWRDWHASFNLWIVRYMYIPMGGSRTKSLSIFPIFFFIAIWHDIELRLIFWATIMCI
                     ALIPEIAVTLFFSSENPLVMRIKRSPLMWRYLRVLGTQLALMELTVANLVGFSVGTTG
                     AAWAAQHMFREMSFTFKILAPCFYLCAAIISIQDSDQKAYEQQQLKLKYDLQ"
     gap             595885..596369
                     /estimated_length=485
     gap             597061..598897
                     /estimated_length=1837
     gene            <600052..>601254
                     /locus_tag="LDBPK_191380"
                     /db_xref="GeneID:13386122"
     mRNA            <600052..>601254
                     /locus_tag="LDBPK_191380"
                     /product="phosphatidic acid phosphatase protein-like
                     protein"
                     /transcript_id="XM_003860262.1"
                     /db_xref="GeneID:13386122"
     CDS             600052..601254
                     /locus_tag="LDBPK_191380"
                     /codon_start=1
                     /product="phosphatidic acid phosphatase protein-like
                     protein"
                     /protein_id="XP_003860310.1"
                     /db_xref="GeneID:13386122"
                     /db_xref="GOA:E9BEC7"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:E9BEC7"
                     /translation="MVVLSKKEFYYAWNQYHLLDWIVLTVLLLISMIVTISMKPHCRT
                     FSWNDATIAYPSHADTFPDYSLALMLVFSVVFYVIFIWYLVRPLQEFVGEPLDWYSIG
                     GADAGTSGEGNAYAEMDTVVNTRQPRIRDMQTGRGLVYPWLRAQLWSVGMESCATAVL
                     KVYAGRLRPDYLSRLKAAGYTSSMSHLPDPQTNPDYYCALMDAHPALKEGRLSFPSGH
                     SSTSFAVCTVVCLFFVAHLRPFARHASFTRLIICLLPISVSLMCAVSRTRDNKHHFSD
                     IIAGSLIGVVSAFLSFYGSFRQVGGAAGIYFSRTAMDIEYEQLREWKSAGGNEGSGAA
                     VEIPTAGGSSANYQSTNKREEAARCRSASPINRMNDAVVTFNDSVRRPTGLTERRLNE
                     DPAAVPWI"
     gene            <602766..>603032
                     /locus_tag="LDBPK_191390"
                     /db_xref="GeneID:13386123"
     mRNA            <602766..>603032
                     /locus_tag="LDBPK_191390"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860263.1"
                     /db_xref="GeneID:13386123"
     CDS             602766..603032
                     /locus_tag="LDBPK_191390"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860311.1"
                     /db_xref="GeneID:13386123"
                     /db_xref="UniProtKB/TrEMBL:E9BEC8"
                     /translation="MTSRARLLLLACVGTVIVILLVRAQTVVAQGDEANAAFAQQEAP
                     ESEKDQHLLRLVVILLPAMFVLWFILCIILAYIYICVYPNYYTK"
     gap             603298..603396
                     /estimated_length=99
     gap             604330..604428
                     /estimated_length=99
     gene            <604935..>605429
                     /locus_tag="LDBPK_191400"
                     /db_xref="GeneID:13386124"
     mRNA            <604935..>605429
                     /locus_tag="LDBPK_191400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860264.1"
                     /db_xref="GeneID:13386124"
     CDS             604935..605429
                     /locus_tag="LDBPK_191400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860312.1"
                     /db_xref="GeneID:13386124"
                     /db_xref="UniProtKB/TrEMBL:E9BEC9"
                     /translation="MFGRRVFASAPLPRHMWAKMHIQNAAQAQRMLPSLAPLVSSLGR
                     STNVLNSQALTQARDGMASDPSAASLEEFSVRCFSGSLTTVSSIVFGPVKFTLSVSTP
                     LVSFLELLEQLRIKLIHSEGLRCEPEEPRVSSPIRFASQLILPLALAKHCRDVRKNER
                     SEPG"
     gap             605664..605762
                     /estimated_length=99
     gap             606816..606914
                     /estimated_length=99
     gene            <608672..>610915
                     /locus_tag="LDBPK_191410"
                     /db_xref="GeneID:13386125"
     mRNA            <608672..>610915
                     /locus_tag="LDBPK_191410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860265.1"
                     /db_xref="GeneID:13386125"
     CDS             608672..610915
                     /locus_tag="LDBPK_191410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860313.1"
                     /db_xref="GeneID:13386125"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:E9BED0"
                     /translation="MASSTELMPHSERDGSEGSVPYPHRVGETLVLELNTLCRLRDFY
                     EQHTFDTQGPYADLFAVLLSSCKHVIDINVELVHHIKAQQDQQRRQQVACDVLCREAA
                     LQRADIKHLRAALEHLSARRASGEASVVKCEDDDTGLGNGSAASSHASPKNEAATAEC
                     CQHVSQRSPAASLAPQRSTGAASPSSAAVGLERSSLSTASASLVGPVSQAHATVTFAP
                     TEAPAQPINSLTHSSPSDHACGGAWAAEMVRRTDAMQGSSATVLVDGQLSSVRLDEEQ
                     RKQQQSSTALFAPSEARKHHAEDAVESHLEHLTRHFAAVDPRVHKQRRMWGEEEDVGS
                     RSPSSSPVAASGTAGESEFPHSCTTVAGHARSNPQESSQRQGTSVASPVGTWTPPAVL
                     VRWLDSRLCRWKAEWKRVLEDVQDALLLDATVDAQTLRPIAHAAGQQEAHVNLGTAHE
                     RASESNGGAEAVMTPSCRGDLVCVIRALLSSHGTELYKQIVAESTRQVQRTDEELHDL
                     RSRLEALEVYAPHRYAVTARPPLLGVELEDVLEPRIGVRLRTVYHHYLADRAGLSVGD
                     VLVGVGHQSIQTRAQLHVVLGELTRDYNAQCHIQIEEGFMRSFALGDQCCVRDGHCVE
                     CHSPYREATVERKGNDYGLGQELQRARSEAAAAVAGGTIPSDARSSARWMYMHSSLKG
                     RAAMAGSSAAASPFLSTFHSAAQHKEKLAQYLPYFELCLHVVRDGRLRDVTLLIPPWE
                     ALRSAAY"
     gap             612387..612521
                     /estimated_length=135
     gap             613816..613914
                     /estimated_length=99
     gene            <614900..>616741
                     /locus_tag="LDBPK_191420"
                     /db_xref="GeneID:13386126"
     mRNA            <614900..>616741
                     /locus_tag="LDBPK_191420"
                     /product="cation transporter, putative"
                     /transcript_id="XM_003860266.1"
                     /db_xref="GeneID:13386126"
     CDS             614900..616741
                     /locus_tag="LDBPK_191420"
                     /codon_start=1
                     /product="cation transporter, putative"
                     /protein_id="XP_003860314.1"
                     /db_xref="GeneID:13386126"
                     /db_xref="GOA:E9BED1"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:E9BED1"
                     /translation="MKPSAVAKTTTAGGTAAQLHAHSHRHGGHAHAHSHGSIEKGISG
                     KYLRQCQVATLAGGATNVFFCVTKLWIGSAGGSVALVADGFHSLTDILADIISYVAIS
                     LSRKKLPRCRFPLGIGRLETSGAVIVAAILFFGGVALLVQSLEQCFADVASLLETAAP
                     TGGIAAALALGARRAMAALRGNSTSAGSPAGHVHAHGSHDHSHEENHGGGDHQGHSHF
                     QVMTYDEDIGKQVILWTMVGVATASVVCKELLFRWTRRVGLRAGSRVVVANAYHHRAD
                     AWSGGVSLLGVAGQVMGLPGVDGLAGLAVSLSICKIGYGIFKDSVLEFFDYQNAEEVS
                     AIRDQLQRFNLCIVRGVDVVPNHKCQNAVKAAASGTEASSTSSPATASSSDDDETVHR
                     KKMHFINVFLVRHGHQYAVHVTLLVYESVSAQQIKEAADLITALARRSLPVQDTFTTL
                     LVCSNYTESREVSLGGCNDNEGVDEEGAAAISSGATAANCHGHSRAGCSGSFSRAHGS
                     EDSATSTPPIAATGAIINPSLERCIASLQEFHTFTAPIRYSWEERTITAPSSESCECE
                     RDINSVAEMFKCRLISGEIASAKKTAADSAKRSGHSCSHGAQADHSH"
     gene            <617821..>618702
                     /locus_tag="LDBPK_191430"
                     /db_xref="GeneID:13386127"
     mRNA            <617821..>618702
                     /locus_tag="LDBPK_191430"
                     /product="transcription initiation factor-like protein
                     (TFIID-like protein)"
                     /transcript_id="XM_003860267.1"
                     /db_xref="GeneID:13386127"
     CDS             617821..618702
                     /locus_tag="LDBPK_191430"
                     /codon_start=1
                     /product="transcription initiation factor-like protein
                     (TFIID-like protein)"
                     /protein_id="XP_003860315.1"
                     /db_xref="GeneID:13386127"
                     /db_xref="GOA:E9BED2"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="UniProtKB/TrEMBL:E9BED2"
                     /translation="MDDDYAFFESDNLVEEELPVIGAFPDPVAEFGGVVGPTGAIGDS
                     ALTADGHLAAAAATLPGGDDAAANLDVDELPPPIKNVQEFLPNVHPDAFPVVVAVQAQ
                     ASIPVGINLAELSCATRNVEYMPNNRIPSATMRLHEPTAVVMMHNSGALSIIGAASVS
                     EARQAAELAARIIRKALNLNFSSLKFRVRSIAARFNVCSPIRLDKLAAYQLDPAMSIG
                     VAKLQVSYEPERFNGCVLRLVGKSSRGDNQWSVSCSVFVTGKVQLMGARSMDELRFAF
                     NAFVPIIAKNLDERKTA"
     gene            <619558..>620244
                     /locus_tag="LDBPK_191440"
                     /db_xref="GeneID:13386128"
     mRNA            <619558..>620244
                     /locus_tag="LDBPK_191440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860268.1"
                     /db_xref="GeneID:13386128"
     CDS             619558..620244
                     /locus_tag="LDBPK_191440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860316.1"
                     /db_xref="GeneID:13386128"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BED3"
                     /translation="MSDWETIAKESEEVLAKPDIKGCHEILMKAYEGGNQHPEILWRL
                     GRSYYEMANESTDPAVREPYLKEGMELCKKSVEADPNNFASHKWLGILISDQKVGNKE
                     KIANAYVIRDHFLKAVELNPNDATSLHCMGNWCFKILQIGWLERKAAALILGEPPSST
                     YEECLGYLLRSAEAGNTIHNSTMIGDAYAQQSMHDEARKWYQKAIDMPAYTELQKRNH
                     DVAVAKMKKL"
     gene            <622461..>625262
                     /locus_tag="LDBPK_191450"
                     /db_xref="GeneID:13386129"
     mRNA            <622461..>625262
                     /locus_tag="LDBPK_191450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860269.1"
                     /db_xref="GeneID:13386129"
     CDS             622461..625262
                     /locus_tag="LDBPK_191450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860317.1"
                     /db_xref="GeneID:13386129"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:E9BED4"
                     /translation="MTEKEANDLIASAFSSEAMVEAVARVVASGYEKCSLCNNIIEGE
                     AEHVLREHPHVQHIHTMVAKPISPLPARGSQDQASMDVGSFAVATSVKADRGEDAFRV
                     VQRARAQLHRLLDGMQGIEGHVYLFGSVVSMGSWDGVGDGDFSFICPKWYTLPAPHGQ
                     VVVREEAVEEDSDDETLAGRKEGKEVEESSSVGEADDFGTVSATALRHASPGKSAEDA
                     ATEKSQSSVLSLKKEKRIICNIAARLRDAGFRFEELDLVLSTRIPVVRRKRAEQEPLR
                     LHAAPQGSFICVRFDTAHAEEQFRNERLSRVISTYNAEEVPSRGNQRGRSLVLCVPDS
                     TDAIHLMSQWKRKNGVRREWLGNRRSPEIFSIDFDLSCRCNGIRNSWLLRRYLAQSEV
                     FRVGNVFLKTWSKACGVNNSRVGFLTSYAVSVLWIYFLLRRGEVVFVNPADIPALPNP
                     KEQMEVPYIPLWPAVADAEADAARTARLGSLLRGFFFFYGEEFDWGAHVATIRQPCDS
                     AADIRTKEDLGWEKSDTLSLVLRDRCYHIFSIEDVYEDDLDLGRHLTPEKAGWIRLQF
                     RLAYRLCCSTRRAGGAAGPSPLWQLFDTPRKRAEDVLHARLYAYLLRNTEDAAAPISE
                     ILEQLGVDEESEAVDADTKEDPLYLACAYELGNRLCDLWFDDAQVAQDTAFHKMYNRR
                     SMDYTPPANPTTCGEWAAVCTDDLQEHHDPTSVHQQRCVRLVPPLRSEAGAPAPHFQA
                     ANAPARERALQLIKSRRQYEECARELGAHAAKKSNQAPAAVVGVPLKKSAAGMLYPHC
                     FYPLQQHRLFETYAARATFTRCVRDVIEEMALLRGADAPAAFGERGDVLHDRNKLLRY
                     LKKRLCSSVVVADPTYEAVLQFVCLPTEPYIHAPQLPHGHNERPTLHPTPLFLSLVGD
                     GSSGAGVAAKAKVPRARPP"
     gene            <626399..>627463
                     /locus_tag="LDBPK_191460"
                     /db_xref="GeneID:13386130"
     mRNA            <626399..>627463
                     /locus_tag="LDBPK_191460"
                     /product="cysteine peptidase A (CBA)"
                     /transcript_id="XM_003860270.1"
                     /db_xref="GeneID:13386130"
     CDS             626399..627463
                     /locus_tag="LDBPK_191460"
                     /codon_start=1
                     /product="cysteine peptidase A (CBA)"
                     /protein_id="XP_003860318.1"
                     /db_xref="GeneID:13386130"
                     /db_xref="GOA:E9BED5"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="UniProtKB/TrEMBL:E9BED5"
                     /translation="MARRNPFFFAIVVTILFVVCYGSALIAQTPLGVDDFIASAHYGR
                     FKKRHGKPFGEDAEEGRRFNAFKQNMQTAYFLNAHNPHAHYDVSGKFADLTPQEFAKL
                     YLNPNYYARHGKDYKEHVHVDDSVRSGVMSVDWREKGVVTPVKNQGMCGSCWAFATTG
                     NIEGQWALKNHSLVSLSEQVLVSCDNIDDGCNGGLMEQAMQWIINDHNGTVPTEDSYP
                     YTSAGGTRPPCHDNGTVGAKIAGYMSLPHDEEEIAAYVGKNGPVAVAVDATTWQLYFG
                     GVVTLCFGLSLNHGVLVVGFNRQAKPPYWIVKNSWGSSWGEKGYIRLAMGSNQCLLKN
                     YAVTATIDDSNTSHVPTTAA"
     gap             628302..628400
                     /estimated_length=99
     gap             629410..629508
                     /estimated_length=99
     gap             630281..630379
                     /estimated_length=99
     gap             630792..634197
                     /estimated_length=3406
     gap             635101..635199
                     /estimated_length=99
     gap             636356..636535
                     /estimated_length=180
     gene            <636963..>638060
                     /locus_tag="LDBPK_191470"
                     /db_xref="GeneID:13386131"
     mRNA            <636963..>638060
                     /locus_tag="LDBPK_191470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860271.1"
                     /db_xref="GeneID:13386131"
     CDS             636963..638060
                     /locus_tag="LDBPK_191470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860319.1"
                     /db_xref="GeneID:13386131"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:E9BED6"
                     /translation="MLTASGLMVGFAFVAKTADESCSYIVNVCGHDSVGPPLARSMNA
                     VDTEYVEHRGVDNLIIPISVSEPKETKSGDYAYCVDVVVHTLLIKKCSPGHRLLQHLT
                     EKLVTLSMEWIRNECGVQLLPRSCRIAGNPLYYDDTVETSKSMTSIIENAAALLQRKS
                     NSSFTRKNEQDTIPDALDLMKAQVPECKQPRIREVISTPAIKKGFLVDGNARLYGPDG
                     SSEGSGKAPDPLSHIPQSLRERCQIIDTRNVEGLTVPPAKTLKSVDKTANTHTSGTIV
                     APTSELQGKDEASWARFSIERTGEKVIVRFLVPDSVSSLHDIDLSATKGTLEINGSVT
                     QLPVPIVTDDVQAKFVKSTRILIVTCMIDVS"
     gene            <638350..>639441
                     /locus_tag="LDBPK_191480"
                     /db_xref="GeneID:13386132"
     mRNA            <638350..>639441
                     /locus_tag="LDBPK_191480"
                     /product="mitogen-activated protein kinase"
                     /transcript_id="XM_003860272.1"
                     /db_xref="GeneID:13386132"
     CDS             638350..639441
                     /locus_tag="LDBPK_191480"
                     /codon_start=1
                     /product="mitogen-activated protein kinase"
                     /protein_id="XP_003860320.1"
                     /db_xref="GeneID:13386132"
                     /db_xref="GOA:E9BED7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BED7"
                     /translation="MAQLVPLVELPSGKKIYSVRGQQFEVDRQYDLVKVVGFGACGTV
                     CSAVANGSGERVAIKRLSRVFGDLREGKRILREMEIMTSLKHNNLIRLHHFMRPQSKE
                     TFEDIYLVMDLYDTDLNRIIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPS
                     NLLVNADCALAICDFGLARDDQVMSSSDLTQYVVTRWYRPPEVLGMGSNQYTSAVDVW
                     SLGLIFAELMLGRTLLPGTDYIGQLVMIVNLLGSPSIDDMEFLSSEAKAFILSQPRRP
                     ALSFRDLFPMATEEATDLLSKLLVFHPARRLTAKQVMEHPYFSKYRDAAEEADAPDPF
                     VWNHSHIETKEQLREDLWRVVEAHSQSNG"
     gene            <639836..>641590
                     /locus_tag="LDBPK_191490"
                     /db_xref="GeneID:13386133"
     mRNA            <639836..>641590
                     /locus_tag="LDBPK_191490"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_003860273.1"
                     /db_xref="GeneID:13386133"
     CDS             639836..641590
                     /locus_tag="LDBPK_191490"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_003860321.1"
                     /db_xref="GeneID:13386133"
                     /db_xref="GOA:E9BED8"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019180"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="UniProtKB/TrEMBL:E9BED8"
                     /translation="MRRPREPAPGECCGSGCTRCVWDIYYDEVARFEELIAGGGIEED
                     CTQSSEEEEVVNYIGSVVVKYIDPPALPTTGSPGEWERAEMKARGFFPIDRIELVSCS
                     TSLFSPTDPGISVVNLFTSAKGRTMLPGDVVEVLVTNSRGTQDADDVERLCKALRLDP
                     YAWCELHRSPFVPEDNFPPWLPLQKPLTLGQLLSAYVDISSSSYLLHQSFFESLFRIY
                     SDSKPSSASSTSTTPSPDPEKVRLLEACASSETGPQLLRSLSKSSTPLCYPSLVDVLE
                     VFSFVQIPLDRLLEVSGPLQTRRYSLANWIPATLPPSPLQLCMREVCARRSANLPAAT
                     AVGADAQRVADMLNRAAQDASRDHSDFFFGHTSHPLCCAARSMTRSAAAAGQRGMYVS
                     FSLFGNSLFARQLQAGCTALCNPAQAKSLCSQLFLIGCGTGIAPLIAAVTQLMLRRAS
                     TAAGSAPFPCWVFYGARTKAELLYDETLQEALRTGAIAKYEYALSREEDNKKQGRYVT
                     DLVKRNRLMVTDSLQNEGQLFVCGPAKALLSVRQLVKCDLLAEPDDDDSVQEQRLLML
                     EDRGRLNFDIWSTGNIFE"
     gene            <642797..>643150
                     /locus_tag="LDBPK_191500"
                     /db_xref="GeneID:13386134"
     mRNA            <642797..>643150
                     /locus_tag="LDBPK_191500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860274.1"
                     /db_xref="GeneID:13386134"
     CDS             642797..643150
                     /locus_tag="LDBPK_191500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860322.1"
                     /db_xref="GeneID:13386134"
                     /db_xref="UniProtKB/TrEMBL:E9BED9"
                     /translation="MPQDTYFRRAINWMYGDDAYLQNMPTKDLANKHINELLGRHPYH
                     PYDPDMKADNPCYQFNALFHECMEADHVEGYELYQKHVACYFPYKVDLMKCIAKEKRR
                     HRMEVEALEEKGPKS"
     gene            <643947..>645812
                     /locus_tag="LDBPK_191510"
                     /db_xref="GeneID:13386135"
     mRNA            <643947..>645812
                     /locus_tag="LDBPK_191510"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860275.1"
                     /db_xref="GeneID:13386135"
     CDS             643947..645812
                     /locus_tag="LDBPK_191510"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860323.1"
                     /db_xref="GeneID:13386135"
                     /db_xref="GOA:E9BEE0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BEE0"
                     /translation="MGSQSGKASLSTSNRRRAVCDLCGTKATRKSSLQTGSTLVLKQC
                     SRCHLRCCGECYVWRRYGSSFSTCYDEEHAVAEFAPVCRRCVAGPNLVANAPRFVWNK
                     IFEYCDATAKHHLLQLCHATQMGVVLPYPHTRYGWSTFFEGRHFISKGANGEVYHTVV
                     RRDITKELARSLIDALDAKVLADLSGRAVAVKAIRKSTVFSLRRWKHIQREVDTLRRC
                     CHRHVVQLHFVAQGPSEVYIVLQYVAGGDLFDWLVRQQIPMEYDVVVIARQLLETLHF
                     MHEVCGVVHRDIKPENILLQPVANPDVQRQGDGSLGADDGRSTEHTNSSDDLYIRLAD
                     FGYAKLLPQNEAGDATLSPAQISRPPLPPVPADAIGIVGPRAENVQRTEPRAKACKPL
                     LISSTPCGTLGFAAPEILSAYNARKNALQRPRSNRQSAEQLGDAAKPRTPVDLVKRMD
                     IFAAGVTICILLTGCEPFPCRSSKEHIEAVHEGLDFSGPQWNYVSQPAKNLLRRMLAP
                     RTADRPSAFECLNSSWMKHQGPYTDATSEVEDDDENARGKGLNRSASVWQLLSTSFQN
                     SVHSLRKNEGWLFVQDAQGLVTTIPRQLVNGREDSESFSEALHSPNSCEQASTVY"
     gap             646845..646943
                     /estimated_length=99
     gene            <648080..>648925
                     /locus_tag="LDBPK_191520"
                     /db_xref="GeneID:13386136"
     mRNA            <648080..>648925
                     /locus_tag="LDBPK_191520"
                     /product="eukaryotic translation initiation factor-like
                     protein"
                     /transcript_id="XM_003860276.1"
                     /db_xref="GeneID:13386136"
     CDS             648080..648925
                     /locus_tag="LDBPK_191520"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor-like
                     protein"
                     /protein_id="XP_003860324.1"
                     /db_xref="GeneID:13386136"
                     /db_xref="GOA:E9BEE1"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:E9BEE1"
                     /translation="MDPNRRAPASTVTDEQPLTLLWGTWEMWCDMPQRQQGQGTENTN
                     WLEQVKSIGLFDSAEGFWGIFNCTILPSQLPPNGSYYLFRKHIAPMWEHEANRRGGKW
                     VIPFTGKSSRSEGDLQPVDEAWQTLCLSAIGELFPGDEEEVCGVTVSRGRQRTLPSGH
                     ATSVLSEWKLCLWTRSADNRGSQMRIAEYIRKQLHLQSLSKETSRDGKSGENDTLMEM
                     PRSPDRSPVAKTREASSIPSAMTYVAHRDLMEAKQEFVKGGSSVAQAFRPKYTLAIDV
                     RGEAV"
     gene            <649707..>650051
                     /locus_tag="LDBPK_191530"
                     /db_xref="GeneID:13386137"
     mRNA            <649707..>650051
                     /locus_tag="LDBPK_191530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860277.1"
                     /db_xref="GeneID:13386137"
     CDS             649707..650051
                     /locus_tag="LDBPK_191530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860325.1"
                     /db_xref="GeneID:13386137"
                     /db_xref="UniProtKB/TrEMBL:E9BEE2"
                     /translation="MFGRRVASCCCIPANMYARLHISSPQQASRMLPPLVPITTSICR
                     SVSGGTGAFASLVAGSEAVPADLTSAGNLLSLLGVTPQVLLGAINANTLLLRIISDTM
                     CTYSVILLHTIG"
     gene            <651347..>652312
                     /locus_tag="LDBPK_191540"
                     /db_xref="GeneID:13386138"
     mRNA            <651347..>652312
                     /locus_tag="LDBPK_191540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003860278.1"
                     /db_xref="GeneID:13386138"
     CDS             651347..652312
                     /locus_tag="LDBPK_191540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003860326.1"
                     /db_xref="GeneID:13386138"
                     /db_xref="GOA:E9BEE3"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:E9BEE3"
                     /translation="MSTEQARTLLYLALNAFSSIGIVYTNKVIFTRHGFSYGTLLTVI
                     HFFITTLGLFICRMMGVFEPKRIPVLKILPLCVGFCGFVALNNVSLVYNTIGFYQLIK
                     VLTTPMLVVIQTLFYQKTFSAKVKLSLTVTCIGVGLSTVNDTSANLAGTVVALSALLI
                     TCMYQIWVGTKQSEFHCDSFQLLYNQAPISCAMLMPMAYFADDLANKYYTPCWPTIIV
                     IIFSGLLAFFVNISIFLVIGKTSPVTYNVLGHFKLCVILSLGFLWFGDQMNARIFLGI
                     VITLFGVFWYTHLKMQEGEKEEDAKILAKHEEEHVSVGEGDEKYV"
     gap             652515..652613
                     /estimated_length=99
     gap             654006..654104
                     /estimated_length=99
     gap             654838..655876
                     /estimated_length=1039
     gene            <657884..>660241
                     /locus_tag="LDBPK_191550"
                     /db_xref="GeneID:13386139"
     mRNA            <657884..>660241
                     /locus_tag="LDBPK_191550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860279.1"
                     /db_xref="GeneID:13386139"
     CDS             657884..660241
                     /locus_tag="LDBPK_191550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860327.1"
                     /db_xref="GeneID:13386139"
                     /db_xref="UniProtKB/TrEMBL:E9BEE4"
                     /translation="MSAAESFSSPSASRILPVDVADSICQDEEGEGRSTSCSSHITRF
                     VYEASNSAPAMSAASSSSPASSLTVKSPPEEAWTSDEDAMERLYAVKPTSTIFGSDLD
                     RLERDMMRDYHQRGARLPPRDRVYAEFGGSQRGRRMQWEPSSSFDRLAASDFRFHARS
                     ETAVGDDTNRNLAAYHLYAEAYQTQQEESRRSQRGRATKGKGVNLCRVDQGASVGAET
                     DLPASENPHFPTGGPSDTNHLRASSSEHVGESDEGLLSGVRSAPKEVVVNARTDYKAR
                     LSIVSSPPCEGEDANRIVYDAYNQRPTDNTLLEVRGADYWGHYENRRRVEERSAYRQE
                     AVAREVLQEGAVDTSEVEYSTNKVRKETLLYFQAHPINEMIQEPFVRIRQLVPPGGGA
                     SVSFNPNEPPPTPAESENGGRRVIESVNMDADIPVQEARRMAQELGLDLVRIGAIYSQ
                     KTDRRIIALCMIGDHREHMREMIKFKIQKLGVQPPPTKECIEVPFKGGTHPHAIRFKC
                     VGVAKHLLHRHAIRINLTKFGTPREGFPVFQSILDELKRQCMRLKAYHTAGQIQSNYD
                     EIFCYLYPSTGRSPKTTVTHPTPQQVLEARDERILENEKEIYFDDLQDKATRKQRLQY
                     MLKLENGTAWAEKDEGMSLQRQRAIKVMLGYLPKGNRELYAARGDVNVPAPFRASHPT
                     SVHKWSYPSESNLEQASRGAAALGKRAAMPISEMHDAGEMPENPTQLDRFYYTAQGPA
                     LEMGEFKEALGLKDNRARRPPMGAGFSTLGVGSADETVQNGFATK"
     gene            <661326..>662624
                     /locus_tag="LDBPK_191560"
                     /db_xref="GeneID:13386140"
     mRNA            <661326..>662624
                     /locus_tag="LDBPK_191560"
                     /product="peptidylprolyl isomerase-like protein"
                     /transcript_id="XM_003860280.1"
                     /db_xref="GeneID:13386140"
     CDS             661326..662624
                     /locus_tag="LDBPK_191560"
                     /codon_start=1
                     /product="peptidylprolyl isomerase-like protein"
                     /protein_id="XP_003860328.1"
                     /db_xref="GeneID:13386140"
                     /db_xref="GOA:E9BEE5"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:E9BEE5"
                     /translation="MSDRPISSSASAVSEASQPPMEVAYPLNEEVEVPGTDGGLYKTV
                     LVEGAGSQPVKGAKVTVHYVGTLLDGTKFDSSRDRGDCFEFTLGRGQVIKGWDKGVST
                     MRIGEKALLRCSPEYAYGVAGSPPTIPANATLLFEVELFHWTREVDISAAKDKSLMMS
                     VLKDGVDYENPDFESSVTMDLLIYVGEFDPENKDKYTPVKTMPDWKAVVGVTSLPPHL
                     EAFLYKMRKRESAACRVRSDLICDAVPEFAIPSSAERGHCDVTYVVEISELSRVKTYD
                     FIGEAKVAEGEKRKNSGNDAFKAGKLDLAERFYRRAMEFIGQDYGFDDTVKPECHRVR
                     IGVMGNLAQVLLMRNKYAESADFSRKVLSLDSSNTKALFRLAKALDGLQDWDDALKCV
                     TDILAIDPGNADAASLKVRLMQEQRAFDQKQKSMFKKMFA"
     gap             662991..664171
                     /estimated_length=1181
     gap             665050..665177
                     /estimated_length=128
     gene            <666638..>666850
                     /locus_tag="LDBPK_221550"
                     /db_xref="GeneID:13386141"
     mRNA            <666638..>666850
                     /locus_tag="LDBPK_221550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860281.1"
                     /db_xref="GeneID:13386141"
     CDS             666638..666850
                     /locus_tag="LDBPK_221550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860329.1"
                     /db_xref="GeneID:13386141"
                     /db_xref="UniProtKB/TrEMBL:E9BEE6"
                     /translation="MPWWHALLSQNADLHRGFAKEPGPTNTVRRRLVQRRLGPGSRST
                     PPQRSQSRDKTGGGRVRVLNLRHDSQ"
     gene            <667627..>670224
                     /locus_tag="LDBPK_191570"
                     /db_xref="GeneID:13386154"
     mRNA            <667627..>670224
                     /locus_tag="LDBPK_191570"
                     /product="choline/Carnitine o-acyltransferase-like
                     protein"
                     /transcript_id="XM_003860282.1"
                     /db_xref="GeneID:13386154"
     CDS             667627..670224
                     /locus_tag="LDBPK_191570"
                     /codon_start=1
                     /product="choline/Carnitine o-acyltransferase-like
                     protein"
                     /protein_id="XP_003860330.1"
                     /db_xref="GeneID:13386154"
                     /db_xref="GOA:E9BEE7"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:E9BEE7"
                     /translation="MAEAFLSQRPHPANQTRDAGSSVMQMRVSWTCNGLDIHVPPLRY
                     IWRGVHRSIVDNIDKVSAMVYPIPFSCVVACAAGSCVCVWYVPQTSWVHTNPASTWLR
                     YFDSIVTPLSRYLPPSFQAPVLCAKAWAVTLAAATVLHRFALRRLLQYKGWMLERNPQ
                     KPSWRTRVWSLVMRAFFTRPSIPKTRVYGSCLPSVPLPSLQQTVSSYLSSMRSLYHQK
                     DSDVNEWLELRRSAESFLLNEGPSLQMYLRLQNVMGHSYVPELWTRNVFLAARDSLCL
                     HSNFYTVPFATHLPTPLPEARAAVLIYLLTRLKGHIERRTLCPNFIGPRDCVPLSMDQ
                     YSMAFNTTRIPGREVDVLEHRGERENSYLVILHRGRIYQMPVIDPQTGRQLTPHQLEV
                     VLHQLLLEVEEEVSTGRDESEEDDAEDTLETLGKKRSYRVVEALLPALTTASRAQWAD
                     VRTSYLLHDSNNNGPLRIIEKALFVVSFDERCGMAVPSKASSAVDEVKRLSMDCAHYL
                     CGNGSNLWCDKSFNLVVRSDGHVGLHVEHSWSDMSTFLGFFEHVSAQEESADLWYDTE
                     SGHAKKLPEDKRRAKPFRAPNIDNPLCPKRLRFTIHKKLAAAIRRAHTEFLLNTSSQV
                     DLHVVRYSEYGREVPKSMGCSPDAWVQMAIQLAHYIDQGGHFSLVYESVPQRMFSKGR
                     TEAVRSVTDVSSTFVKAMASTGGEDEAMSAEEKRALLIDACANHQRAVQEAVAGGGVD
                     RHLFALFMASASQETPSDFLTAALRKTKWKVSSAQAHQRNLLDRLHPAGGGSCYHETP
                     GFGFGPVSPDGYGISYCFCANEVLYVTITSYKNCDATSSRTLGNHMTRALDMLGALSA
                     SGRDDSAPR"
     gene            <671189..>672394
                     /locus_tag="LDBPK_191580"
                     /db_xref="GeneID:13386142"
     mRNA            <671189..>672394
                     /locus_tag="LDBPK_191580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860283.1"
                     /db_xref="GeneID:13386142"
     CDS             671189..672394
                     /locus_tag="LDBPK_191580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860331.1"
                     /db_xref="GeneID:13386142"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BEE8"
                     /translation="MLDSGSSSAEGGAKRFSRQQIIQHVKKSLLYTAFDVRWVPQTAS
                     FAVVGQYPNNHGALSVYQLHHGDVQPTVEVRLPHPLKCCTFGHNVSFSSSGGSSGGNT
                     SNITAASATMNQIATGDFAGSLQIFDLSRLGSTPSRAPNALSDVTAASVLHIPHAHES
                     IINAIDGARYSGPPEVATGSRDGSVKVWDTRQSNKPVVSLNPVDPARARDCWTVRLGN
                     SFDPDERVVAAGYDNGDVKIFDLRTQKMLHEMHVNNGVCDLEFDRPDIPMNKLLVSSL
                     EGRVRCYDMRTLHPKLGYAYVEERVSEGTVWCSRALPQNREIFLSGGGGELTLCLYKY
                     PPERTLKDGDGLQRGVAGAVEQLNKAKIGDQPINAMDWNRSKEGLAVCASFDQSIRVM
                     LVTKLSLLS"
     gene            <673828..>675372
                     /locus_tag="LDBPK_191590"
                     /db_xref="GeneID:13386143"
     mRNA            <673828..>675372
                     /locus_tag="LDBPK_191590"
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /transcript_id="XM_003860284.1"
                     /db_xref="GeneID:13386143"
     CDS             673828..675372
                     /locus_tag="LDBPK_191590"
                     /codon_start=1
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="XP_003860332.1"
                     /db_xref="GeneID:13386143"
                     /db_xref="GOA:E9BEE9"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:E9BEE9"
                     /translation="MATNNANYRIKTIKDGCTAEELFRGDGLTYNDFIILPGFIDFGA
                     ADVNISGQFTKRIRLHIPIVSSPMDTITENEMAKTMALMGGVGVLHNNCTVERQVEMV
                     KSVKAYRNGFISKPKSVPPNTPISNIIRIKEEKGISGILVTENGDPHGKLLGIVCTKD
                     IDYVKNKDTPVSAVMTRREKMTVERAPIQLEEAMDVLNRSRYGYLPIVNENDEVVNLC
                     SRRDAVRARDYPHSTLDKSGRLICAAATSTRPEDKRRVAALADVGVDVLVLDSSQGNT
                     IYQIAFIKWVKSTYPHLEVVAGNVVTQDQAKNLIDAGADGIRIGMGSGSICITQEVLA
                     CGRPQGTAVYKVAQYCASRGVPCTADGGLRQVGDICKALAIGANCAMLGGMLSGTTET
                     PGEYFFKGGVRLKVYRGMGSLEAMSQGKESGKRYLSENEAVQVAQGVSGNVVDKGSAA
                     KLIAYVSKGLQQSAQDIGEISFDAIREKMYAGQVLFSRRSPTAQGEGGVHSLHSYEKK
                     LFAAKM"
     gene            <677418..>678164
                     /locus_tag="LDBPK_191600"
                     /db_xref="GeneID:13386144"
     mRNA            <677418..>678164
                     /locus_tag="LDBPK_191600"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860285.1"
                     /db_xref="GeneID:13386144"
     CDS             677418..678164
                     /locus_tag="LDBPK_191600"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860333.1"
                     /db_xref="GeneID:13386144"
                     /db_xref="GOA:E9BEF0"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="UniProtKB/TrEMBL:E9BEF0"
                     /translation="MERSLYYTPQLLWLQVMDRMPYELTHYFVSSPPPHHEAMLSGIR
                     EQYGRPYSAEKPFDVELLGRLWNGHSRVMFATDNLVFSAAAHSVSDRWKEMGFQGTDP
                     STDFRGAGIFGLAQLVYLVEHHPEQWSAILTPDFMAAAAGLNVTMRLATLLGINSSLN
                     QFSSSVLSTYSAREARLRLCRFIFDPSVDVATQRLSEVYCFAMRLLHYRWMRSTRNIM
                     ELNQQLSNMYTELDRLLFLCNTLEELCSLL"
     gene            <679108..>680229
                     /locus_tag="LDBPK_191610"
                     /db_xref="GeneID:13386145"
     mRNA            <679108..>680229
                     /locus_tag="LDBPK_191610"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860286.1"
                     /db_xref="GeneID:13386145"
     CDS             679108..680229
                     /locus_tag="LDBPK_191610"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860334.1"
                     /db_xref="GeneID:13386145"
                     /db_xref="UniProtKB/TrEMBL:E9BEF1"
                     /translation="MPLIGDCMRQLAEQLRGCDGVVAVDPLACASFHEETAARIALEA
                     LSLLLLDRPSERRTDGMCAHRRTWCGIGVLRGRESDVAYNSGEGASVLWNVVPVALTV
                     VPWQVELPRRLQDLVLCQGHFASIDQLDYGSSDVGPVPDTFLTREAVALLCGLPRCRV
                     QAVSGRFPLFGRVVPPSFSAAPRGVTATDATWSLVPSREVSPARSAAAAQRHARRLMP
                     FLVSGLSSLMEPFSLRNDRSVPECWAVVSYPDGLPRAEAAREEVDGVSRDISDTAGAV
                     SSHEANVHESDGSCEAAPFFILPSHLLCRSLRVAVGWQKISPSSRPLVSEVLQRLCCL
                     VDRIALRTDRGVTLTSRTACSTGQETLSATMTIQKASSM"
     gene            <681191..>682987
                     /locus_tag="LDBPK_191620"
                     /db_xref="GeneID:13386146"
     mRNA            <681191..>682987
                     /locus_tag="LDBPK_191620"
                     /product="ATP-dependent zinc metallopeptidase, putative"
                     /transcript_id="XM_003860287.1"
                     /db_xref="GeneID:13386146"
     CDS             681191..682987
                     /locus_tag="LDBPK_191620"
                     /codon_start=1
                     /product="ATP-dependent zinc metallopeptidase, putative"
                     /protein_id="XP_003860335.1"
                     /db_xref="GeneID:13386146"
                     /db_xref="GOA:E9BEF2"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BEF2"
                     /translation="MDPLQREASKNGEEGAAGAERPSYFRGFFDAEKRRKVVNHDPTV
                     GQAIGGAVVMALPVALIIVLVMRRHARLATQEASGAAPKEGGFFSEMQKMMRQTMNPM
                     GEKNFKVSVKDTKFSDVIGVPEALAEVQQYVNFLKTPQVFTRLGGRLPKGCILTGEPG
                     TGKTLLAKAVAGEASVPFYSCSGADFIEVYAGSGPKRVRELFAAAKKDAPSVIFIDEI
                     DAVGSRSSGNGAMGLSSEENRTINQLLAELDGLQPNEAVVVFAATNFVDSLDKALLRE
                     GRFDRKVEIPMPDRQARQDLFNHYLSRIACEDAGSLSKKLAELTPGVSPATIAAIVNE
                     GALSAAIKDKAVVAAVDLLPAIDDVLVGKKHRSRMSDDAARRVALHESGHALVAWLLP
                     EQTDVVKISITPRGPAGGFTQQVGREVLDMATEFSLFTDICVMLGGRLAEMTQHESLT
                     TGTQDDYQRATQTAIREFLAFGMSRQVGLLSYEPQRLSEGRMHQKHSEAAHKMAEEEA
                     ARLVAAASDHVKMLLRSHDALLQKLAASLFERKELLREDIEAIVGPRPGTSSAVSEQT
                     RAALRRFVDASEAAALQRQTAREAMCATLSTA"
     gene            <683830..>684327
                     /locus_tag="LDBPK_191630"
                     /db_xref="GeneID:13386147"
     mRNA            <683830..>684327
                     /locus_tag="LDBPK_191630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860288.1"
                     /db_xref="GeneID:13386147"
     CDS             683830..684327
                     /locus_tag="LDBPK_191630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860336.1"
                     /db_xref="GeneID:13386147"
                     /db_xref="GOA:E9BEF3"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="UniProtKB/TrEMBL:E9BEF3"
                     /translation="MQQPRPGPAQAAPRSYDKKAYQTIYPQYLDSYLTPSEGRRLTKS
                     QGVEHPTMEEILHALRVLGYKDVIVDPARSYPRSQSTTKFPMVPRGCIKVAIKTPVDE
                     HYIKSDFDTQTRSAVVNNIDTKQELLRRVAALIKEKMPNRPQLATVEDIITTYNPTPQ
                     PKSKK"
     gene            <685220..>686056
                     /locus_tag="LDBPK_191640"
                     /db_xref="GeneID:13386148"
     mRNA            <685220..>686056
                     /locus_tag="LDBPK_191640"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860289.1"
                     /db_xref="GeneID:13386148"
     CDS             685220..686056
                     /locus_tag="LDBPK_191640"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860337.1"
                     /db_xref="GeneID:13386148"
                     /db_xref="GOA:E9BEF4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BEF4"
                     /translation="MSARRSRLRRVRWLPHQRIVVLKEVDLWAEDCVTEGVDVVAERL
                     WRMRMDASRNGRAQYLAEYLALHVDSSRHYQWLLSNYGPSLRDVLLTSSLTPFTEERC
                     KGVLRRVLLALDQLHRVSMYVHADVSLGNVLTSPSSCDDVVLGDLESVSPIGAVPRGC
                     LGSYLFMAPERLVDGALPLAPHDDIWAFGIVCYNLLTWDVTHPWCALGTESDHSENYW
                     AFLDLMSKAKDVPPCQLLLQSPLSRCSKEALTFVAVCLSWDPACRPSAAELLQHSWML
                     SP"
     gene            <686517..>687443
                     /locus_tag="LDBPK_191650"
                     /db_xref="GeneID:13386149"
     mRNA            <686517..>687443
                     /locus_tag="LDBPK_191650"
                     /product="potassium voltage-gated channel, putative"
                     /transcript_id="XM_003860290.1"
                     /db_xref="GeneID:13386149"
     CDS             686517..687443
                     /locus_tag="LDBPK_191650"
                     /codon_start=1
                     /product="potassium voltage-gated channel, putative"
                     /protein_id="XP_003860338.1"
                     /db_xref="GeneID:13386149"
                     /db_xref="GOA:E9BEF5"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:E9BEF5"
                     /translation="MHRIVKVNVGGRYFQTRLTTLLRFPDTSFAKMFEGLASTSALPP
                     TPSPPPQPTESEDVFVDANPDVFEKVLGFLRTNRIQLPLNDECLRAELVHYLNAWDLM
                     PHAFPASAADGAVEGEEAHLIELPDVCVVQLCDHMQHDQGVKRHAMTITYGADGFQLR
                     KLTQMIRRDLNQQLSSTYWQCYQTNERAAFFATTKVANGAADILTTSITQQVVQHTER
                     LGYHLATSYVTLSPDVVHTSVRMLIHNFIFRRVRLPALEAADEASLLGDGGDEVETYQ
                     NFEPRPVGPRKVQWADSPSKPPAQDVSTDLWK"
     gene            <687990..>688367
                     /locus_tag="LDBPK_191660"
                     /db_xref="GeneID:13386150"
     mRNA            <687990..>688367
                     /locus_tag="LDBPK_191660"
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /transcript_id="XM_003860291.1"
                     /db_xref="GeneID:13386150"
     CDS             687990..688367
                     /locus_tag="LDBPK_191660"
                     /codon_start=1
                     /product="ATG8/AUT7/APG8/PAZ2, putative"
                     /protein_id="XP_003860339.1"
                     /db_xref="GeneID:13386150"
                     /db_xref="GOA:E9BEF6"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BEF6"
                     /translation="MSSRVAGSYKKAHTLEARLRDAEKVRERAPDRILVICEKAENSP
                     VPDLDKSKFLVPPDATVGGFLVSIRRRITMEAEKALFLFVGDSVPANSTLMSDLFNRY
                     KDEDGFLYVTYSGENTYGWQGLH"
     gap             691669..691767
                     /estimated_length=99
     gene            <693236..>694918
                     /locus_tag="LDBPK_191670"
                     /db_xref="GeneID:13386151"
     mRNA            <693236..>694918
                     /locus_tag="LDBPK_191670"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860292.1"
                     /db_xref="GeneID:13386151"
     CDS             693236..694918
                     /locus_tag="LDBPK_191670"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860340.1"
                     /db_xref="GeneID:13386151"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:E9BEF7"
                     /translation="MHRSFFCYVCCEPLFRAMSDGVCDHHVREACCLKMSVSGTATCP
                     LCGWNGPWSTDGAHSECVRDAIEVRLKENAIALLRDAYPALSSDCVGDVVGSCFDRSC
                     LTVDLHQAQQYLAAVPPDGVGAVCTSLGAPDTIPNKAAVFSLRVEGPWLTSCDLVRRF
                     LKLQVLVLCDCADLVSLRGVECAPLLERLTVERCGLADTLGIDACPCLKFLQLRECPR
                     LSHLGWSQIPNSQSSLQESSGQDGGCAALRSVSVFRCPAFRGIGVLSASPHLREFRAQ
                     CARISSLAALRECRRLELLDVGGCQQVCCIEALRSAKALRYLDLSNTAVSDIGALSQC
                     TALERVNLNGCLRLRSLDSLECCTELRELQASRTSIETLIGLRLCRALKKVDVSGCAA
                     LRDAAALTHLSQLTHVDLSFTAVDDVSSLAYYSGLESVRLRGCRHVRDYSPPHNLEDA
                     PPLRSLDLTNTSVCSISEWGRCPPRLEMLRMNGCTELSDISVLQSASRLRVVDLDNTS
                     VRSVSPLRLAAPELEELHTNDVTYQSEVPLFQTTGVQRQHNVVNAGASSRSL"
     gap             696597..701575
                     /estimated_length=4979
     gap             701685..701874
                     /estimated_length=190
     gap             702274..726776
                     /estimated_length=24503
     gene            <727135..>727818
                     /locus_tag="LDBPK_020720"
                     /old_locus_tag="LDBPK_191690"
                     /db_xref="GeneID:13386152"
     mRNA            <727135..>727818
                     /locus_tag="LDBPK_020720"
                     /old_locus_tag="LDBPK_191690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860293.1"
                     /db_xref="GeneID:13386152"
     CDS             727135..>727818
                     /locus_tag="LDBPK_020720"
                     /old_locus_tag="LDBPK_191690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860341.1"
                     /db_xref="GeneID:13386152"
                     /db_xref="UniProtKB/TrEMBL:E9BEF8"
                     /translation="MPLLTSCAVVSLLLVCVLWRMEDGVELCAVGLVSCFGCRALRMA
                     MRFSLFSLHAFLVLVRAHCPLAYTLLFVAGGLVLHACALLYLSLSLGMRALRSSCPAF
                     PCWQASPSTTPLLREISRNEPPSAKNERNNPDYSSMKPSKRAANLDSRGATSADHSTA
                     SSHTEAVPPLTVDTLTVPLVHAECAPATAPLSPGNGLTPTLAECASEAARRPTEAAPV
                     SAVEALPPTP"
     mRNA            <727135..>727815
                     /locus_tag="LDBPK_020720"
                     /old_locus_tag="LDBPK_191690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860294.1"
                     /db_xref="GeneID:13386152"
     CDS             727135..>727815
                     /locus_tag="LDBPK_020720"
                     /old_locus_tag="LDBPK_191690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860342.1"
                     /db_xref="GeneID:13386152"
                     /db_xref="UniProtKB/TrEMBL:E9BEF9"
                     /translation="MPLLTSCAVVSLLLVCVLWRMEDGVELCAVGLVSCFGCRALRMA
                     MRFSLFSLHAFLVLVRAHCPLAYTLLFVAGGLVLHACALLYLSLSLGMRALRSSCPAF
                     PCWQASPSTTPLLREISRNEPPSAKNERNNPDYSSMKPSKRAANLDSRGATSADHSTA
                     SSHTEAVPPLTVDTLTVPLVHAECAPATAPLSPGNGLTPTLAECASEAARRPTEAAPV
                     SAVEALPPT"
     gap             727819..727917
                     /estimated_length=99
     gap             728407..731109
                     /estimated_length=2703
     gap             731710..731808
                     /estimated_length=99
     gap             732828..733309
                     /estimated_length=482
     gap             734264..734362
                     /estimated_length=99
     gap             735116..756957
                     /estimated_length=21842
CONTIG      join(FR799606.2:1..757180)
//
DBGET integrated database retrieval system