GenomeNet

Database: RefSeq
Entry: NC_018248
LinkDB: NC_018248
Original site: NC_018248 
LOCUS       NC_018248             767234 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 21.
ACCESSION   NC_018248
VERSION     NC_018248.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 767234)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 767234)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799608.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..767234
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="21"
     gap             236..957
                     /estimated_length=722
     gap             1431..1529
                     /estimated_length=99
     gap             2741..3527
                     /estimated_length=787
     gap             4649..4708
                     /estimated_length=60
     gap             4838..4936
                     /estimated_length=99
     gene            <6026..>7066
                     /locus_tag="LDBPK_210030"
                     /db_xref="GeneID:13386560"
     mRNA            <6026..>7066
                     /locus_tag="LDBPK_210030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860472.1"
                     /db_xref="GeneID:13386560"
     CDS             6026..7066
                     /locus_tag="LDBPK_210030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860520.1"
                     /db_xref="GeneID:13386560"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BEY8"
                     /translation="MERDPCIHVPRTRKGGTFRHSEDVELHANDFEWDEKVAELTIAE
                     RQLVDEYMSRCMAELSRTGSWESLDEVPEKPWEMHFSATKHHFPLKNYIVHAFPLLRT
                     VMGRRGSPAWILECGCGTGSTLLPIMRECTSPDVHFVGFDISPSALSHFRSHEIAQGY
                     LQRNQLTLLPLAIGTSSCVTSADPTAPLAKRQRIDENATLVVDALTAADKSLQHQKFD
                     AILLVFVLSALPTVEKMLSAIKQLKNVLKQDGILLFRDYALPDHNFFRFLSKMDNKVG
                     NIAFAKGDCTTQVFFYKEFAAKLFSAAGLVEVDDVPSNLTYHCNRIVNRKNGKKMDKI
                     FINGTFKLAPSS"
     gene            <7609..>7929
                     /locus_tag="LDBPK_210040"
                     /db_xref="GeneID:13386335"
     mRNA            <7609..>7929
                     /locus_tag="LDBPK_210040"
                     /product="ring-box protein 1, putative"
                     /transcript_id="XM_003860473.1"
                     /db_xref="GeneID:13386335"
     CDS             7609..7929
                     /locus_tag="LDBPK_210040"
                     /codon_start=1
                     /product="ring-box protein 1, putative"
                     /protein_id="XP_003860521.1"
                     /db_xref="GeneID:13386335"
                     /db_xref="GOA:E9BEY9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:E9BEY9"
                     /translation="MQTKDEAGMSAAEEGSKGNRFQLKKWNAVALWSWDIQVDTCAIC
                     RNHIMDLCIECQSNPSCSPKDCTVAWGACNHAFHMHCISRWLKTRNVCPLDNKEWVYL
                     RYGA"
     gap             8099..8197
                     /estimated_length=99
     gene            <8552..>9316
                     /locus_tag="LDBPK_210050"
                     /db_xref="GeneID:13386561"
     mRNA            <8552..>9316
                     /locus_tag="LDBPK_210050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860474.1"
                     /db_xref="GeneID:13386561"
     CDS             8552..9316
                     /locus_tag="LDBPK_210050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860522.1"
                     /db_xref="GeneID:13386561"
                     /db_xref="GOA:E9BEZ0"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ0"
                     /translation="MPLLRCTAHRLCARTGSCLIDPLASCSRVAPHNLQFTHVLGTRQ
                     FSLFGEAINHSKLLVQCTVALERSHKYEGGQNTALRGEKASARGPVEFECQLSNMCRG
                     FSLTLSLCCSTRAGLLLINGARFIPAGATVLEGPECTHSQFIYHGPHMNQSHLAELLV
                     GHRRPNSPLDDIAHIEAVFFSAVRCFGSASSTWFAHTPVHTIKPELADRIAELVRAFG
                     VDDALAEYVECKAHAVERLERDAWVRVSNSVLPNLE"
     gene            <9780..>10475
                     /locus_tag="LDBPK_210060"
                     /db_xref="GeneID:13386336"
     mRNA            <9780..>10475
                     /locus_tag="LDBPK_210060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860475.1"
                     /db_xref="GeneID:13386336"
     CDS             9780..10475
                     /locus_tag="LDBPK_210060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860523.1"
                     /db_xref="GeneID:13386336"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ1"
                     /translation="MRKFMLETKAALGVAPKTVDWDFEEKAGNLKTINHTLSDYKSAV
                     EQTRSASQNLLTSMESMLKVLETMTRGNDIPDNVRGVVGDFAQMVQKAHCELLVDFKK
                     TLDDDDSVAEIESLAGKCKSLEARRSKVMNEYDAYREAVTKKEAEYRKKGKDLCDSKL
                     YEEEVSRRDSLKAGFQKIDKEFKETYAELEKKKLRSYMAALSTYLASTSQLMGSIHKE
                     MESTKRKADMVKI"
     gene            <11941..>12678
                     /locus_tag="LDBPK_210070"
                     /db_xref="GeneID:13386337"
     mRNA            <11941..>12678
                     /locus_tag="LDBPK_210070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860476.1"
                     /db_xref="GeneID:13386337"
     CDS             11941..12678
                     /locus_tag="LDBPK_210070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860524.1"
                     /db_xref="GeneID:13386337"
                     /db_xref="GOA:E9BEZ2"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ2"
                     /translation="METMMKIKTALKLAPSTCDEDYNRRKREMKDLCSAIRSYNTAME
                     KAKVSVRRLVEALTEASKVFETLCNYPNIPDCTKDCALALVASMNRIEGTAFPEFNVA
                     MDSTVLTATNGLKALYDECERLECKRNKVMHEYDTYREEVSKKETEYLRKSKSLLKSK
                     YYSTEVARRDELEAAFDSADQKFKDTHDQLMQSRSVTCTDALNAFVSCMSRFMEEISG
                     ELEGLKGSSEYVLPILRNIMRAEHESD"
     gene            <13948..>14649
                     /locus_tag="LDBPK_210080"
                     /db_xref="GeneID:13386338"
     mRNA            <13948..>14649
                     /locus_tag="LDBPK_210080"
                     /product="syntaxin, putative"
                     /transcript_id="XM_003860477.1"
                     /db_xref="GeneID:13386338"
     CDS             13948..14649
                     /locus_tag="LDBPK_210080"
                     /codon_start=1
                     /product="syntaxin, putative"
                     /protein_id="XP_003860525.1"
                     /db_xref="GeneID:13386338"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ3"
                     /translation="MLASDPFNDSVKELREVVVRAKLIEQQLTQKGVISSSSVEELRD
                     AKETAEEMLHFLKEMLRVVDERGGKVQGKVFSANEIMERQNIVRSLEGDVAEARSFYE
                     KIAASAAQRQRVAEAAVGSPGESCGVAADEFISAQVFAQREEEKVQDEVLERLTFGLR
                     ELRETGLHIHEELDTQEVMLDNVDRDISGVQVRLRAANAKVDKLLASMSNKGKVCTIA
                     MLTFILVFLAFFGFG"
     gene            <15240..>16721
                     /locus_tag="LDBPK_210090"
                     /db_xref="GeneID:13386339"
     mRNA            <15240..>16721
                     /locus_tag="LDBPK_210090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860478.1"
                     /db_xref="GeneID:13386339"
     CDS             15240..16721
                     /locus_tag="LDBPK_210090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860526.1"
                     /db_xref="GeneID:13386339"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ4"
                     /translation="MSVTTELAGLVRRLPPRAYERVLLLLHCLATSSEGSQGGSNPQT
                     LFLQVICDVVLCACPGPVPRFLFALSCNDKLLRSADCGLTWRLCFARSSEPLKADTAG
                     VQDLLDDVTSLLKSTEATDDVAGGEEASSVVCCADGYGDVVALCGRNGFLAVSGDKGV
                     TFTTATNYLMGDFGEKAHLRHICVLDTDRILVSDDLRVVCVAVECTGCGPLALGKTHV
                     ALVCSTQICMLRACSFGGGARGAVVAENRKLHLSFDGSASFMEVRHSLGRIRGFNTAS
                     ALRHCELPDFPHATLASSMGLQSTEASPSPPRSASVYDYVSGCKCDAAVGKGDSTAAV
                     TQFEAGALRHGADVFYRFFFVAGCGTEVLPYDYTALLCVCTRQEGNHVVVMSTASYVS
                     YIPFSQSRSHDRLLCTVTRSSGDGGSYLASRGSVVGTSVSRDLDRWSTPHGAAPVGLL
                     AVGGGDILACGRNKVVSRVEGDAEAHTILHDMRVPVLSTAFSM"
     gene            <17346..>18620
                     /locus_tag="LDBPK_210100"
                     /db_xref="GeneID:13386371"
     mRNA            <17346..>18620
                     /locus_tag="LDBPK_210100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860479.1"
                     /db_xref="GeneID:13386371"
     CDS             17346..18620
                     /locus_tag="LDBPK_210100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860527.1"
                     /db_xref="GeneID:13386371"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ5"
                     /translation="MGNTCTKTGEVVDNRSNGTSGSKHFNRYRTKQYAKPEDVPSPPA
                     NDERVADLKKMTVVKKIEALQHMLKPVVSVVLSELLHEDFRQFTSVFARGKAALAVAS
                     CAQAQRPRHILAAGEDRSVALLNYETGHVMQRWVHAHQNDINCVTTPTSSGVFATASR
                     DKTVKVWNLTSDSSLAELRGHTLTVTSIDTNPGCNLLVSGSKDNTVRLWDVNRAEELF
                     CGDVKLNIVHFVRFMSSMNCVAQGGEDLAVRLWDVRTKGTHSDLHLSKTIEGMDYYPV
                     CCETIPENPYMLLTGHNGVNDCGSYVAQWDVRTGKRVALYKGHGSTVSSVRMVAASVY
                     GNGSFFTSSDDGTFGVWNLEDGEASREVQLSVEHHFCLPEGRVTTFEAEDNGDIVIAL
                     ENGCLVVLRPAVKGDSVVPSLRLRYVGVLTVQ"
     gene            <19669..>20526
                     /locus_tag="LDBPK_210110"
                     /db_xref="GeneID:13386372"
     mRNA            <19669..>20526
                     /locus_tag="LDBPK_210110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860480.1"
                     /db_xref="GeneID:13386372"
     CDS             19669..20526
                     /locus_tag="LDBPK_210110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860528.1"
                     /db_xref="GeneID:13386372"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ6"
                     /translation="MESAVKCVDATSRCLRLFNPTRTITQSKGMTTLAKLYGTGAAPH
                     ERVITFLMHIRDAFDGVLPVEIALSGGHCLQRLDPSAADEYLLAFVTDWLALAAAADE
                     QADPFRRRFRDRLSTDNAQKTFHLHFRAAVLLQIECAAQSGRKHVFAAYNTQVMDAIL
                     TPFTREELQKYEATCWQEAARHREVESVVAVPFVSAAPASTVSSALAAYKQQGTQRGT
                     STEARRGGAVAPSSSGMANWRHDAIRILAFLLLAVLLRFAWGPLARALKSVLQVTRAA
                     PARQRTLAL"
     gene            <21401..>22774
                     /locus_tag="LDBPK_210120"
                     /db_xref="GeneID:13386373"
     mRNA            <21401..>22774
                     /locus_tag="LDBPK_210120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860481.1"
                     /db_xref="GeneID:13386373"
     CDS             21401..22774
                     /locus_tag="LDBPK_210120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860529.1"
                     /db_xref="GeneID:13386373"
                     /db_xref="GOA:E9BEZ7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ7"
                     /translation="MTITDFFARLEKKYQVLFIFIIFTMNNGFAWLMFEPVADWLKTN
                     VHGMTSRSLQLLSSWQPLVFLCTFIPIMKLVTRYDGLRLAVRIGTAAEIAGAAFKLVG
                     AFAHKSTFGLVMLNIGQIFSGVGSPVATGAVSALSATWFEPEERTRATAASVLFNSVG
                     NSLCYIFIPTLTKKLSFSAVTVYELLMAAIGLSLAWVIMPQEPESAEMCTETKEQTTL
                     QHSAASESKDDGDVVVHSKEHISLVTQLRSLWSIPSCVCLLVVYAWLSGGFSAWISLF
                     ADTYSKFYSEEFIGIMSFFGMIAYVAGGIASSYVVDLYFSRQMKYVIFFCITMNMLCN
                     LIFIACTPNDKSYSLWNLGQSFIVFSTALCGFWNGAAAPLFYELVAEISFPVEEGVSG
                     ICISVMENVGALVFYQVVSRFFTGQSMSVAYSFGMTVAVALTAAVKQRYNRSYHAYLL
                     QNAKEDC"
     gene            <24815..>25366
                     /locus_tag="LDBPK_210130"
                     /db_xref="GeneID:13386374"
     mRNA            <24815..>25366
                     /locus_tag="LDBPK_210130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860482.1"
                     /db_xref="GeneID:13386374"
     CDS             24815..25366
                     /locus_tag="LDBPK_210130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860530.1"
                     /db_xref="GeneID:13386374"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ8"
                     /translation="MDVKYGDWKNARPRAHLMILFLFIITDLMNIMCYILYLLPSREY
                     YGVYGSNAYITFSCIGVFIFAGVSAPLIYWPYAHGNEMSPVSRRNALCLGIIISFLAH
                     GFPMAWLELWLVTTFGWTELLQAISLFLTLLCFIIGFLVTWVAYSWKLSKMLQIRYGN
                     AAPSQSAVPSAQLARSSSRAYRI"
     gene            <26314..>26769
                     /locus_tag="LDBPK_210140"
                     /db_xref="GeneID:13386340"
     mRNA            <26314..>26769
                     /locus_tag="LDBPK_210140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860483.1"
                     /db_xref="GeneID:13386340"
     CDS             26314..26769
                     /locus_tag="LDBPK_210140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860531.1"
                     /db_xref="GeneID:13386340"
                     /db_xref="UniProtKB/TrEMBL:E9BEZ9"
                     /translation="MFRISLICFPKAGCEEITRQARRVVLKPQEYFAQHRMQVWQMRF
                     KEMGPPFSRVWVALGGKMRRRRIGRQIDVKDMRYYWRPIEPQYQRLYMSRLRIKDHSN
                     KRVQPMRLRATNNDIGQASSLREWERSSDRKYGAALAPPKKRDFEFRVF"
     gene            <27659..>28237
                     /locus_tag="LDBPK_210150"
                     /db_xref="GeneID:13386375"
     mRNA            <27659..>28237
                     /locus_tag="LDBPK_210150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860484.1"
                     /db_xref="GeneID:13386375"
     CDS             27659..28237
                     /locus_tag="LDBPK_210150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860532.1"
                     /db_xref="GeneID:13386375"
                     /db_xref="UniProtKB/TrEMBL:E9BF00"
                     /translation="MMESPRSLSGREEVRVFQSTLDKRTVTTTVFAQPSFYMGLGSAL
                     VMVLTQRFPEELMHRKYLSMSYNGIRAPSLLVIPFCAISGMYFSVASVITAAPTPLVG
                     HLFGYGVSVGVGLTMLWLRRVSWYYPLLGLMYLSFGGLHHYRKMMVYGDNAPIFYWSD
                     FGEIYRDRKARRLEKKRCTEEKAVVQQERAIE"
     gene            <28980..>31223
                     /locus_tag="LDBPK_210160"
                     /db_xref="GeneID:13386376"
     mRNA            <28980..>31223
                     /locus_tag="LDBPK_210160"
                     /product="calpain, putative"
                     /transcript_id="XM_003860485.1"
                     /db_xref="GeneID:13386376"
     CDS             28980..>31223
                     /locus_tag="LDBPK_210160"
                     /codon_start=1
                     /product="calpain, putative"
                     /protein_id="XP_003860533.1"
                     /db_xref="GeneID:13386376"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="UniProtKB/TrEMBL:E9BF01"
                     /translation="MGTKQSPYTYPDTLTHTRTESEPFAAMPSNAELYIYYCRRSACH
                     PNSAVKRYLDDTASSSLEVVDVSANYLGTRGLIPVLDLVKNTKTVHTLDLSNNMMELE
                     HVEHLAYCLALHPCMRTVRLCNDGLHDGHVDALLQLLAENASIEHVSVEGNNLTAASV
                     QAIARALEKSKAVRAQRRREEEEHDSYLKSHTPRARLSFQARLSDHISAAESGGYTHY
                     ATWWKNPQYSVKLSRSSRVSFVLECAHAEAANQVGMLLMRHDGVHRVVEILADTLVVE
                     SSIEDQRCAMEAHLRMDESYVVMPFSFNVGRAVDFTLVATLRNDHTAQEEGWITVERL
                     NARYDWCMRTVEAAWTSDNAGGGPDCLSWRRNDMYHLTCANTAAAAGQQQQPSFMATV
                     HVLLMKEADPYENDSRAIGLDVVTYDVHNATAPPLLCTPEVVRASHSHQRKTFISLQF
                     SMPVAELDVFVVPSTAEARQTGTYSITVFSSVSVDFARSAFPHGWRYRTVTGYWDADC
                     CGGCRQLYQSWKNNPATEVCVEDAAKSLVACVEVHAAEATTVAQSAEEKMATAAAEET
                     PAAMERKAELEELRQRHRSSKREVCVAVVSCSPPSYAELAVSALSEKSAMAVASDIQQ
                     PVFVVPMLRHAAETGAYTLELFSSSSFVVCGATQSLAVRQRKAQLAAYSAENGRRAAQ
                     QNAEQQACRGGADLPALREERRAILDRLYATDLPFVDRDFPRGTSSLFLDPAGAPPLN
                     FPAVTEWR"
     gene            <32445..>33860
                     /locus_tag="LDBPK_210170"
                     /db_xref="GeneID:13386377"
     mRNA            <32445..>33860
                     /locus_tag="LDBPK_210170"
                     /product="calpain, putative"
                     /transcript_id="XM_003860486.1"
                     /db_xref="GeneID:13386377"
     CDS             32445..33860
                     /locus_tag="LDBPK_210170"
                     /codon_start=1
                     /product="calpain, putative"
                     /protein_id="XP_003860534.1"
                     /db_xref="GeneID:13386377"
                     /db_xref="GOA:E9BF02"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BF02"
                     /translation="MPFREHTCDPDALYYISASCSGPATVSIAHVTPNAVTTVAGQWD
                     SNVGAPDSPLWRNNPQFFLSPVEAMEVTITLRTAHPTSGVRGFTVHNTQRCSSFLTFE
                     LATVVASAAADAVGGVPTCVVRLAGMKERRGMPYVVVPYSSGGAEDFSVEVTANRSVQ
                     LRPIDPRLDWHRVRQNVSISAEKGNAGGSLAFPSWRFNTQMALTFPVEREGRLFISAR
                     RLRSADPRVKVGMVLMRSCRTVSGGYRRLLVYAEADIVARSSERAGGEATLATEVNLS
                     AGQGALVLLVHADQPYKEAEVEVSVYSAATVEVQPVVEWTKVLWEEGSWELGTTAGGS
                     RTHFANWINNPFYGLSVIRSTKVVVLLLQYPRDREHPKVRRYGQKKAFLPPPIEFKER
                     CTAIELSIVKYDKDLSEVASVNAGTAAEAYLVTELLPDQPYLLVPCTSEPQHDGDFKL
                     FVFADHPIDLFEAEKPRLPYV"
     gene            <35228..>37657
                     /locus_tag="LDBPK_210180"
                     /db_xref="GeneID:13386341"
     mRNA            <35228..>37657
                     /locus_tag="LDBPK_210180"
                     /product="DNA topoisomerase 1A"
                     /transcript_id="XM_003860487.1"
                     /db_xref="GeneID:13386341"
     CDS             35228..37657
                     /locus_tag="LDBPK_210180"
                     /codon_start=1
                     /product="DNA topoisomerase 1A"
                     /protein_id="XP_003860535.1"
                     /db_xref="GeneID:13386341"
                     /db_xref="GOA:E9BF03"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="UniProtKB/TrEMBL:E9BF03"
                     /translation="MLRRSVRALEKLVIVESPNKVIKVEGLLSDPKVIPDWSFNNSKL
                     RAISTGAEKAIAMATTGHFMSLKELTWSPQSSSPASRVTAADFPSNGLLVSFSLEWEL
                     IPGRRIQDTVSHYIEEKADNLTEIIVATDPDREGELIAVHAQNLIRSMFPQLNVPFTR
                     AYMHSITAEGIRRAMEERHETFDYNLANAAEARHAMDRIFGFLGSSVVRYANPQMRSI
                     GRVQTPALILIKDREDKIKSYLDSHASTFEIQAVCYFTSKQNHRFSQVVKVTPAHKGG
                     AAPVDWSDEATVKQRCEQWALSSATHFSVSPGAKPQETVTPPPKPFTMATLIARANRQ
                     LHYSSDMVSLCLQDLFQMGYITYPRTDSTRIDESILPSIYAAVRREHGKRLLQEQDGP
                     PKSGSRRSTAQKEAADANVEDAHEAIRPTNIDTTVEELGAVSAPMKHIYDLVRRNTMA
                     VHMIPMKTERIVVLVACKAANGEEVEFELQGKHVVEPGWSAAFRGSKGTATPVTETDQ
                     DMEAVEDGGVVVPSISDDEFKAIMDFAAQRGGGTGVKKGSMQLESAQVAENRPSPPLP
                     FSEGGLIEQLKNNGVGRPSTYPMIVKTLLARNYITVKKGRCETTPVGRMLVDTSRATF
                     PSIVDIGFTSAFEKKLDRIAKPGSAKEWALSPNVSDADYVLSSFISNFLNYVTEATKA
                     HRVAITTRSLALQQEKRVASNTPMSPTDFQANLVKETKRVLTQVPDLVDNMKSYRTFT
                     ALQNSLNDYLRRNFPPSAAAVAPASSSGTARSYGSSSSSVKKKESHGAACKVDKKTPR
                     RFRAKPKKPKK"
     gene            <39789..>44924
                     /locus_tag="LDBPK_210190"
                     /db_xref="GeneID:13386342"
     mRNA            <39789..>44924
                     /locus_tag="LDBPK_210190"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860488.1"
                     /db_xref="GeneID:13386342"
     CDS             39789..44924
                     /locus_tag="LDBPK_210190"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860536.1"
                     /db_xref="GeneID:13386342"
                     /db_xref="GOA:E9BF04"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9BF04"
                     /translation="MPLCAPLGTHTAAFRAGGTPAQEHTSTGMQKGTEKTMSRDVDVE
                     SAFTALSPSAGEKEMVHGANAASGLYCFKDTLRIELPVISSEHCATFSSLADGTGGGS
                     PETAIYRPSETAFSREIEECTPLSIEEDNARQSAVALLQAGILPKSAGGSSRRGTSRR
                     LPSFIPTFSNLEPIEAVRKKSPVSLFTNIRRKNICSLSMEADRTRGGEPDGVIPCSGA
                     FNRSSGSFELHPDLTTVIARGASSAPPSPEQQQRCGSTFTSPAPSQTASSMSLADGSE
                     ESGGSSDQGIEMDLVLRDASKIRGLRLAWLLYMLIVMVIVLFVLVLVQITYETSRMLT
                     RSATEAVQAQAASLLNSVDMQQYALEKLFEVMYETKITGFSPDSITHIIVRDIICSSL
                     YRAPIAFAMYDKAGELQWKTSCKWNDTVDMLAELPKTVLPGIAFMRIVDYGKLALAYR
                     TFYASSGGVETYVVMTEKETLGRTLMNNDMADYSTATLQSVMTAFFLPRWNSTQLTML
                     FHTLTKEARSYTNTPTSPTAAALTAAFESLCHTDSPYVWHIVLMPVNASEIVKRSIRA
                     ADWPETKTHTIPTPRFEYKRTWGQLSKANLCGVKCMSAEGDKCTLDNPTNVWFLVDYT
                     MAHLESIHTTVAIVGAVSVMAVVIFSVIMFLVYLSITVPVNYLRYQLMRAVGSNEMAT
                     PWQRKIVRWTYRLWLGDLTSIARSIYILGLCFRLNKKYVPDHVLRNHAKQLYMRRRKF
                     NFLEEADLKEDTMLEHDTDSDNEAESPLVGVNTVLPPSDKRFLWHFSVTHDKDEADHA
                     ASENGVGARISDGATFAEVSPVYAPRPQLPTTSYEVVVPCGRAAPAPRGVGLPRDVPL
                     NVKAYGELEDTVAMQEASTMAAATAMTTQSSNDIMSIRREYETTVLCIRIPSVELAYL
                     INYSGAAHQHRRLMRVLLHRIRRHKGALFHCSGDCLGAVWNAFEGCPNHAECAAVCAQ
                     EIANAFAPYRSDGLYVGMVLHQGTLVCGTVEYSKTAFVTAFGDGPREALAVAELAAAV
                     KTLNVLVTEPVKQALSGLYDCNIVDVIQLPNSAHPLLLFELSGSRTPERSLNDTHLQA
                     PTQAEFSIDYARAFAQFRNHEFSKALQSIQKLRTHISSRNVHLLRRLERLCLFYSAQP
                     AALPRPYHRAFPVWVNYEAIAQAGLRNDPHLTTSQTESLTAHNMSRGLVYQGVPVLRN
                     DMDCIRDFKQELQANMRRLVSPQRTTRQSGSPTLDNAATPTQDSLHASLPMRSTPLPM
                     PMSAGMLLEISGDLSESLSAAMPAKPRYVDPQENAAEMSLPPLRPTPVVTVAPPCFIA
                     GPPLVAASAAAPMACEEGKGRNGPERTSPEVSSPHGMPFPSRHLAVTHSATNLPPVAL
                     AGTPDLVTASAALLQSAATHTDSINSSAQADGASCSIIQSAGLSFQETGGMRGFCVSN
                     ETLPATIKAKNGTTYLRSTRILGKGSFGCVYLGMDAHSGRLVAIKFLPLPSDESGMEM
                     IEAEVLILQRVNDTHVVQLLSYAFEGDTIVIFMECMLAGSLQNMIAAFRTIPSSTARV
                     FMRDVLRGLSKLHSMGVIHRDMKPQNVLLSFAGNCKISDFGASAWLQELARKESKGEV
                     CGTPVYLAPEAARGSPEKESDIWSCGIMFLHMITGRLPYSPEQLALGAAALVYQIGSG
                     IAQPNIPDDLDVLDAEFVRACLDKDPSKRTSAAGLLQLALFTV"
     gene            <47803..>49788
                     /locus_tag="LDBPK_210200"
                     /db_xref="GeneID:13386343"
     mRNA            <47803..>49788
                     /locus_tag="LDBPK_210200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860489.1"
                     /db_xref="GeneID:13386343"
     CDS             47803..49788
                     /locus_tag="LDBPK_210200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860537.1"
                     /db_xref="GeneID:13386343"
                     /db_xref="UniProtKB/TrEMBL:E9BF05"
                     /translation="MVKAARSLILVLCGCSVSGRGMQRYVGCAWGHRGGRWATTTLAM
                     ASAAATPSLLVSSSMLTTSRYCTTTSASAEVPAQGDDGNAVVRHLKQDMEALETLRSI
                     APVSSTEEIQAMIKSAKNAREVRMVLERIVYTHHLCFDLLNGHGYRVAVLQTLTAVAP
                     HASCMHEWFDCVARFRRLGFMLTRTYAAEGFTTIRQWLSREFLHRGRSPSLVTEGTTH
                     IKELMQWCLEDRLVFDHVLYTRIVFLLTMIVSYLDRQNLYRASFPEDFAKRDGIVVEW
                     IVTNERCVDFDECVLQCDAVMEELLEQMRQDIPSRPPFSFMYRLADYYFATDNVEKMI
                     AVMEDAESYGVSVAESTTAKLMQMACAFNSPQVPELLLRWRVLPPQCVLATPDVSRLL
                     FFYSRSGGGLPCPHCGEPYNHRNVSVYCWLQTPPHQRQCPALRKARVQKGELEESREL
                     PQNADWSAQAFGLFELSRARAIEWTAVEWRGFLLCCIFSPRAMEAKALMDQHLDVTEM
                     DDFLRAACIRLLRHHAPAEAWPTLKKWKQQQCNMSPIALQEALMAASMVADAATRLEH
                     MKAVWQLLLEKDSYVMPLTRRFYQRRMEELAKSYAAAAGGDGKESQDDLATEREEAQL
                     MQRVVEMQPRHVSLLDMKDSAADFVVGTRRKNVYRPR"
     gene            <50514..>51575
                     /locus_tag="LDBPK_210210"
                     /db_xref="GeneID:13386344"
     mRNA            <50514..>51575
                     /locus_tag="LDBPK_210210"
                     /product="serine/threonine-protein kinase-like protein"
                     /transcript_id="XM_003860490.1"
                     /db_xref="GeneID:13386344"
     CDS             50514..51575
                     /locus_tag="LDBPK_210210"
                     /codon_start=1
                     /product="serine/threonine-protein kinase-like protein"
                     /protein_id="XP_003860538.1"
                     /db_xref="GeneID:13386344"
                     /db_xref="GOA:E9BF06"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BF06"
                     /translation="MTASLSSSPVRHPSVDNAAIPAASHHIPPPLNGYAFLEHRRSAL
                     SHDTFIARDVRQQQHPEQQDNDQAKVIIRVYALEYLRRDEECRFALERECLAARLVVH
                     PHLLPLGSPFASKTDLFVVEKYCAGGDLYELMVSLAKEGPIASETGAAKGEAPPRSST
                     GLPISTVKRFMRELLSAVQYLHRTCGLVHRNIKLETLFIDEEQHLRLGSFGLCAVLPP
                     PSVATGDREGALDAPEDKASSSHAPLRLCCGSKHYAAPELVQGHPYQGEGVDAWACGV
                     VLFALLTGCFPFDSDDGDEALFRLLCGDVEAHLAQHPAMAAIEDPQACDLVRNLLRPN
                     PNARYTVSEALEHPYLWEV"
     gene            <52147..>54390
                     /locus_tag="LDBPK_210220"
                     /db_xref="GeneID:13386345"
     mRNA            <52147..>54390
                     /locus_tag="LDBPK_210220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860491.1"
                     /db_xref="GeneID:13386345"
     CDS             52147..54390
                     /locus_tag="LDBPK_210220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860539.1"
                     /db_xref="GeneID:13386345"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BF07"
                     /translation="MRCLRRCWGPWPSAPSSCWRLWSLDAVMSAPQASVEGLLVQVRQ
                     QAATSPVWSVDFSALLERCFTVGCHSPQSRAQLMGRVAATLATVLSASEAPSVTALSV
                     TLPTPEAAITVMQLCQNTPLLASLESLELVVDVAAVRSRQEGMEGTGGHEVASLLREL
                     AAHQRRRAGQSHWTSLSVRSRDTSAPGVFTVGLHAQPQHHVVPRLWDDVMVSALAELV
                     AAAPWARVAFCHADLTPSSYRARQRLWASFDSVHASLAVLDLTGVRHAHELVASRQLR
                     HLTRLSSLDVGHTQLEEDAVQCLLRDVQDGVGGWWLLQHLGLAQCEVSEAVVTLLHDQ
                     HEQHARNKVPLLESFSVSGARLSCRAAFVMAMCLMQCTRLRLLQTRNCHLQPASLESM
                     AAALRHAPGLQAWVLCLNKFGDEGVAALTKHARCWPSLTDMDLSRCRLTCASVHTLSR
                     ALPHWSKLQSLRLVGNDLRWQSPQTLSSASSSRVEGSENGRETAGLFAYDPAYMKGHG
                     SSVKVPTSYELERRDRQEGRQRYKGTEEFTEAAAPIAPPLEVLGEALSMCSQLRVLDL
                     SDSAMADAQLVQLVTHFTGAALEELRLAANPLFATVPALDALIKLLWRTPSLSVLDLS
                     FTGLGDLGVSMMCDGTAGRDGGVLKSMSRLHTLLLSGCAVESLGWESLAAAVSQLTSL
                     RHLALHHNRVSKVALLEELLCQLVTVSSLQSVNLAGCVDSTESVRRLQDGAVCRALRD
                     RGVQVLL"
     gene            <55701..>58001
                     /locus_tag="LDBPK_210230"
                     /db_xref="GeneID:13386346"
     mRNA            <55701..>58001
                     /locus_tag="LDBPK_210230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860492.1"
                     /db_xref="GeneID:13386346"
     CDS             55701..58001
                     /locus_tag="LDBPK_210230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860540.1"
                     /db_xref="GeneID:13386346"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BF08"
                     /translation="MPPSAHWGKRPREGDSDEAFVRFSELSPAQKLERRRQERAEKKE
                     RDRTLAYFKSVQRALEEQGSGGGDAGALASIVDGFFSELLKLLKADSSFYILRNGTAC
                     RVVELALANALLLHVKSLLYVFLGHICELLISPVASYTLETLLASLSQGLSALAATSP
                     EGLEAELTEGGVGMHTGSGVPSSATLLRSMAEEMCENAEDLIVHDIGGRALRSVVLML
                     GGHSIRQAPLPVHPVAFPCILGTLAEAVIKALEEGYGREYRTASPAEAWMAAVQAPAT
                     SLVVQSLLRVSDEGSVVDRCVRQRIEQLSYKGRPLLHHLLVDTLGCHVFQSYLQVPPP
                     TAVVVEGDAAAVRASASTEESDGSSEAASVPGGDTSCCWSRAAGAVTVEVSNLLKPGS
                     DLVAQTSYVLQDLVLYAPTATHLQWLWRRVLEPRLALLFDVPALAPVLVQLVKRCAFE
                     SFTLKPFASPGLAAAGDAADPTTGEVSHHGTVLPADVLKTLRKDAVHHVRYSPVPITF
                     QKAVCTSVCGLARQRVVKGAAQYLLVDGALGDRGYELARFLLHLHPTASTMLQYSLDK
                     LQRDDLLAVMCHQKGSLFMQQYIKVAALAVPKSTAAYAEGDKAAHVSDATAAAAAAES
                     KRPLMRLFRRLQSSLGTLIYDRYAAFMLEVLYEAASMPVKEALVKSLVPLYQEMRTQS
                     SGSTPTPSASAEAAPSVASATADNEGGENGTHADLTPTQRRFIAYKVMSRCCVEQYVH
                     RKDDWVKLAERQCHAQRLLRRMLLSE"
     gene            <58593..>63020
                     /locus_tag="LDBPK_210240"
                     /db_xref="GeneID:13386378"
     mRNA            <58593..>63020
                     /locus_tag="LDBPK_210240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860493.1"
                     /db_xref="GeneID:13386378"
     CDS             58593..63020
                     /locus_tag="LDBPK_210240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860541.1"
                     /db_xref="GeneID:13386378"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR024983"
                     /db_xref="UniProtKB/TrEMBL:E9BF09"
                     /translation="MADTAHSTALPVLGEGKRGGNGRLTTIAAPVSADGSMDHVALYR
                     QFCAEEGCKANSAFLRYMQDRGGHFSLERLNLSNNYLGSKGLRPVIRMIDLCQTIVSI
                     NLENNGINNDAVMGLCEVLQRHVSITSLNLSHNPISVAGGRRLLQLVEDNPRITELLL
                     NGTDIFEGSQSRIRMALQRNSATQLSSGPHMEVNKEVASPAALARAARCQPPSPPARR
                     RGGPAAANTLPVLTSPKATLQAIHHHPRSADNAAADGPSAGAASTFSGAVSRRSPVNG
                     SSSSCNGFSYSATSAAVLEASPRYTWHEVTLGKPQPRPPHPAVASQEHKSFSLSKVKD
                     LKTLFAERARLLTEINRGEASRRAYAARQELMALERHGRPTEATATGAQSRTYPGAAT
                     TSIPLPVLLTNVDEEGSPTANAIGGDGGAENASVDISAAPHVAVSSGGETTEAVQRSG
                     NAHAASPPSSLAGATACINDAPAPTTVVGVQSAEAGLADGAALAVPEERPQAHTIDDV
                     LTLTRMKLLTTEEQFTVLFDQGCREYMNRNLDAAYMAWNEAMRIAVREGQREWMAVVA
                     SNLQRLSYELLVEEGASHLEHGELDKALETFKLAYDVAMKAKNAAWERDMRTALQNVQ
                     KALFHRCHEAALLLFRRAQEDMSGGVAATTVTEDDYFLIPGTEEMVRHTAAFVREWSC
                     LLLLKEAVGMWVEATRATGRLSEAAAAPLKESVKDAVSLVAAFIAEHHFNAASPTGLT
                     WFGTDAYLYHECILLSELWCDLVAYSEQNLHHGLLSAICAAQLGELYVATFQLPQALV
                     QLNKLVTYGRTQRSAVLEAAGLTLCGRVHLQRADYALAEAALDEALRIWTELQSDPAP
                     KVLADSRDAGVWHRYDVALMDASSVTADETAVASAQATAVQKSAASAPAKAAAAVPDR
                     LEEMRGTTGHGNSSTRFRIETHLPTDAVAVLANMCRHYKVCLLLHTYRYSAALEALES
                     SLNNAYSDTLREKLRRNFHLSPSLDEIAAIAGVLKTPLVFYTLATKYDWAATEGGYAA
                     EDSLCIWVVSESREMRFVEVNLARDFRCTLSGLIASLRRQLCIEPEMAVQPDIITELP
                     SLSWQEPLRVLYQACIHPIIGYVRALDSHLLLGDGIITVVPSGQMWLVPFHALLNVKA
                     GDRYFVEEAAVQMAFSATQAALAALSAERVQQQDLHREVVAVQRDADHGAADALFYTP
                     FPFDTDRSEQEGAAVVEMLSAGQVQLVEQLRRHCAPEKAIFTRKVELVEDVESLRAVL
                     PRARAVHIATATTASAPLSQASAIDKTASRPEDEGGLLMRTAAPMGDVGVIRAAEIAH
                     MELAAEHVILTNTNMSPQHTDGIRDDVLGLLRGFFGSGVPCVIAGQWCTPDMKPMELF
                     RYFYAQRCRPLPTSPADLSVRTDTASGGSVSASNEQSSRVAQPQVVAGEEEPKEEGEM
                     ARHRALLLARSIRHLLTEEPAMRYRPRVWAGYYCIGSGW"
     gene            <64203..>66377
                     /locus_tag="LDBPK_210250"
                     /db_xref="GeneID:13386347"
     mRNA            <64203..>66377
                     /locus_tag="LDBPK_210250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860494.1"
                     /db_xref="GeneID:13386347"
     CDS             64203..66377
                     /locus_tag="LDBPK_210250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860542.1"
                     /db_xref="GeneID:13386347"
                     /db_xref="UniProtKB/TrEMBL:E9BF10"
                     /translation="MSSGRRDIIFFGSIAVSIIGHEVHDEAVAAQLERQNARIKLHTT
                     ARAPYAKTEEVFGLDATSPLYEIDSADFKASPASSLTPQRGASHPRHHRQKAAFLPVM
                     LKLAQDAAVGEVPSVEDQDGALLQLDSPTNSADPAPSYASASVRIEVGMSRSGGDATP
                     VGTKDVFLPSLNYLAIRDMCTVVRIPVWSNRIQKSETGEVDVAELDHRSPQPQRAGDG
                     NSRSSGGVLGGVRDRNSRGDAVSGVALSVYAMVRVISLAEKVRLALEADDAVRCLLSL
                     PDPVPRMSLALTQRGDAPYGAMPLTELYEHHRQFFGYYSNTIIKHSSVVTQRLAEAPR
                     QREADASFPHRWNTLTVVDLRPALLGEDAFAPLLVTLAYCANLRALYADGNHLGDLTC
                     ARLSALFRRHRYLARVSLSKNTIHEAGGEQLLRLVRNNLRITSMPCQGNYFSDALRSR
                     IEEVARRNASVIAQDPLNIFSASYDYLTGLSSLPNSLQQQGLRTWAMLSAAPVGDVDV
                     MVRNFTTSTQRTLGDSPVVAMQRAKAALRARESFSLIPPAALAPLLNEIMRTVSVGVS
                     RVLPDPLVRSLFSDMETVVALEQEQVEAQRRDELAGGSRDALLLPPDVCDAVGGVYTP
                     PVDSETMYARSFVRIVVAALRGVALGTPWAEIAKVLEGIGRVHRDLGVMPEDYWLAVH
                     IFMTSLRISCGAECYDADNASSFLGLLALAVRTAAGTDTVLQ"
     gene            <67241..>70120
                     /locus_tag="LDBPK_210260"
                     /db_xref="GeneID:13386348"
     mRNA            <67241..>70120
                     /locus_tag="LDBPK_210260"
                     /product="major vault protein-like protein"
                     /transcript_id="XM_003860495.1"
                     /db_xref="GeneID:13386348"
     CDS             67241..70120
                     /locus_tag="LDBPK_210260"
                     /codon_start=1
                     /product="major vault protein-like protein"
                     /protein_id="XP_003860543.1"
                     /db_xref="GeneID:13386348"
                     /db_xref="InterPro:IPR002499"
                     /db_xref="InterPro:IPR021870"
                     /db_xref="UniProtKB/TrEMBL:E9BF11"
                     /translation="MSTASVVKLMPHEYLHVEDTNTCEVLTLVGPITYTLYDHHRQLH
                     ETPQPCVVVPPSQFVTVKNPMHAVPTSLKDKADAPPVYTLLRSSPGSITGLAALPYSR
                     WKMPYGSSELRFFDESPFPLLPGETVDEPSPMPLLTASEALTLEALAPHDVVDPVTGA
                     AVHRAAQECFLFKGPGLYTPRLDERIVSKVTGVYVSPPQVCYLSAKYDFVDDDGVPRV
                     AGEQWIVQAHGIFFPHPAVTLQVRDAYVLTSFEALTFVSYKAFYDEGLQVAREAQKPY
                     LISYADTKDGTYLPRPHETFRGRRRQVHLTATQYCVVINPVGADGTARLHQAEVRLGK
                     QSFMLQPGEHCTKPLTALVLSEDEALLHVALQTYTEADGTVREGGSRWLVRGPRQYIP
                     PVYARVVERRRIIKVDENCGVYVRNIHTGKVRSVFGKPFMLGADEQLWERPIGAYVRR
                     LLAEPRQSLRVTDMSAKERAEASLEEGWAATRVEWDMQASSTAAAEVAGGGCYSASSS
                     GESLDSSDDFMDRGECADELQLLDAATRNAHPPRLSRHISRYHVITVNVEHNTLVRLY
                     DTSTGLSRVVAGPATVFLEPHEHFTPLSLSGGRPKEPHQIHSLSLYLGPDYMADVIEV
                     ETRDHARLRLHLAYNWEFGSVDSSGKAGMVDPELAFTIPDFIGEACKALASRVRSAIA
                     GQAFEFFHCNSSTLIRQAIFTPAEDGSIVSHGDSLCFTANGLYITTVDVQSVEPVNIK
                     TRTALAKSVQLAVEIITKAQESDASHQAALLEQEAKGALDLQVMRDRAKAEQQRTELL
                     RVMGENTALEQAGASRAQALAESAARLAEAQGEVDATPIRCAAHSVGMDTELEVLRKR
                     AELDLAHRQSMNNLAIDKIRKLSDIEATKYEKIMASLGSETLIAIANAGPELKAKLLG
                     ELGLQGFVVTDGKTPINILNLADKMAAGPLASTPSPAAPGATRVS"
     gene            <70828..>72432
                     /locus_tag="LDBPK_210270"
                     /db_xref="GeneID:13386379"
     mRNA            <70828..>72432
                     /locus_tag="LDBPK_210270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860496.1"
                     /db_xref="GeneID:13386379"
     CDS             70828..72432
                     /locus_tag="LDBPK_210270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860544.1"
                     /db_xref="GeneID:13386379"
                     /db_xref="UniProtKB/TrEMBL:E9BF12"
                     /translation="MLHEVNVGTSDIVRGGHDDDEAATQRQPPALSVVEEHMQRIRLE
                     LCGQRHPPSGYASGIAIPSTAAGLDRVAVLVDLLDQVRYWAIEEASTFKDEPSRLAET
                     EAPEAVVACLCSQRPQLVAQALRVVQPMLRHRQTAYKTRRVMVDVWAYREQVNSMVPL
                     PEGLDPLLVMLAEVLEQHKGVLPVLVEALSAATAALVQDVTVCVGSDNGDDDNLDGGV
                     SLRRCVAPLVVALHETTLVYQMESAMRRHPDAVPLQVEGVSFCAALVDLPWPFEAEVD
                     SEEGTPTSLADIVAHSDGVLDVLQGALRRHRQNLRIARGVLHVWRVCAQHPANRVPLL
                     QHGAYAGALQQLREVGPYTVGVWREIAETVGYFIPLLDTLQRRSLALTLRELLLRRPQ
                     LEVLELILALLLSLLMVVDSGHHGGGGKSGGAFNMYAMYPQPPAAAPSPSATDIAGEP
                     HHRGTKAVLRFSLLQWHPMRGHHPHSGASVAGEDTWHFLLERCAMPQLVSGLLEYFGH
                     CEAVDEEDASDLDRVCRLAEAVLGFF"
     gene            <73077..>73541
                     /locus_tag="LDBPK_210280"
                     /db_xref="GeneID:13386380"
     mRNA            <73077..>73541
                     /locus_tag="LDBPK_210280"
                     /product="calmodulin-like protein"
                     /transcript_id="XM_003860497.1"
                     /db_xref="GeneID:13386380"
     CDS             73077..73541
                     /locus_tag="LDBPK_210280"
                     /codon_start=1
                     /product="calmodulin-like protein"
                     /protein_id="XP_003860545.1"
                     /db_xref="GeneID:13386380"
                     /db_xref="GOA:E9BF13"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BF13"
                     /translation="MSVLSEAQRTCASLQFLLLDQDSDGFIGSHELGAYLRAIGLYPS
                     QSDIAGYIALVDPEEQGRVSQESALALYEKLYPQRTTPEELYAALKVLDDDADGYLTT
                     TQLRHILVNLGARISQEEAEEILCDVEKDGEGMIMVDDIIQLLMPTEGEERL"
     gene            <74154..>75926
                     /locus_tag="LDBPK_210290"
                     /db_xref="GeneID:13386349"
     mRNA            <74154..>75926
                     /locus_tag="LDBPK_210290"
                     /product="actin-like protein, putative"
                     /transcript_id="XM_003860498.1"
                     /db_xref="GeneID:13386349"
     CDS             74154..75926
                     /locus_tag="LDBPK_210290"
                     /codon_start=1
                     /product="actin-like protein, putative"
                     /protein_id="XP_003860546.1"
                     /db_xref="GeneID:13386349"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:E9BF14"
                     /translation="MPRVQLFIDNGGYSVKALYLPASADTSSRSAATHASALTNSSTH
                     GEVAATATTLAPAPKVLVVPNCVGAAVYAGTGIMGDQLDHLPHYHGLMVRRPVDRGFV
                     VDGGLQARVWEHVLQHFSIESEEEVDVWLTVPFAAPKAVAQLLWLLCTRSFRFGSVTI
                     VSSSFMSLIAYNFARGASAPSSAARKRPRSTVDTDAQESPGCSGNSATGGGMAIMVDV
                     GFSATTVVPYVNYIPVHSSAVRLDVGGKVLTNRLKEYISFSQMNVMEDTWLINHVKEQ
                     CCVVARHPRRSLQRYAALWKGRARDEVEAVVGTVSTLRREGGGGGGGGDGQSPRSQRP
                     GAPAAGVLTSPDVPIRYYLPTIPALLPLGVLEAELPSRLPKTSGVDAAALQHLLLCQE
                     RFLIPELLFTPADVGINQQGVAQAITEGIFQRGLLQHLTKLLRPLLLHNVCVYGGTAS
                     QPNFRDRLEAEVAAVAPQSPDCDADLDLKDSKRSSKSSSSRHGAAEACADRATCLSAT
                     PALPEFLLTAGGASTDLSLQPLLGAWCLLSATVDGGSNGGASQRELLRLRALVHQRSG
                     IELQHPPAGRVTVETFQHALERML"
     gap             76862..76960
                     /estimated_length=99
     gene            <77020..>78435
                     /locus_tag="LDBPK_210300"
                     /db_xref="GeneID:13386350"
     mRNA            <77020..>78435
                     /locus_tag="LDBPK_210300"
                     /product="hexokinase, putative"
                     /transcript_id="XM_003860499.1"
                     /db_xref="GeneID:13386350"
     CDS             77020..78435
                     /locus_tag="LDBPK_210300"
                     /codon_start=1
                     /product="hexokinase, putative"
                     /protein_id="XP_003860547.1"
                     /db_xref="GeneID:13386350"
                     /db_xref="GOA:E9BF15"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:E9BF15"
                     /translation="MATRVNNLLSHIAIRDSDSEEMRYIKQRLALASLATQFTMSSEK
                     MKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPAKATGVYYALDLGGTNFRVLRVS
                     LRGGKVDDRTDSKFVIPKSALVGDATDLFDFIAQSVKKMMSENAPDDLEKRVPLGFTF
                     SFPVDQKAVNKGLLIKWTKGFSTKNVEGNDVVELLQASLRRVRVNVNVVALCNDTVGT
                     LVARYFVDTDVQVGVIIGTGSNACYFERASAVTKDPAVSARGNAVTPINMECGNFDSK
                     YKYALPITVYDDEMDAITPNRENQRQEKLVSGMYLGEISRRLIVHLAQLGCLPRGLVD
                     GLCRPWAFESKHMGMIAADQMPGLQFTRELIKRIAGVDVTDMSDLHTIREACCLVRNR
                     AAQQGAVFTAAPMLKTRTQGLATVAVDGSVYEKTPSFQRLYQECITSILGSTSNVKVV
                     LQKDGSGVGAAMICALAANKK"
     gap             78733..78831
                     /estimated_length=99
     gene            <80721..>81683
                     /locus_tag="LDBPK_210310"
                     /db_xref="GeneID:13386381"
     mRNA            <80721..>81683
                     /locus_tag="LDBPK_210310"
                     /product="hexokinase, putative"
                     /transcript_id="XM_003860500.1"
                     /db_xref="GeneID:13386381"
     CDS             80721..>81683
                     /locus_tag="LDBPK_210310"
                     /codon_start=1
                     /product="hexokinase, putative"
                     /protein_id="XP_003860548.1"
                     /db_xref="GeneID:13386381"
                     /db_xref="GOA:E9BF16"
                     /db_xref="UniProtKB/TrEMBL:E9BF16"
                     /translation="MCMCMCKCVCVCVCVTARVYVYMCMHIYIRISLSMSRSRSVSAN
                     VRARGERGGRLSFHVLSLVRPRPPHPLLTEHRGDQNEIWPSPPVSSACKNTYTHTLLP
                     DMDRAATIKRTRARVHKSGVVCTDEEEEAQYTSPPLALYALPRPLIFGSRTKSSMYGR
                     MMRHAAAYLATPALPSSPSHPLLFVSFPHSFASTRYDGHHRCPPPFLTLPPARPTHPT
                     NTRTRWSTARLHLPPPLEVSYNSQTPFTPLLSSSAHTPPLPTTLHSVTMATRVNNLLS
                     HIAIRDSDSEEMRYIKQRLALASLATQFTMSSEKMKQLTMYMIHE"
     gap             81686..82705
                     /estimated_length=1020
     gene            <85682..>87472
                     /locus_tag="LDBPK_210320"
                     /db_xref="GeneID:13386351"
     mRNA            <85682..>87472
                     /locus_tag="LDBPK_210320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860501.1"
                     /db_xref="GeneID:13386351"
     CDS             85682..87472
                     /locus_tag="LDBPK_210320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860549.1"
                     /db_xref="GeneID:13386351"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:E9BF17"
                     /translation="MRVYTNLGRIDKVREVLAVGLRDLAAPKEPKLASPVQYAWLGSS
                     ARRRDGGNATAATGTPLKLQDDLLAPGAAARGGRSCDTSAIMWWRRPTVLNADVFNAY
                     FEALTRRNKYAVEEVVFVLDQMKACGVEKDALTYHYLVELHVRAGYDPTGLWEEMKQR
                     EPEVTPLPATVQTFMLRVVPYSADPSLVVEITRAALRYGTAIVDKRMLAELMVQWLSP
                     VRAPNHGESSGGSGSRHTAAQASRLGLSTGSPSSAAQYPPEHVLWLMLELELRCVLEK
                     ASFSQYVQRHYFTELLLRCAKCTDAGTAEQVLALMDRHAIAKTSEVLALVVWCWSQAL
                     EIEKALDLIEWMALKGYLDQVDCFRKAQIESLRYTMDRHYLMAFADAINTLALVERAL
                     SHLQARRQKGALVTVHTLDLLVLALARIGEERKALQLVSAYEPRWGVAPRTNTYNALL
                     TGCSRHRSTMLHRVVYKTMKNSGVVPNVLTFRVLIRQAVMAGNIDEAIFYLEEVTAYP
                     GLRVEVEMILPILERAARVGDVETATRVSQYSLKCDIGIDGSVLRSVMQQLTEAGQSV
                     EVLKGQLPLHEALRSRSKAGRQRARNEVLV"
     gene            <88480..>91899
                     /locus_tag="LDBPK_210330"
                     /db_xref="GeneID:13386352"
     mRNA            <88480..>91899
                     /locus_tag="LDBPK_210330"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860502.1"
                     /db_xref="GeneID:13386352"
     CDS             88480..91899
                     /locus_tag="LDBPK_210330"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860550.1"
                     /db_xref="GeneID:13386352"
                     /db_xref="GOA:E9BF18"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BF18"
                     /translation="MATVDTVRGRYSSYKLLNEVGRGGSALVYRAQDVATRKDVAVKQ
                     LFGNRPQDMEDWLREVDALHTLNNHHCPHVVKYLDHMQQHDRLFLVEEFTEHGSLLRR
                     LKENSKLPEDIACRYIYQVLTALYHMAPWGVVHGDLKASNILLFDGDVVKLTDFALRS
                     HGEDDHEDGERRTTAASTPSAEALPLMRGSRAGRGAGEECSGSALSVFRGSAYWAAPE
                     VLAGASKATAASDIWSVGCLAVELLTGAPPYFERPIHNAIHHILKSYYEVLCESEASR
                     VGAAGTSRASTNPATPSAAMGSGDDDGPRGPRKKKNGAKDGCGAAPQKTDVASARRAT
                     ATTSTHNPPKEPVDAVKTAASSGAVCASDRNEVATPLCEAALLPPLPEDVHLSDECLS
                     FLRMCFRPRAVDRPSAGELLHDPWFLDCTVPQLLRAAREGRPMNGTTGDESVSAGTSS
                     GSRFGVIEQWVKRNLTCDNESRCEAWLNSDALPLLVPVLTPRIMTPKYIGNVMWCFSQ
                     FAESRSALATLFVDRLGSTELWGVEELTSACDADHLATLFRRCCATQDAQVPVYTPAD
                     PRALRFVLGLEKEKVLACVRALHSRLVLEPTAAAMAADASSLATATDDTAVDLNDCPA
                     SSRDPAAPAHAAPDRAPASLQEQHEQQQRARERLLSDGGAAVLCQCVEAQCKAAFLSN
                     TAPMMEWSTMNLLFDVLCTIEPLAGGQALLWGLGADLSGGHTSPSSTVGTGGGGAAIL
                     KSLTVVVNPCGGRGGGELNSTWEKSSPGTGPPLLVSPISVSPQESIPTTAAAAGGGGG
                     PLSSLGSTMGFGCHTVSGLPPESVQWATSMTWLLAVQEAARHLCEAAVRLLTRYIPVA
                     RRCRAEYLEKAGVSLTATLVLVASSEVVSTDVRCAAVEALPQLQASSLRATRYLRDPV
                     RCIALLALTLKRSYGVPALTSCLLTAITAMTSEKQMLAACTGCPWVWESLVSLLREVE
                     AADKAAAAGGKRSSSALHSAASTDGGAAEGAVAPPALVAAAASPTSVKSPSASSSSGA
                     VAAGGAAVFADIVVLLSRWFAEVTPTALLSSAVTAAAAASEAIPALGHPAASLPLPVF
                     LQTLRCQLIALSQNGRVCHGDLMPDVAKALRHLAPLEAAAVAASTSTATVA"
     gene            <93419..>94234
                     /locus_tag="LDBPK_210340"
                     /db_xref="GeneID:13386353"
     mRNA            <93419..>94234
                     /locus_tag="LDBPK_210340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860503.1"
                     /db_xref="GeneID:13386353"
     CDS             93419..94234
                     /locus_tag="LDBPK_210340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860551.1"
                     /db_xref="GeneID:13386353"
                     /db_xref="UniProtKB/TrEMBL:E9BF19"
                     /translation="MENGVCFGSPDSCGLRALRTARLAFISSIELTANGLAWRQRRHT
                     CEEARGLTVLDASAIDFTFAQAALQSTLELGLHAGAGCQISHVPLTDAAAAHVEPQAA
                     SYIRVVAAGPGRALPRPFDYLPTHSIDVGAYTAHLPLPVGPAAEEKGGGGGGEGSAAS
                     RRGFKSPGRDARANRQQLAVQLSQALATLRRGAFMLVTFVPTCSSVATLYHQMETQRR
                     AEVLIEHKVVTEAKACIAEAIARTGRWGFITDEVLPAADSAQGSSFSLVVMLE"
     gene            <94800..>98111
                     /locus_tag="LDBPK_210350"
                     /db_xref="GeneID:13386382"
     mRNA            <94800..>98111
                     /locus_tag="LDBPK_210350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860504.1"
                     /db_xref="GeneID:13386382"
     CDS             94800..98111
                     /locus_tag="LDBPK_210350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860552.1"
                     /db_xref="GeneID:13386382"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:E9BF20"
                     /translation="MLSNTKGYQRFSHTLGFHSDDLSKLSKVCHQWCETGKCKAYNKE
                     QEVRREIAAAKEAELLKKATALYTMHMELMADMAGADGDDAEALELMQSAMSRGSFPA
                     DPAKREEVISKLVEELKQEPVYLNWSLDAAVAERLVELKVKRCPYNHRGALNLALKRG
                     RSEEDEEEMLHRSEEEVLRGSSTNGAAAASSSSAVATTTAAGPAKDTGDDSDGGWAEA
                     RHRIFRTLTPLQRCVVCLLWQRTFQVAQGLVMDVRLALEKRVTAQHKATGRVEPPSIS
                     CSGVAAQSSSHRPHGGSQNDVKDADGEDALEAYLSSPAFEELVERETKRVVPRVAFRP
                     EFGLVDLSALPQLVAHLSAHPTCGIFLARTLTYFTGKALKRDGSSPSAAPAAASSLSK
                     HQSDDAPAPESFHHLLFPSRKLITEKELDLSTSTCADEVIEAIEWALHVYHRHGQPHA
                     ETERAEGKGEWGMTGDERRLCKASDTASAHVTALFRNQRIRLHGLTLTQCKITSADGI
                     VESLHKRHMEQYLYALDLSENRLWSLRFLLVLRAHYARRLLRLSLRNNPITRKPEYQE
                     QVRASLPQLTSLDGEPIRRPPLRFPKPWPTSCTRWIADEGTPEHQEQESVLDCVARLL
                     YIWETRRIPHTARELAAFRDAGHPATEEEALNEDNFPHRYLHPAAAFSVTVSPSLSFY
                     DAATMRDARSVELDKDYTGMRLSAVDVRDARVFNVAMKNSSRNLLAGRQALQRFGRGA
                     ENCYMAYQLTLYPERMDVSHHLTDAVVSVARVPQVVNAAVSGGKAAAAGKRKKSAADP
                     GVARAAGSGKTSSHGSPTSARFGALAHRNPPLQQHVVTLHGIMTWRLPSMKRHECMQA
                     SYTRVLAFTKKVLPDQNREWERLRSPPYVLMNDQVFLYPAPTAGAAVAATALLSSVFA
                     ANTATRLSRLVVEFGLEACRDGVALVRDVMERCTSPASEYAALQALVLGVLGPREETD
                     EAEEAAQLACAQAAEAQLAPLFADYLRRSPPPATAHSREYMIFSMLDGVAATTPVEPA
                     VHTTGLTQHQRGATSAVKRLKAPAVTAAPSAPHKASEKAADAQTWASAVHVVSLPLLH
                     QVTDITNVCYTLSFH"
     gene            <98756..>99487
                     /locus_tag="LDBPK_210360"
                     /db_xref="GeneID:13386354"
     mRNA            <98756..>99487
                     /locus_tag="LDBPK_210360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860505.1"
                     /db_xref="GeneID:13386354"
     CDS             98756..99487
                     /locus_tag="LDBPK_210360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860553.1"
                     /db_xref="GeneID:13386354"
                     /db_xref="UniProtKB/TrEMBL:E9BF21"
                     /translation="MGCSASPWARWAAKVQHRCKASSSSTSATRSRPHNNLRSSTVES
                     TPFHVKPNMCVPVWQPSAKFMKYTPVRWLSNNLFAIATYQLTLEVGFTVIFGSLLYAD
                     KMTAQGVCDALAAYHYPFVNWIDVEGGVYTEPVRVGPFTLNAQKMTALHTGHNIASGI
                     LPVQVLLLVTTFVPVQHAYRLLRHAAPATTSALHPASGVGGVNAAAAAAATTAPPTSV
                     SAGARRASYARATNAKKASPAWPYY"
     gene            <100347..>101315
                     /locus_tag="LDBPK_210370"
                     /db_xref="GeneID:13386355"
     mRNA            <100347..>101315
                     /locus_tag="LDBPK_210370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860506.1"
                     /db_xref="GeneID:13386355"
     CDS             100347..101315
                     /locus_tag="LDBPK_210370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860554.1"
                     /db_xref="GeneID:13386355"
                     /db_xref="UniProtKB/TrEMBL:E9BF22"
                     /translation="MACLLLALCILPDPAAAVVGSLNGASARSPSVAPHIGDLVPLAM
                     YIRTKRQIRHSFISVADQQLAVDEEAVVDDAAGNVEAATAAEVLRPKDLDLPSLGATR
                     GKHKNQVVRLLPPASSPRFGINKAVTIVANSTLRAAGQSLQEDTALQQSDLAFRFSVG
                     RGLHKESTWLPLAARKKYTSQLSETLAGRLHEMQAAQAADAAAERQRDKEAAEAMDNT
                     AAAAAAQKVQYLSRVTFFFGYRKGDLQKMTSFSIAAQYSPEVKPGVELQFLWSEHRPY
                     NPNRAVTLCSAVAVLVSMITVLAVFHPSSRSMLLFSQRIVAVRAHD"
     gene            <102207..>102920
                     /locus_tag="LDBPK_210380"
                     /db_xref="GeneID:13386383"
     mRNA            <102207..>102920
                     /locus_tag="LDBPK_210380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860507.1"
                     /db_xref="GeneID:13386383"
     CDS             102207..102920
                     /locus_tag="LDBPK_210380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860555.1"
                     /db_xref="GeneID:13386383"
                     /db_xref="GOA:E9BF23"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9BF23"
                     /translation="MDPSAVAAHGTAAGADQRHPHNGSGNGALSGGQPSEAEMKRIRQ
                     RRRLACKTPEQRRKLQQYQRRHNEKDERLYYCDYCDLFISSRHRTWMTHLRSARHTVA
                     FQSYYDLVAHVESVWVAEINREVELARSREVHRLQQRSAGKGAATPLTAQQVAPGIVV
                     GGAPAPGRLPPPPPFPQPPHGSAQVGPTPTIRVGAKTILPSAAFVALPSAATPSPASP
                     LADAERSRTSENEARLSMP"
     gene            <104023..>107226
                     /locus_tag="LDBPK_210390"
                     /db_xref="GeneID:13386384"
     mRNA            <104023..>107226
                     /locus_tag="LDBPK_210390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860508.1"
                     /db_xref="GeneID:13386384"
     CDS             104023..107226
                     /locus_tag="LDBPK_210390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860556.1"
                     /db_xref="GeneID:13386384"
                     /db_xref="UniProtKB/TrEMBL:E9BF24"
                     /translation="MHPSSAGGGNAEERRQRLREQMKAFYGDPSASAKRTPSHASTQG
                     NPNVPPELDLDSEYFNVNRYTTDLLKRESLKGLVETDTELLRRVRRLDGELQELVYRN
                     YARFISATETIREMKNNVVEMDAKLQTLSQNVNTIDSISSQISQQLQVHRGHIEDTIT
                     ANRMLKKVQFLTSLPTTMRRLIDKEEYSVGVKYWVAGDGFLSKHKSISSITQIQESCC
                     ELARELYRAIETRMCSYPLDDPDAMDRLRGYVEDLRLLRATSLFESENVADEAPFEAA
                     VLQTLMKSVTASFQANVATTQRSLKAALVIPDDLQASEMAKREASLAQVNLREPLAQL
                     KNACAMLAVNSERVHALLDVEVCSSSGSSPAAPLVAKSIEPVLLEVLQPISQSLADFA
                     MVHLDAMAMDGALALRDPTASAEALQAATVHLTRLLKQLVTAMKTLGEIYLPSVEHGT
                     AGASGSAVPAAHDVVQLYASKVHEVACGVVRQCWEKIQTKLLQGPEPELLRACVPLPI
                     PNSSVLSTLPAVDEERAREMAFVLTRFLYASLAQCLSTSLGANLVGEEGVPAEMLTPI
                     TAGLEQTAQQLQHRGIVLLGQSEVQQVYDKAFSGSSGYASAAATTTGPTVQEALLLLL
                     PQWSTMYDALKALPPVKAASATEATKAGDGASSPLNRRRDNSGYGGGNAYRVGGGNNI
                     GAYSDGTGGGGSTGTRSDHRTGGGSAMVGGFSPHPRGGSGGSKPAVSYTRQVMSTLQM
                     SVNHIFANTDTWLRTEPVAGPPSALMACVVRYVLQGILDRVRDEVAYTEAQFQQLQVS
                     CTFLLYALVSPAKGSAPRQWRKEWSEDDMRDVQRLLDEICTCAYDKYEAKVPLSTAVL
                     DRVVEAAVRGSRAAQESVSMNSTGTAMETGAPMPPATTVALRREETKVPLLEPSQQAP
                     ATPAHVTLQPQPQQQPQEVCRPLHDGSLQSSAAASSKEAPPSAAAPAPNPSDATPPPK
                     PPAATSAPTASAAAPPPASVTPSPASPPISSTAPVQTSVARPSAPRTAPVASLQPAAA
                     APAAAMSPPQVRRSSHYSNDSHTERLARLEEEEELPL"
     gene            <108373..>109776
                     /locus_tag="LDBPK_210400"
                     /db_xref="GeneID:13386385"
     mRNA            <108373..>109776
                     /locus_tag="LDBPK_210400"
                     /product="mitochondrial processing peptidase alpha
                     subunit, putative"
                     /transcript_id="XM_003860509.1"
                     /db_xref="GeneID:13386385"
     CDS             108373..109776
                     /locus_tag="LDBPK_210400"
                     /codon_start=1
                     /product="mitochondrial processing peptidase alpha
                     subunit, putative"
                     /protein_id="XP_003860557.1"
                     /db_xref="GeneID:13386385"
                     /db_xref="GOA:E9BF25"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:E9BF25"
                     /translation="MLRATSCLGIYEYQFGQPSLRSAFSARIAPAAKARSPGAVQSTK
                     LTNGVRVVSHDLDGPVASIGVYADAGPKYDPIATPGLSYVMRFALQTSNMDSSLFQID
                     RTMRSTGNAYGHGEVCKRYLSWKAEGRRDMWEKPFEMLATGVVAPRFHESDIERFRDT
                     MDNQLEEMRWQNPREYAIDQLETVAFYKEPLGAPRMVPRIANDRCSHKALLDHWAANF
                     QPSRIVLAGVNVPHDALIAAYEKLPYKHSAEAPHHARAAAPKLSHSNEAAQFYAGRQN
                     VEYESRAAVMGTMPDMQAEVIGAVGVPTHGRDEGAKQYATALVTREIYEEAMRSAHGS
                     RAGSEHYGAQVFYRPYSSAGLIGYTVRGAPAEVKTMLQVASSAFPAAVDEAAVKRAAH
                     CAYVRLLHDQVEMTRDYCDFLATSPNSVEELVQAVSGVTKANVEEAMKKMVAQKPATY
                     ATGDSFTFPMVASLSHA"
     gap             110030..110095
                     /estimated_length=66
     gene            <111338..>111703
                     /locus_tag="LDBPK_210410"
                     /db_xref="GeneID:13386386"
     mRNA            <111338..>111703
                     /locus_tag="LDBPK_210410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860510.1"
                     /db_xref="GeneID:13386386"
     CDS             111338..111703
                     /locus_tag="LDBPK_210410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860558.1"
                     /db_xref="GeneID:13386386"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:E9BF26"
                     /translation="MERIKAECDEIAFHYPDVFMKQLFAFLVLQAAVLFDWTYVHFDW
                     NFVEPITYLVGYSATWIAIAWYGAMQQEFSYESLHRFLQNAKRERLYKAHQFDQQAYE
                     ALRVEVAKLDRVVRGLEGV"
     gene            <112290..>113120
                     /locus_tag="LDBPK_210420"
                     /db_xref="GeneID:13386387"
     mRNA            <112290..>113120
                     /locus_tag="LDBPK_210420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860511.1"
                     /db_xref="GeneID:13386387"
     CDS             112290..113120
                     /locus_tag="LDBPK_210420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860559.1"
                     /db_xref="GeneID:13386387"
                     /db_xref="UniProtKB/TrEMBL:E9BF27"
                     /translation="MAANSEQYWRRQLAQTEAEYEQIIQGLRDEVERQQRRCGDLVHE
                     NAMHRATVAADIRDFCQQYVANANQQQQQQQQARWGPAAPRMLQGAKKDVDSIPLPTL
                     LTFLHEYSHGLLQLPENRRKRLRQDTQLSPLHHRLRQRMLAHHRRTGREDELMEEWCS
                     GEYDGSGVTLPSMPSLSASSSPTWPTTVPPRYADPEGKRQMAPANGESSPDGDGPPYP
                     RRSGGSSGARTAAMAAGGAAVPTGKASATAGVGVINSGGEGGPVMAASAFGLPSLPPR
                     "
     gene            <113451..>115628
                     /locus_tag="LDBPK_210430"
                     /db_xref="GeneID:13386388"
     mRNA            <113451..>115628
                     /locus_tag="LDBPK_210430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860512.1"
                     /db_xref="GeneID:13386388"
     CDS             113451..115628
                     /locus_tag="LDBPK_210430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860560.1"
                     /db_xref="GeneID:13386388"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:E9BF28"
                     /translation="MCCALLFCAVQARMLRIRRMSSPAQPSLPPHASPLPSHVHRDVR
                     MSHSPADSAVKSGSGARGGAWEVIIDKAVSFVTEYLASTTREFDPAAPLSQHMLHLID
                     RGSLRDILVERNYNELCGCFGCSNKPRGLLAAGSGTLSFEWDSSLSLSASSAEGDDTT
                     DDEADGRSHGSHRRGRGETADGAAAAARSIKDQPDADAEEIVYEEDLYTAESFRLAQR
                     QRAMLNRMQRKKLMREQRAMRAAATSDDAAAGAAVRPAPVGPGGTAPVSSRVLRNGLI
                     GASFPQRFCSPECEETYESSIMRRVSPYFAYDYPSILGAITNLFPNLRVAALQQLAGA
                     ETSSAGLVKRVLETQQQEGGNAPANASASVSAGPAGGALKPVHVGVSLESSELIRCNP
                     GKRAARVAHKARGADTAAQVNDASSAPLLREVLEQMQVLQHVWSNEVGPRLSETRLSR
                     MADDAATAPSPTSAATAARRFGSAQGPASFPPRPVLRGSLLLLDFIMNTSCAQTRRLF
                     HAHYARHRPALQRCLTAAASSRETRASSLFYSVSADIVAELEKRSVEALAAAGAAEES
                     VGDTAFDVENEGLRVDPLLQQQRRELLVSHIFSEDVTATLSRLLFVDYAVLSNMSWSG
                     VWFSGLSLRLPAGQQSSNCSLLRSLQFPFAIPAVLLQTAESTPEVLGLAMIFLVAAGC
                     CSEGVWRGCMREEVAFDEVAEAIGLTRDDIAAAVGSLMLGEEV"
     gene            <116282..>116929
                     /locus_tag="LDBPK_210440"
                     /db_xref="GeneID:13386389"
     mRNA            <116282..>116929
                     /locus_tag="LDBPK_210440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860513.1"
                     /db_xref="GeneID:13386389"
     CDS             116282..116929
                     /locus_tag="LDBPK_210440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860561.1"
                     /db_xref="GeneID:13386389"
                     /db_xref="InterPro:IPR007714"
                     /db_xref="UniProtKB/TrEMBL:E9BF29"
                     /translation="MFHNSYQAGFLSILYSIGSKPLQIWDSQVRNGHVKRITDEDIQS
                     SVLEIMGSNVSTCYIVCPANPKQTLGIKLPFLVMIIKNMKKYFSFEVTILDDKNMRRR
                     FRASNYQSTTKVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVETLRVQVHANC
                     RIRRLYFSDRLYAEEELPPEFKLFLPIAQQPPAAAAAEQRDVEAADVPQASSVAQ"
     gene            <118069..>119142
                     /locus_tag="LDBPK_210450"
                     /db_xref="GeneID:13386390"
     mRNA            <118069..>119142
                     /locus_tag="LDBPK_210450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860514.1"
                     /db_xref="GeneID:13386390"
     CDS             118069..119142
                     /locus_tag="LDBPK_210450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860562.1"
                     /db_xref="GeneID:13386390"
                     /db_xref="UniProtKB/TrEMBL:E9BF30"
                     /translation="MQPLKRIRHPSGSEILFDAKWHQYKLGGTTLRSVSKLLDRFFPF
                     DEKRVLELVSKKTGQPVDKIKQGWSRQALLGKNVHEFIECKLLKKPPPTFTLLMKRKQ
                     AREAARPADATGPAAITTTPLEDEVLHGEEALYLPVAEMAVEKVLSAYDVLGAEQVIA
                     APGWGIAGTIDFMGRNRRTNRVLIGDWKTTGGVTSNFRFGAFETACPGALRHLPNSKT
                     YRYAMQVIIYGEILAREQYFEKQFFDAQLRASLTASLAVPSTDVMPPAPPAKTRGRPS
                     SRAAAPAKSDIGSDVESLLKTFYHNSTEQRFEYGIVQLAKGEDGGVVAEFKEVTPSTV
                     MPPDCPEMTFDSLLQRVMEGVGV"
     gene            <121934..>124099
                     /locus_tag="LDBPK_210460"
                     /db_xref="GeneID:13386391"
     mRNA            <121934..>124099
                     /locus_tag="LDBPK_210460"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003860515.1"
                     /db_xref="GeneID:13386391"
     CDS             121934..124099
                     /locus_tag="LDBPK_210460"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003860563.1"
                     /db_xref="GeneID:13386391"
                     /db_xref="GOA:E9BF31"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9BF31"
                     /translation="MGNETSKSSGTASASNPLRRNSQSEAAVGFGGAPAATEKAGSPN
                     AASTAASVPSRPIALSAETPPLRSASGATDTVGSSVPRYVDAKSMVYTLPCFTPDRSL
                     SSPTSGGAGPRSQPIAIQMAASQQLPMMSSSSDFRVGAPSSPLSPSRRHFSAANLSNT
                     MEIPTYNTSTPTAVEDLSCSSPVLKSYRQHSFSHSKRDACLADSPNSPDMSVHGGASL
                     SAGASEAPVAMSLATSFSPGAGSGSPSTAIHTKFLEITGHPLGLENYGNTCYCNSVIQ
                     LIYHCAPLRLRLLELYHVYLTKKGKSGFEEDTVLFQLCSLIAVMHKSNNRTKDKYPRE
                     KIAPKELLNCVRAKNEVFNNDMQQDAHEFTMFLLNDIWDTEQRIMADPANVNLFLKHE
                     TSMKKKGSLSFSWKHSKDKHISSHSHKENKLDKTTSAAATNSDAGANGGKAVDAQQPF
                     SGELTPLQVILQGQFGSLTACLECENVTAREEVFMDLSLETAQGTSLLRCLDHFGDPE
                     YFWGKNKLRCEECKMPVRAAKTIHVQQLPQYALLIHLKRFQYDVKKQIFTKKADHVAL
                     PMQMDVEEYLTDPEVVEQSLRNKLARSQKNIGVDAVSSTSGHNNSGSGQKDEANATSS
                     TDTFKPASEEVRRKLRGVARHKARFELTGFVAHIGEGPNSGHYFTCVRYGPQLWRRFD
                     DETVSTMAERDVKQYFGVPSDAVGVVTTTAYILLYERVA"
     gap             124681..124779
                     /estimated_length=99
     gap             126136..126234
                     /estimated_length=99
     gap             127632..127730
                     /estimated_length=99
     gene            <128202..>131945
                     /locus_tag="LDBPK_210470"
                     /db_xref="GeneID:13386356"
     mRNA            <128202..>131945
                     /locus_tag="LDBPK_210470"
                     /product="argonaut-like protein, putative"
                     /transcript_id="XM_003860516.1"
                     /db_xref="GeneID:13386356"
     CDS             128202..131945
                     /locus_tag="LDBPK_210470"
                     /codon_start=1
                     /product="argonaut-like protein, putative"
                     /protein_id="XP_003860564.1"
                     /db_xref="GeneID:13386356"
                     /db_xref="GOA:E9BF32"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:E9BF32"
                     /translation="MWSLLRPSPAVASSILAAVAAKGDCRYPVGGIARGTIVINVCLR
                     HYHGYSDGQRTPHGQRSASSALATDGRGRRDHGPTRSPSAPPQQHRSQDVQLQQYRGQ
                     QRRSTSLAAAEAASTDLVTARSTFWSQPVKHVSAATLKRQHTLERAQDKKSKFLVRSS
                     IREDGVISNLFPLNFRVADASHPDSHRGAPPTGTHVYIYEMYVTRLTATQRGGSAARG
                     SPSVTGAGARGKARAGAAATAAAIGGVQAGGLASVERRVSPGRAWRAVERFLRHKYAG
                     VAAALLPPLVQLNSKVYTAAPLPPDALVLPRAYFDIGWQTAVLRLQRRCRFTELPPSE
                     LQMLLNKIVPEVARTSHREQRQKVDATPSFLEVVREKTGKLVCATQGVSAGGLRIYQG
                     VLVQAIFVDSSAALDPNAADAREGQVARETHTCSLAPAKTGAGSSTKPPTDADACPIA
                     TRHLGDTPVGLTDAAAAVHFQVVAFLRPFAYRGTHAESYRIRDASGVYLASLWAPAKP
                     RSLTVGAVYAAAPVRIREFAERGNARLIEFLDGTTLTLLSASTATAPASLSSGSAMAQ
                     PFTPRSDSGNGGATSEASRLPGQLSLKIDTKGTIASEVSLWEEVLQHFGHGPYDEAAQ
                     QRLRKSVQGIPVVISYSLRQSIVCDVRFDSDALLAAASHTHDLAAAEEGRGQSVSAPH
                     SSSPNGDAVAHGRARERLSAPMLCVREPRLAPLMPRLDSQQPCAILADHTIVPLQVLH
                     CCFDPRMRSWQEIGVSALSLMPQQRAALLESIRALLANGLQRWGIDVSANPYRTKALS
                     LLPAPMKCVVPQRRPATGFANPAVVAFPTTIVVIGVTGPRCTAEQSRRISLTAQHLAH
                     YFRTKFVATLADEGAAVQYVHEQLMYTPAAVAAPTGQPTASLKDPNTSVILITNEIDT
                     RATRWLKVECMCRGAHFIAIPASSSPKKLNLAGAQLRMRIASQFELNPLRGVDLRGEL
                     PVLGHRHVLVIGVDSCHTNTHSVGTIVGILSTPTESKLLSYFWRHDARGRETQHVAKH
                     FRGILAGAVALSGRVDEVVVFQDGDVFSELVGVKEELTMQVPNCGLTFMCLHKRCNVR
                     FMHASPGQDGSSATRSQASAVASASDDVEKADRDTNAFREDNGLHNLVKGVVIPALAP
                     VPLDHQLAANSFYLQAHESSMSTARIVQYTVHHVSPSLDVTDVQQIANIMANVLAPQA
                     TKLPMSTRCAHRLADQAERLLDAVPQLTADMIPRPLCNRLWFL"
     gene            <133050..>135149
                     /locus_tag="LDBPK_210480"
                     /db_xref="GeneID:13386357"
     mRNA            <133050..>135149
                     /locus_tag="LDBPK_210480"
                     /product="ferredoxin NADP+ reductase-like protein"
                     /transcript_id="XM_003860517.1"
                     /db_xref="GeneID:13386357"
     CDS             133050..135149
                     /locus_tag="LDBPK_210480"
                     /codon_start=1
                     /product="ferredoxin NADP+ reductase-like protein"
                     /protein_id="XP_003860565.1"
                     /db_xref="GeneID:13386357"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BF33"
                     /translation="MLCGSWTLHRCACAPALATRGALNTAVSWTSSHTLAFSASLRWC
                     SSTARSTSNTARCTGSADAENASSASASAPNPSTAGTTALKRRVQIAVVGSGPSGCFV
                     ASHLVKKHLELHVDIFERLPVPFGLCRYGVSPDHPDVKNVEKQFMDLFQSGRVTWVGN
                     VSIGKEIPLQALLAHYAAVVFATGADGTKKLRIPGEDLGGVISAHSFVEYYNTLPFPY
                     GSPRFCPFDLERTKRAVVIGNGNVAMDVVRVLGGSYKYFSPTDMNCVCIKELMKNRIE
                     HISVVARRGVEHSAFATAEFREITKYQEGHVKVEVDHFDLGAAVAAMPVGKVMRAHKR
                     MMELVHQYALTSEETAAEAAQLATDAQGVPLPSAAASPAEPSATTTASEYGMGRPQHG
                     NRGSCCLRFRYNLTPIAILPSRHRKNYVGGVLFKRTRGEAPGKATEDEGEYCVVPCDL
                     VMTSIGYRSDSIAGVPFDDRAGVIDNEKGRVKGMPRVYCAGWAKNGAKGIILHSVVDA
                     QETAATILADMEAGVIPTEPTAQPEEAEGTAAAVRSSSASAAEAESVEVLSFESGNST
                     PHRQAAGAATTTMYGKYGLVDYFVTKKLQPVSIAGLQRILHVEHQRGVDLGKKAEKIS
                     TVRDMLDVALGGGVGKKADERIRGMTPARSDAMLYLKELLDDDTDLRALARQVARDVP
                     HKLAQQHPLGSIAPGQL"
     gene            <135953..>137194
                     /locus_tag="LDBPK_210490"
                     /db_xref="GeneID:13386358"
     mRNA            <135953..>137194
                     /locus_tag="LDBPK_210490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860518.1"
                     /db_xref="GeneID:13386358"
     CDS             135953..137194
                     /locus_tag="LDBPK_210490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860566.1"
                     /db_xref="GeneID:13386358"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:E9BF34"
                     /translation="MSELQSLTPETAFTVASTFLAYYYSEFVKLNELARMSDLYDERS
                     YMTLVDFRDEVPVVAHGRNAVANLLAKLDSTLGQRKVEIITVDTVALPHNCVQVICQG
                     VMYLREYRRVFLHVFMLEPTAYRTKTYHIASDYLRFVDSEKEVIPEGAVVIAADQVAA
                     YLEESRRRVEEEQRRQLLEFQQRIRLQQQQLQMQQQQQQQKAAAMNMPAPASRQSRPA
                     ASASREPSDPQEQHQQQRPARPPRDGGRPARGERKPREPRENRGERKPREPRGEHKPR
                     EGQEKVAAASPSRPAGEGKKGGERGNRKPAAAANAAKGAADTAAATPAPAAERKPRRE
                     SGPTAAIIMFRVPKKIKLSDIKAELVSQGFSELKDLFWCGRDSAHAVAKFSAVEKATE
                     VFEKKPFKIQGESLNLDYYHE"
     gene            <138665..>139477
                     /locus_tag="LDBPK_210500"
                     /db_xref="GeneID:13386359"
     mRNA            <138665..>139477
                     /locus_tag="LDBPK_210500"
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /transcript_id="XM_003860519.1"
                     /db_xref="GeneID:13386359"
     CDS             138665..139477
                     /locus_tag="LDBPK_210500"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /protein_id="XP_003860567.1"
                     /db_xref="GeneID:13386359"
                     /db_xref="InterPro:IPR019547"
                     /db_xref="UniProtKB/TrEMBL:E9BF35"
                     /translation="MAVSGGEVIGREGDPSVRKANAKQLAAGYTRKKRLLECCYLSAS
                     TFLWCSNVISCGRYFVFASDANLMQLVWMPLFILAAMVLADLVSGLVHWGMDTWGTPD
                     TPIFGTFIRSFREHHVDQTAMCKHDFIETNADTTLPLLPLLLIQYACVRSTNRSGNRY
                     VANLHVRNIGVHVFLCTFFIFVAITNEIHKWSHQAKQSRIVRKAMGIGILLSPIAHRK
                     HHKDPFDRTYCITTGWLNPLLDSTNFWRHLESLVSSITGEIPRANDQTLLGK"
     gene            <140910..>141677
                     /locus_tag="LDBPK_210510"
                     /db_xref="GeneID:13386360"
     mRNA            <140910..>141677
                     /locus_tag="LDBPK_210510"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860520.1"
                     /db_xref="GeneID:13386360"
     CDS             140910..141677
                     /locus_tag="LDBPK_210510"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860568.1"
                     /db_xref="GeneID:13386360"
                     /db_xref="UniProtKB/TrEMBL:E9BF36"
                     /translation="MKAILQVGPAQFFIEGATFHFLCVDIQQTLSAIVKLQKCNISLK
                     LHVDELETRLAEDARRLRAAGVALPGDDDDTTAGSSLLSRVGAASRSSWQWRAYVKSA
                     APMPRYVCPTTGQRQPVFHRGPLFIFSTASFDAAEAVVQRLQTRLLEQRLLLDEIELQ
                     ALCSGGDGYSVSDALTRVLPLPIMELSTCLSTSANVMPAYDAEGNRRRCFMTVVGASA
                     NGRYRSCVLGGGEVVARGDARECTCEEHPLCTCVGHT"
     gene            <143112..>145232
                     /locus_tag="LDBPK_210520"
                     /db_xref="GeneID:13386361"
     mRNA            <143112..>145232
                     /locus_tag="LDBPK_210520"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860521.1"
                     /db_xref="GeneID:13386361"
     CDS             143112..145232
                     /locus_tag="LDBPK_210520"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860569.1"
                     /db_xref="GeneID:13386361"
                     /db_xref="UniProtKB/TrEMBL:E9BF37"
                     /translation="MYRLMPEEFVKMEVKALAALAARSMRPPRAASTGRSVAPSFRSL
                     FTCYMRLEYPPGTLCPHRVPVPIAEPLLTRQELVELVRATAHIRRHHPLRVAYRVWPQ
                     ATSLTAAAPASALPWSGGRAGISSAEARIAVATPTMRAPPLHALESDAAMVEFIRDVL
                     AYGCTAVQVVAVRSGRVPVQDTNRRRPEAVGSGVPRAPQRPYYVEHNMRQVGERSAVL
                     VTNNARMNDILRGITRKDSATQHGNVSSVWRAVEPLPIDREDEEVEREYSKVPADAIH
                     PHEASGELACAAPAEARVTAALAEASGMDCLGSRGDAAPSSIHDSDAKASGEDEPPQL
                     LRKDAVPPSLSEESTGNITPAGEAALQGVHHGRFSDADEFGATRRNADRYTEHVSGEG
                     AGDGVGSQQQRQQPELQREALRRPRVDSSVQCKLFIEDALEGKPMALAQKGPSAQYAE
                     KVIAVGSWSDHRAPHTPHLRGPTSSPSKTPADLGDVSAGAAEGAITDNVHVAVPAPCA
                     KSPCSVSLTQQRRTTSSSCGSATMPDPATMVLVRYKVDPTVVCVSGLVLQTVLQHLQE
                     AIFQRCCAHLCRDLDAPRPRFHAAHPHRHAGSAQFKAATSFINSSSTAAAPSRDAVMA
                     VRFGNGDRNTRDSDLSIASTTDVPCTEFILPLYQYTFTRVEEDALERCIAEVMATYQG
                     LEQLPAKEAEKWIRTAPNLVSLGC"
     gene            <146672..>149707
                     /locus_tag="LDBPK_210530"
                     /db_xref="GeneID:13386362"
     mRNA            <146672..>149707
                     /locus_tag="LDBPK_210530"
                     /product="vacuolar sorting-associated-like protein"
                     /transcript_id="XM_003860522.1"
                     /db_xref="GeneID:13386362"
     CDS             146672..149707
                     /locus_tag="LDBPK_210530"
                     /codon_start=1
                     /product="vacuolar sorting-associated-like protein"
                     /protein_id="XP_003860570.1"
                     /db_xref="GeneID:13386362"
                     /db_xref="GOA:E9BF38"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BF38"
                     /translation="MAFRIPDDDGTDEYVVTLRGPVLTAAEEQKKWLQEALIAVDRKA
                     AIMRSSMESQDSMAVVIRAAAQMLDELRTNLLEPQNYYELYMKVFSMMEVFVAYLEDE
                     HRAKRHTLEEMYERVQFCGYIVPRLYLLIAAGAVYIDAGDQPALEIARDLVEMCKGVQ
                     HPTRGLFLRHFLLTMMKGKLPGDPNRRVSDVGNESAGEAQEEYPHKEDGGTVTDTANL
                     LVQNFKEMNWLWIRMEAGSYTNRNGGSTNSVTACSPTTAALPATSPPPAASAAASSRS
                     SDAATRPGSPPRSLRAARRTQQERRAMCVLVGMNVVRVAQLDGISRDVYASTILPQLL
                     SIMVRYCEPLAQQYLFEVLIQVFPDEFHLFTIDKLFGAISRTVPGVEVSELFRSLMER
                     LCKYAVAVQEGVTEVSSPEEEAKLRDVFPMLLNQMSCMSVSYSAQMSTTTVIKRTSTV
                     PPPTPMMLGAYVTTMRHLVNVVMTLYGKSAKRRFMSLSNIVDVVASKFPSAVVDSSES
                     KESTGVVETAAASAETSTPVSISPAAALAAGQFLVHIITECCATVQEVMAMEGIAALT
                     SCLPFLQRREVAMAVCEVALRGSTAAPVLPSVSKAASSGAGGGVLKPTVVVTVPPPLP
                     RPITALEDVARLFELLDPILVEQPDAPSDLRLIYKYNPAVEFVDEQNLVCRILHLLAN
                     DDPAVYAKMLTGVRKVLLQGGARRIPLTYPTLMTLHRRAALRLYAQYQRVSSSAKSDE
                     GERDGDEADTAAAAASQAMKAIRKCFSHVHSGDSKGILEVFAVEAPTEALKEYLFCSN
                     TADVCEQSETSYALYVEALTLYEGHIEESHEQIDVLVACVNALCQMRNMPEENYEVLA
                     AKVCQYASKMLKKHDQSYLVAVCAALFAKKQLSRENQQRVQECLRRSLKLAGQVLALA
                     QLQLYVQLLNIFLHFFTSKSGYLVSVELVNELIEKISEASEVQRSEVGGDGKNSTADD
                     DDSDNAANTFAKIRLVYRNITKYIRSRQSAEERWNEIDV"
     gene            <150770..>152260
                     /locus_tag="LDBPK_210540"
                     /db_xref="GeneID:13386363"
     mRNA            <150770..>152260
                     /locus_tag="LDBPK_210540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860523.1"
                     /db_xref="GeneID:13386363"
     CDS             150770..152260
                     /locus_tag="LDBPK_210540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860571.1"
                     /db_xref="GeneID:13386363"
                     /db_xref="UniProtKB/TrEMBL:E9BF39"
                     /translation="MDQLAVDLSALRELVLQHQHQQRLANDTHVGVDAVAVPSALSAS
                     TSAATVTTTADKLRQLQRELGALTEQLHAEKAASAQRLLQQRCDAASLQELLDQAARA
                     DEKVADLTSQLTEWKRRCQAVEEAHAGCTGQYESVREQVECVQRHVAETQAQHAVLTA
                     RATEAQRLVSKLADEKAQLQGTLRSRDAALLRLSGVELDRDEARARVQAFEAQHAEWV
                     AEVCAYQRYFDSAREEYVRGLRHVAAVRQEHEALREALTQSEARCVHWEKLFTDLSAG
                     ACAGFAATPADASTEEAAADISGASSAVIAVGVAEDGSPSSGGCCDASDCFDHPTSPF
                     DAAFVPLLEAKVADLALRLCDAQARADAAERTAEDLSRLSLADSTLLIHLKSLVCALR
                     PQVDGVADHNAQLQARLLAAESFTDALMQHVVRLGEAFADEASQRCWLTAASSASAIG
                     GGGGVDVLSGGSGGRGSETTLPPATPPSALTQSRRHRLRTRVLGGR"
     gene            <153839..>155200
                     /locus_tag="LDBPK_210550"
                     /db_xref="GeneID:13386364"
     mRNA            <153839..>155200
                     /locus_tag="LDBPK_210550"
                     /product="DnaJ protein, putative"
                     /transcript_id="XM_003860524.1"
                     /db_xref="GeneID:13386364"
     CDS             153839..155200
                     /locus_tag="LDBPK_210550"
                     /codon_start=1
                     /product="DnaJ protein, putative"
                     /protein_id="XP_003860572.1"
                     /db_xref="GeneID:13386364"
                     /db_xref="GOA:E9BF40"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BF40"
                     /translation="MVRETELYEVLNVSVEADEHEIKRSYRRLALKYHPDKNTGDEAA
                     ADMFKKVSNAYEVLSDPEKRQVYDKYGKEGLERGAGEGGGFHDATDIFSMFFGGGARE
                     RGEPKPKDIVHELEVKLDDLYNGATKKVMISRDRLCGTCEGSGLKPSGKRITCAQCRG
                     RGVLLRTQQVFPGFHHQVQMRCPACGGEGEIVAASDLCTGCRGKRAVREKSVLEVHID
                     RGASKSDHFTFTGEGNQEPGIRLSGDVLIFLSVRPHPVFHRINDHLMMRCPITLQEAL
                     CGFEVPIEHLDGRQLVIKASPGQVVHSDSAWSVYNEGMPVKGTGGLQKGKLFIYFDVE
                     WPETLPREQIDKIVTALNVPEKPGKLGGHVVELTEYKAAGKFKGGKNGKRGGAAGSRS
                     AGAGRGRGAARSRQAHAEEDEFEDVTDDDDDEQQQYGGQQYFRAGPQGFNGSTQTVEC
                     AQQ"
     gene            <156732..>157376
                     /locus_tag="LDBPK_210560"
                     /db_xref="GeneID:13386365"
     mRNA            <156732..>157376
                     /locus_tag="LDBPK_210560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860525.1"
                     /db_xref="GeneID:13386365"
     CDS             156732..157376
                     /locus_tag="LDBPK_210560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860573.1"
                     /db_xref="GeneID:13386365"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:E9BF41"
                     /translation="MASILTRQALWVPVVKHNPAFVESVHRLLRSSPITSLTAAAIGL
                     KLEEVQVALEPDAWHPDKMVASMMAFPVQISAAACDYMLEQQQRQQPKPRELTFGFAI
                     SICDSCNTLHVMERLLPASSRHVSVNMQTHCMRNLREEEKVVVVSTIDKMGKRLVYCK
                     TDFFVEAAEPVPEEVVQREKSIKTLAELRAALMHYEKAVSGAHVKSIMSASKPG"
     gene            <159238..>160491
                     /locus_tag="LDBPK_210570"
                     /db_xref="GeneID:13386392"
     mRNA            <159238..>160491
                     /locus_tag="LDBPK_210570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860526.1"
                     /db_xref="GeneID:13386392"
     CDS             159238..>160491
                     /locus_tag="LDBPK_210570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860574.1"
                     /db_xref="GeneID:13386392"
                     /db_xref="UniProtKB/TrEMBL:E9BF42"
                     /translation="MSALQYQALCAAVAAYGLQLLPSLEEILKRVALAVLTPWLSTPE
                     AWETLAMLCTTYRAGAAHVLAELLESLLREPGVLLLDAPQLVPAWYAEAVVHVLPSAM
                     ASNAATAALGGLLTLAEDQQLREESAESVQQAAHIHTERTARKLRALVDMLYAAGGYV
                     PQATLQQMALRHAMEVVEGGVLPCYLSEQEYSEAFSTASTFPGTAAAGDSTGAAVLRW
                     NVPAAWHAVSLQLLEAFLFACRPGLPAQLLVTATRAINVLAARLHRGVPLLSTSQDPN
                     STAGPSQDRSKKATLVALPLLPVTAAVGAAVVRLGHVLQLLRHPVVLPPFQPAQLVVE
                     KAKRRTFVLTEPAAAPVTSAPAAPAAPPAETVAAPSTRVAMAPPPQQQPRPVAPTVAA
                     PAAVPAPAADLPRTPAPQPVKPAPPP"
     gap             160494..160508
                     /estimated_length=15
     gap             160677..160775
                     /estimated_length=99
     gene            <161406..>162749
                     /locus_tag="LDBPK_210580"
                     /db_xref="GeneID:13386366"
     mRNA            <161406..>162749
                     /locus_tag="LDBPK_210580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860527.1"
                     /db_xref="GeneID:13386366"
     CDS             161406..162749
                     /locus_tag="LDBPK_210580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860575.1"
                     /db_xref="GeneID:13386366"
                     /db_xref="UniProtKB/TrEMBL:E9BF43"
                     /translation="MLRRIAYTLLPRDPQEVRLLHHTSGGVVIAAVRYRKTSSPLFFT
                     VVEMAAPNEQALPLRVVHVRVPRPAAVVSAVALVRSADGADIYVIVQAAEKTDAEAAP
                     ASVTSYVYRRQIVAVDEDDDGDKSHNYAVEDDVVSSSAASAAAASTRVRYQRLPRAFA
                     SASAATWTAVAAFNPSENMLTDASSSVGAAVTPTAAFITASGGGTDIQLQLWQLCGTR
                     VALEATWRVPALAGFAVKEILTLPGTQDVVLLRHHNSILEVNLSALRSACAYRSTVTG
                     NAFLSRAWRWLAHEQLTACAVKDALLYAGTEGGAVLVWDLRRPTSTAAAAGPCGGPPP
                     LCSAELKTPITGLYAPYATGFITCDASGGVRDWRERGEMDMGDNQNEEAEEGALRDVA
                     GMAASAAAAATQFPYRSRAPVEMPTGDEGCVALDGHDNFAAVVSECGRLCLYFCD"
     gene            complement(163818..163898)
                     /locus_tag="LDBPK_21tRNA1"
                     /db_xref="GeneID:13386367"
     tRNA            complement(163818..163898)
                     /locus_tag="LDBPK_21tRNA1"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:13386367"
     gene            complement(<164636..>168100)
                     /locus_tag="LDBPK_210590"
                     /db_xref="GeneID:13386368"
     mRNA            complement(<164636..>168100)
                     /locus_tag="LDBPK_210590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860528.1"
                     /db_xref="GeneID:13386368"
     CDS             complement(164636..168100)
                     /locus_tag="LDBPK_210590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860576.1"
                     /db_xref="GeneID:13386368"
                     /db_xref="GOA:E9BF44"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR028796"
                     /db_xref="UniProtKB/TrEMBL:E9BF44"
                     /translation="MSAITSFAAAANSTVGASPAEYVNYVDIKLDGVHHLPADWVSAG
                     FPVLTSGTAGGAAGAGANHAHVHDKEGLTEETEVAYAYHPFRYEVTLALPAATTNATA
                     AADNDEADAATAETFREEPPPNTDEGAKLGMSIVASFTRGRLLAPLPQYTAYIAAAEP
                     APAPGVDDASPLRDVPVSISAESEMAAAGASGDEREASEAGKASDRVAAAGATPAVLW
                     VVTERTDAPGASGGANGVDAVGMVATKRRARSTTPLAPAASAASAAAAASANNTAAAA
                     VPGAPAPPVPEPSEPAPCVVRVPLTAVQEAYLEGLLEAGAPLKLSFRRVLRPGCPAEW
                     EDFNAGYFEAEIPISLHALAEPGSTHLAADVALQPTNAPEKRAAAGSVPSENDPADRG
                     KKRTVTRKQRQMVPSILIDVPDRDAPHPYVTAGTMATVSLTLQRTLTPLVSDRVRPAV
                     TPTQLIPPRPTPTVSAAAADDTQTRLQQTLLGVVRQLVRDMRGATQMKSCGLSGSDDA
                     AWRTDFVAALQSTGELAAFKSQLTPLVTSLVQERLRSGLTGGGSPQEVARASNELYVQ
                     LMDMLHSVLHECAGEGDAVSSVPQLRTTSSGGAPNSGEEQEVRWRAIEAEVSGDFELA
                     AKLYQSRLASHVAGDNWAALWVDCGLFYQRTEELAKAEQCYREAIACDPYCTSALLDY
                     GAWLLAQDRLDEAAVFLHGLVDIAPQHKLGWGCIALLADLHELAVRVGSPDAAVEQQK
                     WRREQRLALRKAAECGAVSPSHATGGADSGGLSGSSGPANDSVPTPPPASSQRDAEEE
                     LMYLEVATYLVNLHHRDLANVCLARCRPGALQVELLYARLFTQGGQYEEALRTLDEIN
                     TPSGAHTSISAAEQRLVDECALLRAECAAALGRSSDAVRVYKQVLCRGEPPTAPPYLG
                     TLTTNWQAQLQEVQSFGMAGKSGAARPAQALLDQRITEAESMHYLSAYLHLCNLLLRE
                     GRYRDALGVVTLALQVWPSSSVLWLGAGVAYYRAGDLLPAEECLQESNTLNPANPRTW
                     AYLALLAVRLHNVGVEEVVQQLLTLNLEDAPLWAELGRTLLGTARFPRLSVLCLRRAA
                     ALVSGKGGAVDAILPSTQYHLAHALMELQQWEEAEQLLGKVASNSGSNEVLRGKAEEE
                     LAVLRAGQ"
     gene            complement(<169569..>170579)
                     /locus_tag="LDBPK_210600"
                     /db_xref="GeneID:13386483"
     mRNA            complement(<169569..>170579)
                     /locus_tag="LDBPK_210600"
                     /product="la RNA binding protein, putative"
                     /transcript_id="XM_003860529.1"
                     /db_xref="GeneID:13386483"
     CDS             complement(169569..170579)
                     /locus_tag="LDBPK_210600"
                     /codon_start=1
                     /product="la RNA binding protein, putative"
                     /protein_id="XP_003860577.1"
                     /db_xref="GeneID:13386483"
                     /db_xref="GOA:E9BF45"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BF45"
                     /translation="MSDLADKIRRQVEFYFSDVNVAKDVFLKSKMAEDPEGFIPLEVL
                     LTFNRLNSLTKDPKVLAEALASSDKLVMNKDGLSVRRKDALPESIQTDEQTVYVKPVP
                     ATASLEQLQEFFSAHGTVLAVWRRYFQGGSKDAPVESRTKPSVFVVFASKTDAEKFVA
                     APPQYDGVQLSAQMKTAYLEGKAVQMASQKNRKRVREDGEDAGAPSSAAPRTPAMPTN
                     SSYRISGCGAIEKFSEVKGLWPAEEQKGVRYVYMPTKEEALIIFQDAETAEKMVESVK
                     TRAATLQGKQPEVTKLSEDDEKALIANVEKEISERAAQHGSRGGRGGRGGRGGRRGGG
                     RH"
     gene            complement(<172599..>173783)
                     /locus_tag="LDBPK_210610"
                     /db_xref="GeneID:13386393"
     mRNA            complement(<172599..>173783)
                     /locus_tag="LDBPK_210610"
                     /product="dihydrolipoamide acetyltransferase precursorlike
                     protein"
                     /transcript_id="XM_003860530.1"
                     /db_xref="GeneID:13386393"
     CDS             complement(172599..173783)
                     /locus_tag="LDBPK_210610"
                     /codon_start=1
                     /product="dihydrolipoamide acetyltransferase precursorlike
                     protein"
                     /protein_id="XP_003860578.1"
                     /db_xref="GeneID:13386393"
                     /db_xref="GOA:E9BF46"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:E9BF46"
                     /translation="MMRRTLLWLVNFEPVFMPALSPSMETGTVVEWKKKVGELVKESE
                     VFCTIQTDKAVVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSDAADVSKADEYTP
                     EGEVPAADAEAPAAAAVAAAPAAGGASSEVPEGVTCEPVFMPALSPSMETGTVVEWKK
                     KVGELVKESEVFCTIQTDKAVVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSNAA
                     DVEKVANYYPEDAVGGPPASAADPSAAAAAAASARPAASAASAKHYGGSLDAAVAASG
                     PSVARIAAGLEPSALAGIAPSGKGGRFLKSDFSGQPGFDYNDTAPARAMQQKAAPAAA
                     ADGASKAAAKSAAPAAVSGDIYNVVLKPGPVYKSVSDTALLKKLMCSMHIPKPKSKKA
                     AE"
     gene            complement(<174906..>175196)
                     /locus_tag="LDBPK_210620"
                     /db_xref="GeneID:13386394"
     mRNA            complement(<174906..>175196)
                     /locus_tag="LDBPK_210620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860531.1"
                     /db_xref="GeneID:13386394"
     CDS             complement(174906..175196)
                     /locus_tag="LDBPK_210620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860579.1"
                     /db_xref="GeneID:13386394"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:E9BF47"
                     /translation="MERTFAQQDDLRTQDQLLDQLHASVMNTRHYAIQIGNDLGEQDD
                     MLDRLHGNVTRTADESRRQNQNVIQLLRESENRGFYSVVLLLVVIIILLLAI"
     gene            complement(<176738..>178063)
                     /locus_tag="LDBPK_210630"
                     /db_xref="GeneID:13386395"
     mRNA            complement(<176738..>178063)
                     /locus_tag="LDBPK_210630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860532.1"
                     /db_xref="GeneID:13386395"
     CDS             complement(176738..178063)
                     /locus_tag="LDBPK_210630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860580.1"
                     /db_xref="GeneID:13386395"
                     /db_xref="UniProtKB/TrEMBL:E9BF48"
                     /translation="MRSSAYQLTKVACHAAAKPRSAAPVTGTSSAAGKQAVEELEVYL
                     RVMKTAQRRWAREIVAHETHVRRLMIMEEHCRERLKQQVLKGTREHLKYLTNTDLMAA
                     SQLVSPPSVDVFLAYGILPEQVSGFTVYVMGCLVADPNRLNVPLPILIADLSSTWAIV
                     PPRKKEAYNELAAIFRPHLPPRAADVEGNDARATEATTAVPKRRVGGTLKATRRNTAS
                     GDAGVRVRAHAPLPRHGRGFQPKPSAAATGKSPVPQVLRSAGKQLQVQRRTATASARA
                     PVPPLTSLSSPTAAATQPSTLPRSAKREHSASKTAACVNNRAGSSVISRSRSQPVAPP
                     PQPRRQPALRAADKAAVAALAEELQLPDAERDAFCQFAEASLHEMEMALNLPFVSPNS
                     DRSSGSSKAKRSAKTPRGGVQLVVKEWLPIAAEEWARKTRRQKRFYMRG"
     gene            complement(<178774..>180168)
                     /locus_tag="LDBPK_210640"
                     /db_xref="GeneID:13386369"
     mRNA            complement(<178774..>180168)
                     /locus_tag="LDBPK_210640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860533.1"
                     /db_xref="GeneID:13386369"
     CDS             complement(178774..180168)
                     /locus_tag="LDBPK_210640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860581.1"
                     /db_xref="GeneID:13386369"
                     /db_xref="UniProtKB/TrEMBL:E9BF49"
                     /translation="MDAFQATLDELQRESKEKIAHVQDTASAAVLQARVVPHRIAVAM
                     AQRFTSDRVESCFPVLCLLDATLARTASASPSTSSEADQALEAILAEFWTLAPAAFMS
                     VHGAGQPAWREKCLRLVRRWKQRRLVPEPLITELLTAMEKGTAKAEAAEAASVTGVSS
                     NATSTAGTSSSSLAIAAAATTSGQPSPSTTVTATAATTAAMAPPSASYSVPTPSFTAA
                     QARAFRSTLQACLSTLESLQPARAALYLELVRSQHFRAPSRTSLAFFEDLLKELRREV
                     TMASSSSPNRAASAGGGAGVKEGADPASNGHARETLGKLLDQLHVAASEGAAGLSAGG
                     RAAAAGVAGAGVHHSAATTVVRYVSPIFSDIYARQALGQRGTGFGTLQRKAGHGGPSG
                     GSAFYTSYYPKAEANAQRPFRIPPARQMQGGAVRLHFPRQQEWVNAQDMADISQYASR
                     GITDRGRKRTREGV"
     gene            complement(<181404..>182570)
                     /locus_tag="LDBPK_210650"
                     /db_xref="GeneID:13386370"
     mRNA            complement(<181404..>182570)
                     /locus_tag="LDBPK_210650"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860534.1"
                     /db_xref="GeneID:13386370"
     CDS             complement(181404..182570)
                     /locus_tag="LDBPK_210650"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860582.1"
                     /db_xref="GeneID:13386370"
                     /db_xref="UniProtKB/TrEMBL:E9BF50"
                     /translation="MTSRVPFSAASLAAYAMPEADDSTYMSTVVVPPQPHTCNAAAAT
                     VGAASSTDVTNDDYARREGFSCYPLPVSTPDSGVASDAPSALLSAPLISVSHDCHLQS
                     PRSIDPPQSVPSLSVRESEATGVVAPAEIDHGIVADAGAEEDEAAKQDEAQTERCGAN
                     RDVQRLYMHPLAAAAAEGSFGVTSPVDPITAALSRQQQQQNRGEPCSPLSSRTLQALY
                     AAYAEGRYSSFITQLTADDVLAPPPLALTWYPSVPAGVTRFADRKRTADSLTVTAMRQ
                     HEKSMLAEEEAHGVAEMTSTGAVPPLRRPRTEELAMPGAGPQPPSASSSVPASMGTCI
                     PPLGIYTEECATNRSDSADAARASAAADMHANPHRKRDRDERVYEYLSHGRRLR"
     gene            complement(<183675..>185285)
                     /locus_tag="LDBPK_210660"
                     /db_xref="GeneID:13386396"
     mRNA            complement(<183675..>185285)
                     /locus_tag="LDBPK_210660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860535.1"
                     /db_xref="GeneID:13386396"
     CDS             complement(183675..185285)
                     /locus_tag="LDBPK_210660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860583.1"
                     /db_xref="GeneID:13386396"
                     /db_xref="UniProtKB/TrEMBL:E9BF51"
                     /translation="MLLRRAAPAASTCAVAGYVCGSTCSARRSLSTVTSTLPLSSHQC
                     LCAPAASSSHGTPERTVASLDNRRRHSTTSATASSSASDDIPSDVLQRVAGRKQEMLR
                     LLRLAAGHAAAPAEKMEGVFERHCGFVDTKAASTGNERAPSTTAAAWRTAVWRTLQLH
                     CYFTLTVIENGRGGNAKDRVVSVVPFSWASTLCQVATQIPYEGWTEQELLARLRSNWP
                     ILKTYTPVWSTRYSGVNSLAQLVYRHFSSILTVTRSAVTGEVLYHRTGHNSVSVTWRA
                     SPDASAKTQAPSGAPGANEASAAVQYALHTLGRGHQLPVWTDVDQVAPLLSAQSGLAD
                     GRPSTWQEAFAKDAELRGTFQLEGYVRVRAIQDQQRFMAIVDCTSVSSAELRALLRQH
                     PMRGGGVSVKLLLRDGMAPESHEAYAKTCKEALGPSTLIEDVLVDALLEPEHLFAALL
                     EAVATDMARDVASAAQPAECTAVSEDVESEAPEKGGMLLPSSPLTPVPVIVLCGAASR
                     EAFAAVVADVPSSKVAITVLTPKPLAHT"
     gene            complement(<186173..>188266)
                     /locus_tag="LDBPK_210670"
                     /db_xref="GeneID:13386397"
     mRNA            complement(<186173..>188266)
                     /locus_tag="LDBPK_210670"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_003860536.1"
                     /db_xref="GeneID:13386397"
     CDS             complement(186173..188266)
                     /locus_tag="LDBPK_210670"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_003860584.1"
                     /db_xref="GeneID:13386397"
                     /db_xref="GOA:E9BF52"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BF52"
                     /translation="MSVYSWETADSAHRHRRKAKKTGTVVFHTDERVDTAFDRLQKEV
                     IVEKLHFSRKEAEDALADPHHRANSVKTALMTASTAKVLQKTMNFKALLPCQAQCYRG
                     IFNGRDVILHSRTGSGKTLAYALPLIERHLLLEQHQQPANVGATAGPFLLVFVFSNDL
                     AMQTKRVLERVYGKQTTLRIAVAGFDDLHPTSDGRVVDILVGTLRSIDVAIRGHRVAA
                     AATAAEEAEAQRDAHLPGKKRPRSARKPQQAVAAAAEEEEDDDDGDAAASMSDDNEDE
                     AIAGHGDTREAGIISPARVRAIVVDEVDITLGPRFSATGRRMKNLLKFIRKANGSLAD
                     GLLNDFRAHHYVLCGATIPNWVLKAGFLGVKKYYYQLVTVGSAKLPPHLECFHQTCSV
                     VDRVQTAIRLLTENTAFNGRVVVFGTLKQLTALEAGLHTATTTNAAVTEAKTTTSSPS
                     AKKGGKKGNGKSAAAAAAAASLSSLSSSSSLIVRGLTSQKDELDRMAAIEDFNCGVAQ
                     VLLCTDIAARGLDFTEVDTVLMLNLPRDALASDTFVHRAGRTARVGRPGRCILLHDAS
                     EAALVDAIAKSTHVVFKALGPALAAAAGVSADSLRGGKVKTSAATNAGASDVALTSMK
                     LVVRNPFRYTKPNVKVPSAMHVFNTNLDEPLKALLKDIREEGGSNGEVVLFRVPMSHV
                     HEVKQRLWKYTLQEA"
     gap             190632..190730
                     /estimated_length=99
     gap             191522..191620
                     /estimated_length=99
     gene            complement(<191622..>192272)
                     /locus_tag="LDBPK_210680"
                     /db_xref="GeneID:13386398"
     mRNA            complement(<191622..>192272)
                     /locus_tag="LDBPK_210680"
                     /product="DNA polymerase eta, putative"
                     /transcript_id="XM_003860537.1"
                     /db_xref="GeneID:13386398"
     CDS             complement(<191622..192272)
                     /locus_tag="LDBPK_210680"
                     /codon_start=1
                     /product="DNA polymerase eta, putative"
                     /protein_id="XP_003860585.1"
                     /db_xref="GeneID:13386398"
                     /db_xref="GOA:E9BF53"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:E9BF53"
                     /translation="MSSRCGAGPSDTGEDARCRSSPRVFRPCSADAMRCIAHIDMDCF
                     YAQVEAVRLGVDCRVTPFALVQWGSFIAVNYPARARGVRRFCLSPDEVRRELPDVKMS
                     HIATYAMGESEYCYPEAPRINTHKVSLEPYRHASRQIFAILRAEPGVVVGKAGIDEAY
                     VDVTEAARQELAEVRAAAAGASLDPLADVMEPSTRLIEDRRAEMEAWFSARGTSLAA"
     gap             194516..194669
                     /estimated_length=154
     gene            complement(<194670..>195260)
                     /locus_tag="LDBPK_210690"
                     /db_xref="GeneID:13386399"
     mRNA            complement(<194670..>195260)
                     /locus_tag="LDBPK_210690"
                     /product="DNA polymerase eta, putative"
                     /transcript_id="XM_003860538.1"
                     /db_xref="GeneID:13386399"
     CDS             complement(<194670..195260)
                     /locus_tag="LDBPK_210690"
                     /codon_start=1
                     /product="DNA polymerase eta, putative"
                     /protein_id="XP_003860586.1"
                     /db_xref="GeneID:13386399"
                     /db_xref="GOA:E9BF54"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:E9BF54"
                     /translation="MALLPSSSLSSSDPMRCIAHIDMDCFYAQVEAVRLGVDCRVTPL
                     ALSQWGSLIAVNYPARARGVRRFSNVSEAQALCPGLIVALSPSYRMGESVSQYHPHPV
                     QDSYKISLEPYRHASRQVFSILAATPGVQVEKGSVDEAYVDVTEAARQELAEVRAAAA
                     GASLDPLADVMEPSTRLIEDRRAEMEAWFSARGTSLA"
     gene            complement(<197292..>199061)
                     /locus_tag="LDBPK_210700"
                     /db_xref="GeneID:13386400"
     mRNA            complement(<197292..>199061)
                     /locus_tag="LDBPK_210700"
                     /product="phosphoglucomutase, putative"
                     /transcript_id="XM_003860539.1"
                     /db_xref="GeneID:13386400"
     CDS             complement(197292..199061)
                     /locus_tag="LDBPK_210700"
                     /codon_start=1
                     /product="phosphoglucomutase, putative"
                     /protein_id="XP_003860587.1"
                     /db_xref="GeneID:13386400"
                     /db_xref="GOA:E9BF55"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:E9BF55"
                     /translation="MEVPTTAYKDQKPGTSGLRKKVTVFQQPNYTANFVQSTFNALHH
                     QGAVPDVLVVGGDGRYYTSEAVQVILKVSAANGVRRVWVGQHGLLSTPAVSTMVRRRR
                     DADGRKATGAFILTASHNPGGPDADFGIKYNSENGGPAAEKLTSQIYEETVKITHIKM
                     AATLPEVDIHTLGTYTFDDYNFQVEVVDSLADYAAYMQEVFDFEAIKALVQRLDFKVH
                     VDSLHGVSGPYVDRIFHECLGVPKASLFRTNVLPDFGGCHPDPNLTYAADLVHVMGLL
                     PDGNANPAMKHISTVPSFGVAFDGDADRNMILGCRFFVNPSDSLAVLAANADCVPFFT
                     QSGNSGLKAVARSMPTSGAVDRVAAAQGFTLFEVPTGWKFFGNLMDSKDVYGGKDLNP
                     LLCGEESFGTGSNHIREKDGIWASLFWLSVIAKRNVPGTPLVGVQKIVEEHWATYGRN
                     YYSRYDYEDVSAEAAKAVMETVENTVVEDVPHLNGVACKMIDNFSYTDPIDGSVSTKQ
                     GVRVLFEDGSRFVLRLSGTGSSGATIRLYLEQYMDSATVKSHLAEKTLPSASTALKAL
                     IGVALQVSKMESLTGRKTPTVIT"
     gene            complement(<200072..>202468)
                     /locus_tag="LDBPK_210710"
                     /db_xref="GeneID:13386401"
     mRNA            complement(<200072..>202468)
                     /locus_tag="LDBPK_210710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860540.1"
                     /db_xref="GeneID:13386401"
     CDS             complement(200072..202468)
                     /locus_tag="LDBPK_210710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860588.1"
                     /db_xref="GeneID:13386401"
                     /db_xref="UniProtKB/TrEMBL:E9BF56"
                     /translation="MPCRCVAIQQSRYRSTYARGLMGWPSALSWPTPIACGAHMKSFS
                     LQREKRMGRRRRSRPFPCALGFSRCACASSAVLLSASSPDACAHTCVYAIASLAHFIF
                     PCLAAQGQRVGEQQQQQPRFFPSLLLTGRQQQQRGSVGKVYLRLRMGGAGHLLLSSSM
                     SAISSFVLECAHAGRWVRGLMALQEQHLSTEPCIRVACVALAQAAAPHSWAAALCLLR
                     PSDALRHPREVCKTVDTIARHAELPIEVFESSMESFLLSLQQLSQSSSHPASGSSRQL
                     ASIGPFEGLRLATPSTPIQRQVFLSATQWCGWETAARLLACLPSPLPRACVERVQELR
                     TLRHRILRDVGPFCHWGSRAAVSSVIDSAEGPLPTSPQETSLAEQLERMEPSPARRYS
                     ARDRRELSWLRDHKRQRLLQRTREEENMLTRQAAEDVAPSALSVCAALRAVSRLPSAA
                     SVTAPNVLCRHVLTLAQSRRLTPDIALLYGRAAGLCTPHSWEATVDTLNRAEVRDARL
                     HRQLTTWVISRGSWRAALERLSQLHRDTSGAMPQRSGNNTGDLHRGDDAAASFDCVQR
                     TAVPASYLHRAVPQTSRPWYRLVSSRHSTASLLRQIAGALAGGVRLDEVQLSEAGKEW
                     AAHGRWEAALALYYRFPLPEFQKYATRSLVTARPALPPVPSVSHPPASCLQIGSGPLP
                     GSPSKDSAAFYACTVLELLVPRDGVRYDRASPPRPAPPLGTYPACLVIDAAADWSEAV
                     AVFRACVRRGTRCNPQLLSTLMRRQDLPPQELRQILKSYPAAVNDGVRRRAKEGFGVE
                     "
     gene            complement(<203473..>204456)
                     /locus_tag="LDBPK_210720"
                     /db_xref="GeneID:13386402"
     mRNA            complement(<203473..>204456)
                     /locus_tag="LDBPK_210720"
                     /product="nucleotide-binding protein, putative"
                     /transcript_id="XM_003860541.1"
                     /db_xref="GeneID:13386402"
     CDS             complement(203473..204456)
                     /locus_tag="LDBPK_210720"
                     /codon_start=1
                     /product="nucleotide-binding protein, putative"
                     /protein_id="XP_003860589.1"
                     /db_xref="GeneID:13386402"
                     /db_xref="GOA:E9BF57"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR025669"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028601"
                     /db_xref="UniProtKB/TrEMBL:E9BF57"
                     /translation="MATAQNANPECVGPESPQAGIAPSCQGCPNAAICASAPKGPDPD
                     IPLIRERLAGVKHKVMVVSGKGGVGKSTMTKELAFALGARGLSVGLMDMDICGPSLPR
                     LTGVRGEDAHQSAGGIEPVLVDENVTMMSMHYLLSNKNEAVLFRGPRKNGVIKMFLKD
                     VIWGNLDVLLIDTPPGTSDEHITVNSLLQQTTNGVDGAVLITTPQRVAEADVRREVNF
                     CQKAKLPILGLVENMSGFVCPGCHKESQIFPKEEGREGRKEGAGVRLSREFDVPLWGE
                     VPLDPLLMKACEEGISFSEYVEKSGMTSSTTLDALFTVADQLIASLGIQVD"
     gene            complement(<205757..>206767)
                     /locus_tag="LDBPK_210730"
                     /db_xref="GeneID:13386403"
     mRNA            complement(<205757..>206767)
                     /locus_tag="LDBPK_210730"
                     /product="metallo-beta-lactamase family-like protein"
                     /transcript_id="XM_003860542.1"
                     /db_xref="GeneID:13386403"
     CDS             complement(205757..206767)
                     /locus_tag="LDBPK_210730"
                     /codon_start=1
                     /product="metallo-beta-lactamase family-like protein"
                     /protein_id="XP_003860590.1"
                     /db_xref="GeneID:13386403"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:E9BF58"
                     /translation="MHAGAAAEAAMPPIATLSSRVVRIMGLNPGYMTLQGSNTYLVGT
                     GQERLLIDSGEGVEGYGHLLQKAVDEESTRLGGPVLISKLLLTHWHRDHIGGVETVRR
                     LFPQVQLLKQPSQYVHTEVDALCQVPPEVVKVEGATLQLLHTPGHTDDHLCAFLQEER
                     ALFTSDTVLGTGTSVFSSFKDYMNSLHVLERMKPKRLYPAHGPVVEDGTARIEEIIQH
                     RNTREKQILQVLCERTHGVAALDSEKGLTVRELVDIIYTTIPAALKTAAGSNVFHHVK
                     KLLNEGRVVVRYAPADLVHFLKDATDYTVFGEGADADVKVIERILTEFRVAAAGVSSG
                     AP"
     gene            complement(<207908..>209200)
                     /locus_tag="LDBPK_210740"
                     /db_xref="GeneID:13386404"
     mRNA            complement(<207908..>209200)
                     /locus_tag="LDBPK_210740"
                     /product="histone deacetylase, putative"
                     /transcript_id="XM_003860543.1"
                     /db_xref="GeneID:13386404"
     CDS             complement(207908..209200)
                     /locus_tag="LDBPK_210740"
                     /codon_start=1
                     /product="histone deacetylase, putative"
                     /protein_id="XP_003860591.1"
                     /db_xref="GeneID:13386404"
                     /db_xref="GOA:E9BF59"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:E9BF59"
                     /translation="MHAVHKDDARAPLLNTESRCRVALIDTSGYASDMNISAFVPQHA
                     MKPYRVLAAMEIVRSLKIDAHCRTVVPPLVKVEELMAYHTDTYLANLGLHSCRSWLWN
                     AETSKVFFSGDCPPVEGLMEHSIATASGTLMGAVLLNSGQVDVAVHWGGGMHHSKCGE
                     CSGFCYVNDIVLGILELLKCHDRVLYVDIDMHHGDGVDEAFCTSDRVFTLSLHKFGES
                     FFPGTGHPRDVGYGRGRYYSMNLAVWDGITDFYYLGVFEHALHSIVRRYSPDVIVLQC
                     GADSLAGDRLGLLNLSSFGHGQCVQAVRDLGIPMLALGGGGYTIRNVAKLWAYETSIL
                     TGHPLPPNTVLPVAEMPLSGWLFQDSPLLIVAQDRSNHVLPGLHCQRAYQMMTEQIDR
                     HVPHIQPHPRLQKASTEAAAVDKQVEDGTTAVEDFKRQ"
     gene            complement(<210085..>210531)
                     /locus_tag="LDBPK_210750"
                     /db_xref="GeneID:13386405"
     mRNA            complement(<210085..>210531)
                     /locus_tag="LDBPK_210750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860544.1"
                     /db_xref="GeneID:13386405"
     CDS             complement(210085..210531)
                     /locus_tag="LDBPK_210750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860592.1"
                     /db_xref="GeneID:13386405"
                     /db_xref="UniProtKB/TrEMBL:E9BF60"
                     /translation="MSYNGRKLRYFVEDSDGWLRRNQQVAEQFVMAEDDRETKEMLSL
                     LAPRAHFASFWGVVRGLPAAVALQAQEREHLRITWTSGLQPLTSRTFARNGYVHVLDR
                     ERISFIPILGPWLSSFFQRPVQELLVVRDGRVVFRSMGYVWDIGKH"
     gene            complement(<214228..>216093)
                     /locus_tag="LDBPK_210760"
                     /db_xref="GeneID:13386406"
     mRNA            complement(<214228..>216093)
                     /locus_tag="LDBPK_210760"
                     /product="dual specificity protein phosphatase, putative"
                     /transcript_id="XM_003860545.1"
                     /db_xref="GeneID:13386406"
     CDS             complement(214228..216093)
                     /locus_tag="LDBPK_210760"
                     /codon_start=1
                     /product="dual specificity protein phosphatase, putative"
                     /protein_id="XP_003860593.1"
                     /db_xref="GeneID:13386406"
                     /db_xref="GOA:E9BF61"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9BF61"
                     /translation="MDDLVAVRIKDGIFAGNAGAAADKTLLIMNKITHIINCAGAEVA
                     DFFLGEPGFSYLSFPWKDAAGSVCTTILFDAADDNIHRAVQFIDEALAAGECVLVHSV
                     YGNSRSPALIAAYMIMKYGWKLESALLYLKMAHPDSDIKPHFQRQLRQFAKRHDVDHD
                     IFAQDVDDSQFGLDNDQWMLRNTLLNGLLYKDQMANDLYRQCAEKVDVGNPVNGKATK
                     AHITFVDTKKGTDADSRTTCPVVNCAASFPADPASAEPGSFLGLRGHSCLRAGRRLPS
                     ILSRSTSPCSRRLESDPRTCPKGRQSLPVVHSGTTETSTGVLAKAVERASALRASAPA
                     PSTHSSFSHLEDKSAKGRDREGGPAPPQLQRSSAESIRSIDYARLAPPTQLRSPFATL
                     GSSHKYRNGSPLPTPKDKKVTTKESHTRIQSLPASRPGSTTLVSSVSMPTSAWVGSSF
                     GLSNPTSVRSTPRTSSPLASNRLTRDVVGRPSAASYRGIAPYRSTVVPRTATEPSYRA
                     PRSSNPSPSRRGVDHATGSRSGSRRRTMSPVYLTAKRSPSGGRTQSGTEDKPHSRTRS
                     PKGQKHQDPNSGSLNNSFASNDSNGTSGGANGANSKHTSTVRRQPPPVISSRRQA"
     gene            complement(<217658..>219637)
                     /locus_tag="LDBPK_210770"
                     /db_xref="GeneID:13386407"
     mRNA            complement(<217658..>219637)
                     /locus_tag="LDBPK_210770"
                     /product="ATP-binding cassette protein subfamily E, member
                     1, putative"
                     /transcript_id="XM_003860546.1"
                     /db_xref="GeneID:13386407"
     CDS             complement(217658..219637)
                     /locus_tag="LDBPK_210770"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily E, member
                     1, putative"
                     /protein_id="XP_003860594.1"
                     /db_xref="GeneID:13386407"
                     /db_xref="GOA:E9BF62"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BF62"
                     /translation="MPPKKQAEEQSRLTRIAVVNSDRCKPRKCNLECHKCCPVVLQGK
                     LCIEVSHQSTISKISEELCIGCALCVKKCPYDAIRIINLPSNLERDTVHRYGPNSFKL
                     HRLPLPRPGQVLGLVGANGTGKSTALSVLKGRIKPNLGRYMNEPGWDEILKYFRGSEH
                     QAYFQHLLDDKMRVLLKPQYVDKVPKTNNGVVEVLLTKADERSMKDYFMEVLDLKNVA
                     DRTLDKLSGGELQRFTIAALCVQNAQVYMYDEPSSYLDVRQRLTAAQVIRSMLTETNY
                     VIVVEHDLSVVDYMSDFVCVLYGVPGIYGVVTMPYGVREGINIFLDGFVPTENLRFRE
                     EGLTFHIADDIEEGVSKRRAMNEYPAMSKNLGSFSLSVDAGTFSDSEIVVLLGENGCG
                     KTTFIRMLAGHVKPDNDVEVPKLSISYKPQKIAPKFQGTVRDLLQTKIYEMYCHPQFQ
                     TDVLKPLTIEEILDQEVQNLSGGQLQRVGLCIALGTPANIYLIDEPSAYLDSDQRIIA
                     SRVIKRFILNSKRTAFIVEHDFIMATYLADKVIVYDGTPAVNCTARTPCGLLEGMNRF
                     LKSLNITFRRDPTNFRPRINKLDSVKDRDQKASGNYFYMTDMEDPKGKKPAQKNGDDS
                     DNDDGSDVKAAPKKQQSQRHDGEGNNGKGKKAQKN"
     gene            complement(<221727..>222815)
                     /locus_tag="LDBPK_210780"
                     /db_xref="GeneID:13386408"
     mRNA            complement(<221727..>222815)
                     /locus_tag="LDBPK_210780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860547.1"
                     /db_xref="GeneID:13386408"
     CDS             complement(221727..222815)
                     /locus_tag="LDBPK_210780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860595.1"
                     /db_xref="GeneID:13386408"
                     /db_xref="UniProtKB/TrEMBL:E9BF63"
                     /translation="MQSSPSVASGSIARCETWPFPLRSSLLLLLPLDFPVFGNKGGLV
                     VCIAHNFSMLRLSMHRISPPFWVGARLLSSTAVLRVEQSAEERAREEELRQKVQQKYR
                     GMPIPEMTHHEYGHFSTMGINASAAQQAARSAGVQGYPGFGGAAFQNRGRVDWLFLLT
                     GCTMVYLSGKILFRQFTRGVNGLELPLWTASVELQAKHILFAVQFQQSEQEQMKKDFE
                     AVRQTNPFVDFFEWVRSRRPEFCCGRKYGADYVMHTLVSCLRGSDGTQLATLARTLQQ
                     SMTRRNGDSLQRVDDFVEQLQSAGYLFHGIRGVGSSGVYTPEPLPQPIYTPFREVNQC
                     GAQESDLINALDVKNGEAHSSTPFSEAK"
     gene            <230061..>231206
                     /locus_tag="LDBPK_210790"
                     /db_xref="GeneID:13386409"
     mRNA            <230061..>231206
                     /locus_tag="LDBPK_210790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860548.1"
                     /db_xref="GeneID:13386409"
     CDS             230061..231206
                     /locus_tag="LDBPK_210790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860596.1"
                     /db_xref="GeneID:13386409"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:E9BF64"
                     /translation="MHATYLQRVTRHFCEDKGKEFDIAAEVRHAGQATDVRHLVPLTK
                     AGIQHFSTFLPPVRSKDDLDTLPERLKGSEELGFSPLFDPSLIDACCQRGIFPLAIAI
                     DDNSFLFAPKLHAERAVCALAEGAAQRNTMDGFPFCEGDEGIFDKDCLGVSRKLTKAP
                     NESTRCPSFDIFINRKEDLVDVFTLIRRQHGENWLCAPLRVCLLHMFFNPTKYATKII
                     VTAVRHRQYSNVPISGNSPVIQEGELVACEVGYLVGDIYASATGAYCISGGGSLQLSL
                     TGVCMKSAGCRLWDLGMMLRYKKSLQCVSLPRKKWQKMVSARRSIPNEHILNYLRDLE
                     KGRPVSDFLKSDVPPAIADPNSKSQHKKRLKKEAAIQRKAERRRLDL"
     gene            <231634..>231951
                     /locus_tag="LDBPK_210800"
                     /db_xref="GeneID:13386410"
     mRNA            <231634..>231951
                     /locus_tag="LDBPK_210800"
                     /product="60S Ribosomal protein L36, putative"
                     /transcript_id="XM_003860549.1"
                     /db_xref="GeneID:13386410"
     CDS             231634..231951
                     /locus_tag="LDBPK_210800"
                     /codon_start=1
                     /product="60S Ribosomal protein L36, putative"
                     /protein_id="XP_003860597.1"
                     /db_xref="GeneID:13386410"
                     /db_xref="GOA:E9BF65"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:E9BF65"
                     /translation="MSAPTPRTGIIAGFNKGHVTTRRPRQPSPNDRFAVPHKHLRAVK
                     AIIADLVGLSPLEKRVQEFLRVGKEKRALKYCKKRLGDFTAAKKKRSKMEEALRHTTK
                     KHH"
     gene            <232217..>232555
                     /locus_tag="LDBPK_210810"
                     /db_xref="GeneID:13386411"
     mRNA            <232217..>232555
                     /locus_tag="LDBPK_210810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860550.1"
                     /db_xref="GeneID:13386411"
     CDS             232217..232555
                     /locus_tag="LDBPK_210810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860598.1"
                     /db_xref="GeneID:13386411"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:E9BF66"
                     /translation="MKADCSLSSHQLKKLDKKMGDSTIIDRDALTESQKWSYITDNTL
                     KMMSLGFLCGGAVSMVVFRSVASRAAVTAFGTGCGIGKSYVDTKYVLGHDVAAETVWS
                     AQVAPPKSST"
     gap             232955..233053
                     /estimated_length=99
     gene            <233226..>233546
                     /locus_tag="LDBPK_210820"
                     /db_xref="GeneID:13386412"
     mRNA            <233226..>233546
                     /locus_tag="LDBPK_210820"
                     /product="ATPase subunit 9, putative"
                     /transcript_id="XM_003860551.1"
                     /db_xref="GeneID:13386412"
     CDS             233226..233546
                     /locus_tag="LDBPK_210820"
                     /codon_start=1
                     /product="ATPase subunit 9, putative"
                     /protein_id="XP_003860599.1"
                     /db_xref="GeneID:13386412"
                     /db_xref="GOA:E9BF67"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="UniProtKB/TrEMBL:E9BF67"
                     /translation="MMRRVIAQPVARRAAAASSALVVAPRQASTVALSVQGLHYVGTG
                     LAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFL
                     MLFS"
     gap             233854..233952
                     /estimated_length=99
     gene            <234647..>236815
                     /locus_tag="LDBPK_210830"
                     /db_xref="GeneID:13386413"
     mRNA            <234647..>236815
                     /locus_tag="LDBPK_210830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860552.1"
                     /db_xref="GeneID:13386413"
     CDS             234647..236815
                     /locus_tag="LDBPK_210830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860600.1"
                     /db_xref="GeneID:13386413"
                     /db_xref="UniProtKB/TrEMBL:E9BF68"
                     /translation="MQRFAVSNDGKLAWGSCFASCHGGQVPASIKLVKKAGDGDRVEP
                     ACVAFSSFDVERSARFGIKTSYSAGDHVVLAFNDPDSFFAATIVRCDTWAVQWAIEKA
                     ACLTDASVTQLAALCANTVCGVATASSSASSSSPVQRLFVASRFDVPTSSRKANKEWR
                     QFLAPPRSIETGLEEEGIASISAFDKNTLLALTGKGSLALVRLDARALKEQPASASAF
                     YTVQRIQCKLALASIRSRIVVYNDDKEHAYAAVYSVSEKAMELVYFHQTTAEISSRAG
                     ERTATVLKVATSIPIDDLRFAGSFHLAVSCSRIKENMQFVGLIPGADALEAMVFDPLT
                     VPYAPITTLYSESTEEFVVISSSQEVAAFSTLTNEQKVASLIGTTLKFSTGSFSQASL
                     NKAAWGLISNPFRHYGPKTRRHTEEESGANEEEDLQLLQGAGARSAGRWTPLTLCYAL
                     ATLRSSLPTTQVAVFAVETAPFLHTRLIKQWHNATTGLRTILGAASTELTGALALPWN
                     PRHVRRALRLFSQDELSSLLHRIATTIAASERVVSPVSYPDATTTAVDIALHVITLAR
                     QMGATLKPEDVRIVAIILRAARESSHELLRYASCMELLMESHLQQRAMDRVLARRASA
                     RDEADEVSQTLEGNFYGIAAELQTERTLHTRYTSNAWAQHLGKCKVQYKAEAESALRL
                     LAAAHHKSEKTMECALSDWRQLGSTPHQDPFLNQFEHALL"
     gene            <237960..>239384
                     /locus_tag="LDBPK_210840"
                     /db_xref="GeneID:13386414"
     mRNA            <237960..>239384
                     /locus_tag="LDBPK_210840"
                     /product="proteasome regulatory non-ATP-ase subunit 5,
                     putative"
                     /transcript_id="XM_003860553.1"
                     /db_xref="GeneID:13386414"
     CDS             237960..239384
                     /locus_tag="LDBPK_210840"
                     /codon_start=1
                     /product="proteasome regulatory non-ATP-ase subunit 5,
                     putative"
                     /protein_id="XP_003860601.1"
                     /db_xref="GeneID:13386414"
                     /db_xref="GOA:E9BF69"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:E9BF69"
                     /translation="MADNEWKGASFKQDEDHSAETAKLLERVNATTIPVLLRSSNAKL
                     GDIVAELLALEKVSRLGGDAASTKLLAVEVLRIYRTQNELDQMLETLDMLMKKRGQTK
                     QAQSAMIAECAIVLTDDSLAKKKQEEVLERLAYVTENKIHVELEHARFTIELATLHEA
                     AGRKRSACDMLRTLHIETITNMPRLEKLEALNQQIRLCLELEDYDHIPLVSRKINHRG
                     LGRDEAQQQKLKYFELMRAYYAHKESFFNVGRCWYETYNTVKSTDDKLSALSNMVVHY
                     LIAENATAKEIEDLAECTAFAPATKLHDRVAALSTISEKLRSDLEDIPQLYALLQRFN
                     SIELIQERVSSEVEVLCQTHPELAPYPARQELLSNRCSEHDIMVIARFYTRIPLKRLA
                     ELVHLSPEHTEMFIMTMVTNKTLYAKMDRVDELVVFEARKNTTEVVASWNDSVERSVA
                     LLDKASHLITKERMLHNLASRKVH"
     gene            <242003..>243496
                     /locus_tag="LDBPK_210850"
                     /db_xref="GeneID:13386415"
     mRNA            <242003..>243496
                     /locus_tag="LDBPK_210850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860554.1"
                     /db_xref="GeneID:13386415"
     CDS             242003..243496
                     /locus_tag="LDBPK_210850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860602.1"
                     /db_xref="GeneID:13386415"
                     /db_xref="UniProtKB/TrEMBL:E9BF70"
                     /translation="MSYTTHLREPAPFAVPSLASKGKGDDFQQPFGGETCNGYTATEE
                     GSAAPTAEVSEEKHSSSASSDYKKEDEKWIWVLDPMTRKLRVPLHLLVPTHATSTPGT
                     VPSLCIAFLEGRCRHAWCRQAHVVPSAIPQLRYEALSSPTCCHFHQDPQDISMLKNHF
                     KYILITGNGGSNELIPADRVACTVGLRRYLVHNVPKKSVCASINAAEKRLVPEENDIL
                     ELPAKFICRLHLAHRCRYLDDCNNIHICREFEVRLQPPPQILSSLNSVTTSTRTVNIG
                     DTCYTVTPLAVGDVSDEDFNAIAEAKRINHRNASTPASAIFKSAVPPYDAALGGSSEN
                     GSPMPYSAAGGAFPTFPDYRGALRTPNTSAVTPPSGQSPAFLHAESPSQIPPGGFGFG
                     GHLRVYDVRPKNQSDTVTPSCTNSPAMNPNTQEKNGAGGKIAPPKYTDGASPTAMASR
                     SNGMSGSGCASSRTEGGMSLATSEANTPLATGGYSIISGRTAVTTRK"
     gene            <248382..>250730
                     /locus_tag="LDBPK_210860"
                     /db_xref="GeneID:13386487"
     mRNA            <248382..>250730
                     /locus_tag="LDBPK_210860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860555.1"
                     /db_xref="GeneID:13386487"
     CDS             248382..250730
                     /locus_tag="LDBPK_210860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860603.1"
                     /db_xref="GeneID:13386487"
                     /db_xref="UniProtKB/TrEMBL:E9BF71"
                     /translation="MHIAARVWAALGFFEMRWEERAEEVPPYATGPSSPEDVESFLWG
                     LEEYLSFYRADSPGPSAVVLVEVTALLRNGLWRVLFNAVFYCLTVLDKHRRRRGPLSC
                     REAEVQTGGAEDTYEVVYSSSSDAEGEDAKEASLNREAPVRLVWKYPGESDEERLARC
                     VRDPLPPNSPLWSGSPSAAWEREADCASMLRSDLHGIQRPSSRCPLDEAYGGRLRTAL
                     PITDWYLVLRCLAQVGYRRDVFYLQTPFDASPQELILALLWLTQRYKMLAVAEYVELN
                     RRYAFLLQYHVNDAFLYGSAGTGGSPRPACTTARERLLYHLSHASAWPPVSFDENATI
                     AVRLAQLERCLGKATSSGGRGASAQLCVPTAPSAATLHVRRLMAVRRLLGLSFNRLHQ
                     ALQRQAEQVTLLGLHSPLDAQLCREQHHALYEEVTAGLAHVQATPQRLQTAADNLAKA
                     GSLVAFLLRYEESTMSAEEVLLGLEEDDATWLSHDDPAGGDASDAEATLARGKRKEAE
                     ADRWRRAVRRGKLPVSQSVPEDASAALATSAASLAQSIAKFRAAHVRATLTETWRRLL
                     RRSHIAPQTVPQESLRFLLDTEAQQVQEARVRENMRYRYSLQAALAAELAVLGYQTQQ
                     RRHHSHSHSPLRGGDGGAVSSTNLAAETRTVDDTKDVEARPVQVALPPLDLVTNAGIA
                     FAQLRSEEAVYGSVTLGSAELQLTEVGDPVAGSTTSARLELERLQAWEEKLDAQLRVP
                     AETTARMGYCMGLLHALYYKYGLRIATPVAQKPTSQLLPSSK"
     gene            <252576..>253442
                     /locus_tag="LDBPK_210870"
                     /db_xref="GeneID:13386416"
     mRNA            <252576..>253442
                     /locus_tag="LDBPK_210870"
                     /product="small GTPase, putative"
                     /transcript_id="XM_003860556.1"
                     /db_xref="GeneID:13386416"
     CDS             252576..253442
                     /locus_tag="LDBPK_210870"
                     /codon_start=1
                     /product="small GTPase, putative"
                     /protein_id="XP_003860604.1"
                     /db_xref="GeneID:13386416"
                     /db_xref="GOA:E9BF72"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BF72"
                     /translation="MDARMRELSFKVVLLGEGRVGKTSLISRYVHNAFDEKEASTVQA
                     SMYSSKAVPINDASSAPGAIREVDLALWDTAGQERFHALAPMYYRNADGAIIVYDVTD
                     ADTLRKVRTWAKELYAVVGEGNIKLVLCGNKADTPLTEREVSEGEGAAMAAELGASHF
                     FASAKTGQNVAEVFSAMATQVVRSREVTGMGGGVAAGGSSGSSGGGAYAGIRGRTPSR
                     SRARRGLMVVTEDGEAVTPGRSSPSEGRVYGGITPPRAHRYGSSGTNQPITLSADDSP
                     DAAAAANSSGCC"
     gene            254250..254372
                     /locus_tag="LDBPK_210871"
                     /pseudo
                     /db_xref="GeneID:13386417"
     misc_feature    254250..254372
                     /locus_tag="LDBPK_210871"
                     /pseudo
                     /db_xref="GeneID:13386417"
                     /db_xref="PSEUDO:CBZ33899.1"
     gene            <257395..>264156
                     /locus_tag="LDBPK_210880"
                     /db_xref="GeneID:13386418"
     mRNA            <257395..>264156
                     /locus_tag="LDBPK_210880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860557.1"
                     /db_xref="GeneID:13386418"
     CDS             257395..264156
                     /locus_tag="LDBPK_210880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860605.1"
                     /db_xref="GeneID:13386418"
                     /db_xref="InterPro:IPR007196"
                     /db_xref="InterPro:IPR024557"
                     /db_xref="UniProtKB/TrEMBL:E9BF74"
                     /translation="MLYDRVNDIGSSQGEAIRYILGAVSKNTVQTTLTTLEQLCSRSV
                     ELHRYTIKATCTALLAARSDERALLASRLVGEALGRPNGLTLVACALDGCSSTLTKES
                     LTALMANDLKLSPMKQMQMAMALVLGGNAMVKTAATDILEDFNVPQAALKEDDGGVRA
                     AALLSRQVGLAPENLDGQLANVCHTVALPKPKTEVKPRVSVAGVLRELGTGCVTTLAD
                     SRELLSIFPHSFTERDGAEVLAFFASAGSAVNDSSTYASLMTASGKSSPKSMSGTTTL
                     VNAMPLLDALCEGSPKGFNWDLVIRMLDQPDGEPFRVKHISVIFDAYHRFQPDNEFPS
                     VALFLGRWTNTMRQRSVLEYILRHPDKVNRKPLAIDAPSELLPATKPPGVTTAEMDLW
                     RSTAFMEAAVHVASREKDFDNDVFRPAAEKLSLLFLYCLFTGNFQGTVKHFTVMKHLL
                     KAHCPSLDLVSQHIVPEMERRGRLSTVIGVLSDLTEAAPERLVDVLQVVFKCKPAAKR
                     VLAESGSPRLVTAVAMCMEEAGESSDKWLQRALEGKLHFRASSTENRFAVAMNIVEVA
                     EMLLEKQLYTVSATAALNALLASPLKEVLKSVTDCAKALLASTDSLFPDDVENEALEF
                     FKKMYAAGSTAAAIATVENLLKSTVPRDKQLYACIVGIMFDETSAISCYPRKELQLFA
                     ELYGQMIAKDLLPPNQQQRAWGVLLPAVAKPGNYAMEEYGIIALEQVKPRLPDWPQYG
                     RALRYVRDLDFRVPGIVAAINRGIKQEDAAARGGAAASAEPGEGSPTSPTSPKQPGSP
                     NKALAAIDPAIVSAASSQSKKFTDMAAAKLHTLDIGTLVTNANVTAPPRVIQEQINFL
                     IGNTDVRNLESNATELSQLLRPEYYEYFADYLVVKRAALEPNYHSMYIELIAKLHSKD
                     MERALRKATIGAVHRLLSSQKIGTDSSERILLRNLGSWLGSITLEKNIPILQQDLHFK
                     SLLCQGIREGKLVPVVSFITRVLTSCAKSRFFCPPNPWTMAQLVLLMEMYTLPHLRVT
                     LRFELELLLKSLDQSMQDLAQYMRLHASHASTETRLRDVYDEININESPDFRVGEDES
                     NVSAAVVAAQPAPATASPPMQQSLRSSARPLQASAEPFQPKDKAQAPPSEVSRVMQML
                     NKPIRPPIGISLNWVFSTLSDPAFGNNAQRLTDHRLEIVAQLQAVVDEAVSYCMQRSV
                     AIAARTTERLVLKDYARDPFPDDMLVAGDAMARSLASSLSYVMVRDELPLLLHRSMTN
                     LLERILAPYTPLEHKATIRDTLVARNLELCMRAVEYSVGEEAATATSRFLFDVAREKA
                     SAFAEQEPLPLPPDQLEAAELLRVMGETLVPSGRMPAPQRDVYDDFYSCVPPVAVFNM
                     VLRSVEEAVSRYHSNENAPPLDFAQLDAASQKPGGLTDDAQAPIRQHLGRLMSLITEE
                     SSPYFLSPMLNKLMSLAVSTERLTKLVNSSAKNTQAAAATAAAAAAVTNPDGTPNAAE
                     DPAWQQEALRISAALHQLYLRIVLRCRECGEETNRDEFTRLFLRHSHCYSFSKLTTDL
                     IRIKVLKCSEFDDALAKALTNGTSNYVTFAGDIITDVIIKEKLVASKDMRRTLMALDT
                     IARTRAPRAAPAAPAQTLPSYVTEPPLSKIVPSQITKLLVPCDCVRPGEDEAFQKEVG
                     QLMNDWISVWSQKSHRYAEKRIPSVEFVKTLQQRRMLDTAHLQTFLSLGVRYCVEYYA
                     NTMLAMERADGNITSETLVGTRPGGPPGYRTPYTAKPFVMCDGFVELVMVLLQCCSLR
                     NEASHDLRAETTLLRRVLDAVTRVLTEHHNFVAKARPAPAWTLAADEQFVPLFQQQPY
                     VRLLSNLVYSLHRLEISTTRAMSTEFTSAFHTFLRRVHPMEYPGFVFGWLEILSHRHI
                     IPRFMNVQSMWPHYVDLLAGAMMFVKFLIKGNRISPNGLVFYKSLLKLVLVLLHDYPR
                     FLIAQHYPLCEAISLSCVQLLNTVLCSFPPDKRLPEPFPHVDSNDPAMLQVLDTSVQE
                     ACIKATFTSFNVQPQLLANLEMMITNDDAPVRDSVLTDVLNDLTQASAKRSLINAVVQ
                     HMAIVYLRTHDNRIPANFAKSNVLACYRFLCSRLNTKRRYYMLGACANQLRFPNIQTN
                     FFANVVLNLFLPSPTVDAHTQTCVQEQITRVLAEKTVIVQPHPWGVLNTFVELMREPK
                     YKFWETSFIHYAPLDSMFTKLHHTVHTRLSKTGSGGAAALDGARADSANAAATTSGIG
                     ATPSA"
     gene            <265496..>267739
                     /locus_tag="LDBPK_210890"
                     /db_xref="GeneID:13386419"
     mRNA            <265496..>267739
                     /locus_tag="LDBPK_210890"
                     /product="methionyl-tRNA synthetase, putative"
                     /transcript_id="XM_003860558.1"
                     /db_xref="GeneID:13386419"
     CDS             265496..267739
                     /locus_tag="LDBPK_210890"
                     /codon_start=1
                     /product="methionyl-tRNA synthetase, putative"
                     /protein_id="XP_003860606.1"
                     /db_xref="GeneID:13386419"
                     /db_xref="GOA:E9BF75"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR023457"
                     /db_xref="UniProtKB/TrEMBL:E9BF75"
                     /translation="MLKFFTEKANHQALKAVLCAVFVQKPLEVTLGSTYSTPYLQLPK
                     SRALLYSCNEAARLLWNTHAAPSPADNSLEGEAEWLEWESTVLTPALTPLYTQRRITG
                     EAEVALKKLDSTIEEHQGTVAVKGAPSSTSFLVDSVLFASLLPALCEGGLLPAAQAAR
                     VPHLVKWFQVFQAEHAELIASAFDVLSVQECSDFLRVPQTYEVSPKKQKVFFATTPIY
                     YVNASPHIGHVYSTLIVDVLGRYHRVKGEEVFVMTGTDEHGQKVAEAAAKQGVSPMDF
                     TTSVSSEFKECFKEMNYDMNYFIRTTNPTHEKLVQDIWKKLEAKGDIYLGKYEGWYSV
                     SDESFLTAQNVADGVDKDGKPCKVSLESGHVVTWVEEENYMFRLSAFRERLLKYFHDH
                     PNCIVPEFRRREVIKTVEKGLFDLSISRKRESVMNWSIPVPGDERHCIYVWLDALFNY
                     YTGALTRVAADGTETLDEDHHTLNRWPADVHVVGKDILKFHAIYWPAFLMSAELPLPE
                     RLVSHGWWTKDRRKISKSLGNAFDPVEKAKEFGIDALKYFLMRESNFQDDGDYSDKNM
                     VARLNGELADTLGNLVSRCVAPKINVNGMWPEPAEYSESDKTLIASLNNLAGTVDHYY
                     CLPDIQHALIAIFDVLRSLNAYVTENAPWKLVKTDTARLGTVLYVTMEGLRICTMFLQ
                     PVMPQKAKEIMDALGVPEAARVDMENYLFGIVKPRTKIAGLAEGQVIFQKVTLPTEEG
                     ERIPEGQ"
     gene            <272526..>275672
                     /locus_tag="LDBPK_210900"
                     /db_xref="GeneID:13386488"
     mRNA            <272526..>275672
                     /locus_tag="LDBPK_210900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860559.1"
                     /db_xref="GeneID:13386488"
     CDS             272526..275672
                     /locus_tag="LDBPK_210900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860607.1"
                     /db_xref="GeneID:13386488"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9BF76"
                     /translation="MMGGGSASNSANRGIMGPMGGSKQMQQGPPPPLQQQQQAMPPPP
                     QQQQPGMSSNWGSPQPPPTHMQPNASPPPQGQPQMVGMQYGGGGPVPMVGRGRVPGAR
                     MGGGGMGPMGNNMGAPPPPLQQQRQPLQPPSMMGGVGGPQQMPGGGNMNPQMMMPPPP
                     QGGQGPMMQQSGGVPGMYGGSMDANMMGGMGGPPMPGYMDADPRGDLAPQQTLYEFLM
                     EKRLLRKTTLGTFFPEDYDPKCDSRITIAVDGNYMITNLRAQLQRTDPLWFLHSCLPD
                     CLLSLVHKHVEQMRAHHLEPLWVLNGISINGDVEAFLPSPDELHSRDAVWAKLNEGIE
                     LPTQDEITEAFETSSAVGEDVLRAIQRFLRTEENVVCVTAPFLNWCQMCTLHKEGIAQ
                     LLMGPPEMLMVPYDDMKVIAEVNLQTSEVAYYDRDEVLRELFPRYVTETSTAAAGDRF
                     LDFGLLIASHPAITTAHASVQLSTQSIYEELSTPHPSFNTLREFIDQYEYPQNQNERP
                     NLEKLKHSKGRTYIQYSPVFSNQVTSESSLVYFKRILDPSLTNANMPNNLSGVFGYLV
                     PLSLFYFQFTGLLSVGLMTAVTQLYIRDEFPVADTEEYHHLLHPLMALRGQIISQMVS
                     RIKADAHGQRLGKISWVRWFDSILMSVLPPDRLIVLDEWNLKNSPELASVPDDQLENI
                     DMSMVLSLKSSVMCIPAPQLPANASPRDAPILYHGKKETFFAILLKTFDFVGYFSHSA
                     DPMDGAELASEPVQAMVQGQSAPDDQSNGPDGGKGDLVDSSSDPNMSEQRVFFTAYLS
                     ISLEHCPQEFQCALVRFTELVRVSTINSIAFTFADTIELQHDEDGALADPPEVLLATR
                     IACLVSVPYEQKTDEESEFEWAPVYSRQLCAFTVMSRVMNRSLRVLTEAIAAALFLSG
                     FSDCSLEDYDSMTPLLPFGDVPGSLGGLLLHYVLVFPPDYEANCQTPEERCRLLETKF
                     KAIPNIQTQLRRVMEFTFHALYLLNVYILRDPSIVSSPELVETDVVANALNLLHEKWV
                     LHLDGPAPEDVHGYFQFE"
     misc_feature    281224..>281298
                     /note="Short protein (LDBPK_210910, CBZ33903.1) was
                     converted to a misc_feature."
     gene            <287707..>296367
                     /locus_tag="LDBPK_210920"
                     /db_xref="GeneID:13386490"
     mRNA            <287707..>296367
                     /locus_tag="LDBPK_210920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860561.1"
                     /db_xref="GeneID:13386490"
     CDS             287707..296367
                     /locus_tag="LDBPK_210920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860609.1"
                     /db_xref="GeneID:13386490"
                     /db_xref="UniProtKB/TrEMBL:E9BF78"
                     /translation="MSSVHASLSGSGAPSLQHITASAGIASPPYIHHHIGGSSVHGDH
                     PSLLYPPLTPEREEALRSKGRQLLDEHRRQVAANGLPYTAEEVAALQERGRELLRSAR
                     EAAAANGGHHVPAPMLSAAVRIAAETPHHSSLHSDTPDVSAGGDKSGAAQSSSAPTQL
                     PHTSAAMPYLPTAKPGATAEGETPPAFDSSASIGATAIPSSSSSSQLQDFLAAVQSPQ
                     CVAEEQQAQLHALRSSSRVAGEESFTKSEVDALRQTLIQQFNEHMAQCEQANQVYWTQ
                     VTSHHRNEVSALEQECAAYKRRAEKAEAAAQAQQLQRDVEEKASVSAADALRLDVNRL
                     EAELRLARQQSAEAQAAKDAAEAEAAILRETVQEQRGRLTELEQQVFSSTAQLQNARD
                     DAEHAAHTAEAELNAARLQIAHLQAELDAANAELQATRESAAAAQHASDRDLEAARQS
                     LADLEDALAEAAGDLERLQEDVDEKSRLIQALRAGEAALGSLRVDATCSGSGSGWAIT
                     RSSAGVHGGAKDTVTGTSAETVHVLRGRVADLTHELERMRRQQEQALVSAVVPAMEAL
                     GGQYVEGEHRLALFEEANSAVDDEAAQRRGQVPGVPGEWKSEEDRRGAESGEQTTRPL
                     DGTTRTTAIATASASLTNPFYSSTDGDEAADGMMLSPVPRPPAGTFMKVLRSPGNLKG
                     SDVFAATESARRVALRGMQPSAVAAEMSAAAEIGIWEEDDGEDCRNTPDTLASFHMSR
                     DGQAARGDDAFRGSDSRKDGGAEAEDMGCRRAASSRTLAPAINEDPETPRALSAVSEK
                     NADFNDLRRCSRDVNVDSDEDDSTEECDVSVSTRVAASYGRQAAHSTAMEGKVDDSGA
                     AMQKLGRQYADAQHRLYLSEEARQSLEAEVSELRKMVEELQAVLACQPRQTSAAAPTD
                     GYAGDEADVRTITTSFASSVPTAARERLTKEEGYDANASSPRTPSPRSGDDDTESGSL
                     GSAHFSEHGVSVTTTAAPAHDDDPTSCQYPLATAASEDTAALYERIAELEERLKDIEA
                     QHEEELESLAEAAAERIAAMEQRYAENLAATEKAAAAAEVERQGEQDTTVSLLARVTQ
                     LTEALTDAQAAHAAELQRLQDEHEDLLRQRLSEQEDSFGAVVRQLNQGHQGHLWALAS
                     SAETGGAGAAESSLSPQENVQYWKGQHATLLKRFEQLQNEYDAFAQDIAALQRRLSEQ
                     EATRQEQEQEQSRMMRDATSQQFTTLHQRLEEMSKVVDAAQADAQASSKKLHYLTARH
                     TENEAALQAEMNGLRSQLQSARDELARVNNLNEELSELLQQGANSVDTVLRERDAQNA
                     ALEQQVQQLKLQLAAAGDRLTDLQAALQEKQVSADALQQRLVELEEEKRAAEAQLRES
                     RRHAEEHERTTMNAADRAARDAEQARVAAQQAMAQQHATHKQEIAALHRELDELRDEL
                     EVAQTVAATVPLEAQRHQRDLGTVRDRLAEALRSQQELQQQLKTSRAELERQRLLLMR
                     GGSGNGSDAGDAGAFEGGGAPADARLNALLHRSEELEEKLREASTERNALQQERDRLS
                     MQVKSAARVAEVKEQATRRQEAELRRARSQLAAVRDDLAQRVQSNHALQLEMDHLQER
                     LADVTSAYEELQGRHAATVLQSGMQEHAEALLMAKAVTIPRALEEYVEGVFSAYHAML
                     QAASKDRRHIYDRCDLIEKAASEAMAEAEAQNHAYEAAIADAQEEQQQMKEIIESLQQ
                     TTQKALEAKNAAVADAAAARDELEATQRRAREDVFNAQRDLQMAELQHADTLHSLSLL
                     QDEVTNTAALIKNQKSKYERREAELMEEVALLQAELETRKSAARQLQQANDEKRTELQ
                     DMADAAVQARDQAVHESQALQAQLARVLPRLAQLEDEQAQRTADLMDTAQQLSALHKK
                     TTSTENVSRKHIEELSQTLQELLQAHAMLQRTHTTTEATADRLRSQLASVTQELERAT
                     ATASQQEEELTTVKARLHEVETHTSRVMGEDQARLRDGELRLQGLEQRNAALQQECKT
                     LQESLQSLRIEHDSTVDALQHKSEAFAAQEQQMNHQLRLLRERIETLESERQELMSSE
                     QAITASRDACQREMLALEHQVEHLQHHLGASNGHNERLNQEIVQLKTDHAVEVDRLRE
                     AITDAQKELAKCRQLLAQAEAHQVEQESTHYSLSTEVSAVREELKAARAQAERATQQH
                     RKAKAEQEEMATLLQSQMAQLHEELRGKHEQLRMLENTSAHQQDTLNRLRQGMAEAEE
                     SLKHTRQQLLNQQEAAAAAKEHHRRDRYELQTKLNDAEDAMAEMTRSQEQYRQRMTSK
                     VELYEVAEEALRSEVTDLRTDVARLEEELAATTHSKAAAETHQSRQAQSIKAAESELQ
                     LLRAQTAHDMTEIATLKLQLQQRTAELERCRREAAAQLTGERLRWEAEHTAACDALKE
                     ALRQEQQAIKDAREARERALASLECKQRDAVALEDECRAMRAQVRHLRRCLDAAQYQL
                     TSLEGMAKDMAEDLGMTPEGLPGHEEGAFLDAASHTHDTSVNSTESCATAAVAAAAAS
                     GAAVQSVMDELQRRLSIFTFVANTFDSEDDQLAELRKALEQQEDVVQLLAEACAGESM
                     NAANSATPLRTGRAGASDVTPGLNSTPTPRGLRAAVSSGADAGGASASAVPPPAMLTQ
                     AQRVLVQQISQASSTYVHRVEDHLRTAQQMLRSVMMAIGSHEIVSPPASRPTTAALSS
                     RHKLQVAATAAELHRRTATLTRAVERMLDLVVQGGDGPAAAERSSTQSFSVSLIREQL
                     QELRRLFSEAERYVLLPFNELLCVPDSVGVVTAAAATAGDESDVDGQPPPHKRYSYTQ
                     QSPLAKLSGPRAASVTASVAPQRPSSSTTHTSGETCVQEIAAATLSPIARDEGARQWF
                     "
     gene            <298672..>299316
                     /locus_tag="LDBPK_210930"
                     /db_xref="GeneID:13386491"
     mRNA            <298672..>299316
                     /locus_tag="LDBPK_210930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860562.1"
                     /db_xref="GeneID:13386491"
     CDS             298672..299316
                     /locus_tag="LDBPK_210930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860610.1"
                     /db_xref="GeneID:13386491"
                     /db_xref="UniProtKB/TrEMBL:E9BF79"
                     /translation="MKSSDIFHACKYTPILLKSRTNDSGVNQYGLRPVNSYDYLNPTN
                     LVNFGRGTAFDNLGVRRSERGQIDSAPSLGGSPVFTQAKLLGLSGDDQLRLCEAETTQ
                     LRMCMAKGGSTCERESLLLDACLSKVGHLRRAISQAGSEFNDWFIQNVSDNHTKPFQH
                     RPHDWRHYYAQEKLVREKQQNGHAYGRRPKEFSFGARYVKTEGYGKRPRLPYNK"
     gene            <300360..>301514
                     /locus_tag="LDBPK_210940"
                     /db_xref="GeneID:13386492"
     mRNA            <300360..>301514
                     /locus_tag="LDBPK_210940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860563.1"
                     /db_xref="GeneID:13386492"
     CDS             300360..301514
                     /locus_tag="LDBPK_210940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860611.1"
                     /db_xref="GeneID:13386492"
                     /db_xref="UniProtKB/TrEMBL:E9BF80"
                     /translation="MSIPLVASGKTVKEDSELFFSVTRDFSVPGVSSQYQTPLAFNQL
                     MRSRLRQRNRFNHDHHDTCAYIERSKNANVVAYTANLVDAATQKRVGSGIGRQCVPYR
                     DHPLHAYFVSLEPSYLEERRRKGIEYDCDELSILERTLAYGCSATPVNTESVLRYWSK
                     HTPEAFAALQEEWKADDSVGIPAENQATAYGEHQGAKGVSAAGGATAAPPSANALTAE
                     SLDAALKTWWAPFHPYISHFVALPTWPGLIVYLPPVAKVGSSRRSSVAAIESPASATS
                     AAQTSTSTDQARAANTTEAEPPMVDTTNITYGNHTEPAEATATSGVLSDEDTVVAIIT
                     RIDGELSVLEKVYVKSIEPKRFYNLPKVEYIEVFGVSLATGKETYEKKTC"
     gene            <303297..>304268
                     /locus_tag="LDBPK_210950"
                     /db_xref="GeneID:13386493"
     mRNA            <303297..>304268
                     /locus_tag="LDBPK_210950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860564.1"
                     /db_xref="GeneID:13386493"
     CDS             303297..304268
                     /locus_tag="LDBPK_210950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860612.1"
                     /db_xref="GeneID:13386493"
                     /db_xref="UniProtKB/TrEMBL:E9BF81"
                     /translation="MTSCAALLFHNFVWEPCGLSMKGQTNTPSVQVASGVNPGADVGA
                     QLGPRAYVQRLNRTIRRHLVARDRFNADHHDICMYIERSKNENIVVYRANLIDSKTGE
                     PVESGAHQSDCSFKTSDPLHAYWIKINPEHVARRRARGELEDTCELNMIERKLAYGCK
                     AVVISKDRFFSEVLPDKASRTAASKKKMEAIELLFEEVQPCVCNFAALSSWPVWMLRL
                     PPLVEGKDTAASVALNTDSEASPSPHGGGAQLLTADGEAEEHALPTRNTVVAMVTMIA
                     GKLSVLQKVYVKSIEPKHFYQLPKVEHIEVHGTSLATGESTYEKLTR"
     gene            <307032..>308429
                     /locus_tag="LDBPK_210960"
                     /db_xref="GeneID:13386420"
     mRNA            <307032..>308429
                     /locus_tag="LDBPK_210960"
                     /product="methionine aminopeptidase 2, putative"
                     /transcript_id="XM_003860565.1"
                     /db_xref="GeneID:13386420"
     CDS             307032..308429
                     /locus_tag="LDBPK_210960"
                     /codon_start=1
                     /product="methionine aminopeptidase 2, putative"
                     /protein_id="XP_003860613.1"
                     /db_xref="GeneID:13386420"
                     /db_xref="GOA:E9BF82"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /db_xref="UniProtKB/TrEMBL:E9BF82"
                     /translation="MPPKMSAKNKQQPKQQGGNKKGKGSSQDGDDFDAMLAAAVNASK
                     ADAAKNHSNNHQGKRSSNGNGTAPASRSLAADEPVVPSSADHPENPYPKTADGYPRQT
                     WPEPTVLVSKQFAPGQFPAGEIVDHPGEMNNFRRSSEEKRALARASEQQVQEMREAAE
                     VHRQVRTWAQSWIKPGLSLMLMTDRIEKKLNELIGKDGILRGQAFPTGCSLNHVAAHY
                     TPNTGDEKVVLAYDDVMKVDFGTHINGRIIDCAWTVAFNPMFDPLLQAVKEATYEGIK
                     QAGIDVRLGDIGAAIEEVMESHEVEINGKVHQVKSIRNLSGHNIAPYIIHSGKSVPIV
                     KGGEQTKMEEGEVFAIETFGSTGRGFVNEDLECSHYMMRPGAEVMQLRSEKAQQLLKH
                     IHKSYSTLAFCRKWLDRDGFDRHLMNLNRLVDEGAVNKYPPLVDVKGSYTAQYEHTIY
                     LGPTAKEILSKGSDY"
     gene            <311099..>312058
                     /locus_tag="LDBPK_210970"
                     /db_xref="GeneID:13386421"
     mRNA            <311099..>312058
                     /locus_tag="LDBPK_210970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860566.1"
                     /db_xref="GeneID:13386421"
     CDS             311099..312058
                     /locus_tag="LDBPK_210970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860614.1"
                     /db_xref="GeneID:13386421"
                     /db_xref="UniProtKB/TrEMBL:E9BF83"
                     /translation="MMLRLSRRRLATSIGGFSSAAFTGDDGGAYERRKSEQERLKRDH
                     QQEGTGAQEQQPHNGGGDAQHAGTPVSASMSSSSFWEETCSPSGFHGTKGSSSGSGNA
                     AYAAEANAPLARPTIDTYRAMTDSELVETLRTRDEQIRQLRAIYESFHYDADRHFRKM
                     IFDYHDKTMQLSQVHGRMQQASLQINREALSKMRDQQDMMTRDKRIIFTICTLWTLIF
                     WVWVRRHYVKRRELELEPLDGREWAQMSPSITGAGSYNENVFGSNKRNARFTETAWER
                     ELRERREAQNLREQQVALLRNQMELQKAVATQREQQQACDSDS"
     gene            <312927..>313562
                     /locus_tag="LDBPK_210980"
                     /db_xref="GeneID:13386422"
     mRNA            <312927..>313562
                     /locus_tag="LDBPK_210980"
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /transcript_id="XM_003860567.1"
                     /db_xref="GeneID:13386422"
     CDS             312927..313562
                     /locus_tag="LDBPK_210980"
                     /codon_start=1
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="XP_003860615.1"
                     /db_xref="GeneID:13386422"
                     /db_xref="GOA:E9BF84"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005904"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:E9BF84"
                     /translation="MSNSAKSPSGPVGDEGRRNYPMSAHTLVTQEQVWAATAKCAKKI
                     AEDYRSFKLTTDNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASSYGTGVET
                     SGQVRMLLDVRDSVENRHILIVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSG
                     RKVEVLVDYPVITIPHAFVIGYGMDYAESYRELRDICVLKKEYYEKPESKV"
     gene            <315709..>316434
                     /locus_tag="LDBPK_210990"
                     /db_xref="GeneID:13386423"
     mRNA            <315709..>316434
                     /locus_tag="LDBPK_210990"
                     /product="xanthine phosphoribosyltransferase"
                     /transcript_id="XM_003860568.1"
                     /db_xref="GeneID:13386423"
     CDS             315709..316434
                     /locus_tag="LDBPK_210990"
                     /codon_start=1
                     /product="xanthine phosphoribosyltransferase"
                     /protein_id="XP_003860616.1"
                     /db_xref="GeneID:13386423"
                     /db_xref="GOA:E9BF85"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:E9BF85"
                     /translation="MLPTHSCKGFVDAQGRVFVDGREYPMASGIVATEDVIQTNIKAM
                     AHTIAKDYKSLSHRDARLSPSTAETAEAAEAAEAPISYDNPLIIISVLKGSYIFTSDF
                     IRYLGDCGLPHVVDFVRLASYNSGTKSTGQISMLAGLRFENLRGKHVLIVEDVCDSGR
                     TLRFLRDYIMEKLQPKSIKTLVMVNKEQAARKVDFDPEYFCLAGPNKYIVGYGFEVND
                     RYRDLRHILILRDGEATRYPAKL"
     gene            <318888..>325847
                     /locus_tag="LDBPK_211000"
                     /db_xref="GeneID:13386424"
     mRNA            <318888..>325847
                     /locus_tag="LDBPK_211000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860569.1"
                     /db_xref="GeneID:13386424"
     CDS             318888..325847
                     /locus_tag="LDBPK_211000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860617.1"
                     /db_xref="GeneID:13386424"
                     /db_xref="GOA:E9BF86"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BF86"
                     /translation="MMNDLPRWPRYRPIRVIGQGGFGTVYLCVDTEPTSTMYEQEVAV
                     KAVSLGALSDEEVLMVMSEVSLLKNVGHPNIITYYDSFLYDDDESALSRKGGATLVPQ
                     ADGDDIAAAGAGFRSQWLCLVTEYMDGGDLAALLRQYSGQELNSTKDVCEATSLSTVG
                     TAAAARKRGRPSAAVTEDAAAGADQGEVSEGDWVSRSRLHRQRLATTLRAAPRPPMST
                     FPTTVTKATVMRWDGLDASVDQTWMSDASAAAMPTTPLGATDAEAADGAACGSRNGIQ
                     MPTAAASNAAVGSAATGAPHLTNVSVKNTVAAAGLASEPLEPQLPPPPNQLWVESFLI
                     TDIAKQCLDALAYLHALCIVHRDIKPSNIYLSKRDGTVKIGDFGVSKLLQPAEPFTMT
                     FVGTPFYLCPELCMGDPYSFGADIWALGVVLYELYCLKLPFTSDNVLAQIYVITEGVY
                     DTAALGTPHAFAESQQAVLETLYGPSFLHSERLLHSLVVSMVDKMLQVDPAERPSAEE
                     LLTGVFGAGSTSRCGSSAGLPLAPVAPTPVHRPLSTCALAHDSVSTPPQRGPSSFAVK
                     PEGVAATTPQAPSNRLGPSASEQHARWAGSLVAAASSTLQQEQGASRVSLTAPGSRRS
                     RERRDDVVDDFTGAHAPLAVRVKTSVGDILQGMPSAQRERLGNRAAAEERDEKEEVSR
                     AMLPVASPKPTPSSALFHSTVKAGVGSDSANRQAALSPSLAGRERAEVAALPEKRRGS
                     TVGAEPPSLELAEHTALQLLPAAPFPLELLYGGLVNIGDSAVNSTGATGEQRTVDDKA
                     SVSTPLGAQATQQASPLSSMLPADRPPAVRTHCDDDDALDHPIGAQTRSEFMALMENI
                     PWLKNAEVFSSIPLSAGCDNVMLVERANRSSVSASGADGALSSATDNTAAGGSEERAE
                     GAAPASKGSRTAPHQRQSQLPSPLRSPHSPATGTEDMQMSSNPLLPVCRAGVVSPTAP
                     RIEVKTISGTTITMGGSRRPPSSRSPFQRGSAGAAEMADAESTQSVSQRRVSGGLTAA
                     SRQPPCIPAAPLRQRVSVTALPTTVLTSTPKPPASRPDEPQMTQDSSGPACPSPSLQP
                     RGDADRQPTAVTVASKGASASHPRLFSSSGLEPTVGNAASEARLRPFSAAQMRATAIA
                     SASGAAPPTPKAHSPGHCEGYSTTELEALLQAKLLTHYQRRQRQLGAQRTQHAAQEAA
                     KAAARAKLKALYDEVFVSRLDPASSDAAYTAPYHSGGTIGGPSEVPDEFVARTDKRSR
                     AASDSGDSGAHFPGDDAVAAPVARAATQLPALEADAWAKGAPVAVHLTKEAASPSPPS
                     APSSHGSPLPFSVDATARQAETEESVLRALSAVYSRPVEIPATTVPGTGTLMDDGDYG
                     KDWLAATPAVRRIREAASLAVAVEHQCAAFRRGKEPARLCVAPPWRPPHDSRDVPGLW
                     ETSSAEEEADVSARGRLGCPAPASVREEVRWRWSAPPSDLDDTAGTTSEDEERGALLS
                     STASSSAVPSISTSPSSSSSALLASTSGANMLDAPGQTSKTPSITAAPEADVQQRLQS
                     RKLVPSGGELGGGVIGSRRSPADAHAGGPRPSSLLGSPMYLELDSVDGGIRGGHTRDD
                     GIHGVSLSMSSLADASAKATAAADHEKDETDSASASSSSTTSTISSTSSASHSSASHS
                     SRALSHPHRSKDETRHDVSSSSHDDGSSAQNSSSGSSSDDAPSSASQTASFSFHSFGG
                     AASSTDANDDDAEPCAATKRADSDGDEDMSYTYTVQLDAVTGRRHFEYVCPVTVEVVG
                     ALPGGCRVVSAVAALRALDFAKAAPLSAMQVPPSEHCSMKQGSDGLATRVLTAEAPTD
                     LSATPSPHEGGDDTAAANGGISSCPGQDKTFLFDGEYHTMWQEDGGFGAAAASPPTPS
                     APAPSSSLSSLPPDAGATVGFTAVPGKQQGHVPAANGMAPPEGSQSAREATLHSALPS
                     TTNWQPDATARVAAASSSCVEDGNNDGNGATAHLRGRAASLHLSGETRARVAAPLRPS
                     HVALAALSEETMAKAHAPLTHPSLVDSDPTKVNTEMLPASKSASSNADGNQAMGFLCD
                     RACTQGQTAVTPAQEIAAVMETTWWVRVPSSPSASSQGLGTSQQQHQLTGSPQYIHLP
                     LSLALRPLRQRTRFVGLLWRLWVSLKVSEPALSRVLLHRRGGAPSPSPGCTFAEAFGD
                     WVTGTTPARDTDTGECTEVDVSQQSSSETSTSLRLGRTITTTATTEASSNSDTAADSQ
                     VLPASGSLTAPSRPSPLKWGLYYVEARTWCAVQLRTDADWAVVRRKISEMGTMLPFVR
                     LYLLLEEAEPTSE"
     gene            <326622..>327512
                     /locus_tag="LDBPK_211010"
                     /db_xref="GeneID:13386494"
     mRNA            <326622..>327512
                     /locus_tag="LDBPK_211010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860570.1"
                     /db_xref="GeneID:13386494"
     CDS             326622..327512
                     /locus_tag="LDBPK_211010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860618.1"
                     /db_xref="GeneID:13386494"
                     /db_xref="UniProtKB/TrEMBL:E9BF87"
                     /translation="MWASSGSSAPAAPEVSARTYAAASPSPSLSTSSSAIVASPQWRL
                     ISTISQKASRQLAKYPAQYIYASAAAALALTVTTTLLARHLVHRGEDRVRDGRRISAA
                     SVPPHGAATGSGCAADKLGCVEGTKTAPARRGAVDGDDDIEFANPAESAFFSYVRRAK
                     KQKEAPLLAALTYLETAVAELVEVRRRHAHDDSFVGDESCEGGEGCNHNSSDAQVSNI
                     DSGGNRNDVGDSGAVAEAQAKVHRLAVAADELLTQWICSLDGVPVRQSEVLKQRRKAL
                     VQEAAALTRRISPHLPDIRM"
     gene            <328913..>336895
                     /locus_tag="LDBPK_211020"
                     /db_xref="GeneID:13386495"
     mRNA            <328913..>336895
                     /locus_tag="LDBPK_211020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860571.1"
                     /db_xref="GeneID:13386495"
     CDS             328913..336895
                     /locus_tag="LDBPK_211020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860619.1"
                     /db_xref="GeneID:13386495"
                     /db_xref="UniProtKB/TrEMBL:E9BF88"
                     /translation="MGNSSSRRSSSSSSGSGSSLSHTAVGGSSRRQRSRDSQVRGRPA
                     LRSLYSGKNVSAVTSATATSSRVAASSLLTGSGLRTRKQHRDAAAGAMTTSAATQDNN
                     LASPVSSIHRHGLLSLSSLPTKSLVPSPARATAAAVTASQHSVGERGHPLRDSRGRER
                     PCDAELSPQQRHHQQQNNDFDLAVIDASNSCQAHGGDENANGGAARSGSAVSVHRARS
                     SSTLQAATDSAVPLPLRTLLILEDAHPAAKVSTAPTPAGGHTRGTVSMRRGGDTEVDM
                     NEHNTDSSQVCRAISPSTLNPKGRVPLESPAFSCPPSTAAPPLPVGRAARSTNAPCHP
                     STTTTSTATPQRPDEPLDLGVKGAVDRGSGNSKSDLKSKTEGAGDGRSGGGGGGFWRR
                     QSRNLLFRKLLSRPGSRAERSSLPSRPKAGEDGGSARGTKAELTAGEGSLCRRDVEAK
                     TVYKRTSPAQRAHDVPSTAPAALATQPRSSASSPFPAVAAAATATGLAVSRPPTSSMT
                     ARRVSAFQPSGAAGHSVGRTTVAPTVDDARSPASDSKSPRGAEDVSGPRPSGKECGEA
                     LPRGLPVSIETPHFLQLVPGEQAGHQGSEESDSTTPTDTNSAPILPPPTTASFAEAVW
                     GTRRAAAPATPTTATDNTSLFSDDDHDNGQDSDCVTAAASPSVYYSFHQQPRQLKAPG
                     VPGAGLSSTTTVTDTTARVSPRSPFVSPLTAVVAAESGGSAAAAAFPSSAATTDACLR
                     GRRSVSQSVIIAAWNRMGARTGAPVSGVGAGGGHNGGVESPEPSAEALQMSFALRKSL
                     AVAGDSIGGGDELATSAVPASRDTQLARVPTGAAAEVATGKASFFRHQCTVAGHQEAG
                     SRGSSRRSWASVASMLPIRRRSVVTRQREPPALFSPSPENSEPSDAVPQPFSALGQLS
                     IREGAPAAGHPASPPTPTKAANDIAHSWVAAPPQELHRPPRARIKYKKEAPSADRALP
                     LMREPPASLRTSTATSTSIATQWPSSQESRGSDTSLSTMQSLQAGILVPVNGEDRSGG
                     GLVEERERLSVRRTTAYDEEMGSATATTVDADEEDRANEEGGAAERQAAPRSPQSLAQ
                     HQLQRQPIEEHPHRASAPGFTTTHTTVAANSAAPGLLLAHDNDQQHYSPPHCMGSGTF
                     FAPSTCGAAACGAILWVHSSPSSPRSYSTSDSRLEVARDAQDVEDEEDSIDEVGLRRT
                     RDGEDARCRLHRSGDEHAKHFVGLDASPFNRNYSSPSVFAYRSDSTGFNAMTAATRGG
                     GGAKRAALVRSSSHQLLSRRSQSEPTRNTSLLSSTARVMPRWRERLTPTPQPTSLLSS
                     STARDDVDGTASGLLSAPRGRRGLTSQGAPPLAHQPSAHLHPPPPPTSALPSHVPQYL
                     RREISGSLGSVRWQEVSLHASGGRASPNFGFAGSSRVNDDTPPHYDALDDDDEDNAED
                     GGDDGAQRRQGCPVSGAVGEDTGDDGDDTFLCLESSEAPTWGMATLRTWHRDDAEDDD
                     EDGRDEEEDKDDTSENGAGSCGSGEARSGGRHCLRLPQRHRWCRSVTPPSASTQLPTQ
                     QPQESCNVGRASREFDPSTPSEQGIPPSRTGTRTFADAIVRLPQTRYEPPMPSNRNTF
                     TAFVHLSDISSSQLLATAAATFQCGFDAHLRGVSSGVHGDEAAAATSEDGGYAVHRAG
                     PHVHTPAIADTLILNGYAFQEAHLADGSGVGADVVDAAGGALPISPLNSSLGTAPTDH
                     ISRVDTPVLVAVHGAVARRTPLSEEAEAASARSESPDALSCVTPPKLRSVTKAPRGLN
                     HAAAAVAAAAVGLDGSSGGFDGDNDAGSDDLSVPAAQPGATSPRTSWSLESMRAGGAP
                     VSEGERHALSDEERPWLDAFGHSTPLLHSVADAVVAVEAPATVDSRLQHSAPLSTSQS
                     LPWWNRHRHTTRSEGSDTMDFSQRGGESGNGGGGHSPYSSVSVNSALVVVPGGRAASL
                     ASPATPTGSVAITGPPLGHTLHPGGGAVASVSFWMSGCRLRREAQYPTAPTNGCRSSA
                     FSSSSGGTNSNGGDAAHSGAAGAALRHNPNNEVLVMQGRSCDAGDSSSEKRVAGEAGI
                     EAGAAPVAKHTSHDHDGDNAGLSDACMQTRKRHPWMPVFPSSSRSAKTALTAGTACAE
                     FDSKGMLATTAPTHAMATITVVPPTLSFIEEAEVQSTCNASPLALAIAATSGGPYRGE
                     GEPTPDKEALDDGVDGDERSGVDVLIPLPLGVQAHHSRRASSVSNTIAAPTNTAVTAA
                     LDGLGETETYARTCIEESAADARDAGVSVRDTLQTQHGQPPLQQQCSPTTAPFALPSA
                     LPGMGMVESGASHAIEGFAAGAGRDSGSCGGSGTTGVAVSGRNAASMPTALRAATSLA
                     VLTSRESCDSLVPPSQTSELALMPRRSGDAADGNGGTGTGPGPLLIDERVSGVAAAGS
                     SAVTGAHAAEDGDVHDGRVAAHTDPGLEAEHELPHSPLATKLIGSDLMAEPHATSHRR
                     VDIRSAGLAVGVDQRDTSLGEQIPLTVPQNSPEPSQPTASCTVGPPGSPDHVLARSPL
                     LLGEEASVDTRAASRAQTRPDHHYGLVVSPSPHHEGSTPRVRAQSRSQRQHRGPSVGQ
                     VVCRWCGEPYTNTDVCLAARRPHSVLREERRIEKAAKRTAQTLLREGRVTEAVALLKS
                     AGVYVQ"
     gene            <337588..>339618
                     /locus_tag="LDBPK_211030"
                     /db_xref="GeneID:13386496"
     mRNA            <337588..>339618
                     /locus_tag="LDBPK_211030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860572.1"
                     /db_xref="GeneID:13386496"
     CDS             337588..339618
                     /locus_tag="LDBPK_211030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860620.1"
                     /db_xref="GeneID:13386496"
                     /db_xref="GOA:E9BF89"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:E9BF89"
                     /translation="MWRGSHRRWYSRHQACSSPLTPTLGALWSAHRMRHSPALERGAG
                     DLRAVTRLPRGMSPFQSSRAAAPASQQRDAVESCPDGGSHIGHSLSPSTNVEGAPSSS
                     AQPSEQLPPWPVDAFEFNAVTAHGGHDVRLAWDAIFSSSDSATADASGNESATSTLMG
                     AGAVPDATSPLLDTASRTTPKLSLVTLDTIRQLKTVEETAEAQAALRGGGWVCTGCWS
                     IVRADCSDNTSSGASDSTGLSSFPRTICPACRTLRHDARMWSHTVSLRRRPDLWQCGC
                     CGEANARAAANCRCCGVARSESIDTADDSQKEAFVRMTIAAEVDSYPIGHVVVTRNRT
                     TRWRCGACREVNSLQIVVCRHCARERFAVTVSCPTCDAPRVLSNAVVFGGGGADAHVT
                     RGPDSHKALDAASPSSAGTAGASGGGHTATPNSSARVFGPENCYNPNSTQLTCLQCHS
                     PLHGGRVTTVSATPSWWCACGVVNTMTAYSCLRCRLPRALECPEKLRALLRSAVADSV
                     SASPPLSAHDADAAPDCSDASPKWDFRSCTNWMCDSCCGVNTASYQVVAESSLPPFSD
                     AACPDHTKRGRRLWMRHGDAACRHCGAPWHHHVLQEGNSWRCACHALNSRADAFCASC
                     GLPALDGVRPDMLSSWSKGDWRCPSCGSLCYRGRQRCSCGTPRPPARLGGAI"
     gap             340955..341287
                     /estimated_length=333
     gap             345166..345179
                     /estimated_length=14
     gene            <345658..>348408
                     /locus_tag="LDBPK_211040"
                     /db_xref="GeneID:13386497"
     mRNA            <345658..>348408
                     /locus_tag="LDBPK_211040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860573.1"
                     /db_xref="GeneID:13386497"
     CDS             345658..348408
                     /locus_tag="LDBPK_211040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860621.1"
                     /db_xref="GeneID:13386497"
                     /db_xref="UniProtKB/TrEMBL:E9BF90"
                     /translation="MYSAAGMRDGNCDEAQPLPPPVVEDASAAVIADAVHTSCHDFSC
                     SPSEATENSTLAFSPPTQEPTPLPTPAARLFTSRPTPNASPLIAGTRPSRWPSTSPLR
                     SCGSPIVTFAPSTRFDQCRQRTNVAVRRSDDVPHFALPAPLLELPLSSTWASSGQMTD
                     SALRAIGLQQPRVLAGSPPTPSPRRPPSSTQSECLRDFAVDDFSDTASSADSACSTNS
                     SSTTLLDSDIPAVRPRTPPSLALGLSIPSVVLLVPPDCKHSAIPSVTDEIDSSTVAAV
                     GTATKTTPPSLANTSDVSFTLLEPEKLARTTAHLLTEAVGSIREQCHVASAKTERVSA
                     ALAQCRQTTPEAPLIEKPCLMSMKVPPPPLLESLSLSSTPEVTPSIAPLLLAPSPPTN
                     SVELANSRMALRLPDTPGEQLHTAPLDPVFPSNNAELLVNAAAEVTTLWQRKPSSTAI
                     LVLSRWGGEELNESSHPTGFPAANAAAAIFTARIAEVSCDSNHGAGAIDAQPSKATTP
                     PQTSFVTAPSSGGSDASDRCEGAVENSCTSFAGTEQVGEDGADVTTHPTPHPPLHPAE
                     LRSPHDQERCAVDSAAAAGTARLRSPSPAHTPSRPRLFQHPLKCSPGVATCSLAMAFE
                     AGGSPSSSAESHAEKDSGTHERFSQPPLRTDAAREALRSSCEGPAPISVTMTSGIARA
                     AFQHLGCAMVEEDDSADATSPAKQPIHSGSSSSRSCDVGAGAPCLMKAQKDAAAAGSP
                     LPLASPTPPRSVLATGCPSLFRLSGDRGSSHLPRCPQRQLPMQPITPFTNDITSATTS
                     RPHPSSSSPVRQPTGGLDASLLSLTMESSSAPRRSANLSLSGTPSQHAFPMLCSSPHA
                     LTATITTARQYFFGSEGSRSPTSTTRIGPRLLSPFPPLSRNAPYGGSAPISPKGAGTA
                     DE"
     gene            <350780..>353347
                     /locus_tag="LDBPK_211050"
                     /db_xref="GeneID:13386425"
     mRNA            <350780..>353347
                     /locus_tag="LDBPK_211050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860574.1"
                     /db_xref="GeneID:13386425"
     CDS             350780..353347
                     /locus_tag="LDBPK_211050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860622.1"
                     /db_xref="GeneID:13386425"
                     /db_xref="GOA:E9BF91"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BF91"
                     /translation="MAFFLKALGLSDSIPGFPFTPAANDPGRTVYTSPRMCWTLRPGT
                     QSDDAQTRVSIFTCSVSAATTAGSSGDRELIKQLARNTMRRAKSLMIPGFLKCHGAVE
                     HGETIYIATEPCVALKDVLESLELRRHYCGEMEEEYAASVAYGLETVGGALAALQSNR
                     LVHGNVHCGSIFISAVSGFWRLFGLEFISAMDEVARGTPGCLFESARRAGMVVGYRCP
                     PELGSSSCGDVGSGDPVVAVDAWGVGCLLYETVGVTAEEAINGRLNSVAHNLSAAELR
                     NVCRQSLPKSLHQGCIHLTTPNPRMRKSIAAFLENCEFVKKSAFVQYMKALSGLLLMD
                     LSQQMRLAESLAETVEKFPLRACLCFVLPRLGELVRTAAKASGSSGAIGVSIGPLADP
                     VLKISERTAAGEDFDTYVTPVLVQLYQSADVLLRYKLLLGVETYGAKLSSTALNNAIW
                     PLYAKGFAYSAPRVREYSARALVHLAPHMSESILGDQVPKALAQLQRDVDGALRANAT
                     IALNLISEHITPPSQRAMVMLVYCRPMLRDAFEPSRVAALRSLHGSLECLSAKQLAES
                     VLPAISPLTVDPTSAESRTAALSLLNASMAKLEAHHKQLSAQQVTVPSGGPVTANGST
                     DASSTSTPVPATVPAGTASRGWGLLDGFTISSALSTAGAAPQHVDAVSAPVSSSASSP
                     LRPTPVATVLPTPVADAASSVGGGGSGWSDDDEAAAASEDDGESRPHAFRESSQFAKS
                     TAPPPSAPTAPFFAGTKSAPTAASYAASPVNAAGGAHGSTSSLTGLASSPPSQPVLTV
                     PTASRVSIRPGISSLVGGTGGAAPVSVSGGTDSVTASAPSGPMKLRRKGGLGAARLD"
     gene            <354523..>358362
                     /locus_tag="LDBPK_211060"
                     /db_xref="GeneID:13386426"
     mRNA            <354523..>358362
                     /locus_tag="LDBPK_211060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860575.1"
                     /db_xref="GeneID:13386426"
     CDS             354523..358362
                     /locus_tag="LDBPK_211060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860623.1"
                     /db_xref="GeneID:13386426"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025283"
                     /db_xref="UniProtKB/TrEMBL:E9BF92"
                     /translation="MSTPKTSPRHRGRDGKSDNKSGCTAAGGSKPSTPSGAAAAARGG
                     GGIGFSYHPTHNLQFLKELLRPSAVSRIAAVARAVHMDDDHGAAAGAVCGPLPSYASA
                     LGWSGAAASSLSPLPPPSYGSAMPPYQPTGKSPAPPPFAEANAATPSSTNSLAHRHPD
                     VNALASAAMSVPSLPLVLECATQLSGMLAQWRVSNEGERRRPPPPPFAPVPKSSYGTP
                     AGQGNQGGVMLPTAAVCGTADAGPPLKSIPQPAGGGGTTVPPPTRPSAQRILQLMDLI
                     LWYCLSTAEDAQLATGGRSRGTSGMATPAPLPGATATGAGGVANQALGGSSGSSPFGL
                     RGSRGGRSGSVSVAGGRPGSVGRSGSGSADPLAAQDWLDGRMSSAPPAAGAPTITMSD
                     DQLGERLFRLAVDAVVLLQGPRSQPMPSLSSTLSPLSRSQVADTASHIGNSSAVAVAS
                     DTRGGLAPPPAEDATDNDAATAMELQTMALWTLAAVLVRFTDSPFNATVFLPVLFPQV
                     DVRSLAGAPLRHPLLQPLLRGDPCNTSLRCGAAAALTALLHKLRSTLQYAEEPPTGRQ
                     AAFLSLAAQCGMILTSLHESLCWGLVQSQQQQPQNAGDGTVATTPLSAAAVPLLNTYA
                     TVVSVTPYHRCPRSREVALRTLQLPVMHFFLAHDEVGAFVPATVLVSNILKNDAMRVA
                     AAQLPETAEAQTGLQGRSEGDETLATGGDRAAVAASFLQAMLSHADTRVEVWRCMVPL
                     SRLYPRLVNNEFEALMTASVKVASALTAWEAAEEAAEAAAMASVSAVVEREDDLTSQG
                     QLSPAPSASATLSRPMQSAAGGGDNNAEERSVPPPIYGEGEGADPDAGAAPPSPQRSR
                     APTASLDAFAECLRTWLHYMGYVWKAFDDNASDPAQRPEGQVDRASVEHKQRIHEELL
                     RPAMRLRRCGADVRTMTLRCIAQIGNEYMSTVADRSLCEEFVAYVQSSAADAQPRVRG
                     EALTTLGVWLWQYTSMDDFACVAIDSAVHSLTTDPNPVVRTKAAFALSNVTGRLPEGS
                     CAVVRNSPDYIATLCSTAMHAAVIDAESGVQGHGIRMMNHLLQVLTFEELISEVEEFE
                     EGVAEGFLRVLLECLRANNTRGGHNTHQEGDSVGESGGSGAASLRYAVPREAKHRWNA
                     ACALGMGLSREEVFEAEPKYAVEAVEALCTAVVRDHIFKVRTQAAGALGRIPGHCLSG
                     TYTATDMTPTVVASLCKALETATSTENFRQYKEQGSLHDALRSALAVMMASTTPSNAL
                     EKVFTSHMKVLQKEGLL"
     gene            <359795..>362650
                     /locus_tag="LDBPK_211070"
                     /db_xref="GeneID:13386427"
     mRNA            <359795..>362650
                     /locus_tag="LDBPK_211070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860576.1"
                     /db_xref="GeneID:13386427"
     CDS             359795..362650
                     /locus_tag="LDBPK_211070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860624.1"
                     /db_xref="GeneID:13386427"
                     /db_xref="GOA:E9BF93"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BF93"
                     /translation="MSTYQPLSTVIVSCGSSSSSNGDGVSEAAPHHHRQRDSVASTVA
                     EHADDGINGALHIVSATGPHSGRLRTRHRRRCNAGHSAGDLENPLRGVSTTYLTLCCD
                     SVSVQLNARDVIDDVSCLFRGGRVTAVVNCCGTHSAFALLAVMAGRVESTAGNTVLNG
                     IPVSASTYQAQVSFLEDVGEVADKEEESGSRVTRASGGLFAELTVRENLQYASALRVA
                     NSAQAYSVDEVLQQLLLGPHEASKIKNCSLYVRRRVALGKELLLNPSVLLLDEPLEGL
                     ATHESQQYLTILSKLAAPSAADAEARRVMREAMCAAAATAAGECGVSACTAANLAANP
                     HAADVLLYTPRHSRLHSGAQASPSTPADMLLTPATTAAATFADPASCAEAQRIVVLSM
                     VQPRWALLQHVHDVVLLERNRCVFAGSVQDMLAVKLPKGVMRENMAASASGDGELTDE
                     TGTLTTGTAAAATSTPRRNPLMAALVDSYDAVDASIQQQRLGEQTVHGLYRLAASMTT
                     PAAGGDGSESGEGGAAATSESEFRPIINVESFSDGQASRPSSVAASASFSPYTGTNAD
                     GLSVTPLSQLYAHRQQRTRAKVTAYMEACAMGLVDMPEAFHQPPSSIVQLLHLFHFGF
                     LELRHNLLWDVFSLVCGLTLAAALAALYGRQAGQDGMQNRVGIIFFLVSCVVLQAVLS
                     LDTLRREYAAFQHYSFRGYYGACTYLVFCAITAALWRFGLASFVALAVFVLSNFGEPW
                     HEYRGVFELSVILAVTSFCSHFGVWFLCAWLPSDHVGRFVIFTFYTLNIILAGLVLNL
                     QTLPETVQAISFMSVVRLAYESCILTQFIGKSFGCHDNDTAEANGTWPRVSVIPPSSS
                     AAHQGCIAAPTAEYAGACRHARASTLFMRGMFGARAAVYTNTCYTGTEYAEFLGFSPS
                     RRWSNVGVLVGMSALLLAGSWIMMTLYRPRRRLKMSA"
     gene            <363539..>363865
                     /locus_tag="LDBPK_211080"
                     /db_xref="GeneID:13386428"
     mRNA            <363539..>363865
                     /locus_tag="LDBPK_211080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860577.1"
                     /db_xref="GeneID:13386428"
     CDS             363539..363865
                     /locus_tag="LDBPK_211080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860625.1"
                     /db_xref="GeneID:13386428"
                     /db_xref="UniProtKB/TrEMBL:E9BF94"
                     /translation="MSGLTRWCVNTVTRVWERTKSTANLVYNVGDQLRIVYNTANSQD
                     ERKRDFDATVLRAGGFIAATVLCVIVDAQGGVPNTLRWLRALVTTEYQASSGAVDAAA
                     PAMATL"
     gene            <364760..>365371
                     /locus_tag="LDBPK_211090"
                     /db_xref="GeneID:13386429"
     mRNA            <364760..>365371
                     /locus_tag="LDBPK_211090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860578.1"
                     /db_xref="GeneID:13386429"
     CDS             364760..365371
                     /locus_tag="LDBPK_211090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860626.1"
                     /db_xref="GeneID:13386429"
                     /db_xref="InterPro:IPR028110"
                     /db_xref="UniProtKB/TrEMBL:E9BF95"
                     /translation="MPSEPKRATNGGTPAAAAAEAVQSSSRSDRLPYRHPLRLYLPVV
                     IAFVLLNNLAFRVEVDATGKNLVLPEYVRAIAMERYALRRAMAAGQVPTEPIPFNAFL
                     FFEESVMGALLQAGLFLFRSLSGIQAVCVLAWLIHLFELGVCFRICWSCNASFAVTLR
                     YMFCTCVGGFTQLSPLIKARDAWVEEMRATAAVTAAPQSKKNQ"
     gene            <366504..>371192
                     /locus_tag="LDBPK_211100"
                     /db_xref="GeneID:13386430"
     mRNA            <366504..>371192
                     /locus_tag="LDBPK_211100"
                     /product="mis-match repair protein, putative"
                     /transcript_id="XM_003860579.1"
                     /db_xref="GeneID:13386430"
     CDS             366504..371192
                     /locus_tag="LDBPK_211100"
                     /codon_start=1
                     /product="mis-match repair protein, putative"
                     /protein_id="XP_003860627.1"
                     /db_xref="GeneID:13386430"
                     /db_xref="GOA:E9BF96"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BF96"
                     /translation="MFTSPTAWNELYGPPRAPALPPEAASRRHSRVFAAATTAPVVTA
                     PPHTLADGRVSGPFSGHAYHRAVPPPVHALFATPTTSGFCPASSHYTVASQPVRYFPL
                     LPTPAAERTYYESHPYTSAYSGDGGGWPHAENAPTDENNYELAGPSRATAPWRHGTCG
                     PHQLLQSQLRVSGTMGPGAAGGVFGAGAAAAPYAMHKAHSAEMAADAEEAAWEGGAAM
                     PHDSGMPGARRPLRRPPPSTHGNPMSDCRGATLWPVAQSVSPVERGEAAKAAAQDGSR
                     LHHAAYASREGRRQAAVGMKLAAHTPHDVDGRYTDGQLLAPPPPRPPSPLHEHSDHEQ
                     QQQTHEYSSISDGARHLNSAGHRSAASAAALFFHSPSVTGGFASSPCASGSAALRAGR
                     RAAAATSAISSTATFPSATGASKMVTPAASAAAAQAEPCCVAALIFNNAKEVGVALCE
                     LPSLTVSLFQYGDTATFFKTASLLHTRNPVEVLVPSTAVDSELVQTVLRQHGAHMTFT
                     SVQRCFYNAEEGVQRLSQLKSSAEASLCIEDTDRYLCVAAANAVVLYMEHVNDMHLLP
                     GSVRVRAEALEHYMEVSRTTARVLQIIPDTACVSAAAAASMELMRNAANDSERADRQQ
                     RVRAQRYGAARRPMFLGHDLAEPPPLQTVALVDAIPRACTVMGQRYLRRTLLQPLRDR
                     VAVQGRHDAVEWLLCEPRRLHMLRVLLRHTAALDLERLTATLTHQPRRERSSAQQQSY
                     LESLQLLWSALPHLEQLRVQLKAYLGPLPRVQAPVNGEGVPPSTPSPLPGGGSDAAAP
                     SHDLRSTAAHPSVLHSIATALGQCRFPELETLMGTYLERSVLPSVVGHHERSAAHYGA
                     LHSADTGSTHIPPSVSVVAQQQQPQRPRRRLRSDDGDALASHQHPQERSQRVTGVFLR
                     LLRMCFLVQAPHSGELDALRTRLSLRISDITSYAAELRATYRIFSLRLEPDPVKLYCL
                     SYAVAEEAKAQAGPFTWRYAGGSHFALYLSALREQQLRRQQEQQQGQGRTLRSSPWHP
                     PTSAGDPFCTASSSPPTELSRHTSDADGAGFESSVIDPFSPFTFGANHTAPRQLRRRR
                     VRCSTEDLDYRCARAQECVAAILQLQLHSVQPLVRAIQHEFLGSLQATVESVALLDTL
                     LCFALYSLTHQCTRPVLVELPTGSTTAPRVRTLMTELPGDGEAVASSGRRATSVAGGA
                     GASWDRVDEYTDAASAAADLGGQGGGTAASAGTSATSSDAATPSCTPPLSTLTAHTMT
                     SAATTETETRHASEVRLFLDSALHPSAAQWQPPSRAVARAGLSARWTGAEVGGKARPA
                     SGSSGGLTMSWGSGGGDVCVVTGPNACGKTTLLRILGQYFTLAQAGCFVPAQHAQLFL
                     ADRLLAHMLCDELPSITHSSFRRELMELSELTHAATAESVALIDELGRSTTTAQGFSL
                     AWATALLLSDRRVHSVLTTHYPGLPSLARVRPARVVAFHFRVTFQHLAARDGGRDGVA
                     DSSWRGPARTRITIARFGHTLFPGPCPQRWYGLALAEKLHFFEPVLAMARRTRTCQSP
                     AEAHTEENEV"
     gene            <371989..>374121
                     /locus_tag="LDBPK_211110"
                     /db_xref="GeneID:13386431"
     mRNA            <371989..>374121
                     /locus_tag="LDBPK_211110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860580.1"
                     /db_xref="GeneID:13386431"
     CDS             371989..374121
                     /locus_tag="LDBPK_211110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860628.1"
                     /db_xref="GeneID:13386431"
                     /db_xref="GOA:E9BF97"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:E9BF97"
                     /translation="MVALTTPPPRPEETIPNLDEVEVAFRELLQQGASLNMPYVAAAQ
                     NALQEVLREHARLLTYMETHSRPNADAASATAYDDDGDTEPACVYTFRVMYDGAITAV
                     QDSVVAAAQRAAGNFFRAKASLEASSSSSLTEDALQCIGVLIESLGWALHRSIAFTGD
                     AQGYLTSMQQKLSALSTHAMSAFEPGRATLSSSSTSPATSNTAVAALAIVLPAWLRQA
                     NVALSTLSHFVSKTYPHGPWFAHHNRRAVERSRRLRHPSDVGEAPFETLVRAASRVQD
                     RDVEALSKVVLRVAQAHTQCLAAVRATSERPRDRSNLAKIFAPLNTSLNGLTATCEDV
                     IRRREDDRPHAHAVLEAGNVFTWLATDLEPCVVIEEAFSSANTYIKKITARGNVLLLQ
                     QENGCALGQRELAKATVTWAVMLRDALERMVLLVLYRYPRAVPWGESLESRMPRYISE
                     PRPPSVPRDRGEAVPVWRRSQTAAEQVVRPPTHPPSSTISSTAAPAPPMPRTQGAVVV
                     GAMPPPSKASKFAEPQPTDAQQSKPTPECTFDAVTQTWTVQHYHQPLVSPASGAKQEP
                     VLVVLPEEKLDSRHLVRILDCFNTYVTIPVKVRGVAVERCQNSKLQLASSVGPVRISD
                     TERQEVLIETSAPGVHAAKVSGLTIHLAEECNTPIVTRMASNVNATVTVRMADGDQER
                     RELALPEQYITTIKEVDQLVTREVTYSG"
     gene            <376181..>378127
                     /locus_tag="LDBPK_211120"
                     /db_xref="GeneID:13386432"
     mRNA            <376181..>378127
                     /locus_tag="LDBPK_211120"
                     /product="aspartyl-tRNA synthetase, putative"
                     /transcript_id="XM_003860581.1"
                     /db_xref="GeneID:13386432"
     CDS             376181..378127
                     /locus_tag="LDBPK_211120"
                     /codon_start=1
                     /product="aspartyl-tRNA synthetase, putative"
                     /protein_id="XP_003860629.1"
                     /db_xref="GeneID:13386432"
                     /db_xref="GOA:E9BF98"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:E9BF98"
                     /translation="MLRVSLSSCVPCRLRGIARPTSGMVAAVVVVASSSAVPERRTSL
                     PDSQVSAQRFCSTSASGTQGASSISSPHCSPSSPPSTPSSPPSTPSAAPTEAATLTNG
                     AISGGVCGRTCLTAHGTSIAFLRAAFNGSCGESGCVREGDEVTVRARLERTRGRGRLA
                     FLHLRQPPLESVQAVCEGKELTKQARSITPESIVDVTGVVRRADTPVQSTTCRGWELQ
                     VTALHVVSQAAAPLPFPYHDINAKLDTRLNHRVMDLRTEKMIATSRLVSALGQSFRNE
                     LLARDFIEVHTPKLLGAASEGGSNVFRVDYFERKAYLAQSPQLYKQMMVMGDAMRVFE
                     VGPVFRAENSLTHRHLTEFVGLDGEMVVKDSHTEVLDVLEPVMCAVLAHLTQQHGNLI
                     DALWKQQQQQGEGLQNGGGDPQPATAAEPPRCGSRGHAPRDVCCEVALDRVTSLGITT
                     DASPTTRTPFKISAQVDPYHARVGGDGSGCRVLRMSFANASHLLAGCGGAGAMADCTL
                     PVEDFTLPQERRLGQLIKERYGVDLYVIDSFPSSARPFYTMPVDPSTPDGPTRSYDMY
                     LRGEEICSGAQRVHQIELLEQRLSAKKVDKVSVKDYVDSFRYGAWPHGGFGLGLERIA
                     LFFLGLDDIRQVSLFPRDPKRISP"
     gene            <379066..>380343
                     /locus_tag="LDBPK_211130"
                     /db_xref="GeneID:13386433"
     mRNA            <379066..>380343
                     /locus_tag="LDBPK_211130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860582.1"
                     /db_xref="GeneID:13386433"
     CDS             379066..380343
                     /locus_tag="LDBPK_211130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860630.1"
                     /db_xref="GeneID:13386433"
                     /db_xref="UniProtKB/TrEMBL:E9BF99"
                     /translation="MLSFPRLSALPARRCRTTAFHETPLASAARCHRQWHSTLAASNC
                     GGIAAAPAARRADPCLATSSSSTQALSSHSCPTAAVLVDASDSALVTLPYCLAGVQEK
                     VRAHLRSLLVQRLLAPLLTESLANFFGEQDSEGSSDTHPDRSGDAAAMTSAVVHSVTQ
                     SPSALRYLAFSHQHPQLRHPSWAPLWAASPSSNTPLSAAPRTSHAEPYAEIRADAKRP
                     DEAAPDAFDVHVTLVDQDAAEALVRPCLGELAPLLGCRACGSFRAVTTAARNAVSAAF
                     SPSTKAEAPPAQLSAPSPSLPPSLPVVTYWECCRVDSYIPSYVQVQAAVRHLLLRRRP
                     TADYTANAWPAAAAALMSAPQLPRARPLALVAVVVPDHLTALYSEFVDMLERESGQWM
                     QHQQHQRRGATCGGPVHLLLFNSKGLAREYAVV"
     gene            <380806..>382152
                     /locus_tag="LDBPK_211140"
                     /db_xref="GeneID:13386434"
     mRNA            <380806..>382152
                     /locus_tag="LDBPK_211140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860583.1"
                     /db_xref="GeneID:13386434"
     CDS             380806..382152
                     /locus_tag="LDBPK_211140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860631.1"
                     /db_xref="GeneID:13386434"
                     /db_xref="UniProtKB/TrEMBL:E9BFA0"
                     /translation="MVLRHSAPLPRMATFPGCTLHIAVDADLSVDFDHLLCPPHEGSN
                     CVGVSSVAPSVAHATLFSNLPPRTCVRGVRQVNAVSQTVVLRLASGAGGADSNGAVTP
                     ASTSALARNTYVVVVLDAQQVPQMLSAAMARRCPPHLSGAGPLGWYLDAVVAGLQQAK
                     EAEENDPCSSGTVSALTDKDVNSSCADQPSTTARTLPARRRGADGDAVHMSLIVVPNA
                     TAALSGLNSTNVNVTGTEAAALFSAAVAWSATRRAIMEVSDVEEPLADRNACSAAARR
                     SHAVPVELDLCATAAHVQQATQMIAALGNKLLKAWPTSAAAAGSTSLFASDSAKARIA
                     DAADVRRDTQRKVIPSDFHALYTSMLTEVSSFSERKTMAAVTAFPTMCHLLEYVDSIA
                     GSAPGAQDGSSSGSGGDGDVAVHAPCAVYSTNYGEHRSWNVLNSAIIEALVTEYER"
     gene            <382440..>383588
                     /locus_tag="LDBPK_211150"
                     /db_xref="GeneID:13386435"
     mRNA            <382440..>383588
                     /locus_tag="LDBPK_211150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860584.1"
                     /db_xref="GeneID:13386435"
     CDS             382440..383588
                     /locus_tag="LDBPK_211150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860632.1"
                     /db_xref="GeneID:13386435"
                     /db_xref="GOA:E9BFA1"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="UniProtKB/TrEMBL:E9BFA1"
                     /translation="MMGSCLRVSLSSALHALPAPLPLPIPPDLLCPRCPFRDEILAVC
                     VFLFLTHCMCGRVRRALPTSHTTRRLLPLLFLFPRLGTDTRTRGPRSSPVHPLPLQPP
                     SSPLPFPPMPAAAAAAAASSVGQRLAQLVQRFDVIESGLKHVQQQLRHGAPGGAAAGA
                     ASSDASLCRASSTAKAPGNLPALQPDPKDPLEVARLRRHCVDSGLHSTEFLWVPSNYY
                     QENLQWRRDALRAPTIRHLCKTVLMENTHCTNKDCAERNNSRYYLVVYQYVDRFNSDM
                     VGRAIQELNPGMGKKKFNFRLADPAEAEKLTGVRSGAVAPFGTAIPIPVIVSIGITKL
                     APPTFYVGGGHVDCKCRLDAAEFIRVSNAIVAPISVPLTDEELEQIAD"
     gene            <384332..>384730
                     /locus_tag="LDBPK_211160"
                     /db_xref="GeneID:13386436"
     mRNA            <384332..>384730
                     /locus_tag="LDBPK_211160"
                     /product="histone H2A"
                     /transcript_id="XM_003860585.1"
                     /db_xref="GeneID:13386436"
     CDS             384332..384730
                     /locus_tag="LDBPK_211160"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_003860633.1"
                     /db_xref="GeneID:13386436"
                     /db_xref="GOA:E9BFA2"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BFA2"
                     /translation="MATPRSAKKSARKSGSKSAKCGLIFPVGRVGGMMRHGQYARRIG
                     VSGAVYLTAVLEYLTAELLELSVKAAAQSGKKRCRLNPRTVMLAARHDDDISSLLKNV
                     TLSHSGVVPNISKAMAKKKGGKKGKATPSA"
     gene            <385360..>385758
                     /locus_tag="LDBPK_211170"
                     /db_xref="GeneID:13386437"
     mRNA            <385360..>385758
                     /locus_tag="LDBPK_211170"
                     /product="histone H2A, putative"
                     /transcript_id="XM_003860586.1"
                     /db_xref="GeneID:13386437"
     CDS             385360..385758
                     /locus_tag="LDBPK_211170"
                     /codon_start=1
                     /product="histone H2A, putative"
                     /protein_id="XP_003860634.1"
                     /db_xref="GeneID:13386437"
                     /db_xref="GOA:E9BFA3"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BFA3"
                     /translation="MATPRSAKKSARKSGSKSAKCGLIFPVGRVGGMMRHGQYARRIG
                     VSGAVYLTAVLEYLTAELLELSVKAAAQSGKKRCRLNPRTVMLAARHDDDISSLLKNV
                     TLSHSGVVPNISKAMAKKKGGKKGKATPGA"
     gap             387618..388123
                     /estimated_length=506
     gap             388268..388840
                     /estimated_length=573
     gene            <389680..>390684
                     /locus_tag="LDBPK_211180"
                     /db_xref="GeneID:13386438"
     mRNA            <389680..>390684
                     /locus_tag="LDBPK_211180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860587.1"
                     /db_xref="GeneID:13386438"
     CDS             389680..390684
                     /locus_tag="LDBPK_211180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860635.1"
                     /db_xref="GeneID:13386438"
                     /db_xref="UniProtKB/TrEMBL:E9BFA4"
                     /translation="MSFSLESPLRTLFGAVEKNYPQYHDHLAQAHKMAHRAFKELDRA
                     SPYIAKAASYASIATEQAARFKLDELGPMLLGLALCFFGGSYTMLIAVVETVHLLCWE
                     DLKHSFQVLYHNYERAAEQNRKDHCIDADGECVTDAQEVCDTDLLSRKVALFLKSVDI
                     EAAEAAGRTIGAAAMSVIAALRVKLARSLALGGSLASMAMAYIPLEATLKDALPVEHK
                     KWSGVIAKTAANVIAMTLASMMCGAIGMMHCCIRGAHMFVQHAVHIANGHGLLEADIT
                     LESPKAKALAAMVASMGLLWQVTHTDANPFPINIFLLPFTVAEYVLFFVVNGFLFATL
                     "
     gene            <392392..>393684
                     /locus_tag="LDBPK_211190"
                     /db_xref="GeneID:13386439"
     mRNA            <392392..>393684
                     /locus_tag="LDBPK_211190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860588.1"
                     /db_xref="GeneID:13386439"
     CDS             392392..393684
                     /locus_tag="LDBPK_211190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860636.1"
                     /db_xref="GeneID:13386439"
                     /db_xref="GOA:E9BFA5"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:E9BFA5"
                     /translation="MSHKRDRLTSETKLGGTPTYFPPLSDADKAQIRRWTSCGVCGHA
                     MSLLTQAYSPLPTASASRPHHRMMYVFACNSGYCSRQPTSSMVAFSVQVDQEDEQALA
                     ENSEEEEKDEVIETGPLLPSELPEAVLPPCYVYIDAEPSKEVVVPTDIERELIKMAEE
                     NARSTVTDEELQQLEQTVDLKNKKTDYYYEKFRSRVARAPNQVLRYYERTVAAAAATS
                     ASLRAKDVKPIFMNPDKVKAMVTIPACACCGSAQTAELQVMPTSLYYLHVSEYTALAR
                     ADAAAMAAPAGAPAAASTQGNAVDKQPPVASHSASTTACKASASSGAATGTEKAIPAN
                     VDDGCDFGTITVYVCAKDCAARQHGVVLRRETLCVEEAPTMRDEERAGKADAAKAVTD
                     GVTHKLTLRELLHGNGEGDEDMEDDDEGHIDDEAVSTA"
     gene            <394977..>399308
                     /locus_tag="LDBPK_211200"
                     /db_xref="GeneID:13386440"
     mRNA            <394977..>399308
                     /locus_tag="LDBPK_211200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860589.1"
                     /db_xref="GeneID:13386440"
     CDS             394977..399308
                     /locus_tag="LDBPK_211200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860637.1"
                     /db_xref="GeneID:13386440"
                     /db_xref="UniProtKB/TrEMBL:E9BFA6"
                     /translation="MPSSSSSTTHRSEGVRSSERLSGSHSSLSASHGRPTIGPSPRGD
                     RAIGAQTPRSVEFTEVPHAEMEEKDTYSSSRTSSNGSRLRRSCDGNSGHVHRYAVSES
                     SNCSSCFEMLEHVPENDSHHRAETSVTHGTVTCHMSPMLPPRSGARVGEAACCDIRST
                     CSSPAPAASVTVGGTGGSSRPSSSCPSPAASSSLTTPKRVDGAFTGAHSSAAQPPDSA
                     APFSNDSLAALSTEQMEAALQLYVEKGGVYTNEVTSALQALPWCAATSAHASPVSSVA
                     DTSAADTGEEAEQHLVDPEVWLGAVAAATASAVAVAENDEQASVTAPSVATRIASAGV
                     LHKTQGRHSTLEEVSTMIMQPSNLADPSAPVPVERTVEKRRSSADSSSELAAVGGAAT
                     DSDFADHEADRGPGRSSAVVSPVDSRSHLRGDDSNDSTPRVNSVNGHHVSTDRKLAYG
                     DVNDDSTERPARGERSPSFPQLTRRHRSGSAQQQRLPVPSFMSNTRPLRSSPLYSSVS
                     PMQRSVDDQQRSPATAAASSPVCVTKDATETAAPPAASVFDTVFAGTAGMHALFQLCL
                     RTPLATASATMRVSDWYALLDQLRHNGCHKLPPQPILDDVARTIAHTMQSEGHSGGLT
                     LSDFARVIQCQLKEVRVDMTSPLPRNVPAGDETASRQEVALHFPQHPRYTVTVPTSAA
                     LSSQSPSFPSRRSSRRSSQTKLTPVTDSGQWRVLPTWCMALAGLFPLEMSKVCPVPVV
                     RYLRSVGLIRAVLEAITQRLQIEVEAIPECVAPISSAASKEAENPSEGAAVESLVLSA
                     SCEGSGGSRSVSNLLARSGASAGARPAISVVVTEKAVGDSGGRNGTWNEQPIWGSATA
                     GNYRRRVKRRKRGAATNMVATPERAGSDCAIVASNPQGASSGSSCPKAGTTASASSDT
                     FKSHYLDQRPLDEISISVVARAKARRLMDTLRRHTVPINRYECFARVEQEDEPVRQAL
                     CFVSREELKATFSSDGGEDSDADSDAMPDMIAALTYHPGEETEASLVGTAAKDGGGVD
                     VDQTRSALPPPTLSRTSTPNVLPTVIMGATRASMHAGGRASSVTTSRVASAGSAVRPP
                     PPVPCMFRMSGVLPTALPRKQEEALVSRLSKPVCDPAAMSLRVASKENGYTSCHAADT
                     TTAIGASDSASANAKAIEDRPTRLARSRRPSGSAAQRHYRSHLHPTDRESSNDTVSRS
                     GPAAPSRNGFRRRRGRPSSSRTDRCYASLCPGRQHQLSSSLAANTDSGGACTSQPTEG
                     RNRSFSFFDVPYVLAAAPLSSSAAAAAAAQVIGGGAPSASSSGVAIPPQPPALRRQAG
                     HRIASRGAPCGASRAGSAAPLRAKAKDEPADGRRAGNIPNNAVLKLARRGLRSRRSTP
                     RRSSDAPPRDRSAVDARGEENSSRPKAADAAAAAHPPAAPPQPHISLYERRLCRQLQR
                     AYSNEHI"
     gene            <400082..>402370
                     /locus_tag="LDBPK_211210"
                     /db_xref="GeneID:13386441"
     mRNA            <400082..>402370
                     /locus_tag="LDBPK_211210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860590.1"
                     /db_xref="GeneID:13386441"
     CDS             400082..402370
                     /locus_tag="LDBPK_211210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860638.1"
                     /db_xref="GeneID:13386441"
                     /db_xref="UniProtKB/TrEMBL:E9BFA7"
                     /translation="MCLCACAFFLHLVCGRSLHVLNSPHCTVCALHSLKGIPTVARHM
                     PLHPYPLSGVTPLSLLQQLQRRPCGGSASSWLLRRLPLQRRCEARVEVQRRSFATCDM
                     QLSRSSPAPPSSSSSLLSTTMQAKDVVTRLGPSERLPGLRGVFLTKPIKKFHPIEVLP
                     TAASAAATTTTAATADSSAERPDAPRSSTSAIVSQAPPLVLNLAFAPRHSISLRRFLA
                     LRHMFSTSAYLHVTTEDGWYLVAPSSAAPLCPDVTGLQAWCCRHHHRYLKHASTAVKA
                     ATSSTTPSSRAARCSTHTEITKLEAALDNGEELSEEQLQRLAAQEKASFAHTPESEEA
                     DMDDHTDGTDDMPAVHEPRDPVSRKTASPTAETLRERSAGAPASAFGLSPPELRTPPP
                     LISEAHLFDINDGVAWPLPPSDDLANHEYWKSHRQRMALYESTGDADASEQREALLAT
                     LRADPEIAQKLSSEQELYTAAEALFQALKHKANVTLNVDADTGLLTLVPLRDLHAGEE
                     LLLHYGREWWTGRLLFSLLLSISDAEMPQIRWIEQLFDHAVDRNEPFPLLIVAHEQRK
                     RPRRGCSRGPKVCKGLKSESSGDGDERQQQSTQCAPLTKPHGDSAETSSTTAMTAELP
                     MSQRKLGRAVLYNTVTRKRATDAAVLAFAVRRSCIEQGFLSRLLVGDAAGGAEPVFQL
                     SEPDKEVPMRVLRRVLLASLRGMTASAQRTVPHKDENAPAVAGSAVADTAAAVVDQGA
                     PPQTSANTGGDGDDGDDAVFSV"
     gene            <403337..>408739
                     /locus_tag="LDBPK_211220"
                     /db_xref="GeneID:13386498"
     mRNA            <403337..>408739
                     /locus_tag="LDBPK_211220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860591.1"
                     /db_xref="GeneID:13386498"
     CDS             403337..408739
                     /locus_tag="LDBPK_211220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860639.1"
                     /db_xref="GeneID:13386498"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BFA8"
                     /translation="MQVQFYQNIMKGQLGTARTQAICFSANNKRLAVADATRHIQLFD
                     EQGERRDKFATKAASDKGGRGYIVTGMTFSPDSSLLAIAQSDNIVFVYRLGLEWGEKK
                     AIRNKLSQTSPVTCVVWPNTSSQGVELIAFATLDGSVKVGMLKANKSHVLYSHDHPAV
                     SMCTSRDNTKILTGHLDGTVYQYVFEATEDGAEVAGAKRLFVHSCAPYMLAWGESICA
                     AGTDCQVAFYTPKSGQKPQVIPFDMKDVGSFTGGVCNPSGQAVAIAGREQIRIFDLNI
                     RSHKWEEGTVVYLPHSEGFSAMQWKRDGSRLVTGSVTGSVDVFDCCLRRYRMRGAYEF
                     TYVSHSQVIVKRLASGTRLVLQSYMGFEIQKVNVYQDRYLVAHTSATLLLGDLVSHKL
                     SEVPWQLTGREKFTFDNEQICMVFNVGELCLIEYGKNMILGTCRTEERNAHRISVRVL
                     NPLASDTGAGAAGSGGAGGQRREVNTTTGSPIVPTPVTGSSGALDAYNSRCVIAYLID
                     RQTIQIDDLRSGVSIARVPHESKIDWLELDFRASRLLFRDKQHQLYLYDISRQQRTTL
                     LSYCTYVQWVPRSDVAVAQSRLELCVWYNVESPERVTIVPIRGEVEGMERGNGKTEVI
                     VDEGVSTVAYALDESLIEFRAAMEERDLDRACDLLERTSLSPGTEVMWSTLANVSLQE
                     MKLFIAERCYAALGDVAKVNALQRIHQLAAKARADSADATTGYEHYTVLAELYMMSQD
                     FKRAEQLFLENGRAEDAMQMWEEMNRFDESLAIAESRGLDDVANRRARYFAWLMETRQ
                     YEKAGEMREKDGKLIDAINLYLRGGTPARAAQVVSVNNLKPEQQLLEAIAAALFKAQV
                     FEAAGDFFDKLHMTDRAIDAYKRGHAFSRAVEYAKTAAPQQVVPLEEAWGDYLVSQKH
                     VDQAINHYNEAGKYGKAVKAALDSRQWAKAAAILETQSNGGVGSSGVPVDAAAKSAYQ
                     RIAHHYEEVHQYAEAEKLYIKCGAVSDAVDMYSRAGMTDHMYRVAQRHLEQDKLVELF
                     VSQAKQLETKGDYAAAERIYLKVNDADGAIMMYRKNRDYTNMMRLVQAYRSGYVVQTH
                     LALAAQFQKEGNLKAAETHFIAGKDWSRAVSMYRDRDLWDDAVRIAKVHGGANAAKQV
                     VVSRATVMDSEEGVRLLGKFNLIEAGIEAALESSKFDLALQWAQLARPAKVPYVYLKY
                     AMHYEDQGDFRMAEDAFIKSGKPREAIDMYVHQHDFTGAMRVAENHDPSAVPHVCAAN
                     GRVCFQQGNYKEAEALLLRANAPETLLKLYIDAKMFSEAQRVAKAHCPEMQSDVAKRM
                     ALNSNDPQKAGAVLEENSEYQLAIDTYLAATPEMVPDPATLANLWVRAVKVAQKHARN
                     LLKEVLRSAIDKLKAAQRYVEAGKCLEDCEDYRAAINMYVQARKFDMAETLAKRVSPD
                     LENFVKRAIVQDSISGGSMKDAKVVEEMDPEAAMKAYISKADFANALRMAAQRSQEEV
                     QYVAGLQVQHLLRQGDPVQCLEALSKNAMNSDDFRFYETWMSVAQKVIPLLPGDDAVA
                     TLLQPLHDGLVKVVNSMTQSGQKSEDIAKATALASVVHIYYMSRKMETELNMPDFAVQ
                     LMLGLPRWIPHVAPDKAFYDAGMAAKRSGLEGMQDVAFLYLNRALDINERIDDGDTDS
                     SGIDNTDFSATDFPKVYRLPKEPTVPAQAMEEVNNWVLTVSIDNTAASDSRTLPMVAD
                     PENGELMFAGSVKSPHTGKVYPTCAVTGYPVIGGGLAKCAQCHRPANQADWNKFVLTA
                     KRCPWCGAAANPNFKV"
     gene            <410142..>410570
                     /locus_tag="LDBPK_211230"
                     /db_xref="GeneID:13386499"
     mRNA            <410142..>410570
                     /locus_tag="LDBPK_211230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860592.1"
                     /db_xref="GeneID:13386499"
     CDS             410142..410570
                     /locus_tag="LDBPK_211230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860640.1"
                     /db_xref="GeneID:13386499"
                     /db_xref="UniProtKB/TrEMBL:E9BFA9"
                     /translation="MVRYVQRPWFSPLGFMASSPTAYAPMMTCIALAIIFPFRYQISE
                     YFERQRDGVHVELRRKAVKYYAEMERMHRRQALVNLESIQDDNAPHRLSAVLSVESTQ
                     AGHLDQEYNYWYAHERDAIRAEKLMMEIRELKAKMASDSA"
     gene            <411551..>417697
                     /locus_tag="LDBPK_211240"
                     /db_xref="GeneID:13386500"
     mRNA            <411551..>417697
                     /locus_tag="LDBPK_211240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860593.1"
                     /db_xref="GeneID:13386500"
     CDS             411551..417697
                     /locus_tag="LDBPK_211240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860641.1"
                     /db_xref="GeneID:13386500"
                     /db_xref="UniProtKB/TrEMBL:E9BFB0"
                     /translation="MSEHTSTNADLPPMSSADLAPRWMLAAAQLTTTATELAASVPSS
                     APVAAAPFVRSLVSLQRASSRDVEPYQVCRANVDQLLELQGEQMGLAQSLKAALRVAS
                     MHATPAFGVDSTAGSPQQASTPKLVMDNVENIFPDRRGCSSSRPRQQRPPNASAKAGS
                     QPTPTPSSLPSLVSSVTSLVHRLQVLQRESAEFAATRCLPALAELFATFEAYWAWKRS
                     SMCDGDAQEEEEASAIPVTAGSVSAHHAMDGAPTASQATQERLSQQQQPPTLRQRYDQ
                     ALRVRDELLSFLQLHAEAVRALDVQLEQWCQCRSSEPAAQSARGWITASPTGTSGAPA
                     AVSHDADAQAHTQRCEFEAYACQLVEVAQATHHIAQLLQAALQALCRPSPRTPRLSLK
                     PRADAVVEDEGLSSFSKQPRQTEANAAPSPGIHERRLGRLQTRSSANTEGLAHIRTEG
                     RGSPSSSPGPHTSRTVGRPECALRSLSTPKARTLRGCAKPAPCGDARWASGAAGDAQC
                     SWIDILSPLTPPPTAATASASPSSSPPLRVENGAPHQQLRRQRHGRRLLSLSPGAEAQ
                     AEGSASPDAASRSSSLYAAPSTAGGVSLSPLTVQRGDAAAVPACSREDSTDREPHCPV
                     SMPSFASRLGGPGDAEEDSGVQAAVTPVVTMCPAADGSAPRNLGDDVASRLSADAEHP
                     PWPRLHSFSQDGARSLLCELASASADAAAGAGEPLTTGPQPPVSRRRDVPEVPALTDS
                     THENSAEVTADRQGATAVYVPPPSEQPASRQSDASAAALTPVIVNVARSEEGHAASQP
                     FPSPPPPLQRALATCASVSHTTITSLHLLSPPSLTVDGSACCRTTRNECGGAGEQSLS
                     RVVCAASIPTSLWPRLHQKGASQSSSSAAPVRASADVAGGAQLARNTTALVYTPSHAP
                     PNEPEGDGDVASTHSASRTVDPNFYTARASGAGVSPLPALAAPFHGSASSAGLEPSPK
                     PLEQTQYPVQQQGRQAHHSQEWDRTFIPTPLPLDSLEEELNEAQQRLQAPAPPPHSSP
                     AFSASSAAPDNYPAPWPQHRSLEDRVMLTMREELKALRAEQRHNLHKMRKYVKHTLEE
                     VAEAVSAVSSRNHSSRGSSCASSRSQRPGTSHKMNDNDADASAGGVRVTVTAEKQRHA
                     SHASEQARAEASEKPIEAVSASASIKLSTNSATLPPRLSTAQQQQQTASAAPASPPSK
                     AEELQRSLAVAEAKAARLEQLTVQLKKRLWMAELSRLSPTPATPGAREVTAAAKHCLS
                     LRDAFVYGLSSDAGDTEDDDGSWPKTGQATGCMSYSDEDGSAADGVAAEERAMLYLVD
                     RELGCRTALDARAHSQRRPSAPHQTRSEVYRSSRQVPYDGSRSSSTEQERSPNMRCFE
                     DDTAAHLGLTVTSTASAGITRGYSGRRLCSSSAAPVGATSSTTAMRSLGILQQRASIF
                     QVLRQNQAARDAQPAAPTGQQQQQQSERSRLRPPPPPLQHCSAGTATEVTAKFTTSEQ
                     STAPSPPPCAAQQPRQHPYNAGTAPSRYDRQADEGAAAGSPRQSASSHYYTAISGGSD
                     TGFVSEAGRQSSASATALRAEQVLQSAKRLLQSRSASLAAGHHNISDNSRSSASLSGG
                     LQASFTAISSPKTRANAGDHRSEMPYHHGGGATGGVPAALAGRHSRPGQWGDCVEQLD
                     GATLPPRAFSAPALHSGTTDAATALQRVSGSLDRGAASISAAVSGHGSRSHSSSPESA
                     YHGYDTSPCSAVAYSTSKVPRASSPSAAKAAPKSTQQWCPPLLVDVSHAMTSVTPARH
                     AQHRADSATSPISREDAEVRATAGRGEHGAYIHSDVGLRHRERSARTVTTSIESDYSP
                     PSDRTTDTRSTRGFRSSSSPLHAAAVQHVHDSRQEAPVPLTSRAGQSTSRRTSCSTSS
                     TLSRGSAQQELLDTLEKQESTLAAALDHLQEQQRQLREKHQQVSLLAKRTSLVAPVHA
                     PSQAPRGDYSRATGAAAAATTRKQLMRAFSRDRHGNAAAARTSHASSELHHLLERFAA
                     AETSLAERERRVRKALRVVQRQRSALSRDDLL"
     gene            <418971..>420383
                     /locus_tag="LDBPK_211250"
                     /db_xref="GeneID:13386501"
     mRNA            <418971..>420383
                     /locus_tag="LDBPK_211250"
                     /product="epsilon tubulin, putative"
                     /transcript_id="XM_003860594.1"
                     /db_xref="GeneID:13386501"
     CDS             418971..420383
                     /locus_tag="LDBPK_211250"
                     /codon_start=1
                     /product="epsilon tubulin, putative"
                     /protein_id="XP_003860642.1"
                     /db_xref="GeneID:13386501"
                     /db_xref="GOA:E9BFB1"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR004057"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="UniProtKB/TrEMBL:E9BFB1"
                     /translation="MPREIVTVQVGQCGNQLGQRWFDVMLQEHKAYSHFPEARDAVFL
                     EDMNHPGRLKARCVAVDMEQGVLHAMLRGPLKDIFDANFFVSDVSGAGNNWAVGHMEY
                     GDRYIDAIAESVRNQVEQCNCIQSFFLMHSLSGGTGSGLGTRVLGMLEDEFPHVFRIC
                     PVVMPSEVDDVVTAPYNSCFSLKELIEHADCVLPLDNDALARMADRALSSRPKGRGVM
                     ACSVPQPQAFSAAKPTDTKGLPYDSMNGLVAQLLSNLTCAMRFPGPLNMDINEITTNL
                     VPFPRLHFLTAAIAPLSVSSKHAAVGPRTVDAMIAACLDPGHQFVDVRHGQGSAVTRE
                     AGKTLATSLIARGPQTTVGDLTRGVGRLREQMEMPYWNEDGFKTALCGVSPLGHKDSM
                     LLLANNCSIRGKVESMLSKYERLYSVRSHVHHYDQYLSDAYFVHTVETLRTLVDDYAY
                     LDTAAPPKDLPRSMKDLIYY"
     gene            <421100..>421984
                     /locus_tag="LDBPK_211260"
                     /db_xref="GeneID:13386442"
     mRNA            <421100..>421984
                     /locus_tag="LDBPK_211260"
                     /product="dynein arm light chain, putative"
                     /transcript_id="XM_003860595.1"
                     /db_xref="GeneID:13386442"
     CDS             421100..421984
                     /locus_tag="LDBPK_211260"
                     /codon_start=1
                     /product="dynein arm light chain, putative"
                     /protein_id="XP_003860643.1"
                     /db_xref="GeneID:13386442"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:E9BFB2"
                     /translation="MRTGSNRRHNNGNTGAKIESNSASVADLQEAILQLLPRRASEED
                     AAAYIDVSGPVDANQTLIRYDIPYAPGDPKRSLKLRKSLGLGAEERVVDPNVRVVIDS
                     FITPRRWVDSSTGVVWVQHASPFPSSRIDAAETQERLHAQLEAHQARRTGTSPIRSLL
                     VAECMLEVLRQVTAECWERGLLLLHVHSERVAAQAAHRRLFESRVGHAFRLALKGEKD
                     VAKVEEDMAALKQRIELLGQEEADLRRLCSEFERRAEEQVLIANKEHNDALTKLKREG
                     VQKRAQLEQQLVIPANLQ"
     gene            <423721..>426189
                     /locus_tag="LDBPK_211270"
                     /db_xref="GeneID:13386502"
     mRNA            <423721..>426189
                     /locus_tag="LDBPK_211270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860596.1"
                     /db_xref="GeneID:13386502"
     CDS             423721..426189
                     /locus_tag="LDBPK_211270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860644.1"
                     /db_xref="GeneID:13386502"
                     /db_xref="UniProtKB/TrEMBL:E9BFB3"
                     /translation="MLREARRRKQQVAAKIGHEEYIYRLNGNPFSHQEVIRVRPQGDL
                     DPRRVQAAGIRVGVGGARGVGGPSRPPFAVDDDANYSNGGGRGSRVAPLNPSSGVPND
                     GPSNEAVAPYSAPEGCNGGTPRGKKYAAANYASPYGGGGGGADGHPHPLVSQGQHIVS
                     TFTPVIPAIAPVRDLPAPLPAVYRPKPPLTFHSGPASGAEVPPLSLTPLPQHPAPSQV
                     CYPSSEAGTPRAAAAPVYLSPGEKGAGRPSTSPTVLPPLNSDGGNSSGGGPFPTRSPR
                     PSTSGAALGGGGFLIGGDGLSAAEERHREKMAARQRAVELQRENARQILEKQQRKQAE
                     REREIQEYRLAEERLQREREEVARREQAELDREKREKELKMMAPRAAQAMLEQQQRET
                     QQRREEEAAARRNRARAPATPAAPEAPEVPEAPEAPEMGKEALKSTALPLPASANVAS
                     TSLQSQPPANHLLPLAAPSVLPPPAPAPALPYLVDFNFGSGLRHSPQPLPTPYYYPPA
                     NMCPQAALLPNADTQSIRSELRRITNLLEEQQLQQRRAMDSISIGANAAPQPWHSGTP
                     QPSTKAGAGTYLTTGQPSPSIGAGGPAPVITAQRNSAAPYRSFSTGGTLPPPPLATAA
                     PPAPSSSGAGAPSVGIGTWQGLLSPYAGTSAAGAGGSLLNPPSRSIPQFTSSITDNEP
                     ELSTEPSRFIGPFRAPVTAVPSPPPVPVPGVTLVGADSMATKPLPPLVHRAGVTEPDA
                     EHCVATPPPASTAASSRLSPVSSASALAPARFSMPEMNSPTRSPNVEGLPSVRHGSPQ
                     ATEGSRTDADEGEPARRVSESPMS"
     gene            <428511..>434900
                     /locus_tag="LDBPK_211280"
                     /db_xref="GeneID:13386443"
     mRNA            <428511..>434900
                     /locus_tag="LDBPK_211280"
                     /product="kinesin, putative"
                     /transcript_id="XM_003860597.1"
                     /db_xref="GeneID:13386443"
     CDS             428511..434900
                     /locus_tag="LDBPK_211280"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003860645.1"
                     /db_xref="GeneID:13386443"
                     /db_xref="GOA:E9BFB4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BFB4"
                     /translation="MGRGAAQEVYPDDGHIFVCVRIRNVPQNAACLTNNGGAATNTRS
                     STVARKSVLREAQRICVSVVENVVVMHDPTSIDDAATVAKDGNNVVQMLTDRANHAGA
                     ARNSRKTAGGGGAAAGASGISSRRTVGGARATTAGDARLVSTSTANYYECDYCIASME
                     ESQLLQMPLIRTSDFLQPPPYGTQEEVYQRTAMHAVKAAIDGINSCVFAYGQTGSGKT
                     YTLFGDTTNIRRDPGVVPRTLDDLFGRLEAVKQSYRNDKVTDYSYLVHLSFYEIYQNE
                     VYCLFSRQGPLRVQFVRDLTGKRETMIIHDLQQQTVTSAEKAYPMIEMGLRRRQTAET
                     GMNAHSSRSHAILQIRVAQYRTNRDARETVEHQATINLVDLAGSERQKTANTSGTNRA
                     EGIQINQSLATLARVINDIASGARFVNYRDSLLTMVLKDNLGGNSKTFMIANISPIAF
                     SYQESCATLTYAKDVRKVRNRPMVNKTFQTRANLLEQNMMLKQENEKLKVQMEMWVRS
                     LQSGNLHASVTDMVALLPVLGGGTAEAGDHLLPSPPLSMAQAVETEQRRAADVPLAAA
                     GCNETFLTAISSGLTAPLLISSHRKYTSVAGIGGSCIEGGAVRVSALVKEAMEFPLSH
                     VLHPLPTMAAGDTSYTTDEDSHDAQKRHTTILMDADASSLGCASGEAAQRPDAAGEAA
                     AMAGEVMGLGSLVLERVAQRSCEQRYYVHFKPPTTAEGLSRLIDVQVNGKSIGAKGRR
                     ELHHGDVVCAYLEDAAKMEAAAAETAASACLHTQSLISFHYVDLNALSRGANASMTGM
                     SSATLGQIAVSVDLPADMENLTLDGIKQLQRDNAKLLDMVRQQAETIDYQCAHASTPM
                     MQVEDLLGGISPAGSPGSGSPNPRSLEPSISALPPPETHKVAVALEAFRRVSVSPSIR
                     GGSVMPADLEADELLHRAATQSESKQRLDNAVRENQKLHRTVVSRNATLDALARRLAE
                     LEAGGPLNSLTSPSPSSSLASSSSNTSLSADRGYNGETLAGRRADSVEDDTDVSRRTR
                     GDRGSLTCVSSPSQMRAVSAQRRGEEIVEADDDDEPRPEPIGDGQRRIVYENAEGARE
                     RYQAVVREREQFDRILELEALIGELRERISELESRLRFSKDETLEQQMFREQAEAERD
                     ALLEELANTRCENSALRRENASLEGFLARDEQALADAARLADEELERQTAVLADRIKA
                     LKALSRMWKQRTMKYIAMGYGAGSDDKHTGSAGAAHLEAIPWDDLRAAETAAIAKRRL
                     GRGDADACPVDVAQAIDDFEKSTTEDNVRALEYALLNFEQENQRLLDEIRRIQAELDG
                     YKGLIGRLRAEKAETEKTLADATDSTEEERRRMQQLLRNTNAQLEEAEENLKRTQVRL
                     DDAMEMCESNKRKAVRNNELLLSQQKRTIEQLEAELCRLRRDHAAKDEELTNLTRYMQ
                     DRDALGGDGVAKSCELRSRIEELVSDSMEEYEAPNGYSVFPAGFEFSNEMVSLIRICL
                     RILLDRLKMELYVLNAQSVHKFQLLIHAVKARTEAHFHTFMHQLRDAVSQMSGRTLRP
                     GSKWGLSESDVLSTLVDHRRRQVGDALSGLLIWYDHWDNAPKTEHVAYMELIRNADRI
                     MQMARIVRRESFLNTNATSTSLMPIPGKSGTSDTSLLPESSRRNDKTVKGSCKILSRL
                     ASSTRQSNLARAVNQFSATPSRATIAVREDVVGATPCPVEQGATPFSRSATVAALALS
                     QSMIPFSRTATGTHTSGHQPPSAANLESCSLFSRCPSGLPRVSATTATATGLSPRPNP
                     STVTPMRPIKQATSVGAATPAAALATGASPAALTAAARANYSRMASAGVLPVLEADVA
                     YVANTDVAEAVSISTYNFSRRMSSAAGAGEGAAADKGEPVRRPNRLFSRCQTAIPQTR
                     DSMQQQQRALRRQNSATLASSKTHSSAGATCTRRQVSRAKATEAFARSKTYYTVPKST
                     ATLSRPSRRRSGVRVSTNSSTRSTGSLGGGSPHARPSSSQHNATRLSAFYSIPPAEQA
                     RGSGKGRASMLSSNATTKPSAAEISFCNLDVMKSLRERSTSDVNRQVPTGNKPSSISN
                     RVDLTNISSVHPRKGMAQPVPSSTGARVSAGHDTTLVSTTPVVPRLDFGALEGKR"
     gene            <437318..>437890
                     /locus_tag="LDBPK_211290"
                     /db_xref="GeneID:13386444"
     mRNA            <437318..>437890
                     /locus_tag="LDBPK_211290"
                     /product="60S ribosomal protein L9, putative"
                     /transcript_id="XM_003860598.1"
                     /db_xref="GeneID:13386444"
     CDS             437318..437890
                     /locus_tag="LDBPK_211290"
                     /codon_start=1
                     /product="60S ribosomal protein L9, putative"
                     /protein_id="XP_003860646.1"
                     /db_xref="GeneID:13386444"
                     /db_xref="GOA:E9BFB5"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:E9BFB5"
                     /translation="MVKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLD
                     LRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPINV
                     SVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDLEQVSREAAVL
                     HQMCLVKKKDIRKFLDGIYVQTKTNIEGME"
     gene            <439100..>439531
                     /locus_tag="LDBPK_211300"
                     /old_locus_tag="LDBPK_211310"
                     /db_xref="GeneID:13386445"
     mRNA            <439100..>439531
                     /locus_tag="LDBPK_211300"
                     /old_locus_tag="LDBPK_211310"
                     /product="40S ribosomal protein S23, putative"
                     /transcript_id="XM_024473462.1"
                     /db_xref="GeneID:13386445"
     mRNA            <439100..>439531
                     /locus_tag="LDBPK_211300"
                     /old_locus_tag="LDBPK_211310"
                     /product="40S ribosomal protein S23, putative"
                     /transcript_id="XM_003860599.1"
                     /db_xref="GeneID:13386445"
     CDS             439100..439531
                     /locus_tag="LDBPK_211300"
                     /old_locus_tag="LDBPK_211310"
                     /codon_start=1
                     /product="40S ribosomal protein S23, putative"
                     /protein_id="XP_024329233.1"
                     /db_xref="GeneID:13386445"
                     /db_xref="GOA:E9BFB6"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9BFB6"
                     /translation="MTKTNGQNAARKLVRLRCRNRWADKGWKRAHTFSARKANPFGGS
                     SHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGCLHFIEENDEVLV
                     SGFGRSGHAVGDIPGVRFKIVKVSNVGLYALYRQKKEKPRN"
     CDS             439100..439531
                     /locus_tag="LDBPK_211300"
                     /old_locus_tag="LDBPK_211310"
                     /codon_start=1
                     /product="40S ribosomal protein S23, putative"
                     /protein_id="XP_003860647.1"
                     /db_xref="GeneID:13386445"
                     /db_xref="GOA:E9BFB6"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9BFB6"
                     /translation="MTKTNGQNAARKLVRLRCRNRWADKGWKRAHTFSARKANPFGGS
                     SHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGCLHFIEENDEVLV
                     SGFGRSGHAVGDIPGVRFKIVKVSNVGLYALYRQKKEKPRN"
     gene            <442389..>443294
                     /locus_tag="LDBPK_211320"
                     /db_xref="GeneID:13386447"
     mRNA            <442389..>443294
                     /locus_tag="LDBPK_211320"
                     /product="cell division protein kinase 2"
                     /transcript_id="XM_003860601.1"
                     /db_xref="GeneID:13386447"
     CDS             442389..443294
                     /locus_tag="LDBPK_211320"
                     /codon_start=1
                     /product="cell division protein kinase 2"
                     /protein_id="XP_003860649.1"
                     /db_xref="GeneID:13386447"
                     /db_xref="GOA:E9BFB8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BFB8"
                     /translation="MTSRYERQEKIGEGTYGVVYKARDTSTAATVALKRIRLDSEEEG
                     VPCTAIREISLLKELRHENIVKLLDVCHSEHRLTIVFEYLDLDLKKYLDRENGNLDAA
                     TVQHFMRDLLRGVAFCHQRSVLHRDLKPQNLLISREKELKLGDFGLGRSFAIPVRKFT
                     NEVVTLWYRPPDVLLGSMQYGPPVDVWSVGCIFSEMATGTPLFAGKNDADQLMRIFRF
                     LGTPNNRVWPSMNQYPNSNNMLSQPEFLQNFEPEWSNVLGSVPGYEKLGCAGVDLLEK
                     LLRYEPSERITAADALNHPYFSLQF"
     gene            <445034..>446689
                     /locus_tag="LDBPK_211330"
                     /db_xref="GeneID:13386503"
     mRNA            <445034..>446689
                     /locus_tag="LDBPK_211330"
                     /product="T-complex protein 1, delta subunit, putative"
                     /transcript_id="XM_003860602.1"
                     /db_xref="GeneID:13386503"
     CDS             445034..446689
                     /locus_tag="LDBPK_211330"
                     /codon_start=1
                     /product="T-complex protein 1, delta subunit, putative"
                     /protein_id="XP_003860650.1"
                     /db_xref="GeneID:13386503"
                     /db_xref="GOA:E9BFB9"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9BFB9"
                     /translation="MSAAIVNRAASGAAAPRRKGNESKKDNNTQTDVRLSNITAAKAV
                     ADCIRTSLGPRGMDKMIIDPKGETIISNDGATILSRLQVTHPCAKMLVDLSKAQDIEA
                     GDGTTSVAVLCGALLRAVEELLNKGIHPTQISESFNECAKLAEKVLEDMSIKIDIDDR
                     DTLIKAAITSLNSKVISQNSDLLAPMAVDAVRKIIRSNGDVDLRDIRVTSALGGTIDD
                     TELIQNGMVFKQKASRVAGGPARIQDATIALIQFQLSPPKTDMESTVTITDYTQMDRA
                     LKEERKYLLGLCKAIKDAGVNVLLVQKSVLRDAVTAQSLDFLAKMKIMVVTDIERNDI
                     DFITKTLGCMPVANLENLTKDKFGHAKTVIEEGTPSGKVIKIMGVQPPPPSSLNHELF
                     GKTVCFFLRGSNSLMLEEAERALHDSLCVIRSIVKKRAIMPGGAAGEIEVCMQLGKYA
                     RERAEGMQTFCMRAYADAFEIIPYTLAENAGMQPISIVTELRNAHASGHVNSGVNVRK
                     GCVTDMVEENVVQPLLVSTSAVRLASEAVMMILKIDDIIMTRI"
     gene            447292..447522
                     /locus_tag="LDBPK_21rRNA1"
                     /db_xref="GeneID:13386504"
     rRNA            447292..447522
                     /locus_tag="LDBPK_21rRNA1"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002966713.1"
                     /db_xref="GeneID:13386504"
     gene            447690..447761
                     /locus_tag="LDBPK_21tRNA2"
                     /db_xref="GeneID:13386505"
     tRNA            447690..447761
                     /locus_tag="LDBPK_21tRNA2"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:13386505"
     gene            447893..447966
                     /locus_tag="LDBPK_21tRNA3"
                     /db_xref="GeneID:13386482"
     tRNA            447893..447966
                     /locus_tag="LDBPK_21tRNA3"
                     /product="tRNA-Val"
                     /db_xref="GeneID:13386482"
     gene            448030..448102
                     /locus_tag="LDBPK_21tRNA4"
                     /db_xref="GeneID:13386484"
     tRNA            448030..448102
                     /locus_tag="LDBPK_21tRNA4"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:13386484"
     gene            complement(<448342..>450435)
                     /locus_tag="LDBPK_211340"
                     /db_xref="GeneID:13386485"
     mRNA            complement(<448342..>450435)
                     /locus_tag="LDBPK_211340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860603.1"
                     /db_xref="GeneID:13386485"
     CDS             complement(448342..450435)
                     /locus_tag="LDBPK_211340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860651.1"
                     /db_xref="GeneID:13386485"
                     /db_xref="InterPro:IPR019136"
                     /db_xref="UniProtKB/TrEMBL:E9BFC0"
                     /translation="MTAPHDSPATAGSEKPAMPAFRSYISVELPFAVTPTVTTSSAML
                     GGADHPSTSAHAGERREVEAFLPASFVVPCLHRATPQQTTSRGDAGAAHDSAEEPEGD
                     DEGDDDVPSSSSGGDSDESASRAFPPTVAKRTAVQTARGVRGQRTALRLLTRHHRHYC
                     TVPIFSGWRSTNWGSGSDEEDEEDRASGTGVGGDGCADAHDAAAAAHLQAQKRRRREV
                     FASTEPQLLVNGYYRNDLLLRVRQRRHIRRYRDPVTNAVLREEVDSAEEGQGGSAHGD
                     KDARGTARTSDLSAEVVGVVSREMELARPADFTFALFTPEQLQAAPSLCGADVFPPQH
                     FLSARAPFEVRYEPGRDPNTAVATVSATAAPRDDRLAGDANGGSAAAQYDFATLPTIS
                     ISAEESAVLPTRQAAHNSFLRSMGSSLDGGLDTDPPEVQMMVRLLAERPSWVVQDLQD
                     AMLQSGLCPRAYRNKQVMQCFTYLIRNGPFNRLRLRLGYDPYASASSVMYERITVRLL
                     RRSDVGVRLRDVSRSPHIESVLRLLLERDRVRRVEYKSLPGHARRQTLLEMQCRNIRR
                     GQLYVPFQLADVMDDPYMADVVRCVEPATAPMELARRGQRRGWLSEAAYSRAMAHYSE
                     ALAALLEEEVEPRLRKLQGEEDAEANATNADKAAESSTSSSKDEELEDDEDEDDSAMF
                     SVSAGDLSEAADDDE"
     gene            complement(<451752..>457061)
                     /locus_tag="LDBPK_211350"
                     /db_xref="GeneID:13386486"
     mRNA            complement(<451752..>457061)
                     /locus_tag="LDBPK_211350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860604.1"
                     /db_xref="GeneID:13386486"
     CDS             complement(451752..457061)
                     /locus_tag="LDBPK_211350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860652.1"
                     /db_xref="GeneID:13386486"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BFC1"
                     /translation="MHSTAAVPRVTHDTPVMTHSKTGTATRVHHLPSHPSDGDEVLSS
                     LCFLQRMASVFEQQGNYAECVKSVESALLLRQANTAAVGNALAERRRALKNRASQHRP
                     AKMRRGAPSTGDIDDDYVPLTDDGDVALPMNICLQAQEAVLRCNSYAVEALQHAQYDS
                     AAFFLNRAMFLTDGDEDAQQEASTTDGAVGGITSSSGGTVSGQWWWRAVLQSSAPQPE
                     SQPAVAIVDSIDLDELTNTQDEVKHDTAATAAAFRACFGPTPHDQQLRLSLRVVTLNH
                     LGCLEQRRGRPRAAVVFLRMAIQTQAQLDESRRVDGDAVAQALPKARRCHLSSNSSGT
                     EGTASTYLNLCTVLNELGQHAEAAQVCERVIPLLQQALLECSSAHTAATAEDEADLRT
                     QQQARTATMLAVALYSFGASLERRDAASANVNAQRWAFQEAIQVCHRYGLVPACCRTI
                     EQVMQALRHPGAATVPAEKGSCTAAPSAAAGMHGGEVRWAEEGSRSALPFTGSSAAKA
                     LASAKGRSGVDVAASRPLPPSMNPSSWEASSAVTPMADVLQFGAPTEHEAPLHCPPLQ
                     PVQTGPKRLSLPPTSSTAVHTASLPAPQQPPAPSAFLRPSGHGSPLPPQLPPLAASYP
                     GGQQNAWRAPPEAPAPRSPPSVLEPLTISDIKVAATAPPTLALRPSMVAPSTSAFPLT
                     QWRGLPLAVASGSASTTSMTSGPANPRTSIAASVPAALPRSSLRTSIAGLTTGAANVA
                     ARFTPNPPRGGRLQAAVSDRQRTLKNAKRQQSKFQKSLERRQQLETAVADAALAEKVF
                     QQLISEKSKTEVERCRRAAAQIQRIWRGVLARTWVATLIAAALRLQRVVRRFLVRVRV
                     QHAREAEERARQQAEELARQEVACRVLQARARQFLRRLQIRRTYRANQARHYYAARTI
                     QRGYRAFCERRAAFLAARAEANRRKDEQWQFRQKVAARRIQSSYLEYRMKRAELDEHR
                     ARQRRVRATVHIQAVVRGYLTRAWYAYYRVYRRDQEVRSAAMQSKLVMIQSACRAICS
                     AYYGQQRALHAFFAMREARQHRAATRLQSLWRCYVAKIRRARLQAEHDCLVRHAVRIQ
                     RWYRMRVLRRAFLVYKAEQQRIRAASRVQRWLRECWQAVKAREFAAYHAELLRQQQQK
                     RLQARAIGVLQACCTACLSDRLVASVRRMYQRHDTVVRVWQRVGRGFAARREMALERR
                     VAYWVAVKERETARRMAAVCVLQQAWRCAAAKDKVQRMRREVAAADVITRAYRVYRAR
                     VQLADLRRARQLHLEDAAARRIQRAFADFLHLQRAKETEAYYRGEHRKKMHRLRRQEA
                     AIMIQSVWRGHVTRKAVERDREELQAFSAAAVRIQRAWHSRRSRRQLSRELSQRIKER
                     ARDAEAALVVQCFWRKIMAGRRAAHQRVVTQQRLVAAVHVQMWWRVQLAQREFARRRI
                     LRREEAALELYYAMQWEAHVSLVNSFVRARQAQVLSRDRLRDCLVGQLTEAERHRFAN
                     RHAAATKIQALYRGHYERVYVRGLVAQAREEARRTAVLAARQQRAALAIQCAYRCARS
                     RQQLADLKQAELERVLVSHQEFAEKADPAEVVRELFWLNTTYQQREACNARRREAEQK
                     RAAAASIQRAYRCYKSRQQVSTAADLHQRERAARLLQDCWRHHRDVHRIKKRQRRQAA
                     ATRLQCHIRGWLVRRSWPLWRAAVEAERQEHVLLQDMLDRAAIIIQSFWRRVQAQRTA
                     ARRRKAHQERHCMLARQEAATVIQETFREHQCRRMERTLRGRL"
     gene            complement(<457858..>459690)
                     /locus_tag="LDBPK_211360"
                     /db_xref="GeneID:13386506"
     mRNA            complement(<457858..>459690)
                     /locus_tag="LDBPK_211360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860605.1"
                     /db_xref="GeneID:13386506"
     CDS             complement(457858..459690)
                     /locus_tag="LDBPK_211360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860653.1"
                     /db_xref="GeneID:13386506"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:E9BFC2"
                     /translation="MASHQSTYVRVAPSPRFKDSQTPASSELIQMRVQHMLPQTTQRA
                     KERVGNLKRLYAVPHALLLREHATAMAETLHRLRLVKAVRNIKVLGAGGSSNAVAGAL
                     CLPFHSCAALPAVPAVVSGDSGSSSTSSARVLTGSADGLLTLWDAKHCTPLRSQSTYA
                     DSHGWGRVKSIVVHPRQQGGASAASATSFAFTASMFQRVVRVWRVTLSCGDSDAPDKD
                     SGALLQPLTTASTTSAETVDSSSGGGVGGLQQLALDPTGALLAATHATGIVHVWDARA
                     VLEGTSSSAAASPVADTSPLTHLYAQDGYETAGATLGIAFHPDGSLLTTSDAGGRIVA
                     WDTRSGQLAFHTGGRVGGHLRAALCVAWSPCGVRVASGGGDGVVHLYDARKLSKAGLG
                     PHNDAGGGAAPFQLLGHDDAVTSLSFYANPLSSGGRGALSQVLPIGLVTTSLDHTVRI
                     WDADTGLCVRTLDAGMPLYAQCRPQLPPVSSRFASSTAIMVVGHSKNWLLYDVDTADE
                     VVVAGGSGITVTENDIVVSAHGSAEDMRFSVLTSYASRLTNDNEETDSGSSDDDDEMM
                     ALRKKPLPSQGLVKSAAASALQNGGHDDEDDSDEDEMEMLRKTK"
     gene            complement(<460389..>462278)
                     /locus_tag="LDBPK_211370"
                     /db_xref="GeneID:13386448"
     mRNA            complement(<460389..>462278)
                     /locus_tag="LDBPK_211370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860606.1"
                     /db_xref="GeneID:13386448"
     CDS             complement(460389..462278)
                     /locus_tag="LDBPK_211370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860654.1"
                     /db_xref="GeneID:13386448"
                     /db_xref="UniProtKB/TrEMBL:E9BFC3"
                     /translation="MFTRVGAFLEAIDKKTEELANAADEEDLARAAEQHQQQQRQHSS
                     SGVSRTTSLQQHPQPPLHPARGHDSGACHESRLGGLPRGRGNAAGSSSDDFQTAATPP
                     SAMISSAHLASDEAYAAGHVPLSLPTKLPSFRPSSQDPAMDGGKGGAAAGWKQHLTAS
                     AAANPFAGNSLVSSQGDAAIVSSAALGGGETPIHNASIAEAAVERLEARCKALEADKT
                     RWQQEAATHRAQCRAARDALWKAEQDTRASRAAQRAAEQALAVYKETSQRLLDEAQHE
                     LKQARDAAAGRSSATEPQQQTDASHDARELHQRLELLQADHASLNTEVERYRQEAAKA
                     TAELQHMQEKHRQAQMRVDMLQLEVGATRESLEGEVAAHADTRSALRRLQTQKDELVR
                     RGSSPSSSAAVAQGTGDACPAVDVGPLQRELNELKQRHQLLTLQASNLQAALDAAARE
                     ATDMKARYNELAKHVNDAEVEMAAGFRASAMYGDGNGRSSVFPAPPTASSMRGHRGSS
                     ADGNGLGGHSAAAGAPWAHYAGTAATTPESSGDARRRNPAMVRLARQYGIAGRAVVAV
                     VSSIDSFAMQVGRVLTQARWVWRVALMCYIGLLQVWVVLMIIGTLALEESAHVREPAK
                     VSEPL"
     gene            complement(<462983..>463894)
                     /locus_tag="LDBPK_211380"
                     /db_xref="GeneID:13386507"
     mRNA            complement(<462983..>463894)
                     /locus_tag="LDBPK_211380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860607.1"
                     /db_xref="GeneID:13386507"
     CDS             complement(462983..463894)
                     /locus_tag="LDBPK_211380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860655.1"
                     /db_xref="GeneID:13386507"
                     /db_xref="UniProtKB/TrEMBL:E9BFC4"
                     /translation="MKAIHGGGRIAATACVHVQVKGSLDIPLNLSLLADLGDPMVEQE
                     IIKEAVRIAVSERLGYFDGIEVHLSSSGGREGGRAAAAQKARQRDAQMQPQEEEATAS
                     SHSRDMENGCRDRYCEASVNLEDLGRCIESIQKAYEGLLMHAQLLHELLSTDTARAPS
                     GAADVAVTSTPQSQQPSGFDVQADAVKRLAAARQLVADMVADHRSGVVAEAAALQDGA
                     SPQRLASHETGMLADEHAETTAMIHARRYGKRPPHDDDADAGLRFGLLAGGDEDAEEQ
                     QRQQQAEDRESEEELRARYMELGYSPL"
     gene            complement(<464978..>470266)
                     /locus_tag="LDBPK_211390"
                     /db_xref="GeneID:13386508"
     mRNA            complement(<464978..>470266)
                     /locus_tag="LDBPK_211390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860608.1"
                     /db_xref="GeneID:13386508"
     CDS             complement(464978..470266)
                     /locus_tag="LDBPK_211390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860656.1"
                     /db_xref="GeneID:13386508"
                     /db_xref="UniProtKB/TrEMBL:E9BFC5"
                     /translation="MWRQGTTALQPLQQQQNSVDNAAVPVKSSSQQQLTSMPSTLSET
                     LHEFYRAHTQLEPHQHQQQQQPPNVLANIMLAKERLSASVARSHSCDRSVSEAPVETH
                     RDGKKGPHSRQGQAARPYPGKIRSTVAFSSEGERESSASQMRSASPPDSIATAAPPLC
                     PEVPVTATLDVDPAQPSALLQDRRRRNAEARVDSHDRAAAGRHPDPGVASVALPPSGT
                     RAGANAVLHKRPSPSPEAAADNERHPTSSGELADELQRTRQKLAEMQRLYSFEKRAHL
                     QQRTRQLREEAQRRQSDDDITERTAQLLTDYESLIQFRDTASRERLEGVLQRVTAEWK
                     RSAESLEQTRAACEDALLSRLRATLAEQQDALAKRLQQHLLSVAKSTVETERAQHAAI
                     AAAVQEQVESFKEEYRRVLEQDMAERQRLMDEQAAHREAQWRSFLKDEHARMVATGEV
                     AAREASRRQLETLHIAMRDITALREQLLHEHTRRQAQVGQEYLVAYESLASEYVASTE
                     ETAEYVQRLQHDYASIIHALHKEVSRVSAEKQEAVRQSEQCTLQVAEAVAQQLHFAEE
                     SVDSRWQARWTAEQEAHRAAVLRLMRLHEEALEKVRSTSAAKEAKLKEEHEREHAAWE
                     EHLTRQQEQQTAAVDDALRSAQATVRRLEREKEGLSVQVQQLKDQLRREELAHEAAVQ
                     DARQAEEARYTSQLNSLEAAYDAVLQQYKEKLKTVCNGNDGSGAGFTTAATAVKRVME
                     LEKELHEARAEHATRVQQAVEEAAALWSARLEECRQQQRAHCKAMEQQHRALRAALLE
                     EVQRREQALEENCVAERRAHQEELQDVIMREKEASQRALERLERQHAAAQRQVEAEAE
                     MRVRAGEDALAVREKQLEIAEAEWRRRRAEDKEASLQQLTAHVAAQHAKQLAELEEQE
                     AILRSKHAQLARQQAVMEQDIRRVVRGEMEMRLAEQLAAAEKDWMRLLETELLQRFTT
                     WQELRMQELACVQQLHSEEMRLHDERHAVQMAALQDAQQRHLSQEAEAMRAREAAWAA
                     ARTASLDAYSEAAAAKLQEVLAVEKAQWHTAQQQHAAERDASIETAAARVAEHFAIAE
                     ATRAQLEEKMRSSYLATLEQQQAKMSALLAEQRRRHEDAIAQVRASSAELAQQQAAQF
                     EKDREAREREHEAHVREVREALERQLAAQRSQHAAALAAERSVAQDGITRLQQQADAA
                     REAYENAASARMQDMRRLYEQQIAELQQRCDAQARQLSSIEAGSYLLEQRVRDEQEAT
                     LRAEYEASIAGLRNAIEERNRGYAELQASLYTRVQAEADRIHAGADERVACFMEQQQK
                     QLAELLLAHERALGEQQQRQQEELARLQVRHEVDLKAQACKLREEHEATEAALQSTWE
                     AQQESWQQLLEDERRDRRAADERATAAAADAAELRVSWEQQQAAAYRALDEQYRGLLE
                     QMQHDMQVEREELARRCLEEEERRFAAKMLQRQHAHRRPPEAQPQQKPSVSTHAFPAP
                     DTPILVTAPESRTPLDRRRSSGAATVTLSTPAAPCSATAQGSPLLISPAAPVELPAAH
                     HHHSHHHNHEQEPRADLVQRSKQRLRQLWDVLEVPSEDQRTFLNYADSLEQEAPAAVL
                     QDALLREQRRLEAQLPLLEALTRREYVQRQLRALANVRPLASLSINSKSDAKLKRWSA
                     EDSDYDTDDAVHVSVSATSPSFTGVLTDGKKSATTSAAVSPPAKTRGKAEGKQLEPLQ
                     LELQRLTEQLRRDITQHEKEYGQLFCVHGTRVMDTL"
     gene            complement(<477714..>481112)
                     /locus_tag="LDBPK_211400"
                     /db_xref="GeneID:13386449"
     mRNA            complement(<477714..>481112)
                     /locus_tag="LDBPK_211400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860609.1"
                     /db_xref="GeneID:13386449"
     CDS             complement(477714..481112)
                     /locus_tag="LDBPK_211400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860657.1"
                     /db_xref="GeneID:13386449"
                     /db_xref="UniProtKB/TrEMBL:E9BFC6"
                     /translation="MQTRARSGGTRPLPTATSAASETDSIRTGGSSDSNSPSHGLRRS
                     NLPAPLAPEALSSSLPVSQRLDGASSCPVNRAGRLAPDALRMPTLSPAASPLTVQGRS
                     PPPHQREAYQRRAHPGSGDKGGGKMSLPPPSTPTQAGSAPVDENGDGSGRRGHHNARS
                     SMNSGSSSSSRHERSSNALGLRTNEPAPSMPSMSSRLPAMMQPSKLSTSTTASSNVST
                     TNPPAQQQPASTATMPTVPTSSSRLASQPDVSLLTVTSPARRCCLVADSSDRSAETTP
                     VSTVQIPLPPRSLPQAPAPAQRPSSTVSATSASNSVTRGTAHQREAEARATAGDGSTS
                     KEAYLRDNPRVRALVNNMYQHVMTTQPEEPLWYLAHLRAGTVPQVPSTHLAPPATQRG
                     EARRTPGQQARTVPQPRQLSSRAHGSAHPPYSHTAEGASTSSASVSSELLRDSGSTCD
                     NDGGHTWAGPLQPTPQQPESAAFHGGDVDLTDSFDSGAVSSGVANRPASLTARSDVAA
                     AVRPLRTPPSAPTTSLQSRGGSSGVNAGGRVMPPSIAGTVMHTNASSNAILSGSASSK
                     HGSPQLLQRSGLVTNSLANSGFLSGVAVGSAGHQAGSSGALLQHASGSVSAFRSSGIA
                     APHLVPSFAGSVSGIERGEATPSDLSSLFSTNSVDLQEFIAEFRLAKEERYGGSVDHP
                     AITLDELACIIECNSFPCADAEVLLDLFDELQPCARYLAGVQNPTRSPPAVSATLKRN
                     SSPQLLHRGLGPRSMSPVSLFNGTVAATAAAESAATGKVRGVGATNSSAVAAMGNNGN
                     ATGPAWPPGRVQGAESCVAAAHPPTSVAAKGMSHSHERFADEAQCKGCVTISGRADSK
                     DGKVLVIGSRIADGAPFESSSEGGSYNPYSRCTSDAFTGASTLQRQQGVSQHPYSDSV
                     DGEEVPTVPFDTLLARMAYKIQGRYPSEAIRIAFCGMVVDEESAAAALESSGRSAGLG
                     VDCAALVANGRGLHGVVSTDSLTPSETTVMGSSSAGMATTGYGTLPSCTVPLSRCITE
                     GLFARLGMVDVTAGEVQRGLRSVGLPIGQDEQRVYECHLEDFARLVRAITAVSERGCS
                     ASPANPSLTSLRESYVQRGSSNNFAVCNNSSGGTVPAAPAPWKE"
     gene            complement(<485504..>486937)
                     /locus_tag="LDBPK_211410"
                     /db_xref="GeneID:13386450"
     mRNA            complement(<485504..>486937)
                     /locus_tag="LDBPK_211410"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003860610.1"
                     /db_xref="GeneID:13386450"
     CDS             complement(485504..486937)
                     /locus_tag="LDBPK_211410"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003860658.1"
                     /db_xref="GeneID:13386450"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BFC7"
                     /translation="MCTHASMALVAAVALVLVLPVSRARPVGMRSMSAYTEAQQLHTR
                     KFLDGFLQSMPNLHSIWAGDNFCAWKGVTCLRDGVSISATNWAQLAVSPGRLPEVSSA
                     DFDVSQVFVTSISVRANGRNLSGTLPASWGLLRNLRKVRLESNNLSGSLPPEWSGLRS
                     LRELYLSNNNLTGTLPASWGESMKSLAILNLNRNALAGTLPPEWGRMRSMQTLVLESN
                     RLSGTLPADWRFMRAASTLMIGRNDLSGTLPHEWAEMSMMEWMDLHSNRLTGWLPAAW
                     ATMTFLNTLLLFDNSFTGTLPAEWARLEFLEELRMQDNVLVGTLPASWSAMEFMQVLD
                     ISENTLSGTLPVLWSSMQSLDTLSIRGNQLSGSLPIEWRTLPNIMYLHLEGNALCGCL
                     PLNWTSRYVAVTVDEAVMSVNCAIENACNDVNIDSISDKISSSCSSSTGPNGAVDGSD
                     ATFSSWDASASSASNDPLSHSTGGASS"
     gene            complement(<488171..>488968)
                     /locus_tag="LDBPK_211420"
                     /db_xref="GeneID:13386509"
     mRNA            complement(<488171..>488968)
                     /locus_tag="LDBPK_211420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860611.1"
                     /db_xref="GeneID:13386509"
     CDS             complement(488171..488968)
                     /locus_tag="LDBPK_211420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860659.1"
                     /db_xref="GeneID:13386509"
                     /db_xref="GOA:E9BFC8"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:E9BFC8"
                     /translation="MPQDKRLIVTKAVLYKLQRICAKDGNGGSSSSGGADEEGIYLEF
                     ILPPVITAQCPRLVCEHRFHLPHRVYAANGRTTCLIVPKVISHDCGKINKRHGYYDAV
                     VTAEAICKRGDAEATKRALRVAATFSHFVVDARIQSKLPHAITDAVKASLPSSAAAAN
                     AAPSSAVRCPRKMITPLDGLGERETLGFRLSQGTTAGLVELHKQGQLLFRVGHGVMTA
                     GAVCENAKTFVVSLKKEFPTVWRYIQEFSLVSNRTERIRFMEVHIAK"
     gene            complement(<489860..>492220)
                     /locus_tag="LDBPK_211430"
                     /db_xref="GeneID:13386510"
     mRNA            complement(<489860..>492220)
                     /locus_tag="LDBPK_211430"
                     /product="PIF1 helicase-like protein, putative"
                     /transcript_id="XM_003860612.1"
                     /db_xref="GeneID:13386510"
     CDS             complement(489860..492220)
                     /locus_tag="LDBPK_211430"
                     /codon_start=1
                     /product="PIF1 helicase-like protein, putative"
                     /protein_id="XP_003860660.1"
                     /db_xref="GeneID:13386510"
                     /db_xref="GOA:E9BFC9"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BFC9"
                     /translation="MAAVAMRAPKPKMTMSAVQGRISVFAEDGERIGQWGGTECFLSR
                     QSGLGPCLVVRSSRHKKHEGTFFQLVRLQRVVSTGVAQGRLTVMVPHEKRQCSVFIDT
                     TEDLDELRMMAGVLQDKARWKDMERNVASRSRKDLQRGGKGGGGDRGSRGLRDPGLAQ
                     LSGSCVDNDDDYDTSGEETSKSHHDNGTAAVSAAQEDPFAAHSMVESPTPMTSSQSSV
                     PQRSTMVAGGSSSRSSGPTTSLTAAQQQRLNWTSEQQRAVQLVRAGHNVFVSGAAGTG
                     KTEWLLHVLQHVLPRTRQHRGAKGKADLGAEDEEQEHAVETGRVAVTAATGIAARLIG
                     GKTVHAFSGIGRGEGDPDAILQRVQSKPDVVRAWQRCEVLVIDEISMLSSHTFALLDR
                     VARVLRAPLAPPASSSQRRQRTSNAALPFGGIQLLVVGDFLQLPPVSRGAGEEVQPAF
                     MAAVWRACAFQQLVFTKDYRHAEDPRFAECCAAVRRGECTLLVRQVLEACLGRKLEER
                     FGVEATTLLARRNDVDRYNAQRLQQLESMQFQRYASEDYAAVPGTDIDAEVSLPSVLT
                     LKVGAQVVLLASLPNEPSLANGDLGLVGGFVAQAHGPALPLVRFSTGVEAVVPAITME
                     VHGRDGRLSLSRRQVPLQLAWALTVHRVQGMTLPMVRLALDKSFFEVGQAYVALSRVR
                     KAEDLSLTALDLDVVAACVSAEARDFYGLGTVTSAPSSQPVTTRTGSSPPLESALSRE
                     RDTACAKGSLLTDGVFGSGVPFSLADIEGGGSRVTATRKRAKTEEG"
     gene            complement(<493592..>494473)
                     /locus_tag="LDBPK_211440"
                     /db_xref="GeneID:13386511"
     mRNA            complement(<493592..>494473)
                     /locus_tag="LDBPK_211440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860613.1"
                     /db_xref="GeneID:13386511"
     CDS             complement(493592..494473)
                     /locus_tag="LDBPK_211440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860661.1"
                     /db_xref="GeneID:13386511"
                     /db_xref="UniProtKB/TrEMBL:E9BFD0"
                     /translation="MSLIGGASHARLTAVRPLLVNVCRAPSGVSACVTFCIFAPHHWQ
                     HRAFRSVPTTACLLETKKKRVSRATKQKPTKATSAALPFYKSHSVRPVAATTSKEGGA
                     APPAAASSSTTASTASSLPDANIAALAPVPAPSPPAAAHDAERPRRSYAPTSAAISEQ
                     LASLRRELLETRLQLAKAEETYSGLYEGVLARLAETDRAAHLTASSLRYTGMALRAAH
                     DNLEVELRRLLTIGLTAEEVDAAAIEAGARQYVRQNIGYHTEHVAAEPPAVPDMARVM
                     EKNEHRAAMSNFGKLPQ"
     gene            complement(<496251..>497105)
                     /locus_tag="LDBPK_211450"
                     /db_xref="GeneID:13386512"
     mRNA            complement(<496251..>497105)
                     /locus_tag="LDBPK_211450"
                     /product="thymidine kinase, putative"
                     /transcript_id="XM_003860614.1"
                     /db_xref="GeneID:13386512"
     CDS             complement(496251..497105)
                     /locus_tag="LDBPK_211450"
                     /codon_start=1
                     /product="thymidine kinase, putative"
                     /protein_id="XP_003860662.1"
                     /db_xref="GeneID:13386512"
                     /db_xref="GOA:E9BFD1"
                     /db_xref="InterPro:IPR001267"
                     /db_xref="InterPro:IPR020633"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BFD1"
                     /translation="MFRGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDT
                     RYDEHNVASHDQLMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVNFCNTAADA
                     GKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQ
                     ELIGGADMYIATCRECYSKQQLPSIEEMRTQQMAIKEVEKRYLGMSDKRATAGPQTPE
                     KPAGGWGTKTGVATLPTMATEGAASSGASAGMKSGRDLCEVQTFTTEAPKYQRVEPAC
                     TASAASSE"
     gene            complement(<498536..>502654)
                     /locus_tag="LDBPK_211460"
                     /db_xref="GeneID:13386513"
     mRNA            complement(<498536..>502654)
                     /locus_tag="LDBPK_211460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860615.1"
                     /db_xref="GeneID:13386513"
     CDS             complement(498536..502654)
                     /locus_tag="LDBPK_211460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860663.1"
                     /db_xref="GeneID:13386513"
                     /db_xref="UniProtKB/TrEMBL:E9BFD2"
                     /translation="MEEDNETLVKFYEAHTSDIAALRVLTQERKYKDIVFAAMEAKTA
                     STDAFLKELIDLTGTGRGLRVRRDANSVKCSAAKSSAALTSAPVVTMDEVRDAVQRQR
                     HALEAARRNEEKQTLVIRALEEEVASLKLKGRSTSARSLAQKRGSTKPDDVTADEDCC
                     LPGTAKELRDAQRRIRGLERQLSSAMCDAKDAAAAVASLQQQCTVHLQSLQCRDGELT
                     AMRSVLDSKEQLITALEEEVRKQRSAAEAQQKQQQRTSQPGAPYARTNSAPAATHHNR
                     SGDEASSDRLIVTHHYRLFGGQTFVDGNSFSPKSFKDAFLRSVSTLLQVPYGYLTSVE
                     VRTHSEAVSVEFDVRHSARIKEDEIDFFLLSHDYPELTRFLDKAKAELATRKPLDRNA
                     VRVKELEAALAERADEVDHLRRTIRSLEASLDRRDSDRAVLDTDVDAALRETEMTVKE
                     VYEALQATQQEAQGLQKALTTQSAQLRLSERAKAAATAAAEKLKTELATLQEQLATAQ
                     ASVEQAREEAAQKALQRHTDEKAELLMSTFRLDVALPTALAQRTANRLLEEAQQARVL
                     QALLLCHAARTAGAVPVAVKKCSLGDGATTMAAAVALAFYASKKNAEAVEAEIAKKLS
                     EDSGSAVLEYLRMCSDSCKREAAILADAQRAVSEAEQRAAAAIAAMQGETQQAQNTQR
                     AVTARQLQEIHARLSSVLPGGSAEAKSVLERIEQLVSRLTEAESTARCLEEESRRATQ
                     RLVEAQQEREQLQQTLSDLTARCTEMQVAKEQLAVRAARAESQLRNQQLSAGESEGVL
                     VKKVKLLEEALRAKTAAADFEKDRMLEEHRAAATLAEGQLAEVEEALAIKEAALAQLQ
                     SKTASPGSGAAASASTEEAALREALRLAKQERAALARQVREMDTDMNDLSNIQASMQR
                     ELEVAQQELRAKKHDFDLLVKQLIRMEEREKKWASEHSASPKKQDEDAELDDVARESL
                     VVLTNSNATLQQCLHRLHSALTSMGMEVSLASSNAADSAGTVAGAAHGRGGERDSGRV
                     GDEITGVRRSGHRKSALGATVSRAAIDHQKLSAQVADLLLPVLEVLKISASSRTASGG
                     CRPRGAAAAAATAPADAATTHLAVATQRRIVKHSPSSAPLFRTASTPAAIGAENIGHP
                     FNGSFTIVRDAAIASNGNTPKRGAASDAAVSAAVTGSGGKASMVDEAPRLDFHRQASL
                     RTYIRSNTATSAPMNAGGTALPPASAAAAAAATTDSSASSGASVNSSGAATRVSGDER
                     KEEKGKERLPRGASGGGGAAAAGGASDNASLASAQVSTRRNAAPTAIAKANLLRRMNT
                     TATTTTSGGRGSGSAMGTSLGRTACGYRRVPTVTDSSGSSASLTRRARPTHM"
     gene            complement(<506389..>508194)
                     /locus_tag="LDBPK_211470"
                     /db_xref="GeneID:13386451"
     mRNA            complement(<506389..>508194)
                     /locus_tag="LDBPK_211470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860616.1"
                     /db_xref="GeneID:13386451"
     CDS             complement(506389..508194)
                     /locus_tag="LDBPK_211470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860664.1"
                     /db_xref="GeneID:13386451"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BFD3"
                     /translation="MRTPGQPVPRKSCGGKRKSASSVRHSNANGVDDAPANMCTLSHR
                     SALTICDSVSVSRRFGGQSRCSAVAVDGTAWTGETDGTIAIRLVPSGMEVRRIAPIGR
                     AAVLVMQNVSGNMWAGYSDGAIRVFDHVTQKVLRQSTQHTAAVYAMCAADGYVFTGGA
                     DGKVYQWMAEDLHYSHMYYGHRNAVRSLTTYTDQKSRCRYVVSGSDDGTVKVWEATVA
                     KTSGTPRKDGGCVSTLDGQGRCVLSILVLEDTAELWAGSEDSAIRVWDLSSMTVTTVI
                     TGHRAPVVTLLKVGDTVWSGSKDGAITITNRFSKDIVHQASQPPARRSAAAGGKRSSV
                     SILPVTRTVVYEVWVTAVDGSWQCWNFTVPEGVKSCIEEADVLKGGRCPSHSRPQRLS
                     RVNQCRSRNVRSGSVSAYSENGSDSASARAHSSDEKLRASVAQTRRTVAALLAGSKVH
                     HGLGAHNGNGFAHRSEAVSVGIVDDDDTPLDIVAESIRNDHTAETQREVQLKQAALAK
                     ERRKSAELRAALEMMCKDPVAIAEEGAEKVFRRTDSLVIADAQAETIAMERQSGMLGS
                     PTTEKLVWVSSQLELVKAQNEAMAAAMTEFKKAPV"
     gene            complement(<510162..>513950)
                     /locus_tag="LDBPK_211480"
                     /db_xref="GeneID:13386452"
     mRNA            complement(<510162..>513950)
                     /locus_tag="LDBPK_211480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860617.1"
                     /db_xref="GeneID:13386452"
     CDS             complement(510162..513950)
                     /locus_tag="LDBPK_211480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860665.1"
                     /db_xref="GeneID:13386452"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BFD4"
                     /translation="MIYRSTPRAESPSHQQLYKAHTESTPRCTSSVTPTRNSFSLSMI
                     PRAQSPHSSSRLMSTSANGVRSKSRRLEDTVYVADVNPTYSVAAAVRCIAPVNDRVMW
                     TAEYSGTLCIRSLPKGTPLKELPGREGSYCISLLYLPSEDVVWAGFQDGYLHVYSAKN
                     TDLLKEMMAHGGGLNCMIEVEGSVFTGGGNWKLCQWDPTDCNAQLQRSLHGHSGGVRC
                     LVLYNGPTGAVIFSGSDDGTVRAWDPYESLPGQENTEANIHTFTGHSRAVLALAVVPH
                     ASQLWSAGEDLTLRVWDMRSLSCLAVCRGNHTAPISNLMVVESRVWSADKHGHILIWD
                     IATRSLLQDLSERVPYYGLEKGMVLAMQKVQPTTAYKVWTASSNGVLQCWNAETVPII
                     FDDVPVFGSVFKAPSAGPAAPQVITAGIGRSASATPAVGTSADVVCSSAVTLASSNNY
                     RDTLSSSHSKDNLPVSAPTTQVQEYIRSLQDELEATKRDAKLNYEKYRMEAQCEIETQ
                     QLLAQENDRLRGLVQELEKRAGEPPEGLDAPVQVPQGAASHHMMEEEVARLQSVLIDT
                     QRQLDEALERQLELEAELDRYKPASSSLHMSSMAISPKSAAPDPYRQFMRQDGMAKLP
                     STVDDACSDSHFSSVSPSGPVNTSTNPLNAFLFMSCQDDGESASHAGVPVEHTRLSRR
                     FKGGNWSYIMEEKPHELRSTFIADFCAGVGVAPTQLERVDLSLGSLVAEVEVVHPANV
                     PSAELERRMQTYRFPALMRLHTDAFTAAKTPPDTAVATINDLQRQLAMAQEQRRVQPS
                     PEPQQPSSNDNSCHSEGRISASEWQRLKDQNNTLRDTLQRQIKLINDLKNESAEKDVK
                     LADARAHLQDAEKRLQEAQEQQQDRTPRASRQRALNSTGAYTENYGRDPPHVDGTARK
                     EASEFERMGELVAVPLAQEMVAAAGRARLPPTAVGAGDDEDHEALKRYLHEQLKPMVS
                     RLKREQGELQLDNGNMKKRIEELTAQVQQQQKQLESERQKKAPVSPVVASEASDEEVQ
                     KLREDHEALNNYLHEQLKPTISRLKREKGELQLDLSRSREDLQRACDMYDGAAAALEE
                     EHVREEKMGEAMEALRKALEAEQLKNQTSREEAAAAAASNDSHAASSATCQGFEILTG
                     RPTQPTQLRSCGGSAEPRKEDAEKDPLDKLVALNLDLSVRLADAETVIAQLQNSLACS
                     SSQMAEQRDETRRLLSKIQQYQQSGTRSPDSSGAGRCSSIDNVVSSASPSKSPSQNRQ
                     "
     gene            complement(<517120..>517929)
                     /locus_tag="LDBPK_211490"
                     /db_xref="GeneID:13386514"
     mRNA            complement(<517120..>517929)
                     /locus_tag="LDBPK_211490"
                     /product="adenylate kinase, putative"
                     /transcript_id="XM_003860618.1"
                     /db_xref="GeneID:13386514"
     CDS             complement(517120..517929)
                     /locus_tag="LDBPK_211490"
                     /codon_start=1
                     /product="adenylate kinase, putative"
                     /protein_id="XP_003860666.1"
                     /db_xref="GeneID:13386514"
                     /db_xref="GOA:E9BFD5"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BFD5"
                     /translation="MSSNDGLSEDTVTYIKDNNIGQLMEYILRCIIADKPTKPLQYVH
                     ELTASPLPPRVALAGPPASGKGTQARHICSYYKRTIGKKPVHVSSGDLLRAEVAQGTH
                     LGKIAENFMRRGELVPDSLIISIIRNRLTQEDAVMNGWLLDGFPRTRSQAIALDAAGL
                     CPRIFVVLDTPDDVLFGRVEGRRTDPVTGIIYHLTYNPPPENDTVLLERLQHRDDDTR
                     EVLGPRLETYHSMVEGLLDYYGSIMYHVDGNRPEAAITKDITEYLQNHDVA"
     gene            complement(<519572..>521068)
                     /locus_tag="LDBPK_211500"
                     /db_xref="GeneID:13386515"
     mRNA            complement(<519572..>521068)
                     /locus_tag="LDBPK_211500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860619.1"
                     /db_xref="GeneID:13386515"
     CDS             complement(519572..521068)
                     /locus_tag="LDBPK_211500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860667.1"
                     /db_xref="GeneID:13386515"
                     /db_xref="UniProtKB/TrEMBL:E9BFD6"
                     /translation="MSSTLVAVYEQACSDAAVLPNSALARCFAAAEQAMPLRVLSLST
                     NLIGPRGLVALLPVLRECRHTLHTLDLSHNSLGNATIRQLVLCFSNGGFSALRRLELR
                     GNLLTYQGGKCLVHWCEGLRTVRQTHGTRLPGVGEVEGRSADSLASAAPSGAPASPLC
                     CPEYWCDAADVHIDYIGIEDTAMPEMLQRALLQRITDAMARREARRLGHSSQRRSLSC
                     VVTRESGPVADTSGAADSPRQFSADAESVKVPVLDGPPITGTAHPFARSPADFFMDDN
                     GEPQHSDGMKVDAAVGFEAVAVTEARETDVPCFLQDDIGVDVLQKPAHDYASADDSVS
                     GGAEELKDVRDGNGYHSDNSPAAGVAGTLLSVNACTDQRSLGMHWRSGSVAETLPFPD
                     HPMKEGSGADARCAVSCLRSTASPPMSPTSADGFALYAAEPSEAAAAQQQQQQEEVER
                     YPPPPLKTASNILDELGLEAVAETAGGGGGGGGMEEDVDAVPMWLEEL"
     gene            complement(<522817..>525324)
                     /locus_tag="LDBPK_211510"
                     /db_xref="GeneID:13386516"
     mRNA            complement(<522817..>525324)
                     /locus_tag="LDBPK_211510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860620.1"
                     /db_xref="GeneID:13386516"
     CDS             complement(522817..525324)
                     /locus_tag="LDBPK_211510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860668.1"
                     /db_xref="GeneID:13386516"
                     /db_xref="UniProtKB/TrEMBL:E9BFD7"
                     /translation="MAYGGPAPVNPHLAALAKDVHRITGDISGPFRKGEYTIVLQQFD
                     MLMATSAVEEVAVTAVECREEMRELDLLGRSLNVLGPDFLTWRLTTPQGRAIGVNGNY
                     SLPKPSTVSDDTYQLYLLEQRIEDAWGQVLLASIRQMPDEQEHHEEIVNDFERFFERC
                     SDYLRAMLQDTMSAVHLLDVTVMDTSELSTQYVVCAALMKHPPPDVAALVKFIEYLKQ
                     RSIPLSLAAAEQLERIYLRFMKGKAAADVFESVTAAGVIPLSVRPFAMLFNNLTDANA
                     VLDAYDLMLDYSIAPEESTLRILCKQSRMEYAKLHFTTVLKNMANATSATQSQSPSPP
                     PPRSPLASGGAGAAAAHTSAAASASTASTASRRRDERSYFAQRIEELAERKPKASLLE
                     ALKVLHRAEVEGTSLQGDTYIMSALLRHYCRSTTPRHYLVLPFSESLAYRPGPVSDGA
                     LPASDVEAGGNSKVHPAANAFDFGHDPANEELLEGEGKSAVNEELEGLSGAPTRSRGG
                     EPEAEKGRRPRPRPRDPYFADSSEEGTYILEVLKSYGSYPDNSVLQALSAQYEGQVPH
                     MEIVASAADAFFEGCMASHGAMSPVDCRFLHALGYYYIDNRWRDRAHLLVRRVLEMFY
                     AYHVTFHADLGGTEKWFSYFAVIVGTKTGPLDLGIGLFAASLALSDKTVNPKVATKLT
                     AKRDSSEHVIEVIAELEKCGWDYHRILCCDALMLEPQERASAGNNESSAGANGAGSRD
                     HHHGRGANGSRAAGAVASSAVAAGEEHLGKESIYTSAGQGPSSYNNSHLLSARPSLVT
                     YMYVALRDLGVDKKTADWLRDKLKAARQEALASKRTR"
     gene            complement(<529222..>530553)
                     /locus_tag="LDBPK_211520"
                     /db_xref="GeneID:13386517"
     mRNA            complement(<529222..>530553)
                     /locus_tag="LDBPK_211520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860621.1"
                     /db_xref="GeneID:13386517"
     CDS             complement(529222..530553)
                     /locus_tag="LDBPK_211520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860669.1"
                     /db_xref="GeneID:13386517"
                     /db_xref="UniProtKB/TrEMBL:E9BFD8"
                     /translation="MDVSSKPSAAASSTAPQGRPKPRALALQRSGSGALGSGPTQRGE
                     SRVSGTAVIHGALSRQPAHPERNGQRHTSSGTSLSIAANDAAAACSAPALPGTGCPSS
                     SAQQHAASIDLPYALHDMDEHFFTDMQNWKTEEELPGLVWSLLEGVTLEAPYTSHLWA
                     QAYVNPADLLPAPKAKASALPDMFVHRESQQRTNGFYACVRCGTPVCEPSHQVIPASC
                     SLRGIAVFDALHMNGVELRVCTPTVKDVAPPQSRERRSSSPIFAAAKSHGRVGGAAEL
                     DVVAGGLRFLVHCRHCNGCLGVMRLDEAMAPAAAPATALFCANSACLEYVPYRTRARL
                     DQPIMTDMGADPEAGSSDRGDGAASMFGRASVAEHAQSRATLGSLFGPPHGAVAWGVE
                     GAIDADFREKQGIISYAGDSTGLDASFDALLEDLNPCADPTPMSSSVGSDG"
     gene            complement(<532827..>533600)
                     /locus_tag="LDBPK_211530"
                     /db_xref="GeneID:13386518"
     mRNA            complement(<532827..>533600)
                     /locus_tag="LDBPK_211530"
                     /product="vesicule-associated membrane protein, putative"
                     /transcript_id="XM_003860622.1"
                     /db_xref="GeneID:13386518"
     CDS             complement(532827..533600)
                     /locus_tag="LDBPK_211530"
                     /codon_start=1
                     /product="vesicule-associated membrane protein, putative"
                     /protein_id="XP_003860670.1"
                     /db_xref="GeneID:13386518"
                     /db_xref="GOA:E9BFD9"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="UniProtKB/TrEMBL:E9BFD9"
                     /translation="MASNVNEESHALYGAVVVRLVDRVMLCKTPNVPTDGFTIPGTAW
                     ADLVSRCSAPHFRTSAFLNVTADKDPKQEVTLSYHLMTDDAFGYGIIGAKAVSRRDGH
                     AALDELAALFKKMFVEPPSTLNPKLADVFVRPARDLLMKHSSGAAAGSAENKVTKVKL
                     AVDEVKNMALDNVERVIQRGQRIDDIVQATDDLQFQAEGFQRSSRDLRNQMWWSSMKG
                     RIMLAGAVGFMLLLVYFTFFAGNGSKKTVTTQAPSSAPK"
     gene            complement(<534646..>535476)
                     /locus_tag="LDBPK_211540"
                     /db_xref="GeneID:13386519"
     mRNA            complement(<534646..>535476)
                     /locus_tag="LDBPK_211540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860623.1"
                     /db_xref="GeneID:13386519"
     CDS             complement(534646..535476)
                     /locus_tag="LDBPK_211540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860671.1"
                     /db_xref="GeneID:13386519"
                     /db_xref="GOA:E9BFE0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BFE0"
                     /translation="MFPSGFPSSAAGSGNNTAGATAPHMHVHTVVINVGDTDGTAVGG
                     NAGVADVFSGVPATVSAVMTAAMDLSDLPGLIDLLSDTTPASTAAREWHAESCPPFSP
                     EEVISTFDVVQPPLSSPVTATASTSRRETDGADTAASPSPPAPEAKECAICLEPLFRT
                     SVVRSAPESGESMPNSAPPLSELSTADREKPATASQSPPLQSQAPSSPPSVPPPDAAA
                     SSDATRPLAHDDTAEAAKDAKTVREVYCGHRFHESCILRWITLGHYSCPLCRSPFVFE
                     "
     gap             536458..536556
                     /estimated_length=99
     gene            complement(<537730..>539481)
                     /locus_tag="LDBPK_211550"
                     /db_xref="GeneID:13386453"
     mRNA            complement(<537730..>539481)
                     /locus_tag="LDBPK_211550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860624.1"
                     /db_xref="GeneID:13386453"
     CDS             complement(537730..539481)
                     /locus_tag="LDBPK_211550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860672.1"
                     /db_xref="GeneID:13386453"
                     /db_xref="GOA:E9BFE1"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:E9BFE1"
                     /translation="MQQLFNSQPKEKQEQMMRQAMEMQKIMSKIPGFGKLAQNNTKVL
                     EQLMKMQQQAPPPPSPSTTTTPANAAPASASSTGAAASAASCPRRDLFSSAAALSSKR
                     LNGSGSSGGPSLDELRKVNLGPEIEALFQELRTIRSRKNEYRDKYYQVQSTLEALQRE
                     HKDLTTREASLRSKLAKVEQEVMLLTSENMDLRDSSKSVRQLTQSNSQLKAEVEQLKT
                     AAQLSTAPGTTTYVALQQLLQEREDALRSLQRKLDRMRRRDPLLQFSLACSNVSRLCA
                     SAKGEDVGSAGAAAVATEASQEAAEKAFAELQAKYQDRQQAAWEAAAHDHAAAAAAYV
                     AVVRRYVMSNVPHSNYDAVVTFTGDAAALRTYFSSVGFELEMVAGERGRAHVTAASDA
                     LPFSSAPGPFGYAFAVSLARGTARAESGGTGAVTPASAFTVTSAHPFVSAALVRNAKR
                     CSVAYETARASGPGGQATNVTETQVYAKLAIDGAPAYTAEAQDSRSALSNKEAALDKL
                     QQQRRLQFNDTLAKQEKAELVQAQLVTKMQGQGGFALEEDVHVLVQEAATAKLVSAGD
                     AALVQMLKQLGALAAAA"
     gene            complement(<540807..>541883)
                     /locus_tag="LDBPK_211560"
                     /db_xref="GeneID:13386454"
     mRNA            complement(<540807..>541883)
                     /locus_tag="LDBPK_211560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860625.1"
                     /db_xref="GeneID:13386454"
     CDS             complement(540807..541883)
                     /locus_tag="LDBPK_211560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860673.1"
                     /db_xref="GeneID:13386454"
                     /db_xref="UniProtKB/TrEMBL:E9BFE2"
                     /translation="MRCVRALLHGKLSYPVGTGRLALGTELLPLFPSNDIFYDPPKLR
                     YRLDQDGYLYFKNTVPRDVVNAALDDLATQMRECGLTLDEDRARQAELHGFAMGVPYP
                     STSGGELPPPNIHHTDTIRNAVSGTSVMATVRQVFGGAVQATALQTLHLGAPGESFGF
                     RMPSVFLNRGTKLALVAIVPLHDTPLHMGTPLLVRSSNSHDTYAQLRKTYGQWEVEGD
                     SIRGDGCYTENPAELSPFGKLPGTDDTTGASIIVDVNPFVSSALEAGDVLLTTVYTMQ
                     SFLTNQTNCWRLMAEAVWCMDGDDVGLDPRYMGSAAPGLAAWTERRDDPTVYPKSLME
                     AKKEWGLVPDLAAVTMDESKTSST"
     gene            complement(<542531..>543016)
                     /locus_tag="LDBPK_211570"
                     /db_xref="GeneID:13386455"
     mRNA            complement(<542531..>543016)
                     /locus_tag="LDBPK_211570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860626.1"
                     /db_xref="GeneID:13386455"
     CDS             complement(542531..543016)
                     /locus_tag="LDBPK_211570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860674.1"
                     /db_xref="GeneID:13386455"
                     /db_xref="UniProtKB/TrEMBL:E9BFE3"
                     /translation="MRLPRCTFLRRQSSCGGCRARPRTCVSSMPLFVLAAMLTVCMAG
                     SLFAVVHAKDCVTRGPNSMIAWKYEGGSFQCDNCIGAHAVGVNSGTVRRRWTEYDKDR
                     NILNSFVEEHREGKKLVLHDESRGMSILLRSDLSGIRTEGEQTFRQLYSGAFISVVDC
                     T"
     gap             543903..544001
                     /estimated_length=99
     gap             544635..544733
                     /estimated_length=99
     gene            complement(<545273..>550075)
                     /locus_tag="LDBPK_211580"
                     /db_xref="GeneID:13386520"
     mRNA            complement(<545273..>550075)
                     /locus_tag="LDBPK_211580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860627.1"
                     /db_xref="GeneID:13386520"
     CDS             complement(545273..550075)
                     /locus_tag="LDBPK_211580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860675.1"
                     /db_xref="GeneID:13386520"
                     /db_xref="GOA:E9BFE4"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BFE4"
                     /translation="MPPRRRSARKAGSAATKRHADGAPVRVKKELRDEEAEAADDVHA
                     EEKHVAMVTEQSHREEECRQAEDRLEDAGEVNGEAAPGSREGSQEAREDEAAQREERH
                     GAQDGGERDGSTSSSSSSSSSAARLSTYTPPRLPSTRTSGTELELIQPAMTTTHPSPQ
                     ASARCDSDAGDLTPHSRLVIRDIDVENFKSYYGTHRIGPFHKTFTAVIGPNGSGKSNV
                     IDSMLFVFGRNAKKIRLEKLAEVIHNSAAHPRLFYASVTVNFIRLLETAAEEKDSEQR
                     QEVAGSGLSIKREVFRTGASQYYIDGVRRTQKEVMECLISQGVDLDHNRFLILQGEVE
                     QIALMKPKAEKEGEEGLLEYLDDLIGTGQFVGRISDMTAAAETAQLARLEALDKERKL
                     KAEREALDEAKNSTLSFVTKDNQLQKTLIVMCQLRMRGIEERLEEPRRLLTEIDERIR
                     SMEEEVVHRREEKAQAEEAFATAKKHVAEAQRVRDAVRARRQSAEAHLEQVKSGADQE
                     EKARKKVADQLRKAKEELQRAVVHQQDAEREAAIHQQNHNEAVEAVATLQLEHDTLAE
                     ELLPRLRPLRQQLEEKKKHRAPYERAVTEAKEQLRTVQSRLGGLADSAAKKEQQVNDL
                     AALMARNTARVAELERLLRDSDRKDLQEEVLRVQDQIGESARRKYAINNSIQELKNAY
                     RDGEADDRAMEFLLAQRSLKGYYGTLRQLGRIDDQYDIAAGVASSAWGFHVVEDRQTA
                     TEALMLLKQNNIGRATMMVVSEVEREVGSRMAKPFQCPNPKARRLFDLIQPTNPKFRS
                     VFYQAVRDTLVVETLTEARETAFGGGGGGGGRDAMATGTPSLSTGGAASQQRHRVVTV
                     KGELVEPSGTITGGGAAPRGAKLKAARSPQDKQSIKEELQRLQQDLVQAAEEERALNV
                     RLHQLHEQESHVYPEQRRKLRHELTTLVAKADADAARLASLHSELAQSTQELEVNRER
                     HEQAVRDCETALQKAEKAYITHHADVEALEAQVDEAGGARFKAVAASLTAQQERADAE
                     EASLRACRRQAQKHRATQERKAADIADYEQQLEKLKEEAQDNVEAQVRACVEVLEGLL
                     RELNGAEAQLAKAQTAAEDARAAVPVANGAALNAQKKLDDEQRYRQTEAAKIADALQE
                     LSKFQQKIEGCEEKIRENVELYGKETLGQGDAEDEEGQTAEVDDEDGDDDDEDDGEDE
                     SKPVHGQKRARARPGRRGDDAALHASSARGSSALVSSPPAKRAHVERRHATFRLTPEE
                     LDGCDYDRSVHLAKALSEETKRLHSEIDFRAVALWRERDVAHREAKAIYEAKKLLSDE
                     AERELQTLKDTRRQAFMHTFEHIRQRLKEVYQLLTHGGDADMELVDVNDPFEGINFVV
                     RPPKKSWKQISNLSGGEKTLSSLALIFSLHHIKPTPIYVMDEIDAALDFRNVSIVANY
                     VLRQARGAQFIIISLRNNMFEEAHQLVGVCKVNDTTSTLVLMPRSFRRLVGIQLAEAA
                     SEQRRKRSERRHSRHQLGEAGVAGNADGGDVDVHARSPRTSVAHQSHTPSSGARPTVG
                     DASPMSTSTWPRSSGDIDGTRDSRKSVRFAGLSSVAAVAADDNAYAVP"
     gene            complement(<553370..>554821)
                     /locus_tag="LDBPK_211590"
                     /db_xref="GeneID:13386521"
     mRNA            complement(<553370..>554821)
                     /locus_tag="LDBPK_211590"
                     /product="ATP synthase, putative"
                     /transcript_id="XM_003860628.1"
                     /db_xref="GeneID:13386521"
     CDS             complement(553370..554821)
                     /locus_tag="LDBPK_211590"
                     /codon_start=1
                     /product="ATP synthase, putative"
                     /protein_id="XP_003860676.1"
                     /db_xref="GeneID:13386521"
                     /db_xref="GOA:E9BFE5"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BFE5"
                     /translation="MPALSADAADTISLVRQLQLLDDNTIRLLEQLFTNRLNGELVTS
                     LVDGREESLAVALFRLCAGTHAEHILGYSLRFLADLVYADRKIGAQLGRGDLVKEFGG
                     HPASVLLQIASSHSESLGIANPAIYLAATALRYGEYEGNETAFKDFFALARHTFAPET
                     LQVTDVAFTVQACVQLARRKDFRPLFFQASLVSCIPHLLTDIVSSDSAGIIQVIYETL
                     LLSWLLSFEYEGLVLLVRERMIPQLHRVLQRVQKEKCVRVTLMTLLNMVEAERKYMNK
                     LLNPSSEEWVDSRIYQLGRLHQSETPGQQISTFKKGPSLVAEMVSVGMIKTLSQVSRR
                     KFGDEDINAMVDQLNAALEKSMQVLTSFSQYRGEVLSGVLEWTPVHTSTKFWKEKAVN
                     VEDNGYEVLVALGKVLRESKDELTLAVGCHDLGEIIRYHPTGRNLLTLAPMAGVKECV
                     MMLMSHPNPDVAKEALLCTQKIMVQRWEYMQTA"
     gene            complement(<556316..>561067)
                     /locus_tag="LDBPK_211600"
                     /db_xref="GeneID:13386522"
     mRNA            complement(<556316..>561067)
                     /locus_tag="LDBPK_211600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860629.1"
                     /db_xref="GeneID:13386522"
     CDS             complement(556316..561067)
                     /locus_tag="LDBPK_211600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860677.1"
                     /db_xref="GeneID:13386522"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="UniProtKB/TrEMBL:E9BFE6"
                     /translation="MSHGGDKTPGAATVAPPPALSANKKHDRSSGSYAKSYGRESYEK
                     HKAKQVRSLQPPQEPLRQVNANAAAVPLSTEPSLRPFAPHEPVGLELSLPSSTDFDDG
                     EVEVSPLTTPSQSYVPKHRRRQGGDHVRPLQQDVAAAKVLRHTPPLPHQLQQHADPTA
                     LPEHRRVALSKGSEELLQHHATGKENMSIGSHAAPSPAGATAASATSLQSVPKPASSA
                     EVKQRTVSSAFHPATSAAAATPATDFRRTASGHVHQRPLSLSGAATAPRQSPVPSTLT
                     TSAGRRGGATAAKVPQKRIASVKSRPLTTAARKQPPSLSNAEAETAERHESPAPTPTA
                     AERERSPEMDAGLRYQLYQMESVLDYVAEVATALGERRRCAAPPQSTKGFRASVVPTR
                     RCGGTSSSPEALDGSDVDLPDHSVRVCSSGGTVAFLPDIHQAASRLLSAFTKLEYVQL
                     SEDVDMPLLERDAVEYSARLLRLVDGVERQLSLHEDTLVRRRLSERRDIFRAMHQLVH
                     FIVRMTHEVVLLRDLALRHDLGQVLEAWGSFRAGVEAQAQAAADASDIYTRDKSEDAA
                     ASSAPPLLRKHLIFPIAMMRGSSFFVWLEGRWLPAMQQWRKLVFDALQAASSGDTEGA
                     IRRSRQEALRIDGLEEILRPGETITTLLREQVEQPIEELGRAFSMKRAAMAALREVLE
                     GAEATDGTLNTAHLSKALTAAQAFIVVRGGRGSGVDELAASVGGDKEDAELVCRAEEL
                     LARLAEADVLHRATKAALQHPAPELVTALEHITRANELLLLWRRARDVTSAQTALAAG
                     RAALDAYMQRLHSGRLSDNTSSLSSTNGEVSTGKCMTPSRVNGSSTAAPVPWIGDGFP
                     ASFDVRSLYVAHTPGGPWSKDLSMAYMELCEVFGTLYTQRQARRDLELALARPSVDDY
                     GARPAVALSLSPQVTPRRPTRDALSPADTLQVSDDGADAHCRSLPCSTGGTGETHASD
                     GSTPPAHNVPNGPSAEELHRCIQQAEEAGVGGPLVEEARARLRLLDTLRLKIHFDAQT
                     RVLPVADAAQASFHDVYKQIHDFCQTQLQQPQRAAGAERRLRIRYEDTEGDFISLLDQ
                     QDWHMMLSELAPRGCGGVKIELFCDYPTVPGMMNNSMAVPNGDDVPRTGVESELASGD
                     FQTETAPEASTPAGPAAVVGSAAATPEKRTNVFQRLASASKSSAVAPAASAQRKPRMH
                     PHSLGATSPHRALLPPRTRGIGSGAVRTVSPQKGGAASRAAVGGGSARGKDSSSSAAT
                     GAAAPKTAALTAANLRRNLLYRQAPPCPEGAEAAVQEEVRRSGGRSSSDGVTTVARPA
                     AAEADGYKAASTVAPASAAAAHNSVRNGNANGYGERESSAANLNLDMARRWEMPSDDE
                     LQLLEIQTRASMSTVCPSRCIEMPESMTTTSRPTGVPSRAGPPRNTFTATYCSRKVER
                     ISERGSGGADEAVSDIGEVSTAPKRRLSHSPSRPPRRWASDAFSLDDVETVCSERSRL
                     PQQASMPKGPTSLPPRPVHAGGGGGTRTPQRVRRGARSTPTRSTPDAGDDDRDGGQGD
                     GPNASDVLFEEMQRMREANTRAMAQRKSSWH"
     gene            complement(<562388..>563458)
                     /locus_tag="LDBPK_211610"
                     /db_xref="GeneID:13386523"
     mRNA            complement(<562388..>563458)
                     /locus_tag="LDBPK_211610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860630.1"
                     /db_xref="GeneID:13386523"
     CDS             complement(562388..563458)
                     /locus_tag="LDBPK_211610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860678.1"
                     /db_xref="GeneID:13386523"
                     /db_xref="UniProtKB/TrEMBL:E9BFE7"
                     /translation="MLCTLIAAVLILVVAPPGAQAAPGPSSFRCLRPFSATGTFTNVA
                     KAHPTQNCDYFYFSVEDAKAELKCASPSAATTAVSDEMSCNVTVRMSMRRASDVVPRL
                     QRQVGTDKDYFTHEASTDSTTASPTRVGNTRASAVPFLTEDEDVWRYAVSLKAKGDSS
                     IHYKGFNGGNGYSLCCAALEEADCAWMTPQKGDKDLDCDEDVDVRFAPQRGRVLRGCP
                     LPFPAPRSAGDGVFGASAGARVLLTDLDEGEGSGVFHAVITKPLHRFVEGPWEVMVQM
                     WRRRQHMPRVGREDSLSVPADHSIEAEVLGRIMVPFTLNLTELQKQGRITQMPSMALT
                     VEDVADVAQAAGEKAADEAGDL"
     gap             564791..564889
                     /estimated_length=99
     gene            complement(<565483..>568632)
                     /locus_tag="LDBPK_211620"
                     /db_xref="GeneID:13386524"
     mRNA            complement(<565483..>568632)
                     /locus_tag="LDBPK_211620"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860631.1"
                     /db_xref="GeneID:13386524"
     CDS             complement(565483..568632)
                     /locus_tag="LDBPK_211620"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860679.1"
                     /db_xref="GeneID:13386524"
                     /db_xref="UniProtKB/TrEMBL:E9BFE8"
                     /translation="MDDSRKADQQQRGVDAMGKPVTVKVPLPALLDIKAEALRSNPSF
                     FVTCFSTLLTAVLLGLCFMIVGIPPLYIAVRRGRCIYVGVMVPLLTVIGTVLSYYAMQ
                     HPQRVFNSALAQIVKEMEQHATYLSTAVGNVETELETRRVTLGLAYADEPARMRSLPM
                     TPEESGLQHFSRISMPGGAAASMSATLPAIGGPGFLHGIDKLEEERDVIIATVHVGKE
                     WRWLMGLLGKLNLRSLTGPTNPAVHHQRIAVRALAISVARVERMILSLYFSSFVLSRA
                     NAAAPVNLLGLAASKSVACCSSGFGHNAGRNQESVHGRTSTSMFKPSAPIMTSVKLHP
                     PHTPGNELGDSFTESVFTVPRETPNESRDRAESGGAGEEMTSQLTSLNVKGIPFGRVK
                     LPQFPTLTTGSTGSREPQKPHAHAHEEPSAARGATTASAPVERVLHLDTDAQLTDEKA
                     QRPDSTSASEHSVRSLADTNKADEAGDQGGGSGDSSPLAVGKGRRRSTIIPSSSVAHA
                     ATLCIQSRTVAAADNVAEKAFIDGNAGGRGAVLSHCLSISAQHLEQQLSSGRDNGDSV
                     VRSCTAAPHSDGNATGASPISSPRSKPWLTRPTRSRQPGSAVVANPSLTLHRGARFIG
                     DASNVFVTVLIHVEKGNSACGSRLYGAQAHASYDASANRHYFTNGVDSSLTHSCGFHP
                     FTIFYISNHKGQREGLTTREQQLLQFVYCRPEEPSELDSVSHRCAMDLSSLAVRGPGH
                     TRGDTAAAAATTHAGSSTASFARETASPPSSTPHRASNAVFTEPRVDSFIVAMQILQD
                     RPMRLAFLPVVMAPVQPKGTSLANNNATMQPLKVTCRTDLESSGKELHLTSGGGISST
                     PTASAMTMPARGRPSSGGVGSSEDGATNSTPEAVRRAPSPTTVPVLECMIDNVLCILT
                     EIEITVDTSFKRPSKVLLIGVSLEDVSEEGSECGENGVDEDEGVSQDSVEGSTGSRSL
                     EGAGETKQPADRRGLPRQRAANEVEVIQQGIRSAMATPSCRVMLRHGDSRSVASLNRY
                     KNGERCTLGQEFREVIHLE"
     gene            complement(<571508..>572611)
                     /locus_tag="LDBPK_211630"
                     /db_xref="GeneID:13386525"
     mRNA            complement(<571508..>572611)
                     /locus_tag="LDBPK_211630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860632.1"
                     /db_xref="GeneID:13386525"
     CDS             complement(571508..572611)
                     /locus_tag="LDBPK_211630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860680.1"
                     /db_xref="GeneID:13386525"
                     /db_xref="UniProtKB/TrEMBL:E9BFE9"
                     /translation="MIFTITNAVLSAIFLMLVVVPPLYIYSPDDNAGESNRLPSAGEV
                     LLDESVTQGVKQRLYLLVVIPTCTTVNALFLYFAYYRPVRFVHYRVELNLLTLRWTLE
                     ARRQQLQKSGVLAVGNRSIVGCGVSASSFVINGSSVASLNRSKMSARNVHLDQGSNHA
                     QRLASTVNWEWRRHVRPKSVRKDTWVSSAVFAEIGDLRDQVEQHFLTKANVAEANFTK
                     AVVKTVGVFVPPTPAALLGQVTDVAAEAKQGNAVYLSRRPPLSTLGSPRSGPGSTARH
                     GMLSDGKAAPRPQGNAAPLVPAESLHPDLPRGSTMPANSSGGGSAASCVGSEFALFRG
                     GESTSWGRSNTGADLPQALRGNVLERTHEPAGM"
     gene            complement(<574159..>575949)
                     /locus_tag="LDBPK_211640"
                     /db_xref="GeneID:13386526"
     mRNA            complement(<574159..>575949)
                     /locus_tag="LDBPK_211640"
                     /product="zinc finger domain-like protein"
                     /transcript_id="XM_003860633.1"
                     /db_xref="GeneID:13386526"
     CDS             complement(574159..575949)
                     /locus_tag="LDBPK_211640"
                     /codon_start=1
                     /product="zinc finger domain-like protein"
                     /protein_id="XP_003860681.1"
                     /db_xref="GeneID:13386526"
                     /db_xref="GOA:E9BFF0"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:E9BFF0"
                     /translation="MDNGDLLRYALQRRQYLVAIWLTLQQRWFVTSFNASTRVVGWAV
                     VALGVALVTFTVVTFARNVVPVLTTPGSLPYVLLQCLLVFVSFNIYVNYFCSTTFSRH
                     IGQAPPEYTYRGPYTTNAAGAPYDNSDSSEDSGDDGVKEGDGSPRVHGRTQEISSMAA
                     GVPLAQHAFSSPRRGAEAPRGPFDTTLNDPASPRVPMPAATGMVAPSQPPLPTTNFLG
                     IRVVRVFRGDESADGDAAATVPLHQQKAGVACRRGSMRSLLACFTRLTRSASAVFHAR
                     GCHRCHLPNRPKTVASLDALLELEAIAETAERCPPRLRVARLLDVPRRYCHHCRRLKA
                     PREHHCAICNECVTKMDHHCPWINNCVDAENQRYFLLFVWWLWVGTLLATGFLGYGYI
                     RESSNARRFRRLHAQWRTSPNKAAVEAKLRALRMPYGPAGVLLTSYLTTLTFGVTVIV
                     CLCMSLFLYVNKRLVLENTTAIESIYVHEKRTHVYASTNFTYRNPYDLGKWLNFVDLF
                     STARDPLVKMMLKAEAEADRRATAARPGGCADDRGWRWAAVARRLAQRVAIVVWLTGF
                     PTFRPIYGDGVHYPTFDLLASGELHPLLSE"
     gene            complement(<578314..>578535)
                     /locus_tag="LDBPK_211650"
                     /db_xref="GeneID:13386527"
     mRNA            complement(<578314..>578535)
                     /locus_tag="LDBPK_211650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860634.1"
                     /db_xref="GeneID:13386527"
     CDS             complement(578314..578535)
                     /locus_tag="LDBPK_211650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860682.1"
                     /db_xref="GeneID:13386527"
                     /db_xref="UniProtKB/TrEMBL:E9BFF1"
                     /translation="MQPSCHRHFGSLPSPPPFSFAYAALAARCRQALHRAQTLTDVRA
                     GSLLIPFRLPSPPPSLVAGALPDQELTAQ"
     gene            complement(<578963..>579769)
                     /locus_tag="LDBPK_211660"
                     /db_xref="GeneID:13386456"
     mRNA            complement(<578963..>579769)
                     /locus_tag="LDBPK_211660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860635.1"
                     /db_xref="GeneID:13386456"
     CDS             complement(578963..579769)
                     /locus_tag="LDBPK_211660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860683.1"
                     /db_xref="GeneID:13386456"
                     /db_xref="UniProtKB/TrEMBL:E9BFF2"
                     /translation="MMRFRGSHYQQLLAQLPRNLLVFDGHCLLCQARVRYVLERNFSF
                     FSFFSYARRNVEDEIAEGLDRHRIYFASLDSKEGANVRRLFFQRAPSSSASRASCSAA
                     LPQMALPVPADLVLVLIEKVPSQTASFLTGVRPGGLAADDRTLFEKTAASYGRGAATS
                     ASTVTFSTASSRLVSAAETDLFVSTNYTAMCRVGMHLDRFLTRSIFRFLYCVVPTSVG
                     NWWFERYVCRRRKTIWGTSEQDAVKECGIIEGMRERRWVWRGVSSNSLQR"
     gene            complement(<581390..>582829)
                     /locus_tag="LDBPK_211670"
                     /db_xref="GeneID:13386457"
     mRNA            complement(<581390..>582829)
                     /locus_tag="LDBPK_211670"
                     /product="2-oxoisovalerate dehydrogenase alpha subunit,
                     putative"
                     /transcript_id="XM_003860636.1"
                     /db_xref="GeneID:13386457"
     CDS             complement(581390..582829)
                     /locus_tag="LDBPK_211670"
                     /codon_start=1
                     /product="2-oxoisovalerate dehydrogenase alpha subunit,
                     putative"
                     /protein_id="XP_003860684.1"
                     /db_xref="GeneID:13386457"
                     /db_xref="GOA:E9BFF3"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:E9BFF3"
                     /translation="MFHISRAVRCNALATAIAGRTSLSDAIRQVQKVWNLDFKDGPVT
                     TSTLTFNDEPDPAAPIFHVLDLQGGVFVEEKADSGAAAATPSTVNEAGKTELQSAELG
                     QVFRYHAKDETSVITREVAERMMSAMLTHNTIDKIMLEAQRQGRISFYMTMFGEEAAV
                     IGAAAGLASNDELFAQYREAGILTYRGYTIPEFIAQCMGNCECDLKGRQMPIHYGSKR
                     LNAQMVSSPLATQIPHGAGAGYAFRLENQALERRLPTGTLLSTIPEARICATFFGEGA
                     ASEGDFHAGLNFASTVGSHTLFFVRNNGYAISTPTHSQYMGDGILSRAVGYGMPAARV
                     DGLDALAVYHTVRKARELILNNHRPVLVEALTYRLSHHSTSDDSTAYRSRDEIEHFAE
                     TFSPIERFERFMAERGWWTPEQSTEVVERTRREVLSELRRQEKLPAWPVSTLCDDVFE
                     HLTPELERQRAQLVEHYQAHRSIYDQEKL"
     gene            complement(<585061..>585726)
                     /locus_tag="LDBPK_211680"
                     /db_xref="GeneID:13386458"
     mRNA            complement(<585061..>585726)
                     /locus_tag="LDBPK_211680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860637.1"
                     /db_xref="GeneID:13386458"
     CDS             complement(585061..585726)
                     /locus_tag="LDBPK_211680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860685.1"
                     /db_xref="GeneID:13386458"
                     /db_xref="GOA:E9BFF4"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BFF4"
                     /translation="MSRFYTAKEVREHAFHDDAYVSLNGKVLDLTPLIAAYKEMPKFA
                     HLTKPLVQVAGTDISHWWDAEANDLRSCVDPNSGMRTYAMPLGRVPHMPTIYPDSNID
                     LNYDVPWWKDPQYIIGALTSRTRRIRIVNTLTGDETTLEVCAEETLEELLRERYLSIN
                     AHARSYTWVRLDPDPRELDMSRTLEDNGIHDEADSFEDLGLNADYYIPAIHLYYNDDL
                     TEA"
     gene            complement(<587618..>590866)
                     /locus_tag="LDBPK_211690"
                     /db_xref="GeneID:13386528"
     mRNA            complement(<587618..>590866)
                     /locus_tag="LDBPK_211690"
                     /product="methyltransferase-like protein"
                     /transcript_id="XM_003860638.1"
                     /db_xref="GeneID:13386528"
     CDS             complement(587618..590866)
                     /locus_tag="LDBPK_211690"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003860686.1"
                     /db_xref="GeneID:13386528"
                     /db_xref="GOA:E9BFF5"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BFF5"
                     /translation="MHRRIHKNGEVYTLTKHPPSRSSYLRLLLFPQSPGMSLDGGGIS
                     NGPEAQATASAMEEDYCLHGRERFQNQWARAGVFSPASLRVYGITGEPVLMRSIKQAR
                     MLSATFGTCFLGRFPRFRSSPSSGDSDAAAVTQKDNASNAAGPSRSGSSYDSLPFSSL
                     LLGPCPPPNMTADPHMLHQAWRREVAGTWSALHMPSEWCQTMNGVVTELSWSTRAQRK
                     RIAEQLELAAFMCLRAVQVPLPFYAADVAWSGGDDDDSRDQEDNEGGATAGKRGGAQP
                     MSDEEENQRNIRVACLAADVVLSFIQQCTRVKVWVRCDACNPAHRYQLQRLRQAVLYG
                     YSTLKTDSRRVIYRINTPCSVTSTTTSLMSDASPPSSSSSPRSGVVHTEAASSLMALL
                     YYSTWNPRMLLPSEWLGEEVVGFECPTAPALLACLAPHGVAPHEHPNYRPDAPGTASS
                     THHRPSATLAEEDVVEAQEQAHPNHGNPDEDNAPLRRTPPAYHDGESEGSRTGYSLFD
                     WYDSVTELETSHEADSAVAAAKGGSKGSGSASDTSYEAAADCRRSHLLRSRYTYVMPE
                     DLQPLVASRWAGTYPPFVSAITFIVELLRRRAMPVFDRTFFDQYPLLNYLHFKGVEEP
                     TRDVFASFEGQLQLPLQPLSHHLSSGVYEVFERDARKYRQYREAVFHYVRDWYAAGAE
                     QQHAHQNKMFFAKHGAMQRVPVPSPDERTLHLVLLGCGRGPLIDECLHAVSALGVRLR
                     IFAIEKNPPAAAFTRMRWANDPEWMQLAYTFGHTLEVIVADGRTIATAAEDGSLTLPA
                     DFGLCDLIVSELLGSLGDNELSPECLEAFHAQLEDIQLSRGIAFNPHLMCIPQQYTAW
                     VAPLMSATFDAAVTEAAVKGLTVPPPGCHDRHAALNHTLLVTNLSRAVTLAPPQPCWT
                     FEHRFHGGSGNDYKGDRGAMKRREPVSLERAASLVFQVPPCGRCCGLAGYFSAVLYES
                     ATAPATIIATAPVERTEDMYSWFPCVFALEPAQQAELQDVGQAAAEESRMVAIRVQLD
                     RRTGLAEQRVWYEWSVTYGDAAVERQSPRTGRDASAAPLVHNKNGWAASMLL"
     gene            complement(<591440..>592972)
                     /locus_tag="LDBPK_211700"
                     /db_xref="GeneID:13386529"
     mRNA            complement(<591440..>592972)
                     /locus_tag="LDBPK_211700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860639.1"
                     /db_xref="GeneID:13386529"
     CDS             complement(591440..592972)
                     /locus_tag="LDBPK_211700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860687.1"
                     /db_xref="GeneID:13386529"
                     /db_xref="UniProtKB/TrEMBL:E9BFF6"
                     /translation="MNRHYAHYYDPTEATLRAPFCYPDDVPLRAQGHHSDVSGTEWPK
                     PSDLPLPSTFPMPPHVLPQLSLPVVSASAAEAAARGMVAAPHVWAIPPPLLYPPPPPP
                     PWWFYGTPPLPLPASSSDTSASSAGSSRHASSSSRASARPTTQPSRHPPANAARPHAE
                     AAAPSRHGVAVPAGSVETPVAVASRGDAGGSHAAKQRSVASSGSRYAAGHTVGTGRAA
                     RRSVGSFSASGATSPRSATTTTAHSDPPQGVERRVYASSGSGSSDIQRCAKGQTVQVA
                     PRRTNAAHCVQPDQLQVYGEDVVQERDCSSVTARMKRAVSAAEAYVEKMEHLYRRLRS
                     RYEEVVMSPGKVARYGGNITADEGAEEKRHRRTAPPATTRATRAPPEKGLLHPLERAF
                     SRQTHLQPTAPMPHAKRPVSPALSAAHSSAVEPSPPLSSSSSATSATSLRRELHLLES
                     QWQRLEELKRHGSGGTAAAVAPPAAPSPSTATATVDEDPFTNRRFLQLIKDRKHLLMS
                     AA"
     gene            complement(<594880..>595698)
                     /locus_tag="LDBPK_211710"
                     /db_xref="GeneID:13386530"
     mRNA            complement(<594880..>595698)
                     /locus_tag="LDBPK_211710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860640.1"
                     /db_xref="GeneID:13386530"
     CDS             complement(594880..595698)
                     /locus_tag="LDBPK_211710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860688.1"
                     /db_xref="GeneID:13386530"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BFF7"
                     /translation="MAKWNALSEEIEAARASGDHTKLLEHVQVGLQMLKEIGATNAPI
                     QCESLLCMEASQAHYKMGQYDEALRCAEKARESLLRDCKAELQDKAQIAEIEVFMGFV
                     LCKQGGHGAAVEAQELLQKVLRWIDVDAKSAMPMQAVAAVNLRRSVLTGLGLSTTVQA
                     TTLASKGETAEAKVLYAKGLDTLIEALNQHIDENDFELVKMTLEAILASFEGLDDVSQ
                     AVATCRKYISWCRRHDDASGVADGEAMLTALCARQKIENPLETEKAKEAEEAEK"
     gene            complement(<596992..>599658)
                     /locus_tag="LDBPK_211720"
                     /db_xref="GeneID:13386531"
     mRNA            complement(<596992..>599658)
                     /locus_tag="LDBPK_211720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860641.1"
                     /db_xref="GeneID:13386531"
     CDS             complement(596992..599658)
                     /locus_tag="LDBPK_211720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860689.1"
                     /db_xref="GeneID:13386531"
                     /db_xref="GOA:E9BFF8"
                     /db_xref="InterPro:IPR026619"
                     /db_xref="UniProtKB/TrEMBL:E9BFF8"
                     /translation="MSTLGDSSSGGSSGRHSGAADYPRVAHVPEVHRFSDPQNATAST
                     ITTATSSSSAPSRADGAVSRGATMPLYMIQSQQQQQQPQVAFPGGMAMPIMNKAPPPI
                     RQASSSSSPPTPSPLSTSGSEHDGEAAAAARSKRPLPAVAAPDASGAALQSKRRSAGA
                     ASGSAARLAAAGPIPSVSIHAAAAATTAESHSAGVAGSVFVPGAGPPPTAAAANTSAS
                     PAPSPPPPPPPQVLTMATTEEAAKEAQRQQILGLANALLTFCCIGNTRVTSIRQCTSS
                     FFVLLYQRLFDCTIAGIDRSPNTAEKRRHNVMLVLEQLRQHPYSLEDIEAEEVVKLNE
                     DHISRLIMVFVQVAEDMRQQQELQQQQQQQQQQQAAMVASSSAMMARQNATGEQYPLP
                     HPAHAEGFDAAKTTSGAYAPVGYRVAEVMPPPALQQADAAGTGSGGYHFQQPMDNFCV
                     APAPPLSGGPASGGGIMDPDGGGGGPYMISGGAELGEGLSPSSVSHYLESSVMPTDNL
                     LEEWYRNLVYPPAGGPVEETEMMSAVDPGHVSLHGGYSQRRHPRSDQLGREAGASLTS
                     SGSPMYGAGHQLASASPPERRSPIGRHRHHRTQLDADDIVRRFQRLEEVLDAQERRHR
                     KPFVDASSSPAMQKGSLAERGARESRHRRHTAPQPPSAVADPRGGDLAPTPDKRSATE
                     VGGGALPQQEAPPSSQQQPAYSQPPPQQHRAPPRTPAHRFVSEPPLTRQERYFFAHRP
                     QHRIDVAQRDSKIERLRSARYLGDMQQLLRQRMRREYDAQMSAMRGSLKESIRTAKEA
                     KIDLMRRVRDENARYRAAYATLMEAAANEAQVPARVMSRHTVQLADYYATALQHSLLV
                     CDSLKREADRRNKNELLRYAEEVSAWQQHLLL"
     gene            complement(<603143..>605143)
                     /locus_tag="LDBPK_211730"
                     /db_xref="GeneID:13386532"
     mRNA            complement(<603143..>605143)
                     /locus_tag="LDBPK_211730"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860642.1"
                     /db_xref="GeneID:13386532"
     CDS             complement(603143..605143)
                     /locus_tag="LDBPK_211730"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860690.1"
                     /db_xref="GeneID:13386532"
                     /db_xref="UniProtKB/TrEMBL:E9BFF9"
                     /translation="MNEMDRVPVSSRGLCASQDPQRRPLRPEKEGATPIALAFVPSTT
                     SGGRGDAHICTCTLSSPNRDGTCSSNILSHTLTHPTRTTVPWGRGRQPNHLHAPPRLA
                     PLTESPIVVRGFGPPPIAPAPLALAESSEHALRARRLTFTASTPGGTSLCSARSALPL
                     LPFSTVLTAAQRVAPVPVWRRSKPLTRLPATTLGPTLSSNSENPDNVVVALSAAGMPK
                     GETEEWRNAEASSAAEPTPNAGSAVRHVDYQVAATQTERAGSSLAVKVATESSRMALP
                     DVPAPLVEPPQGASAPSKTETDQPVNAPMGDMEPRKSRQEDALDAHTSSSSALSSPGH
                     PSDHNVHSSVDGVLWAHEAPEQPAYAHQHQLPALFSQLVQDLLVAEPRADVEGDDDPL
                     ERWIQSWFENRCMTQTLQQSRINSMKHLRVLEDTSVGAIAHGAYIQGARSSNYAEPRE
                     KPAVDKDVDDATHAGPAARPAAGPSTTSSASAAVTKTTTKHAPAQLFSSSTAASPPHQ
                     YVPLTVEHICSALHSRMTSGASQRATSPPKPPQAQPLPISPGTLHSAGASSTPRQPPH
                     SAADGGGGVLAAVVGLSPPPQQPQPQPAKPLSGGPHLPAPASTRSMSSKQTVVAAAAL
                     AGGGEGDKGASGARPKQATTACAVFAHSSSSSAPKEAAHPHE"
     gene            complement(<605833..>607467)
                     /locus_tag="LDBPK_211740"
                     /db_xref="GeneID:13386533"
     mRNA            complement(<605833..>607467)
                     /locus_tag="LDBPK_211740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860643.1"
                     /db_xref="GeneID:13386533"
     CDS             complement(605833..607467)
                     /locus_tag="LDBPK_211740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860691.1"
                     /db_xref="GeneID:13386533"
                     /db_xref="UniProtKB/TrEMBL:E9BFG0"
                     /translation="MLSAKRGALLLQAFHRPGEVISYKAGDYHLVPKKFTVGKRIAVR
                     SYLDRNRTELSDRTFMPQKNWFRPYDLQEDRFDRDHERLSYRFYNLETKVIWKAFDTP
                     ELIGVLLHDETVKGNTGMYAPDMLDAALHYTRESRYWRCIGITKPFYDRSTLRAHCWE
                     DNGLQVGTLVMSQAMRHALMDLERAVRRKELGLEPNYLWDRWGPIGFIDGARADYLPR
                     FEHNPYVDPDGVDVTELDVLPFNTHEQIRERYRDFIEPDTAPFEEVFRSPSHGSLTTL
                     ADIPKASVVALYKDLKLKAGTPVASDAVELAPADVRTLFYLSANPEWRAMAGGKASWE
                     EVVDAMQPVQAQLDEKIDAARLLQNTRHSAERVRAFFEEKCGFRDFMYTPDKIITAAV
                     LCYLTELRRICTETAWGTDLAKCLTDVERVQVMGRDAFIVYRHIEDAILDKKRRLWAG
                     RFAGESHEESTLDYLLENFGRRADRPRNVGTTGVEFDREQEPIGRQVQRRVLDSDKAN
                     KLAEVRRSRGKMWSKKRSVFDALHEKQLQNFNYGVH"
     gene            complement(<608199..>612596)
                     /locus_tag="LDBPK_211750"
                     /db_xref="GeneID:13386459"
     mRNA            complement(<608199..>612596)
                     /locus_tag="LDBPK_211750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860644.1"
                     /db_xref="GeneID:13386459"
     CDS             complement(608199..612596)
                     /locus_tag="LDBPK_211750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860692.1"
                     /db_xref="GeneID:13386459"
                     /db_xref="UniProtKB/TrEMBL:E9BFG1"
                     /translation="MKVSATTSAAAAARRGDDCGHHHRHHRHDGAVPRRTDVAQHTCF
                     YFTVFFSNNPPIFHSNRIPPERLGMRAVVSSTTAREEVRQMASRTSSVSLSAAADGSA
                     SSASPSSPSSPCTGCQQRYWKTVFGEPEADRAARPGMGHPYANGFYTAWAEAEEDRDG
                     ATALVGDYRSATATVEEVPQQTLQNVAFPTAFGSCGGACMLPVRTCGRRTRSASAVPS
                     PKMALPAEAASPQASPPKPQPAPPQFPSAADTEIVRAADAEKSAQEASSGCAQKRVAE
                     TLAISSAATGKALGPFSPTTYTLPIRCTATLAKDASPTETVAGAPTIPDHCKPTLPAA
                     KWEDEDKAAVHSAHNEGAAASTIATESRKQLGQGRTRLARLHMGTDAVTNIAEGEAPP
                     TPQQRPTPTAAPAAALNASSITPAPAALGTSTAINGAALRPVAYTSASPRTSINDTGS
                     AALAASASIREGPPWNMRVEEVRSAKGELRYYRIILTASFAALVTTHIGLMHSMQTRN
                     AAAALVVLCPPCGLHFRFLLHHADVLRSVLNRTTEFAIRTVQRFFCLLYSPTQKPKGS
                     QQQVLKGIAALLEAHPEGLETYRAVKTELTNALCLRFPLPMLAPATSAWAVPVLMRSS
                     LFTVRTRSFIKRASAKSLGGPGDASSRFASGPSADDASASVRKRSGAGAPPFGSACSP
                     PLLLDEILHEAASFVREYSEGFASAFICGLLSLTEGAVGSAGLRSRRRVSNNASITAG
                     ATAATPAVNGLTSPDVSGVPPLPSCAQNGSSPIAAHETSPYFAGGGGVAAAGPRGAPA
                     WLSPYAAYWSSITDKCGPLHSGEDSLIDFGKPAPITLEGYDRASSSSCSVEHLDADAA
                     LTAHVSASKITAKTPVVSPLRIDAAHAASMPSYSPEHHFLCEENGTEAAADPAVHLPS
                     AGDGTTAVPLTSKASPPIVVSEETFFTPGVHAVMALGSVASSDTVAARSRSEENSPHS
                     SAAPRTAAAPAGAPSAAAAAPRLPPKTAGRSTTPSTAKEDEYLLYGGRLGRVVIFTRD
                     AVLARQLLVIAAFLWSGYDCGAATGRGLAARSGAPGRAGASGQQRVARSAAEDVALRN
                     QEAQHMYETAVAAAVSSAEYANVPVQWVAEEFSEDCLSTLCSRFSPENALLVVVPRQL
                     QCRRVYLRKYVTGTTVLVEEHSGKGARICTTPFPFRCSISKQVVVQPDPTVTTLLREA
                     CSLHQNSHGTVSFADVFQRMVGWLHWQSAAAVLSRTAAAVRAASAATMANGSSLTRLV
                     SSDAVWPSSDVSIRSASASSGARENNKSSHMTTPVATSPEMRLTRSTNKSASSPVYHC
                     DSSWEPESVEENLLPGSMGGAGAWSHSAGASAHVTGGATATAKTAALRAGAMPATSKL
                     LVSHGLLQPPSAFTSASHVVASPVKTASFKLFQWLRSSPTSPWAATTRSHPILSPATL
                     GQMQGADGVVGGQRSRLLAGDDDEEDVLT"
     gene            complement(<615864..>616715)
                     /locus_tag="LDBPK_211760"
                     /db_xref="GeneID:13386460"
     mRNA            complement(<615864..>616715)
                     /locus_tag="LDBPK_211760"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860645.1"
                     /db_xref="GeneID:13386460"
     CDS             complement(615864..616715)
                     /locus_tag="LDBPK_211760"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860693.1"
                     /db_xref="GeneID:13386460"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:E9BFG2"
                     /translation="MERGRSCRCCGCTMQFCPCCGAALAGKRDGAVKGHSNGNDGGLL
                     SCNSSLRPHSAAERAVGSGASVPWSHGTAAWRKRLPRRPVSAYEVYLAAVHGVVADEG
                     GKEAAAASRTLADPRPAMAAAEGGQRSDEQVRAAALSWLRMTPAEKRVYEEEAHSWQT
                     RLGALSTVPPSAHNLGEDSSSAAALPDALPSVERPLSQQQHSSHLVAQRSSKTPAPER
                     LPRSKSSFALFRAHMKGRRKMCMRELCAVWRNMSAEEKAPYDAAAASKRTEQFLSQTL
                     SAPDSQS"
     gene            complement(<617483..>619510)
                     /locus_tag="LDBPK_211770"
                     /db_xref="GeneID:13386461"
     mRNA            complement(<617483..>619510)
                     /locus_tag="LDBPK_211770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860646.1"
                     /db_xref="GeneID:13386461"
     CDS             complement(617483..619510)
                     /locus_tag="LDBPK_211770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860694.1"
                     /db_xref="GeneID:13386461"
                     /db_xref="InterPro:IPR006968"
                     /db_xref="UniProtKB/TrEMBL:E9BFG3"
                     /translation="MLQEYTGGTCVSYRVNPQRGGCVETVAVVDAQDFFGEHGGLVTS
                     PTTPSTPTGPTSARQARRRVVTALERILLPDGYPSSVTEDLLPFALWDLAQVLAKNVT
                     ATLSTRAVLLGVGVGESKADLTSSTLSWMMQDGTRMIGSIVFASLIPQGLECRAKTWQ
                     LVADFTTDIANLLELCAPWLPGCQTIFRVVLVAASAIKALGGVCDSGTRASFTQHFAL
                     RNNAADIAAKAATRSSVGSFIGLALGTAVAYSVPATSRSLNLAAFALCSAFRIFAHYR
                     GVRGVQLRHLNAPRLEWCLEQYSLFKAKVLIASRKDSGPLSVMPILDVSPRSANAAER
                     LLILPSLRAVPPPSGSFYDSVYRFLRRYCFPATLTLRIHFGASFFRVLQHQNGLTTRR
                     KHELVQQVESALASRGIALLVDDVDMTYYVILPEYFTVEGVPEIWVPHKRQHEAGLTC
                     MEAKQRQSAAAHAAQRKQDGAASLSPSGAVTAAPDAGRGLDEAGRRAAQVEAELERLQ
                     KERVVFPPHILPLAYRQLWAYFYAFMHYRAVRLRREGLLTHSKGVLEDLHKNRSLECR
                     RLHIITALRADGTLEADHSDASDASHSPAQFEELTSPTSITSDVPLTRRVVPALARRA
                     GGDDGDNTAAPSHDGLHPHFIEFVRALRMTGWELDELLVSNEGYTTVVNYL"
     gene            complement(<629280..>629375)
                     /locus_tag="LDBPK_211780"
                     /db_xref="GeneID:13386462"
     mRNA            complement(<629280..>629375)
                     /locus_tag="LDBPK_211780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860647.1"
                     /db_xref="GeneID:13386462"
     CDS             complement(629280..629375)
                     /locus_tag="LDBPK_211780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860695.1"
                     /db_xref="GeneID:13386462"
                     /db_xref="UniProtKB/TrEMBL:E9BFG4"
                     /translation="MGVCVPHILVSPSFVRHIKAHIHTHTHTHTS"
     gap             630782..630880
                     /estimated_length=99
     gene            complement(<630883..>630984)
                     /locus_tag="LDBPK_211790"
                     /db_xref="GeneID:13386463"
     mRNA            complement(<630883..>630984)
                     /locus_tag="LDBPK_211790"
                     /product="40S ribosomal protein S11, putative"
                     /transcript_id="XM_003860648.1"
                     /db_xref="GeneID:13386463"
     CDS             complement(<630883..630984)
                     /locus_tag="LDBPK_211790"
                     /codon_start=1
                     /product="40S ribosomal protein S11, putative"
                     /protein_id="XP_003860696.1"
                     /db_xref="GeneID:13386463"
                     /db_xref="GOA:E9BFG5"
                     /db_xref="UniProtKB/TrEMBL:E9BFG5"
                     /translation="MPVAPQYYHAHAVDATIQHEKAYQRQTAVNENMH"
     gene            complement(<632226..>633860)
                     /locus_tag="LDBPK_211800"
                     /db_xref="GeneID:13386534"
     mRNA            complement(<632226..>633860)
                     /locus_tag="LDBPK_211800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860649.1"
                     /db_xref="GeneID:13386534"
     CDS             complement(632226..633860)
                     /locus_tag="LDBPK_211800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860697.1"
                     /db_xref="GeneID:13386534"
                     /db_xref="UniProtKB/TrEMBL:E9BFG6"
                     /translation="MHIYSKDQQAFHLQRTPAEKWWSRANTFIVVVQLACFLSVVIRT
                     IAGASNSMSNSFFTHSVLSLKAPYIVDGCVYNVTRRHAFFNNVQYSLSRDNVGYFVSR
                     AVLNIRYLIALAAAHVVVSATNRLWFETNTHEIRYHFVVFRKDMITTWEILLMVLSFV
                     VTLGITEENRIMTDYITHCAANRSTSGHFYNSVQPYTELIVSYIISISATVINGAFAV
                     WNLSKKNPLDLMLREAKRQQEEWRQAMEQYYGLGNSDATTAAQSQEHAGGTQPQVIYA
                     DNRATTVSPNADAAAALPVNGNELVNAGEADPLQRHRHGHHHSTRKGLGHRLSAISSS
                     LRRRSHSEDEMKLNAPQPPPQFTPLPPQKQAHLQQQQPHFGPSVSRPLTPTLNEEYDQ
                     VEMPEVRQQGVGEGALGDRVGPTAEMMGGPGAVIESSNSGRYDLHEVDDDEDDERGAV
                     MEADIKNSSLRGGQASYSVVGGAGGVSGGLRVRGMSGSEASTALVAAHLATTPPPPPV
                     HSGDRRQQAQMSRGQMLAPPSPLQGGAETTDDTVHL"
     gene            complement(<635653..>635772)
                     /locus_tag="LDBPK_211810"
                     /db_xref="GeneID:13386535"
     mRNA            complement(<635653..>635772)
                     /locus_tag="LDBPK_211810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003860650.1"
                     /db_xref="GeneID:13386535"
     CDS             complement(635653..635772)
                     /locus_tag="LDBPK_211810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003860698.1"
                     /db_xref="GeneID:13386535"
                     /db_xref="UniProtKB/TrEMBL:E9BFG7"
                     /translation="MDAYVRAFFQGCACASLMWAQACGSRVKPCIAVKREGRP"
     gene            complement(<637877..>639430)
                     /locus_tag="LDBPK_211820"
                     /db_xref="GeneID:13386536"
     mRNA            complement(<637877..>639430)
                     /locus_tag="LDBPK_211820"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_003860651.1"
                     /db_xref="GeneID:13386536"
     CDS             complement(637877..639430)
                     /locus_tag="LDBPK_211820"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_003860699.1"
                     /db_xref="GeneID:13386536"
                     /db_xref="GOA:E9BFG8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BFG8"
                     /translation="MHVCLHPRSLGGGAHTRTPTRHRLSRRYLRTKRTTVARTRRIRE
                     QPATALRTPSNVTPSPTTPPALYPFFLPSHLCHLHCAIMSSDLADFDGDDVRTTVVAA
                     QPMGVGMGTHSAVALGGFQDFCLKSELANAIRENGFEHPSEVQHQALPKAMLGADILA
                     QAKSGMGKTAVFVFALLEQVEKVPQGQKPYCQAVVLVHARELAYQIEQEFKRFSKYLP
                     YATTGVFFGGIPEDENVKQLKKEVPAIIVGTPGRMKALIQNKAFDTTHVKWFVVDEFD
                     RCLEDVKMRRDVQEIFMKLPKEKQVMMFSATMTDELRDVAKKFMKDATEIYVDQRAKL
                     TLHGLAQFYMNVTEPEKTRRLAEILDVVEFNQAIIFTSSVERCEALNRQLQQMKFPSQ
                     AVHSRMSQEERLRVYESCKANNTRIMVATDLFGRGVDFDRINLVVQYDMASEADSYLH
                     RVGRAGRFGTKGLTIAFITTDEKEIKRENRTYTDGGIMKEVQERFEMKVEELTDINTQ
                     LNENQYMNK"
     gene            complement(<640839..>642026)
                     /locus_tag="LDBPK_211830"
                     /db_xref="GeneID:13386537"
     mRNA            complement(<640839..>642026)
                     /locus_tag="LDBPK_211830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860652.1"
                     /db_xref="GeneID:13386537"
     CDS             complement(640839..642026)
                     /locus_tag="LDBPK_211830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860700.1"
                     /db_xref="GeneID:13386537"
                     /db_xref="UniProtKB/TrEMBL:E9BFG9"
                     /translation="MQGTWSVLKKNCLNFVPGLALFASQSRDAFATWLKIYNRGYKHG
                     PQEFYEQAEVYTPDYWKRGHSQDKNMWVDMNLSEEVSQKELAQLMHYKHDLWRMGHGL
                     GLGLFLGGYALIPAFFWLSSDTFAPSCFCKTEEEKKAWREAQDMYRYRSAPSYIMDTK
                     WYFDFHAYPWNATQERAWDDLFEKNNVRRDPKLLRPAAEMYDGFLKFYQIRRKSLRHL
                     ARSMNLPTFPLLSRTCASTRVRDYWNLAWNEDYMVITQKLHHQMSDEDLHDYAWRRFL
                     APYDKNLSRDEIMTRVNDYHEFLGPKFVEEGKAPNLIILTNYVLGYYNDPAYLVEDIS
                     ALDGNDFEYMAHYGKDAFLRRLEFENGPLRDQVEAHTQKLIADRAAAAAAEATAKAPQ
                     VTA"
     gene            complement(<643939..>645294)
                     /locus_tag="LDBPK_211840"
                     /db_xref="GeneID:13386538"
     mRNA            complement(<643939..>645294)
                     /locus_tag="LDBPK_211840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860653.1"
                     /db_xref="GeneID:13386538"
     CDS             complement(643939..645294)
                     /locus_tag="LDBPK_211840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860701.1"
                     /db_xref="GeneID:13386538"
                     /db_xref="UniProtKB/TrEMBL:E9BFH0"
                     /translation="MTHSACFDACMLFSECGPPVNRTKLTDGREVRTPLSPLPRPSLR
                     LAVHLRASDAFYSGSLSPFSTIVTTSKMSSPAAAPATVFARYPAALALPTADPNALAV
                     ETMLRCAEVRYTRADARLGDLSLTISPAASFSSAAAATSSTSAAKAKSEVCAGLMSCL
                     RRLGGESAFDAVPSTHAATAVCVEVLTVQCLFPAFLFYTHFDPALYKAAMRRSVEPKV
                     ATFWEWMRGTYRAHILRENPFFYSGTAAAEVPRGKLSLTSLAKLKEVGEGVDKAFAVL
                     ESLRKTATSAGIEAGNVFFLGTSRPTYIDALVYAAASSFVHADLREAAAGVKGHQRRV
                     QDACPALLEYVEGMRRQFFEADSGTYCLKPCEAAADVDPHVAMAHEAERQYRSGRLPT
                     LWWTGLFASVYFLLVNADMLVALLEQAEEESEEVAAVEAAAGAAGGTASQQSSPSSAS
                     V"
     gap             646764..646862
                     /estimated_length=99
     gap             649670..649768
                     /estimated_length=99
     gap             650894..652504
                     /estimated_length=1611
     gap             654283..654381
                     /estimated_length=99
     gap             658553..658651
                     /estimated_length=99
     gap             659762..659860
                     /estimated_length=99
     gap             660594..660692
                     /estimated_length=99
     gap             661428..661526
                     /estimated_length=99
     gene            complement(<661627..>662940)
                     /locus_tag="LDBPK_211850"
                     /db_xref="GeneID:13386464"
     mRNA            complement(<661627..>662940)
                     /locus_tag="LDBPK_211850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860654.1"
                     /db_xref="GeneID:13386464"
     CDS             complement(661627..662940)
                     /locus_tag="LDBPK_211850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860702.1"
                     /db_xref="GeneID:13386464"
                     /db_xref="UniProtKB/TrEMBL:E9BFH1"
                     /translation="MKSVKKTPKGEHHSLVPTTTTAAANSTSNGTKDHIHNGNNAAAS
                     QRTSVPLLDEESLKANTASASSGAAGGFTLVPHSDDRLKMGGATISGSPPSQPHSVDS
                     SNIYTMLQQQHAVAMAAAQLEHAYNQTCYLLQQCSHNALLTVLMSLLNDYPTTLVQPI
                     RMRVEQVLAHQMSPSASGRVAVPGRRGSEFVPNSSAAPWTPSNMRGSAAPTPTANSTT
                     PSHRRGRGHKGKEEEQEMCSIHNNLRAMKHLQLNVSTGLYECIHGFHCLVDGPTDASP
                     KRLSTASAVSPSTSASRANGPAPSADSQPFAPPPTIVSPAAAESRFSVTEVEALRMLG
                     YPLPNTNSDQPQPHLAHESPHPQPTLQQPHQQFSHLSLRSSGLGLSGPSHHDPESSQL
                     ANGGGFTVISGERSSAGNSPLDARLSMDIPSLEYLLQSVRDIDDD"
     gap             664854..665377
                     /estimated_length=524
     gap             665744..665842
                     /estimated_length=99
     gene            complement(<666649..>668256)
                     /locus_tag="LDBPK_211860"
                     /db_xref="GeneID:13386465"
     mRNA            complement(<666649..>668256)
                     /locus_tag="LDBPK_211860"
                     /product="choline dehydrogenase, like protein"
                     /transcript_id="XM_003860655.1"
                     /db_xref="GeneID:13386465"
     CDS             complement(666649..668256)
                     /locus_tag="LDBPK_211860"
                     /codon_start=1
                     /product="choline dehydrogenase, like protein"
                     /protein_id="XP_003860703.1"
                     /db_xref="GeneID:13386465"
                     /db_xref="GOA:E9BFH2"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="UniProtKB/TrEMBL:E9BFH2"
                     /translation="MRRGAKCLAGAAADVGSLKFDVVVVGGGASGSLIAGRLAMENLK
                     TLVIEEGADIRKCPEWYHTLPASTIAHRLAQRGFEAKDTLTTPQQHPDGVTKAPVWIP
                     TPRVLGGHGVMGSRTWNLGDERDWEGSPWSFREELLPRVRTFENMEVFVPHRGKRGKF
                     LICRPLNFSPYFKAFCEAASQDVPLMSEFTRKEFQIDCGCGRPDTFVDQSLGVANTTL
                     QRYLLGTIKLNRPVRVECGAKVVGIRGSGGNASTAAGVSLRRADGQLVDVESTLVVVS
                     AGSIGSARLLTASRGSVDVDASVGQHFWDIPQVVLQYHVKNRDSHNCYLDPLVCKVLR
                     VDLWYGRPQLSLRSSWDDLIMYWSSTGSSTPDVEIQFQPFTLTNDGTQPMPREHGCQF
                     VVRPLRPRSRGQVSANGSIDPNYFSDAGDLAALQRGVAYVKDCLVKKTPFVPIIGALA
                     HERFESSGINGGSCAGAVDPQTCRLKGVSNVYVCDHSILPSPLTGSTLPYTLALADRF
                     VDKLLKRRDVKHKEAEDPVAQATRIVY"
     gene            complement(<670774..>673176)
                     /locus_tag="LDBPK_211870"
                     /db_xref="GeneID:13386466"
     mRNA            complement(<670774..>673176)
                     /locus_tag="LDBPK_211870"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_003860656.1"
                     /db_xref="GeneID:13386466"
     CDS             complement(670774..673176)
                     /locus_tag="LDBPK_211870"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_003860704.1"
                     /db_xref="GeneID:13386466"
                     /db_xref="GOA:E9BFH3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BFH3"
                     /translation="MEKYTQLKVLGKGSFGSAWLIQRNADRAQFVAKEVRLGGLKPAE
                     RESAQKEIDMLRTLNHPNITRYVDHFEHKGSLFIVMEYANGGDLYMRIKQQQGQLFSE
                     KGILQCFSQICLALSYMHERRILHRDLKTQNVFLTKDGVVKVGDFGISTVLRNTYELK
                     HTICGTPYYFSPELCLNKPYNNKSDVWALGCILYEMTTLNHAFDGSNMKALVQKILKG
                     VYPPIHPMYSSNLSRLISSMLQIDPHKRPNVSQVLDLSFIREALAGLREEVQVARADR
                     RSVVSVEERAHMQEAAARRKEEYRRKELEAAATLAKAQQQQQAILMQQQLEGEERRRN
                     LVEQQRRLQRQQELALQERKRALDERVREQRKLQGQKSKADAKAHHHREKQWDDNMKE
                     QVIEEQRRREAEEHHPRSDCQSPPQLQQERLQQQQEQSAAEAYREMRRQAAANKQRCY
                     RESVFPGGAPCSQQRQQDESSAVPPGQPPPPRTPPSSSHYCSRKMTPEELEDARSQAF
                     WQMRREAMDNRKKMLGHDVTDTGEPRAPTSAEAAPGASPASSNGKSASVASVPAPPQM
                     STLPPPSSAAAEETKPTKKSMSRKDKFTPESTGAQLPAPSPAPAVLLPPGAAAAAVPQ
                     EVDNGMTPDGEEGLHNFLNGEAAAASPTEAEDRRRDDDYNALDTVIGETLKADRKKSF
                     KDDFDDAAFGEATDSSRLVLDGKTFHLPNVSATDPLMHRIESLRIFLEKEMGDDDLIK
                     CYRAMNNISASDDEVMHQLQSALPPSKQRFIPLVAHLVVCEDAFNRQGASSSASASAI
                     GL"
     gene            complement(<674819..>676276)
                     /locus_tag="LDBPK_211880"
                     /db_xref="GeneID:13386467"
     mRNA            complement(<674819..>676276)
                     /locus_tag="LDBPK_211880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860657.1"
                     /db_xref="GeneID:13386467"
     CDS             complement(674819..676276)
                     /locus_tag="LDBPK_211880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860705.1"
                     /db_xref="GeneID:13386467"
                     /db_xref="GOA:E9BFH4"
                     /db_xref="InterPro:IPR018799"
                     /db_xref="UniProtKB/TrEMBL:E9BFH4"
                     /translation="MEAIIEKTQKELGAVIQAPRLTDKLLSRPPFRYIHDIVMSFMKA
                     TGFPDGLFDADQLDSAKVADKKAKVQFLEKLIAAVEAATGTPVTARPSKIVAGEEAEK
                     TNELFQQLAQCAALSSAQKAAAVRKVSGGGEPAPAAAAAPAPSSKKESGETKAPLQET
                     EEERTKRREEERRRRHEEKKREAEKAKERAAAEPPSRTKEETTNQAAATAASGETERH
                     RHREERKRESTGAVDTATTSARKAPPRPKPTHEVIEAQNAAADATPAVGVIREGKRGK
                     ADTESEDEDKEDWQKVAEQYEVKPAARTAAVAEDADVKGLLGQQALKAKRDQEAVARR
                     AEVGGDGAAAAAPAGGGIIIHSSKNTASRGGGSHALGDSDLHQLREQLQLLTKASNPL
                     GKFLEAIHDDIDSMTRELDMWRSESRNQALAAAEARRQTEESLQEIHANLQNLEDAIS
                     DQVLKTNNLRQTILANDAAMEVMAKTIVNPDMAAQ"
     gene            complement(<677354..>677794)
                     /locus_tag="LDBPK_211890"
                     /db_xref="GeneID:13386468"
     mRNA            complement(<677354..>677794)
                     /locus_tag="LDBPK_211890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860658.1"
                     /db_xref="GeneID:13386468"
     CDS             complement(677354..677794)
                     /locus_tag="LDBPK_211890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860706.1"
                     /db_xref="GeneID:13386468"
                     /db_xref="UniProtKB/TrEMBL:E9BFH5"
                     /translation="MPGREPLAPRGGAQTSMSVRRVAAPYASRRPPGNNRARPGLAVG
                     QRTGADLPTTTTTTASRSGQRSPVPAEAAPACPCCAACLKALQEVLHAYNALLLNSKR
                     LFIDDALHHYSGDEAWIRVLRSLGWSNEPAPATGVGRRSDLAQR"
     gene            complement(<678415..>679440)
                     /locus_tag="LDBPK_211900"
                     /db_xref="GeneID:13386469"
     mRNA            complement(<678415..>679440)
                     /locus_tag="LDBPK_211900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860659.1"
                     /db_xref="GeneID:13386469"
     CDS             complement(678415..679440)
                     /locus_tag="LDBPK_211900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860707.1"
                     /db_xref="GeneID:13386469"
                     /db_xref="GOA:E9BFH6"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="UniProtKB/TrEMBL:E9BFH6"
                     /translation="MFKAPPEVGPGRKDTEEANPYKSWEHMNHTWLILMCLGCLCAGW
                     LAGHFVEVDESKIKPKYAREDVVASACKQFEFRPDLAATSIRTAFVLAARRAGFPADT
                     VDESCAVVRGLNDVAGIMNYLSNTYPASSTEDVASLAAIAGIKYLNGPYEAILDQWRW
                     GRNDSDTAPKRNIPKDPDQKVFSIPTILHALGGLTEAECVALLACHSVGEFHEDVSGL
                     EGATHTGKRYILNNRYYQFLLEHEKAFAPLTVARTQDNKEVAALPQTLKCVYVKEKAD
                     GKTKKRQCVVNAAELELLKNKTWRELVVRYAADEELWREQFQSAFTKMIESNFKRLRP
                     YSDPNSA"
     gene            complement(<680416..>683211)
                     /locus_tag="LDBPK_211910"
                     /db_xref="GeneID:13386539"
     mRNA            complement(<680416..>683211)
                     /locus_tag="LDBPK_211910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860660.1"
                     /db_xref="GeneID:13386539"
     CDS             complement(680416..683211)
                     /locus_tag="LDBPK_211910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860708.1"
                     /db_xref="GeneID:13386539"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BFH7"
                     /translation="MEQSILNLQDYTAASSWRRRDQLRGLLSNHADLVTSRIPLAAEG
                     VLFTSAQIALHNTEKGLAVSLSPLMGTSAVGLMPLDEAVPSLNAAARMRWLDMAEGTK
                     TSCVEWCEDLLFLGSSRGRVLVCDVPVASCRESSGLLSPCGALLTRSSEVVLSRVTVP
                     PSAPASSTLVRSVRVNQCVSKTSVLAAQDTSVYLWDLTGGSLPVQRWLPHRHIDAATP
                     VMFAEWAPGSASVVLSGTYDSSVMLVDTRSAAASNSVAFSCRRAGGCPAVAHCGDFNP
                     LLPSIVAVSFSDGTVAVYDARYPLQAVQTVTTLQGDAVRLRWWRHNADLLTTAGSDGS
                     VALWNLRCPPSFCVGRAQYQMPLSDLAMTNTFSDQRAIGITVGGELTMTGLQPEALMG
                     LAPTLSYGNDEAERRGSGGPSRGSTASPPTPPITAAEEEALRKEEHDACGFLYLRRLK
                     EAYQMLAQCASRRLALHQTDVAMQLISHIDVVRVPLFDYAGFVEQLHSAAKGVDDVLQ
                     VLEENGWSYETIRLQFEASVLHCSSHLSTTVALDRIRAMSKPNPSDVQTLEALRLNVM
                     LHRVLDSEDVDQVVVSVRTALDLIMAHPGISELIDVQTVEQIVRLLLRKNYPEGERFV
                     QFLLSQLRVDREQTGVPYQLLRAAMSAAQEPSVTMGMPTRAARRFVERFYRDMAVAKD
                     AVLTQLHIQRLGVEHYREVITIVNAYQERCIQKNLPGMFGWVALKPLLLFLHCLTADS
                     NYVTFFWVSVQYIEAFAHFPGVRKVEAVLFAVVDRIHSAAGKITNDLDELTDTTRFSI
                     PMLRHVDNTLSTTHEFLTVLIRVQLDCENVAVARNMRAMPPVMEQVQDVLNSASEDVL
                     EAWAGVMDALLECDQPDMIRKYCLATVRTFSEQMEDLMEVSAKGEADERLNEILDVCD
                     DFFAAVAPRKAKGGDDA"
     gene            complement(<686095..>687990)
                     /locus_tag="LDBPK_211920"
                     /db_xref="GeneID:13386540"
     mRNA            complement(<686095..>687990)
                     /locus_tag="LDBPK_211920"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860661.1"
                     /db_xref="GeneID:13386540"
     CDS             complement(686095..687990)
                     /locus_tag="LDBPK_211920"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860709.1"
                     /db_xref="GeneID:13386540"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BFH8"
                     /translation="MMQLSDWFSQVQYLHARREKGLHPVNEMNRFTILVCGLFCGICV
                     SLPYTFDLYTTQLRDQFELSAGDLSTVSTVGLVFFFFLLPFSVIFEMFGPFANFMICL
                     ATGVIGTVGLAQTFSGAIPGNVTTISMFYAFLNLASGLIDTTYISTLFEVFPRNRGPV
                     VCLAKVMTGLGSTIFACLSTTLFKGSLIGFIYFLCAFIAVVTVCASALIVLPLYYMNW
                     WRLRGKSAEEVALLRTTKPLYEYKFVPVRRLIVGYAVVLTLIVFFTVETPVVSYVSRL
                     PRSVELTIGVVVSVLTLCLFLMLLPLRWLGGMDEAAPLDFELRAIALSYEASASERDA
                     SAGAAVADAMPTGGNASVSMNNSPASTESDAEGGAARAASELDSWQDPRYPGSTVLDY
                     LKSLDLWLILLYMFCVSPMGIIMSYNGSTISIAKTGNPRSTQTAALYTAFIGLGNSVG
                     RIAFGLFEAYVQHTKGLSGRRRVLVTAALFVSPTLATVGGVLLLVLPGKLILLPYIVV
                     YIMNGFSAALQALIFTCLFESFHNTLYNMAFMVMVICVIVFNRLLFGMYVDMQHRKLR
                     LSASQECNRAVCIETPFIVATCLAAGGLLVAGLAHVRYARFVARVQEWRPGASKPTKC
                     CSPHSRP"
     gap             691175..692093
                     /estimated_length=919
     gene            complement(<693381..>695375)
                     /locus_tag="LDBPK_211930"
                     /db_xref="GeneID:13386541"
     mRNA            complement(<693381..>695375)
                     /locus_tag="LDBPK_211930"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860662.1"
                     /db_xref="GeneID:13386541"
     CDS             complement(693381..695375)
                     /locus_tag="LDBPK_211930"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860710.1"
                     /db_xref="GeneID:13386541"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BFH9"
                     /translation="MPSCGASLVSGLKKLGKPIFSQTRELQQRKEKGLHPVSELRRFH
                     LFVCCFFCSVCASLTYAFDLFTTQFRSQFKLTLSDLTIISTVGLVFCYFTIPYTFIFQ
                     PFGPFSIFWICATATAIGGIGLAGVFRGQITGNTATITVFYAFLNTASGLIDMCYVST
                     LVEVFPRNRGPIVCLAKVMTGLGSSVFAAMSSTFFEDNIDGFIYFITAFVIVVCIWSS
                     FVIVLPPYIVNWWRRQGKTPEQIAVLKATVTYYERKFVPMPRLIVGYAVVLLLLVFFT
                     TEAPVLAYVPNVSRSGRIVVGIMTVALTCSIVVMLLPLRILGGMNELDPGLGRLEDSE
                     EAARTKDVDEDGRLVQLDDLGQEVRTSNEGSGEVLEPFRNATVGTATSSQSEDVINKY
                     AHQDPRYEGTVKDYLLNIDVWLIMLLFICYGCMGVIVLYNSSTISIALTGHKRSTQLS
                     ALYTAFLGVGSSVGRIAFGLFEAYVQHQDPENRKVLVSMALPVSPAMAFLAGIFLLFL
                     PGKAVLLPFILVYMEEGIFAGINALIFPCMFESNHNFLYNLSFFVQMCSIISFNLGMF
                     GRTIDREQRRLHIPMDRECNVKSCVRTPIIVSTVLAFFGVLVALAIHFRYAAFVRGTR
                     ERMRPPGAEGSEPTAGTAPIEEAKPCATEDANAKGLVLEE"
     gene            complement(<696786..>698198)
                     /locus_tag="LDBPK_211940"
                     /db_xref="GeneID:13386542"
     mRNA            complement(<696786..>698198)
                     /locus_tag="LDBPK_211940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860663.1"
                     /db_xref="GeneID:13386542"
     CDS             complement(696786..698198)
                     /locus_tag="LDBPK_211940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860711.1"
                     /db_xref="GeneID:13386542"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:E9BFI0"
                     /translation="MFALHTHAVLSSSFPSSLVSDGEAVAKDDHSGACVMKRGVSHVE
                     RLPRELLLNVFIDVIRNDGDNFGWIGVLSCVCRSWYQLCQHPVLWEYVAKRICVVYPL
                     VVRLHGAAPYDAVSQEIVNRMRLLESEEQCILQYDPLEPLPAPSRAALRKTMEKVRRY
                     RESQQYYKYVQRRRRVVLHFFLSVTLFSVALAITTAMCVSEGFDMGGLCNTTIVFGLL
                     WMAYLCIVAIIVSNVVMQAHFEPLPLLLRLRRNKLLIFASAVTILLGICDVIIPTLLI
                     QINLGRKERFSWLWCGITVILSFCLWQLYTLMYIMPAARQQLRYQMTHVNVREGFQFV
                     VLNIPNGFPFLFAAASFCALQYVQYGYRIYILLGGVPVIVSLGVLALVFLLDFYSLHR
                     FKDLAMGICFFLAMLFPISLLVWEFRGLCLLPLAAAAFGIFFAHARYVVSSAIHELMR
                     TIRAERNGCILRTPDANKKN"
     gap             700218..701637
                     /estimated_length=1420
     gene            complement(<701816..>702541)
                     /locus_tag="LDBPK_211950"
                     /db_xref="GeneID:13386543"
     mRNA            complement(<701816..>702541)
                     /locus_tag="LDBPK_211950"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003860664.1"
                     /db_xref="GeneID:13386543"
     CDS             complement(701816..702541)
                     /locus_tag="LDBPK_211950"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860712.1"
                     /db_xref="GeneID:13386543"
                     /db_xref="UniProtKB/TrEMBL:E9BFI1"
                     /translation="MKIFSTLGRPGTLATTKPKKGEVVLASPEATVSKYKGAIKQHKK
                     ALKELHACTERFTRALAAVAASLQFLTSDTHIPVMVQSSGALASGIEEVQDGVLLQDL
                     MEELDYSLSTRFKQIAEDQRELKESRERKSKAEKTLMLLRSQCDKLQLKKDVDAKMQA
                     LYLTKTQKRDEHEVECTRLRAEFEDAFHDFTTRFGILVYEDMKGLMEHLHRVLSALSY
                     QVRKCKDNILAHPITPKPIAEMS"
     gene            complement(<703269..>703676)
                     /locus_tag="LDBPK_211960"
                     /db_xref="GeneID:13386544"
     mRNA            complement(<703269..>703676)
                     /locus_tag="LDBPK_211960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860665.1"
                     /db_xref="GeneID:13386544"
     CDS             complement(703269..703676)
                     /locus_tag="LDBPK_211960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860713.1"
                     /db_xref="GeneID:13386544"
                     /db_xref="UniProtKB/TrEMBL:E9BFI2"
                     /translation="MSASQQRRPLTAEERARSLEVLADLLVSTFDGEVNTADVHRALS
                     TSDTADGDGDDSWRVRIMECAHERNARVAGEAAQRGSREWVCPMCETVNWIVDARETL
                     RKRQGESSFGFSLTVTDHLRCECCGYDGATAPS"
     gene            complement(<706100..>706585)
                     /locus_tag="LDBPK_211970"
                     /db_xref="GeneID:13386470"
     mRNA            complement(<706100..>706585)
                     /locus_tag="LDBPK_211970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860666.1"
                     /db_xref="GeneID:13386470"
     CDS             complement(706100..706585)
                     /locus_tag="LDBPK_211970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860714.1"
                     /db_xref="GeneID:13386470"
                     /db_xref="UniProtKB/TrEMBL:E9BFI3"
                     /translation="MERVRIRYVLTGACPSTYSGRVVHDFVALKQPNGCDTTIEMVKA
                     QFRSNWPADMKELAERISESGIRVLKAGRVLNDGDSLTRHLTASEREACLVSGDTKVG
                     DTNDEMQKPSVLVHMVIQGNRAPPAENSKREKHKVSSTPEGGNSGEGHEVKKDSCCCV
                     M"
     gene            complement(<708279..>709301)
                     /locus_tag="LDBPK_211980"
                     /db_xref="GeneID:13386471"
     mRNA            complement(<708279..>709301)
                     /locus_tag="LDBPK_211980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860667.1"
                     /db_xref="GeneID:13386471"
     CDS             complement(708279..709301)
                     /locus_tag="LDBPK_211980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860715.1"
                     /db_xref="GeneID:13386471"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:E9BFI4"
                     /translation="MLRRTEIALKKGWTHNPGRTRRGGKNLAWRPKISDAKLSQFVPL
                     ALVHPRRHPNNWQERQFNALGYTKWPKDIGFYNAGDNFEVTPEAAWRLYVHARDEPYW
                     GKLHCEKTIITLLPVVEKAPKENMERVLDVFRHYLKRYGADHYIYNAVMQAAAFAKNY
                     EQTEQLFKEMETLGLEPNAQSYVNMMLAAKLCGLPPEKSEAYFKRAVKDGAMQSVMRM
                     DTEFRMWMDQLDRLGSFTASSGYLSVNEEGAKPMPRDMWAIWGWHRSESKFISRHDLI
                     MQQVRARVHSGKELTGTVYTKTRRQPWAKFNGMLRHDYNGPSYRAPTTFPDAPEYTNE
                     AGHKAF"
     gene            complement(<710135..>710662)
                     /locus_tag="LDBPK_211990"
                     /db_xref="GeneID:13386472"
     mRNA            complement(<710135..>710662)
                     /locus_tag="LDBPK_211990"
                     /product="calcineurin B subunit, putative"
                     /transcript_id="XM_003860668.1"
                     /db_xref="GeneID:13386472"
     CDS             complement(710135..710662)
                     /locus_tag="LDBPK_211990"
                     /codon_start=1
                     /product="calcineurin B subunit, putative"
                     /protein_id="XP_003860716.1"
                     /db_xref="GeneID:13386472"
                     /db_xref="GOA:E9BFI5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BFI5"
                     /translation="MNEIPLTAEELQNIRESTALTDAQVQRLYKSFSKLNKDKSGKIT
                     RAEFNSIPALASNPLVDRVLAVMDTDGDSTVDFGDFVRALAVLSSATSKEDKLRFTFK
                     MYDIDGDGRISNKDLFQMLSIMVGVNLSQMQLQQIVDKTFIEADADRDGYITFEEFEA
                     LAVNSDFGDRLNLHF"
     gene            complement(<711387..>712082)
                     /locus_tag="LDBPK_212000"
                     /db_xref="GeneID:13386473"
     mRNA            complement(<711387..>712082)
                     /locus_tag="LDBPK_212000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860669.1"
                     /db_xref="GeneID:13386473"
     CDS             complement(711387..712082)
                     /locus_tag="LDBPK_212000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860717.1"
                     /db_xref="GeneID:13386473"
                     /db_xref="UniProtKB/TrEMBL:E9BFI6"
                     /translation="MHLLPKAATVTKRNMHGLITGDDCSMTKTLEPSAQLHPLVGYAS
                     AVSLPTVYSALVKVTGRVLSFAAAGGEGRLSREGFRELLALIGPAEVLSTKYADTMFT
                     SLPSYNADSDTTEALAIFTLLIEHRHHPRLNSNVEALFGAFDTDVKGVVPAEALYPDV
                     LAAWAVQRTYGNLRDQWQRFAAVISMESERSADAFPLLPPLASRTAIRAALCSAAAIY
                     TAACSLDLDGSSL"
     gene            complement(<714007..>715506)
                     /locus_tag="LDBPK_212010"
                     /db_xref="GeneID:13386545"
     mRNA            complement(<714007..>715506)
                     /locus_tag="LDBPK_212010"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003860670.1"
                     /db_xref="GeneID:13386545"
     CDS             complement(714007..715506)
                     /locus_tag="LDBPK_212010"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003860718.1"
                     /db_xref="GeneID:13386545"
                     /db_xref="GOA:E9BFI7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BFI7"
                     /translation="MPTSSGVDQAKLREVIRVLKSVGHVGMAESLEVEWGMRPNTASH
                     AKNAKKGRKSQPHKSRESSKARGNSFPSLSSIAVAPSPLQVTSQRRFVVTCIGDEEDL
                     WSPDEDPADAKCCIAPLFDYGAGLLRDHYVEYAAHPVSLVSVHPYEKQQPPSNLPWRH
                     FELKVFYEAGKTGSEEKKEFELVRGYLIGGRYRVDAPIDAATFSRTVRCYDEQTGQPV
                     CLKIIRNSKTFLDQGLDELRALTCVNDAGDADACCVVRLLDYFYFREHLVLVTELLFD
                     NLYEYARKLDIVERCAYFTLARLQRIVRQVLTALKLIHSVNLIHCDIKPENIAFKSVA
                     DCDVKVLDLGSSCYMTDTLSSYVQSRSYRAPEVILGCKYGPAVDIWSLGATAAELATG
                     TVLFNVESVPTMLASIASVCGPIPAEMLQEGRNTSLYVTKHGAFYDYEDEQLVFHFPS
                     EPPDAAVLFGFDDHDYVGFVRLCLTLDAALRPSAAQLLDHPFLTKTYTD"
     gene            complement(<716882..>717775)
                     /locus_tag="LDBPK_212020"
                     /db_xref="GeneID:13386546"
     mRNA            complement(<716882..>717775)
                     /locus_tag="LDBPK_212020"
                     /product="mitochondrial structure specific endonuclease I
                     (SSE-1), putative"
                     /transcript_id="XM_003860671.1"
                     /db_xref="GeneID:13386546"
     CDS             complement(716882..717775)
                     /locus_tag="LDBPK_212020"
                     /codon_start=1
                     /product="mitochondrial structure specific endonuclease I
                     (SSE-1), putative"
                     /protein_id="XP_003860719.1"
                     /db_xref="GeneID:13386546"
                     /db_xref="GOA:E9BFI8"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR020046"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9BFI8"
                     /translation="MPAREKAIVLIDGPALVHRWYHRWSYTAERYGTSIDVKQFAIKN
                     ARFMIATAHSFDPAHMAQHLLSPQTEYTHTPKHNRIIVCFDHGDGGRRQIYADYKANR
                     LEKTVTPEFRLIERVAKKVFADEPRESLLVVPDCDAGLTNLNAEADDMIATLAFFNQQ
                     SRRPTVVMSHDYDLYQLVDEAKKSYHYDIRTKHLVSERGVIERVGVPPKLVRDFKSLA
                     GDSSDNIPGVNGIGKVRARNLLKKYGNLDGILFKGIKKETGHLGELLNEGAKMALISR
                     QLVDFRMCPKVIKVCESFMRM"
     gene            complement(<718835..>720166)
                     /locus_tag="LDBPK_212030"
                     /db_xref="GeneID:13386547"
     mRNA            complement(<718835..>720166)
                     /locus_tag="LDBPK_212030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860672.1"
                     /db_xref="GeneID:13386547"
     CDS             complement(718835..720166)
                     /locus_tag="LDBPK_212030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860720.1"
                     /db_xref="GeneID:13386547"
                     /db_xref="UniProtKB/TrEMBL:E9BFI9"
                     /translation="MDADDLRQLAINVSLDDIAASSDATKRLQQLLTPQQIVAMLKDA
                     SATHALRALVGEMEAVGNADVFHLIGRALEDVFTQPSRESKAVLLAPAAQFLVEFIVR
                     SAAAADTAVASSMSKTLYRLIAIAGDSTEAAAFLGPCLDANFHNEQVLRLFDCDAAES
                     AENKTVCGFLEQWTSLLPFMFEATLNAFENDPLLQANYTIASGVACRTVAVPSALRQR
                     TMEILRANDDSLCFAYVCRFWSIALIHHEANGQRDAAACVSTVIPAVEASERDEGATE
                     AIFDLLGSAASTQAGWDAVTGQLPCKTLQVRLSSTSPSLRLSTLNLMLSMLTSPHMNV
                     SFFTKDLLLDAWQTRTSPDDMVRLALWRVANAALLQESLNRMLGAVCASFLSSGVHEE
                     NVAVRSLKLTAAERLLRHSTLPENVKARLLQVVERGLYPAGSSGVSLMTKD"
     gene            complement(<720915..>721367)
                     /locus_tag="LDBPK_212040"
                     /db_xref="GeneID:13386548"
     mRNA            complement(<720915..>721367)
                     /locus_tag="LDBPK_212040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860673.1"
                     /db_xref="GeneID:13386548"
     CDS             complement(720915..721367)
                     /locus_tag="LDBPK_212040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860721.1"
                     /db_xref="GeneID:13386548"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ0"
                     /translation="MEEQLFQSDIVDLGLTTLEALVREQRLQNARMEARLRVLEKRMS
                     SLPLHMGLKAPKKLTCSDGDDGGATRNTALSLDEVEAPGPNTSADDPATPMCDYCFLF
                     SHKCFPCPRCGREWYCSAACQRLRHRCHASRCGQHYLPQTRLQPRVAH"
     gap             723563..723661
                     /estimated_length=99
     gap             725235..725333
                     /estimated_length=99
     gene            complement(<726228..>727892)
                     /locus_tag="LDBPK_212050"
                     /db_xref="GeneID:13386549"
     mRNA            complement(<726228..>727892)
                     /locus_tag="LDBPK_212050"
                     /product="RNA-binding regulatory protein (pumilio family),
                     putative"
                     /transcript_id="XM_003860674.1"
                     /db_xref="GeneID:13386549"
     CDS             complement(726228..727892)
                     /locus_tag="LDBPK_212050"
                     /codon_start=1
                     /product="RNA-binding regulatory protein (pumilio family),
                     putative"
                     /protein_id="XP_003860722.1"
                     /db_xref="GeneID:13386549"
                     /db_xref="GOA:E9BFJ1"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ1"
                     /translation="MAWTVHEDEYRTEGYTNLEEILQYVVYTEESVQQPKPTVKYTKS
                     SQVFAMPSPLTAAELSSPINHQLTNTVPWQPQRHTPTNSSFHSLGIPYTSAQSPQQRR
                     CNNRFNGSYSGHCDRKPKIVSGSETCVLSPGARKRGMSTGQMDHMMATELNSMPVPEL
                     IMQEVLASQDVMVGGGYGDWSGHGSKYFQGGALTADSLRGRVYETAKDQHGCRYLQRW
                     LDTNCDTEALQVMMDEIIPHVGELMTDQYANFLIQKLFDIMPDDVRYKVAVVAAPHIC
                     MISLTPHGTFSVQKMIETISTREEMKIICEALAKDVVRLVKDAHGNHVIQKVLQRFDF
                     DDKEYIYRAVATDCVSIAKNKQGCCVLQRCLEHASPRQKAALVDQVLACCLQIAQDPF
                     GNYVLQYVLEAHDSKINDTIALAFLPHLVQLSMNKFSSNVMEKVLRGASRPVQVMYME
                     EMCNPEIISHLIQDDYGNYVLQTALTINAPVQAEQLVNAIRPFMPLIKNAPYAKKMEG
                     KMEAVARKIEGNNFHAPRDCEIDARQGSSRGSPHGKFDRSPNHGRR"
     gene            complement(<728451..>729206)
                     /locus_tag="LDBPK_212060"
                     /db_xref="GeneID:13386474"
     mRNA            complement(<728451..>729206)
                     /locus_tag="LDBPK_212060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860675.1"
                     /db_xref="GeneID:13386474"
     CDS             complement(728451..729206)
                     /locus_tag="LDBPK_212060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860723.1"
                     /db_xref="GeneID:13386474"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ2"
                     /translation="MVTETFLRKALFARCAIDLCGKKILPKDAFVALLTQGKLTPSQY
                     QMTDAEAVKYIDTLKRAKMIVEVDDYVYTDVKAVVDAVHLKSGLPLVPATSKTFENLY
                     HALSESLAAFHRQSLPAAERAVRRQREFWAFTALGSGTQMLVLAYLTFQVYGWDVMEP
                     VTFFVTTATALCSYAYFLYFRAEHSYESVDDSFLPHLLMRELGVLRVDADKAIRDMKA
                     MQELQAAVSLDDERVSKLVEAAAKKKSTSACHS"
     gene            complement(<729656..>730351)
                     /locus_tag="LDBPK_212070"
                     /db_xref="GeneID:13386475"
     mRNA            complement(<729656..>730351)
                     /locus_tag="LDBPK_212070"
                     /product="proteasome alpha 2 subunit, putative"
                     /transcript_id="XM_003860676.1"
                     /db_xref="GeneID:13386475"
     CDS             complement(729656..730351)
                     /locus_tag="LDBPK_212070"
                     /codon_start=1
                     /product="proteasome alpha 2 subunit, putative"
                     /protein_id="XP_003860724.1"
                     /db_xref="GeneID:13386475"
                     /db_xref="GOA:E9BFJ3"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ3"
                     /translation="MSEAFYGLTTFSPSGKLVQIEYATTAAGKGTTALGVKATDGVVI
                     AAKKKAPSTLVDASSIQKVFVLDEHVGCTYSGMGPDCRVLIDSARKNCQQYRLMYNES
                     IPISQLVRKISALYQEFTQSGGVRPFGCSLLVAGVDANGYHLYQVDPSGTFWAWKATA
                     IGTGSPDAKAFLEKRYTVDMELEDAVHTALLTLKEGFDGQMTSENTEVGRVVGNRFEV
                     LSVDQLRDYLDQI"
     gene            complement(<731108..>731581)
                     /locus_tag="LDBPK_212080"
                     /db_xref="GeneID:13386476"
     mRNA            complement(<731108..>731581)
                     /locus_tag="LDBPK_212080"
                     /product="cytochrome c oxidase subunit VI, putative"
                     /transcript_id="XM_003860677.1"
                     /db_xref="GeneID:13386476"
     CDS             complement(731108..731581)
                     /locus_tag="LDBPK_212080"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit VI, putative"
                     /protein_id="XP_003860725.1"
                     /db_xref="GeneID:13386476"
                     /db_xref="GOA:E9BFJ4"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ4"
                     /translation="MPHKEHKKYRVQREDLPAMPHFSDFNDPRFCGTTNKQKNGILAY
                     YQWLHCIGNWGEEHSMCKKMRWYVERMMHETWLEKWEEKRALGHFDHTVLYGVKPWKE
                     FEPLYQPVKKNRKGAYEYWLDRDFEPLYDVDASDWREKAPILHDMFVLGKKPVSE"
     gene            complement(<731996..>732397)
                     /locus_tag="LDBPK_212090"
                     /db_xref="GeneID:13386550"
     mRNA            complement(<731996..>732397)
                     /locus_tag="LDBPK_212090"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_003860678.1"
                     /db_xref="GeneID:13386550"
     CDS             complement(731996..732397)
                     /locus_tag="LDBPK_212090"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_003860726.1"
                     /db_xref="GeneID:13386550"
                     /db_xref="GOA:E9BFJ5"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ5"
                     /translation="MVKPTVSKAIVKKRTKRFTRHRYELFPQLSSSWRKPRGEDSPVR
                     RRYKGQKAMPNKGYGSDRATKYITPSGFRSFPINNVEDLYMLVMQNRKYAGVISHTVG
                     ARTRKAIARKAMELDVRLANGNAKLRKIANQ"
     gene            <733999..>734514
                     /locus_tag="LDBPK_212100"
                     /db_xref="GeneID:13386551"
     mRNA            <733999..>734514
                     /locus_tag="LDBPK_212100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860679.1"
                     /db_xref="GeneID:13386551"
     CDS             733999..734514
                     /locus_tag="LDBPK_212100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860727.1"
                     /db_xref="GeneID:13386551"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ6"
                     /translation="MPTSKEAADQSRKFGFKETREQYQQRKRQEKQLKWTVRLSREDL
                     GKLKIELESLKRARFLAPQQNERKRLVQRMIRDLEAAENKEPEEETPVVATTPPAVDS
                     DSDDDIFFAKGTLVNDEHKRLFIPRSIRRKPEEKNCEKTAQQLAGEAEKELLAAVHDD
                     DDIDSFLDSLQ"
     gene            <735025..>736173
                     /locus_tag="LDBPK_212110"
                     /db_xref="GeneID:13386552"
     mRNA            <735025..>736173
                     /locus_tag="LDBPK_212110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860680.1"
                     /db_xref="GeneID:13386552"
     CDS             735025..736173
                     /locus_tag="LDBPK_212110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860728.1"
                     /db_xref="GeneID:13386552"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ7"
                     /translation="MDLGMCLLTRASTYRRNGGELGTSMSSKIAELSGRILSQQQYSQ
                     ILEQRRWLQGLLKGVSLDMGAKEEEKSASPVVLPYGSIVSGTSFTDGDADYIVSFPIV
                     SESTRQSGACVIARERQEKCLSDIFSHIRKCNSDVELHPQRIFRARVPIVQYVRKSAQ
                     ESTKFDLSLSLDGLKNSLLLRHYMAGDPRLRLGVLGAKQWGREQQILNARRGWISPYA
                     LSIMYIHFMKDTGRTALSFDEEAVSQRVNAIVSTAAEAEGDISHVDELASILPLQEAD
                     ISLVEKDVLDFFAFYGTPGGFDFDASVVDIRSRERFSTKDQWCQFLDQLDEKERWHLL
                     GHEVILLRDPFEPHSLGRSVDFFRGEEIREKFRSAAVKKEPLSLFASL"
     gene            <736756..>737913
                     /locus_tag="LDBPK_212120"
                     /db_xref="GeneID:13386553"
     mRNA            <736756..>737913
                     /locus_tag="LDBPK_212120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860681.1"
                     /db_xref="GeneID:13386553"
     CDS             736756..737913
                     /locus_tag="LDBPK_212120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860729.1"
                     /db_xref="GeneID:13386553"
                     /db_xref="GOA:E9BFJ8"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ8"
                     /translation="MSPVLVPTACENWSLNIDDESTRRFWWNNTYSITLWEETLNIEK
                     QTETITDGDVWSKFIDLQLRCAFKICSICHSPEGNDDMKICCYCGNTVHENCSEPAAP
                     EQIMWKPANLAYVEHMRACFQCQAVDYKEPSAPQSPSECDNARRAAKRALTISDEYPP
                     ATVERIQELLQQAETTSNDAVLLGELKSLVQSYFQSPQSLRFLRKERVASKGGGIGVV
                     AAQKIPAFSIIGVYPGYLDFMSGEQAKCGRPVPKYALMEYNCANYFNEVFVELQTTFT
                     PFINEPNVDEKSNCAWIQEPHRKNGRLSVICVRDIQEGEELTIGYGPIYPRTYPYCYD
                     AYACHQIEGHATHPCYSLWHWPTLQEADARFVCYIGYIEKEDCYVLWKNET"
     gene            <739004..>740296
                     /locus_tag="LDBPK_212130"
                     /db_xref="GeneID:13386477"
     mRNA            <739004..>740296
                     /locus_tag="LDBPK_212130"
                     /product="centromere/microtubule binding protein cbf5,
                     putative"
                     /transcript_id="XM_003860682.1"
                     /db_xref="GeneID:13386477"
     CDS             739004..740296
                     /locus_tag="LDBPK_212130"
                     /codon_start=1
                     /product="centromere/microtubule binding protein cbf5,
                     putative"
                     /protein_id="XP_003860730.1"
                     /db_xref="GeneID:13386477"
                     /db_xref="GOA:E9BFJ9"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BFJ9"
                     /translation="MGKKKVGEIQRSEDFCIPAGDRDANSALPAEEWPLLLKNYDKMN
                     VRSTHFTLLECGWSPLRRPLAEYIKYGMINMDKPSNPSSHEVVSWIKRILKCDKTGHA
                     GTLDPKVTGALIICTDRATRLVKSQQNAGKTYIGVLRLHDTVSQKKVNAALQRLTGPC
                     FQRPPLIAAVKRQLRIRNIYSNQLIEYDKHRHLAVFETHCEAGTYIRTLCVHLGLILG
                     AGGHMEELRRIRTGVITENDHLSTMHDVMDAQWLYENERDDTYLRRVILPCEYLLSNH
                     KRIVVKDSAVNAVCYGAKLMIPGLARFDNGIERDDVVVLMTTKGEAIALAYAEMTTSQ
                     MASVDHGIVARSKRVIMDRDTYPRRWGLGPIAVKKRSMMKDGLLDKYGRPQSNTPPDW
                     FYVDYGGVKTNAEGVQYGQAPSKVSGVKRQRVPDSDDD"
     gene            <741694..>742605
                     /locus_tag="LDBPK_212140"
                     /db_xref="GeneID:13386554"
     mRNA            <741694..>742605
                     /locus_tag="LDBPK_212140"
                     /product="ATP synthase F1 subunit gamma protein, putative"
                     /transcript_id="XM_003860683.1"
                     /db_xref="GeneID:13386554"
     CDS             741694..742605
                     /locus_tag="LDBPK_212140"
                     /codon_start=1
                     /product="ATP synthase F1 subunit gamma protein, putative"
                     /protein_id="XP_003860731.1"
                     /db_xref="GeneID:13386554"
                     /db_xref="GOA:E9BFK0"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:E9BFK0"
                     /translation="MSGRLRLYKEKLEGYNRFYSIVKTIKMVTMAKFRQAQVRIKTRD
                     YTLRYTEKAFSKPGQLVGDSPQAKTIYIPVMTNRGSCGALNSNVVKAIDSVASSRAYL
                     MPLGKRGIESLSKLYPSSFRMGIVNDMHEPMHFAYATYVWENAQQLCPEADRVHVIFH
                     RCVSAGSQKQCYYNIPSYEKWREDLADASSTENQKSRYLFANTLLNEDEQMIRDFYDF
                     HATLAILNAVCENELSEQAARLVAVEGQLSNISTLQQKTSSLYNKTRQSSITSSLIEI
                     ISAMTSLEGNAAKGVQRTNFWEGARTM"
     gap             743802..744025
                     /estimated_length=224
     gene            <745168..>745731
                     /locus_tag="LDBPK_212160"
                     /db_xref="GeneID:13386555"
     mRNA            <745168..>745731
                     /locus_tag="LDBPK_212160"
                     /product="vacuolar ATP synthase, putative"
                     /transcript_id="XM_003860684.1"
                     /db_xref="GeneID:13386555"
     CDS             745168..745731
                     /locus_tag="LDBPK_212160"
                     /codon_start=1
                     /product="vacuolar ATP synthase, putative"
                     /protein_id="XP_003860732.1"
                     /db_xref="GeneID:13386555"
                     /db_xref="GOA:E9BFK1"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:E9BFK1"
                     /translation="MKYQIASVVAAAALFGGAAAVSCSDKYPQSSAFFGSMGCASALI
                     FANLGSAYGTAKSGVGVAHLGILHAERIMRGIVPVVMAGILGIYGLIVSVIINNNIKA
                     DDNSYSAFAGYLHFGAGLAAGLSSLAAGLSIGIAGDASVRAYGKQEKIFVAMILMLIF
                     AEALGLYGLIIALLMNNTAGKVAAGCQ"
     gene            <747271..>747585
                     /locus_tag="LDBPK_212170"
                     /db_xref="GeneID:13386478"
     mRNA            <747271..>747585
                     /locus_tag="LDBPK_212170"
                     /product="vacuolar ATP synthase, putative"
                     /transcript_id="XM_003860685.1"
                     /db_xref="GeneID:13386478"
     CDS             747271..>747585
                     /locus_tag="LDBPK_212170"
                     /codon_start=1
                     /product="vacuolar ATP synthase, putative"
                     /protein_id="XP_003860733.1"
                     /db_xref="GeneID:13386478"
                     /db_xref="GOA:E9BFK2"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:E9BFK2"
                     /translation="MKYQIASVVAAAALFGGAAAVSCSDKYPQSSAFFGSMGCASALI
                     FANLGSAYGTAKSGVGVAHLGILHAERIMRGIVPVVMAGILGIYGLIVSVIINNNIKA
                     DDN"
     gap             747588..747686
                     /estimated_length=99
     gap             748378..748476
                     /estimated_length=99
     gene            <750077..>751471
                     /locus_tag="LDBPK_212180"
                     /db_xref="GeneID:13386479"
     mRNA            <750077..>751471
                     /locus_tag="LDBPK_212180"
                     /product="GPI transamidase component GAA1, putative"
                     /transcript_id="XM_003860686.1"
                     /db_xref="GeneID:13386479"
     CDS             750077..751471
                     /locus_tag="LDBPK_212180"
                     /codon_start=1
                     /product="GPI transamidase component GAA1, putative"
                     /protein_id="XP_003860734.1"
                     /db_xref="GeneID:13386479"
                     /db_xref="GOA:E9BFK3"
                     /db_xref="InterPro:IPR007246"
                     /db_xref="UniProtKB/TrEMBL:E9BFK3"
                     /translation="MLRRAIFIGARHHGGKLAPFFLVLGIGLLCLLPVLRTRKIYIDE
                     NAIGQMFPSADAGSVTAYLDPTVRWPQQLVRGRRSPGSEIVAVYVNTDYPASVSLANA
                     LIEVIRRRKSLACDVQFYFVNSSEEWPVPQAYTRAALVLNLSTLYNRHICIDTLGANG
                     IQPNQDYTNTAAQFAAANQFLPSYLCQRRHRSTDDAHAGFWHYWAYLEASVQLPTRPQ
                     PWHIIPSHSINTIAISSDPLYMASSMFPHSQLPDAFAQLVLQIIVSLNGLEEKFHHST
                     FVWLPVSLWHYVEYDHAQFCIILFVASIFSTTYSEYQLRGISITPLFVTLLLTPVAAA
                     AVFQVAGWGAVAAASAAFSLLFRLLMGHVNSGMLLSFNAIALCLLIILQPACGLVAGA
                     AAAIQVSFIHNALQNRPAMAVGAAVSSALAYYFIYHLRLPLFGVDGISELFVSFVIYP
                     NAVWIGSRLLCLLY"
     gene            <752042..>752320
                     /locus_tag="LDBPK_212190"
                     /db_xref="GeneID:13386480"
     mRNA            <752042..>752320
                     /locus_tag="LDBPK_212190"
                     /product="60S ribosomal protein L37a, putative"
                     /transcript_id="XM_003860687.1"
                     /db_xref="GeneID:13386480"
     CDS             752042..752320
                     /locus_tag="LDBPK_212190"
                     /codon_start=1
                     /product="60S ribosomal protein L37a, putative"
                     /protein_id="XP_003860735.1"
                     /db_xref="GeneID:13386480"
                     /db_xref="GOA:E9BFK4"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:E9BFK4"
                     /translation="MAKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGK
                     FAFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELAKI"
     gene            <753128..>753862
                     /locus_tag="LDBPK_212200"
                     /db_xref="GeneID:13386481"
     mRNA            <753128..>753862
                     /locus_tag="LDBPK_212200"
                     /product="proteasome alpha 5 subunit, putative"
                     /transcript_id="XM_003860688.1"
                     /db_xref="GeneID:13386481"
     CDS             753128..753862
                     /locus_tag="LDBPK_212200"
                     /codon_start=1
                     /product="proteasome alpha 5 subunit, putative"
                     /protein_id="XP_003860736.1"
                     /db_xref="GeneID:13386481"
                     /db_xref="GOA:E9BFK5"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BFK5"
                     /translation="MFTSKSEYDRGVNTFSPEGRIFQIEYAVEAIKLGSTSLGIRTPE
                     GVVLAAEKRVPSTLVVPSSMSKIMEIDSHIATVMSGMVADARILVEHARVESQNHRFT
                     YNEPMSVESCTLATCDLSIQFGESGGKRKLMSRPFGVSLLIAGVDEKGPQLWQTDPSG
                     THTRYDAQAIGGGAEAAQSVFTERYHRNMTLEEGETLAVDILKQVMEDQLSPENIEVA
                     VVRADDGKLHMYTPTEIKAIMSRMPE"
     gene            <755276..>756670
                     /locus_tag="LDBPK_212210"
                     /db_xref="GeneID:13386556"
     mRNA            <755276..>756670
                     /locus_tag="LDBPK_212210"
                     /product="peroxin 14, putative"
                     /transcript_id="XM_003860689.1"
                     /db_xref="GeneID:13386556"
     CDS             755276..756670
                     /locus_tag="LDBPK_212210"
                     /codon_start=1
                     /product="peroxin 14, putative"
                     /protein_id="XP_003860737.1"
                     /db_xref="GeneID:13386556"
                     /db_xref="GOA:E9BFK6"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:E9BFK6"
                     /translation="MAAEVPAQPQAALEAPLPEPEQPSSSELDADTTVQSAIRFLQDS
                     RVRRSPVESQIRFLKGKGVPDEQIKYALAKVGRTVTAEKIASVRAPPANAAPTGATAT
                     ACTTPLSAQLKTARQNAPVTMTPGPQYTQTLFPHSPPPPQVERQTKTVDWRDVVIGAG
                     AAMLSGFSAYKLFNRYSPYEFRRKTDKKSRLYRGSSSRPRSANIASSGSETDASSTPQ
                     RGCVPPLPPPPPMAAAAEPSVSAASPAALTEEVKRLQTELDEAKEALANERKKCADLA
                     VSAAKIRADKQQLSRANDRLTQQIDGLKKDIERLEREKSSAVGEATQTTAEGAVAAAP
                     GPPSTYFPSVTTEGEQARNSPEVTSVTSASAPNSDVVPVLPVVPSPEAPATATAAPAM
                     PDPITEAVQVAPASAAAVAPAPELPPVVVAASTPYADAAAPVATVTEVAAPLLPIGGA
                     EPPKAGDGTPMSIG"
     gene            <757390..>760431
                     /locus_tag="LDBPK_212220"
                     /db_xref="GeneID:13386557"
     mRNA            <757390..>760431
                     /locus_tag="LDBPK_212220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860690.1"
                     /db_xref="GeneID:13386557"
     CDS             757390..760431
                     /locus_tag="LDBPK_212220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860738.1"
                     /db_xref="GeneID:13386557"
                     /db_xref="UniProtKB/TrEMBL:E9BFK7"
                     /translation="MDSPRKEEFVLSSGEGPFAVTIKRFATADSSSSSSGDGAEAPHP
                     TSRPRFGSGSNIDSSGLPDDSGDSHNLSSYMGLPSNLAPANAEYAPRVESGAPLVGDV
                     LNGTATDVVAKQRGLQLQRFSTVDSSARDERSMPHESSRSSSSADLAPFRQRGGGATA
                     AAGAQHRLSQEPLVHAPAASLARETPPRGRSAAGEDAAAPSPKEMDDATVAGDSSRRR
                     LPQSRSHVAPVTQPCAGSPASSAVVATVPESKPAPVAAQSLTLPEACKRFGHGHDGAA
                     ACGAFTRAPKKSRPAPAAAEVQQPQSQRQSGDAEPRSPSSGGAHTRVPQWTCHMKKKD
                     GQYVTCVRVTNPTALYDRGINGLRRASAKREAMRAKLEEAALAEATFRPTISPRVRAL
                     KRSGDSAGAAHDSSAQLRYRLQLLELPDEPAHAAHRHTPRLSHTSEMIVRACRGRRGA
                     EPPPEERLYRDYFYRQQAIEEARLVTASPAVVRSKRHIDAHIAELYSFEQQRQRAIAA
                     ARDALLSASSEAHRRLCVDPRALVERLTKPRSPSQQRSAAAQLEKDPCPFHPQTSASS
                     AELAHQARLRGLHRWVRYFCDADILSMAVLSTFQGQAAQEAATLSAVLRRHSPTKTEW
                     SVEELADAFVNDAGDNSFIAELWRRRPPIGEASAALGELTHRPCLNPKSAMIVDKMNA
                     EHRGGPTHDRLFLNARAKQLSQRQQELEEEQASLEDKQREQKRRQRLQAAWRAQEAQR
                     LEAYRAEKAEERRKSAAAEASAAEERLHPCTTSCSRQLFMPSSSPQLRSGGRASVPPS
                     ASPRQSSAAATDAVILKPRSYTPSMPTASSTRPPEVSRVRGSNTDNTTTARNKGSGGN
                     GRGSGCPSPAFHPTTTSAQAAPAAQCLTSSIPRNVEDWPVANKQELDRAAEALRDLLV
                     DPARSCRASPQGSAASSQRSLSAATCFTPCDVNRPLDSQCKLHAPSLDVLLVCAQLRD
                     SRAFPAGERERLDRAQKRQLRELGRLLYSRYMSRVHGKIST"
     gene            <761107..>761346
                     /locus_tag="LDBPK_212230"
                     /db_xref="GeneID:13386558"
     mRNA            <761107..>761346
                     /locus_tag="LDBPK_212230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003860691.1"
                     /db_xref="GeneID:13386558"
     CDS             761107..761346
                     /locus_tag="LDBPK_212230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860739.1"
                     /db_xref="GeneID:13386558"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:E9BFK8"
                     /translation="MPSIQSTIVSRIQEAFQPAELEVTEVSAEDAKYNVRIVSAAFAG
                     VPLIQRHRMVNDLFGEELRSGTIHALGISAKPPPS"
     gene            <765280..>765516
                     /locus_tag="LDBPK_212240"
                     /db_xref="GeneID:13386559"
     mRNA            <765280..>765516
                     /locus_tag="LDBPK_212240"
                     /product="beta tubulin"
                     /transcript_id="XM_003860692.1"
                     /db_xref="GeneID:13386559"
     CDS             765280..>765516
                     /locus_tag="LDBPK_212240"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_003860740.1"
                     /db_xref="GeneID:13386559"
                     /db_xref="GOA:E9BFK9"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="UniProtKB/TrEMBL:E9BFK9"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVISDEHGVDPTGTYQGDSDLQL
                     ERINVYFDESTGGRYVPRAVLMDLEPGTMDSVRAG"
     gap             765518..765920
                     /estimated_length=403
CONTIG      join(FR799608.1:1..767234)
//
DBGET integrated database retrieval system