GenomeNet

Database: RefSeq
Entry: NC_018254
LinkDB: NC_018254
Original site: NC_018254 
LOCUS       NC_018254            1024085 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 27.
ACCESSION   NC_018254
VERSION     NC_018254.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 1024085)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1024085)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799614.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1024085
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="27"
     gene            complement(<3037..>4161)
                     /locus_tag="LDBPK_270010"
                     /db_xref="GeneID:13389117"
     mRNA            complement(<3037..>4161)
                     /locus_tag="LDBPK_270010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861811.1"
                     /db_xref="GeneID:13389117"
     CDS             complement(3037..4161)
                     /locus_tag="LDBPK_270010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861859.1"
                     /db_xref="GeneID:13389117"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BIT6"
                     /translation="MESKVPLLLYFMVTNHPEVKQYTELLCHQVDQANRRLKDENFGD
                     VYQEFGVDAGLAIKLGMVDCLQEPGLMSKFHIDPHMFPLIYFVRNKVFCDKMAGVVTE
                     SQVKEAVEAFIDYAKLESKNESEGVSLLQKVRRQDNDDENAMTLIAAAHGKMQAGDPA
                     KGKQLFEKALRMSMEDIEIVKKRYGVPEKKMTPELWAKLKREPCYNSAPEALCGLAMC
                     AMASKQRDEAFRLAARVREEFPFAPQDMRGVAEAVVRIELIQVVDYDPDTDNYMRLLK
                     FDELVSEPAQFYKHHLKRAVAFYVEGVAGQAIEECLRLIRAEPKLLSALKEGGIVPKD
                     LRLGPTAVTPARQVIRAIFEALGPANEHAEKGRKLLQLYL"
     gene            complement(<5247..>8336)
                     /locus_tag="LDBPK_270020"
                     /db_xref="GeneID:13389121"
     mRNA            complement(<5247..>8336)
                     /locus_tag="LDBPK_270020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861812.1"
                     /db_xref="GeneID:13389121"
     CDS             complement(5247..8336)
                     /locus_tag="LDBPK_270020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861860.1"
                     /db_xref="GeneID:13389121"
                     /db_xref="GOA:E9BIT7"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR019170"
                     /db_xref="UniProtKB/TrEMBL:E9BIT7"
                     /translation="MSQSRSFPCRASGWRIGTMLVMIVCAVGAASQQSTDCDTLGFIL
                     DVADRSCQACPAHARRVQGTCVCDVGYALHVDASTGKLSCVGCAAKKMMVSDVGAGNA
                     SAYCLPCGGDRQLTCLVDATYDESAQTCVCASGSVLAKQVGTLLLTAAMCAPCASSEC
                     VRCSFPYALDASSGVCRCSAGFTMLYDGSCVPTEAYDSMAAAASGTSVALSPPNIDNS
                     GAAGPLTRVFPVQTYSLGAALLCSRGNSTACNLLANLCVVMNYQVTATPCALYEHIKQ
                     SKPCDDPWCETVDGLPWLYYARSNADVLSNVTTELRLSARQKLQLVVSAFDLYGNWLG
                     YQSMVSQVNPCFLKNTELHTFFAAGDTRATSCHVNWHWFLRANRTLFYEVYLRHPLNA
                     SRLVPVPLLIDYSNYGFEPATFYDPWLYRGGAVASNGAMPEGAFRRRFYAYDNVGGSG
                     ASPLRSLPSYVTALRSASLVLGTDHRDDRYVMTPLVVLQYASKMVSTIADAAPADDLE
                     VERQTPLNTSGRSDYTLHCEMRSYYLPSTDSVSQGLKVAVIVLCSLCFFSAWVRTYGW
                     MRRRQYLVLDWFALLRFFVYLCNHISNMFFLAVAVASWYMFIAYKRQLSLSRAMRLGD
                     VYVNAMLYVAVTAKGITVLYRLAEQCNADYFVIDWERSKGQLLRENKVVPVSMWRSTF
                     VANALNELQALRYWCPLLTMTIILLFLVGLDYQNMSASVPRGSRQVDNMTVSFGTLRV
                     AIDTFFWVAVALVMYLFEYQIYYRFIVVHPLQAFVDLCSVSNISIIILLEQQWGFYIH
                     GESIHAHAEVSMEEFQSNLFLEAQGNLPVRGLGGQSKCQSLEVYLGPYTRQYLYMCYM
                     EMHIENQRSLLKRERATNPAQWHYIRFLFCFSRQLCVYTETALAIRDRINYAFQQSVR
                     RAESTLLVKFMLQKWLDFPPNVMYMNGPQRGDHCGKDLFFIDDVQSYGRAFLCGLDFD
                     LFVLYAALFAAIDTALQNFYVAMVLAFAVEVVVHFYRVREGLANLSQKTMIDDRFFL"
     gene            complement(<9189..>10199)
                     /locus_tag="LDBPK_270030"
                     /db_xref="GeneID:13389122"
     mRNA            complement(<9189..>10199)
                     /locus_tag="LDBPK_270030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861813.1"
                     /db_xref="GeneID:13389122"
     CDS             complement(9189..10199)
                     /locus_tag="LDBPK_270030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861861.1"
                     /db_xref="GeneID:13389122"
                     /db_xref="GOA:E9BIT8"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="UniProtKB/TrEMBL:E9BIT8"
                     /translation="MDAQGPFLVIPTKRGAVPTLTPAQANAILEPSERILATSVFEAM
                     DFVKPCIEAGMPLSTYCGLRGYKTVLTLRSSFQGLHASASSTDTTVAGDNERGRAVVS
                     FERWRDIVKATRPTLAVAVHDSLPLCEPLNKRRRVATTRSETWLAKTEEASDLGCTIL
                     PSISAGRTHEGGYIDAVPRGENSYEFFQTLQALQLSPKKCTMCVAPSISALLAAMVSN
                     VSLLECPLPWALAEKGVALLLPLEEATTTTPEPVVPLLDLNDNMYALDINPIAEGCDC
                     FTCRRHCRAYVHHLLTVQEMNSDILLVMHNLAQVVRLVRAYRCAGTSTREALVSRVAS
                     AL"
     gene            complement(<10904..>12187)
                     /locus_tag="LDBPK_270040"
                     /db_xref="GeneID:13389123"
     mRNA            complement(<10904..>12187)
                     /locus_tag="LDBPK_270040"
                     /product="CAAX prenyl protease 1, putative"
                     /transcript_id="XM_003861814.1"
                     /db_xref="GeneID:13389123"
     CDS             complement(10904..12187)
                     /locus_tag="LDBPK_270040"
                     /codon_start=1
                     /product="CAAX prenyl protease 1, putative"
                     /protein_id="XP_003861862.1"
                     /db_xref="GeneID:13389123"
                     /db_xref="GOA:E9BIT9"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:E9BIT9"
                     /translation="MSSSPNLFLRAAVVSLNVIGMWDAYLVLRQRRANQTKEMPSYFR
                     KDITDEEFAKAQAYEGEKSTFSFLQHLKGLVITNMGIFLRLPAFLYYLVAQRASLSTG
                     SFSHNYAAAVAGELISVVLDIPFSFYENFHIEDRHGFNEMTKTEFVKDIVKTLLLRVT
                     LLYPLQIKLIQFVVQRFGERFPLYLFLGMSVMLVVFLLAMPTVIQPLFNKFTPLDAES
                     TLYKKIELLSKEMSFPLKKVFVVDGSRRSHHSNAYFYGFGSNKRIVLYDTILEQLRDD
                     DESIIAVLCHELGHWKHNHIYVNLAMALGQLMLISYGARLVVFDKRVYEAFGFGEVDP
                     VIGLNIFAEMFYEPLSTFIGYGFCYVSRRHEFQADRFAVTHNRGEGMKKALLVISKEN
                     RASLTPDPLYSALHYTHPPVLERLQAIDAELKKRE"
     gene            complement(<12858..>15221)
                     /locus_tag="LDBPK_270050"
                     /db_xref="GeneID:13389124"
     mRNA            complement(<12858..>15221)
                     /locus_tag="LDBPK_270050"
                     /product="DEAD-box helicase-like protein"
                     /transcript_id="XM_003861815.1"
                     /db_xref="GeneID:13389124"
     CDS             complement(12858..15221)
                     /locus_tag="LDBPK_270050"
                     /codon_start=1
                     /product="DEAD-box helicase-like protein"
                     /protein_id="XP_003861863.1"
                     /db_xref="GeneID:13389124"
                     /db_xref="GOA:E9BIU0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BIU0"
                     /translation="MSSYVSVSGLSEVGEDDALQRLLSSRGVSGNCPNALLDAMRKMQ
                     AENVFDVESVTVAPAAQPPPLAKAASKKEGSASHASAEKPKANAVSLREPKKISSGKS
                     PSPTVQLAASAVQASSFRATNPTDIDSLPALVELVHPKLFRPLTESMKIEHLTRIQKL
                     CWAAMLDSDSDVLVRSETGSGKTLAYALPTLHRLLVECDKTPISRDVGTLIIIMCPTR
                     ELVLQVTETVTTLVRCAQFITVGGIHGGENRHKEKARLRKGLPILVTTPGRLLDHLKT
                     TSSFTVAHAQTVIMDEADRLLDMGFEKALREIMELLERKCHHASDMKRVLVSATITEG
                     VERLSHFALRRNIVRIGETQDTFSVPTTLKQHYVMVPVKHRLSVLLSFLRSQLDAGAN
                     KIIVFVSTADSTEFLYLLASRLQSPFHRRSYEGKVVTRSRGASMSTKKMVEAANRHLD
                     NGSATDEVVTFEDVSDEEIEGDARLDSTATLRRAFLDANVFKLHGNMSQVDRAAVFHA
                     FKFGTRKSHSDKSVLFCTDVAARGLDMPRIDWIVHYDPPIDPTSYVHRIGRTARIGNS
                     GDSILFLAPDERGYAAYLTHFIHLQMQQSNSREAAEMSERKYETFLFYLTKLDPNSNH
                     MWMQSTATLERAISRLAMQRDAERGVDAKESLYRVALFAYQSYLRAYAGMPRQTKSLF
                     FSTLHLGHVAQSFGIDKSPSEVQRELQAYIREDRALARDNRKGTVTNSHDEERGKRKR
                     QRVELDHEDRYHSMLTQKQRKLTRDWAEKRRKESPKIRPLQFSEFDA"
     gap             15852..15950
                     /estimated_length=99
     misc_feature    complement(16602..16640)
                     /note="Short protein (LDBPK_270060, CBZ35167.1) was
                     converted to a misc_feature."
     gene            complement(<17270..>18211)
                     /locus_tag="LDBPK_270070"
                     /db_xref="GeneID:13389126"
     mRNA            complement(<17270..>18211)
                     /locus_tag="LDBPK_270070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861817.1"
                     /db_xref="GeneID:13389126"
     CDS             complement(17270..18211)
                     /locus_tag="LDBPK_270070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861865.1"
                     /db_xref="GeneID:13389126"
                     /db_xref="UniProtKB/TrEMBL:E9BIU2"
                     /translation="MARTLLFLLSILVIAAAATAHELHLPADIYDHAAGEWSVELVSS
                     CRLPLLGSVTFHNNTAVVEWKEVGAPEMKISGRSATSSLSVAALSDFLTKDSHELSYV
                     MCERQENYLATPQRPVQVAGMTTTYIKAYSGVLSSSSDGSTCDGSSERTIAIQALGAP
                     FTPSKGKAWQMKEALYAIDIVLDTRNVEGTCASKRGAGVSDAALGNDKRSRKRRAHRT
                     LSSGMAVSTADAMTAENGIVTLRFIRRSAAHQPWFIRYYTPIVFATIFIMYRMAHSFS
                     YTRAAKSSPRSESSGGETAGDAGRIALSGCNSNSIDT"
     gene            complement(<18680..>19276)
                     /locus_tag="LDBPK_270080"
                     /db_xref="GeneID:13389127"
     mRNA            complement(<18680..>19276)
                     /locus_tag="LDBPK_270080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861818.1"
                     /db_xref="GeneID:13389127"
     CDS             complement(18680..19276)
                     /locus_tag="LDBPK_270080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861866.1"
                     /db_xref="GeneID:13389127"
                     /db_xref="UniProtKB/TrEMBL:E9BIU3"
                     /translation="MALLEGARQDATMKSSLELYCGPASKDLMIMDIPADLDVDTYLW
                     EGLLVAESMLEADGTLLVVSPHAFSAHVRRFLQWRFVRARCAVSDAGAVHYAVCSSVA
                     ADFGDAAVRRDDFPGQLPTGKRRPRKWNPYRRPEKQKFVASLRPWFTNAPFIKDALRC
                     TLEREQDAQERLRDADDAFFAVAHEMVEKGVHYSHPND"
     gene            complement(<20913..>22691)
                     /locus_tag="LDBPK_270090"
                     /db_xref="GeneID:13389128"
     mRNA            complement(<20913..>22691)
                     /locus_tag="LDBPK_270090"
                     /product="cytochrome p450-like protein"
                     /transcript_id="XM_003861819.1"
                     /db_xref="GeneID:13389128"
     CDS             complement(20913..22691)
                     /locus_tag="LDBPK_270090"
                     /codon_start=1
                     /product="cytochrome p450-like protein"
                     /protein_id="XP_003861867.1"
                     /db_xref="GeneID:13389128"
                     /db_xref="GOA:E9BIU4"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="UniProtKB/TrEMBL:E9BIU4"
                     /translation="MAANALHSHIVAALHNAATKLPSSVQPYAMLLTREDMVSTTLAT
                     AIATAVILYTVITVVLPVLRMDFYLSKLPTIKNGIPFLGHALLLAGPSPWSKMSNWSL
                     YPEKNLPQKKKSADGPQTSRLVTYNVAGMRVIYINEPRLLRRVLLTHQRNYRKALAAA
                     YKHFMCLLGTGLVTSEDEQWKKGRLLLSHAMRIDILDSVPEMAMKAVDRILLKLDAVD
                     AKNPSVDLNEEYRHMTLQVISESALSLSAEESDRIFPALYLPIVHECNKRVWAPWRAY
                     MPFLQGSRVRNHCLSELNKVLRNIICRRWEQRNDSNCTGKPDILALCISQIDRMDEKM
                     IVGLIDDVKTILLAGHETSAALLTFATYEVLRHPEIRQKILEEATRLFDPARCTRTVQ
                     TRYGPRGVPAVNDVRDLVWTPAVLRETLRRHSVVPLVMRYAAKDDVWPAADTGLDADV
                     RIPAGCTIAVGIEGVHNNPDVWNKPEVFDPTRFIDAEIANDTNYLNQSTKDVKFAKKI
                     DPYAFIPFINGPRNCLGQHLSMIETQVALAYMVLNYDLTIYRDPSYKGDAAAYEDAVG
                     RHHDFIIPQVPHDGLKVWGTPNKLFM"
     gene            complement(<24420..>26402)
                     /locus_tag="LDBPK_270100"
                     /db_xref="GeneID:13389129"
     mRNA            complement(<24420..>26402)
                     /locus_tag="LDBPK_270100"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003861820.1"
                     /db_xref="GeneID:13389129"
     CDS             complement(24420..26402)
                     /locus_tag="LDBPK_270100"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003861868.1"
                     /db_xref="GeneID:13389129"
                     /db_xref="GOA:E9BIU5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BIU5"
                     /translation="MDKYEILAQIGDGTFGSVAKAVSKKTGQLVAIKKMKQKFYTWEE
                     CVKLPEVDVVRRIHGHPNVVKLREVIRENNELFFVFEYMDGDLLGVIKKAKQQGGPPA
                     STPSAAPLIPYPLVKNYMRQMLQALVYIHKRGYFHRDMKPENLLIRKEASGDEVLKLA
                     DFGLVKEICARPPFTDYVSTRWYRAPELLLQDRFYGAAVDVWAAGCIMAELITMRPLF
                     PGTNEVDQLFKIMSVLGSPTEEVWAGGLRLAKKIRYTFPKVAGSGLAQALPSHIPLPA
                     LDLLRQMLVYDPKVRLTAEQCLQHPFFNVGIDECNAPSAAALDQLALMAKRMLPGSKT
                     APPALKSPTAGQVAALKAARASTDASLSDTSSRKFYLLGTLKDPAPSLPKLPVALSTS
                     PPSLDAPPNASSPLRGRGALSPAGMPVLANGHQCPSLTTTVAKGKRRSQETADTSLAK
                     KLAGLKNVPTGKGKLPVSYALPAASAVHSPRAAPNLKVSASVARPYPLAPTANNRDAV
                     ASPRHHNPYKEAETTSPTAASAAAKVEIDLDELMEEFASEMTAMGVLAQRHDSGASAE
                     SKSESYVSQPALPPDPVATLLNNSRYRRKSTTSADPLLKGNNSPRATHQLDTRKVDDV
                     AAKSDLPRIDHSAPKGMSPSLKALLAKHKTSGLAFP"
     gene            complement(<27296..>27553)
                     /locus_tag="LDBPK_270110"
                     /db_xref="GeneID:13389130"
     mRNA            complement(<27296..>27553)
                     /locus_tag="LDBPK_270110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861821.1"
                     /db_xref="GeneID:13389130"
     CDS             complement(27296..27553)
                     /locus_tag="LDBPK_270110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861869.1"
                     /db_xref="GeneID:13389130"
                     /db_xref="UniProtKB/TrEMBL:E9BIU6"
                     /translation="MLRRTTARFYQSVTAPIGKGCVVPMKFDSLKPAYVPKSFTTQFF
                     VLGTWSISNMITNFVIGFLIIASANGGLSGAWPPDPHSLHP"
     gap             28598..28732
                     /estimated_length=135
     gene            complement(<29123..>31024)
                     /locus_tag="LDBPK_270120"
                     /db_xref="GeneID:13389131"
     mRNA            complement(<29123..>31024)
                     /locus_tag="LDBPK_270120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861822.1"
                     /db_xref="GeneID:13389131"
     CDS             complement(29123..31024)
                     /locus_tag="LDBPK_270120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861870.1"
                     /db_xref="GeneID:13389131"
                     /db_xref="GOA:E9BIU7"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BIU7"
                     /translation="MPFRQAVASMLAVLVFSLGLTSTYASSPAKWVPTLALFDINNSR
                     ILSTTGTSEAVSLGQRSLFVSRYDPNPSVSVASLTLYGSENGYATRTFDFLTVPYCVV
                     ESGTTAECNLHDHMLYMMFRFRHRYEADFHAVVWQDPTPLSSTVKALQDFKAHLNRSD
                     VVYPENDGSMRVEESATCSDIMDECYLSRAATYTRSYKEIDPAQYSARFLFRIGKQYT
                     MNGPLRVRLHSNLPHDAETVVDVVLVLCRQPSSNPLNHRWWIESVTGRLALLVVSIVA
                     TFAFLTVTREVGELMVRQRTGEDVLAPTLLYSEEASDGPLVCFQRLAKVASNSLQAGA
                     AYVWAKIQELICVNACCASRLRWLGARCPRVPAREHTAESEREITALNLTVFSEEEDS
                     GPTCRICRCSEPRDDLFAPCACNGSSKFVHHNCLEQWREMTSNPQHRRVCAECKTPYT
                     FVRVVVPHNPDLITGSPIIESVVRHFAAKLLYLAMTVLFAVGGAYCLKAAFFLTTLFD
                     TGVDWGFYHGYHWVLTAYFLAALTLNLSIMEPFVRDTMLTGVQLLCVLLSLLFIEIPM
                     SYAMSAFLSLIFDRLFTWEVSYGAGLVSAVLLHLMDTFSNFAKILESFSEEREVVAAR
                     AESETQQSV"
     gene            complement(<32724..>33179)
                     /locus_tag="LDBPK_270130"
                     /db_xref="GeneID:13389132"
     mRNA            complement(<32724..>33179)
                     /locus_tag="LDBPK_270130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861823.1"
                     /db_xref="GeneID:13389132"
     CDS             complement(32724..33179)
                     /locus_tag="LDBPK_270130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861871.1"
                     /db_xref="GeneID:13389132"
                     /db_xref="GOA:E9BIU8"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:E9BIU8"
                     /translation="MSPPADCVPRRQHRVLSPLSPQSKIIILLTNSTSIKMQQAYFGQ
                     QPMLPPGWQLSYTADGKPYYIDHNTKTTHWSIPPTAYEPYYNNGRGRGAGYRGGRQGI
                     DRTKMKSKMCIYWEKNGNCAWGDRCAFAHGAEELRNPASQPRNDAPASA"
     gene            complement(<33971..>34624)
                     /locus_tag="LDBPK_270140"
                     /db_xref="GeneID:13389133"
     mRNA            complement(<33971..>34624)
                     /locus_tag="LDBPK_270140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861824.1"
                     /db_xref="GeneID:13389133"
     CDS             complement(33971..34624)
                     /locus_tag="LDBPK_270140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861872.1"
                     /db_xref="GeneID:13389133"
                     /db_xref="UniProtKB/TrEMBL:E9BIU9"
                     /translation="MLSQLISHVSRSAVTPYGARVPKESAESVLLKQRMEVMKTVAAI
                     RANEDTFGGARVSRHGCTLPQTKAAPRDTTRRPLYTATSSNQYKTIKDLKAGDGTEPG
                     AVQLKRTSLVHDASGTLVTAESPHGNDTESRDPRKAVAEKHRAALVTPRPHVPTRIEQ
                     WIGSFGRSLGAVKPYAVGRSTKLATRHCFTDLPVDTNDRYVDRMQCCRPSKGLYTYY"
     gene            complement(<36530..>37081)
                     /locus_tag="LDBPK_270150"
                     /db_xref="GeneID:13389134"
     mRNA            complement(<36530..>37081)
                     /locus_tag="LDBPK_270150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861825.1"
                     /db_xref="GeneID:13389134"
     CDS             complement(36530..37081)
                     /locus_tag="LDBPK_270150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861873.1"
                     /db_xref="GeneID:13389134"
                     /db_xref="GOA:E9BIV0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BIV0"
                     /translation="MSLQAGGVVNGVIPGVVPPHDRTQEVCKYFVNGGCLRGTNCPYL
                     HELPDERHLDVNGLGFILNPNVHNAQKTVASPQTQVTASTPSQPLKAAGSSLTMMLNN
                     QNASQSRVFSPTKAAKHQPPSMSGSSSASPQTMPMGKLPAPPKYNPPEPYLELNLPPA
                     LAFPLKVPAKDTTATLAHLMLQN"
     gene            complement(<38582..>39367)
                     /locus_tag="LDBPK_270160"
                     /db_xref="GeneID:13389135"
     mRNA            complement(<38582..>39367)
                     /locus_tag="LDBPK_270160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861826.1"
                     /db_xref="GeneID:13389135"
     CDS             complement(38582..39367)
                     /locus_tag="LDBPK_270160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861874.1"
                     /db_xref="GeneID:13389135"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BIV1"
                     /translation="MNASFGGSFARGVFAEREIGYGREVMNLPAYCMYISENDRQPLR
                     EQVLIMTKEIFSKVVYGTPQEQQYVKHRILSLMSGGFSYFTRERDVFDFAEEVRAPGA
                     DGAFRNGCSCLMSGEFSSYDLQKLPLIVEFNRFEVDYRGRRGICLFPEASYLNHSCEP
                     NVELSITYNSIKNNFFLSARAVRPILEGEELFINYMPGNNLPLSRLALAMKKRWGFEC
                     SCVKCKSRAVGAVTIVFVVLLIPIIVYIRRFIVERTKEKHRSL"
     gap             40645..40743
                     /estimated_length=99
     gene            complement(<41109..>42521)
                     /locus_tag="LDBPK_270170"
                     /db_xref="GeneID:13389136"
     mRNA            complement(<41109..>42521)
                     /locus_tag="LDBPK_270170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861827.1"
                     /db_xref="GeneID:13389136"
     CDS             complement(41109..42521)
                     /locus_tag="LDBPK_270170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861875.1"
                     /db_xref="GeneID:13389136"
                     /db_xref="UniProtKB/TrEMBL:E9BIV2"
                     /translation="MQDQWKIDLESEDHRSRRDMTEKSIARYVKGEVERQVTSSSTSS
                     SVFVSDCTWIMGASVAQPSYLCCGLSNGSVCLLNTSNLSKIYLFEVDRDSRRSQRDSD
                     RGGQGQGPGRVSAASQQLVAVATHTVSAGTNPAAVQTLLCMTLDNVVCVCPMDMSTVL
                     ERKKVSRSDMAKVKPFPAVAAGAVLHSSVHFNSKGSGILALLCIEQESSAAPGASSIR
                     YCAAVLSSPDETVTLQSKYASEDDWHTLAPPSAGGDSRPGAPVELCYCGWWSADTLVC
                     VWSNSALQFLQAAGMQVVGECGLLHHCTSDAVTNATVTRPGAAEASDGASSGLIAVVL
                     DHNVAASFYVTVRHSASASAQEPKRHRIEAFLTVTLTPTMQTYCTEDIPIRELHLVRS
                     FSWTIVLLLESGALVFLDAETMRLSVHRPVNRLRAPDAGRYHAGPLMVAPRNFFCVLS
                     GKPFSAVVVEHNTAILLKSQ"
     gene            complement(<43363..>43902)
                     /locus_tag="LDBPK_270180"
                     /db_xref="GeneID:13389137"
     mRNA            complement(<43363..>43902)
                     /locus_tag="LDBPK_270180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861828.1"
                     /db_xref="GeneID:13389137"
     CDS             complement(43363..43902)
                     /locus_tag="LDBPK_270180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861876.1"
                     /db_xref="GeneID:13389137"
                     /db_xref="UniProtKB/TrEMBL:E9BIV3"
                     /translation="MLRSSLRYGVHKVGYTHPHHLPVPCAQRWDLRLARARIFQEYIE
                     EKAPGAWQLEDERHMSPEFNTFTGYPMRNLRPGYGQNLPEFIMKKRLPNNTHYELFAR
                     RDIPNEDNAMYGKLLYDMTIHGTSLPSIYRMHKDINKAQRNDRKLSGNRFKVLNSSGA
                     KSPPSGFEAIPDAVEDEDD"
     gene            complement(<44985..>45701)
                     /locus_tag="LDBPK_270190"
                     /db_xref="GeneID:13389138"
     mRNA            complement(<44985..>45701)
                     /locus_tag="LDBPK_270190"
                     /product="proteasome alpha 7 subunit, putative"
                     /transcript_id="XM_003861829.1"
                     /db_xref="GeneID:13389138"
     CDS             complement(44985..45701)
                     /locus_tag="LDBPK_270190"
                     /codon_start=1
                     /product="proteasome alpha 7 subunit, putative"
                     /protein_id="XP_003861877.1"
                     /db_xref="GeneID:13389138"
                     /db_xref="GOA:E9BIV4"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BIV4"
                     /translation="MAGTGSGHDQSTDVFSAEGRVFQVEYAGKAVDNSSTAVAACCKD
                     GVVVAVEKIHTSRMLEKGSNNRIHAVDRQAGICICGLLPDGRAIVSRARQEAENSRDI
                     FATPIRGSVLANRVGEFMHVYTTHFAYRPFGCSAIIASYADDGPQLFVSDPSGTVAGY
                     YGVALGKAKTVAKSELEKLDFSSLTCDDAVVKLANILHDVHDKQKDKLYEVEVAWVCD
                     KSDRMFVHVAADMVPSETSN"
     gene            complement(<46465..>47583)
                     /locus_tag="LDBPK_270200"
                     /db_xref="GeneID:13389139"
     mRNA            complement(<46465..>47583)
                     /locus_tag="LDBPK_270200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861830.1"
                     /db_xref="GeneID:13389139"
     CDS             complement(46465..47583)
                     /locus_tag="LDBPK_270200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861878.1"
                     /db_xref="GeneID:13389139"
                     /db_xref="GOA:E9BIV5"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BIV5"
                     /translation="MESRGRVLGAVRTLSEAVSAQGKCENSRSLVIQVVSGSCESFSL
                     HQLEQALCYFTNHNSNYTNVCEDEFHMLAEETLNNLIRSILVYDDFSGFFGDAEVYSL
                     SMAFQYNLSVEALTLRGINISDEAICSLCEALVRSRVNYIDLSNTPLEDEAGRSIAAL
                     AHINPYLRTVIVDDTLIADDVLDEIDVACQFNQSNFEGNKGEVDESVLRPADLGRLKH
                     RLQQIVRAQEKKVHYCVAHLFGCCPNGEMCLYSHSLGKSGMDETDTSLSAKISELFAN
                     GGNWEERLPPRPTDGPSWRNPEDEAKRTPRVNNARRRREQDSNTPAAAPAPAAMPPVQ
                     QTRWSPLLSGLAGMCCGFLAVGLVGVVARRLAPRPSSG"
     gene            complement(<48326..>49195)
                     /locus_tag="LDBPK_270210"
                     /db_xref="GeneID:13389140"
     mRNA            complement(<48326..>49195)
                     /locus_tag="LDBPK_270210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861831.1"
                     /db_xref="GeneID:13389140"
     CDS             complement(48326..49195)
                     /locus_tag="LDBPK_270210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861879.1"
                     /db_xref="GeneID:13389140"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:E9BIV6"
                     /translation="MSESTALNVSATEKKGYKSCDAARAAFRAGDVEASRREHMKEMP
                     QENHNVSASEYVKSLVFGGLDGIMTTFAIIAAAAGSGGNKATVLIFGFSNVIADGFAM
                     GFGEYVSGEAERENAISERRREEWEVENSFDLEIDEMVQIYMAKGLSFDDAHTIVGII
                     SKDPKMFVDFMMVEELGLLVDIDDAHGPKKQGVVMFASFMFFGSIPLLAYLPGKGQGV
                     DFVFFVSCFLTMASLVFLGSVKGYLVGVSMGRSAVLMVLNGLISGIVSFMAGHLIQMA
                     LTNGDEATTSLPV"
     gap             49974..50086
                     /estimated_length=113
     gene            complement(<50806..>51750)
                     /locus_tag="LDBPK_270220"
                     /db_xref="GeneID:13389141"
     mRNA            complement(<50806..>51750)
                     /locus_tag="LDBPK_270220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861832.1"
                     /db_xref="GeneID:13389141"
     CDS             complement(50806..51750)
                     /locus_tag="LDBPK_270220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861880.1"
                     /db_xref="GeneID:13389141"
                     /db_xref="UniProtKB/TrEMBL:E9BIV7"
                     /translation="MHDSVDGFWAACSGCGATSKRLLIHKTGVAASPIGLVTGEAVKH
                     GSPLINVPYNSVFNGQTLRGDVLPRALPSLRKMLLFLTRRGRMGVVTAHSLWLACFVA
                     CYRQQCAVTNKAGRWLLQPLLSSTVYPPLPNLFSERNKFACPSLRASSAAELEVMERR
                     VQDELDLTYSMLRHYMKRRGVSSKLRPSRDMLVQAHRTVMQRALLLPRNGEPSAPAEL
                     SELIETSPDLPLFPSLVPAIDLIRAAPLHSRAEAEEDAEPPSSGNCSIFTCVQSDFLS
                     SSSRRRVIVETAPLAARRVVVCATKPLKEGTELLMEFE"
     gene            complement(<52588..>53151)
                     /locus_tag="LDBPK_270230"
                     /db_xref="GeneID:13389142"
     mRNA            complement(<52588..>53151)
                     /locus_tag="LDBPK_270230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861833.1"
                     /db_xref="GeneID:13389142"
     CDS             complement(52588..53151)
                     /locus_tag="LDBPK_270230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861881.1"
                     /db_xref="GeneID:13389142"
                     /db_xref="UniProtKB/TrEMBL:E9BIV8"
                     /translation="MSSGALGRGSFHSVVAGANPRRIPTYYNSAYELIQLHRAHREVT
                     RNFLVRDKVFDNKFPGCSLANGLFKMVPNKRGNFHTRELTESIRHRTIWAQRIQQQRT
                     INAAILDDATKVLSPAQMEDRFSYRTPDAAAYFSPQEYTAANNWPNYWQHPTEKHVVP
                     RPRWRREPELGGITRVRDAVATPIADY"
     gap             54356..54454
                     /estimated_length=99
     gap             55460..59316
                     /estimated_length=3857
     gene            complement(<59438..>59512)
                     /locus_tag="LDBPK_270240"
                     /db_xref="GeneID:13389143"
     mRNA            complement(<59438..>59512)
                     /locus_tag="LDBPK_270240"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_003861834.1"
                     /db_xref="GeneID:13389143"
     CDS             complement(<59438..59512)
                     /locus_tag="LDBPK_270240"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_003861882.1"
                     /db_xref="GeneID:13389143"
                     /db_xref="UniProtKB/TrEMBL:E9BIV9"
                     /translation="MNRRGLSNRNETKQCVNMTLSQEAQ"
     gene            complement(<61959..>63146)
                     /locus_tag="LDBPK_270260"
                     /db_xref="GeneID:13389144"
     mRNA            complement(<61959..>63146)
                     /locus_tag="LDBPK_270260"
                     /product="flap endonuclease-1 (FEN-1), putative"
                     /transcript_id="XM_003861835.1"
                     /db_xref="GeneID:13389144"
     CDS             complement(61959..63146)
                     /locus_tag="LDBPK_270260"
                     /codon_start=1
                     /product="flap endonuclease-1 (FEN-1), putative"
                     /protein_id="XP_003861883.1"
                     /db_xref="GeneID:13389144"
                     /db_xref="GOA:E9BIW0"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9BIW0"
                     /translation="MGILGLSKLLYDKSPNAIREQELKNFFGRRIAIDASMSIYQFII
                     AMKGFQDGQGLELTNEKGDVTSHLNGLFARTLRMIDEGIKPIYVFDGKPPKLKADELE
                     MRRQKAAEAEREFEKAKDAGDDEMMEKMSKRTVRVSRDQIDESKKLLRLMGIPVIQAP
                     SEAEAQCAELVKKGKAWAVGTEDMDALTFGSTVMLRHLNISDAKKRPIAEIHLDEVLQ
                     ITGLSMGQFVDLCILLGCDYVPKVPGIGPQKAWEGIQRYGSIESFLESLDTTKHPVPA
                     DFYYKEARAFFQNPEVTPAEEINIQFSEPDEVGLIQFLVKEKLFNPDRVNKGIARLRA
                     ALTRKTQGRLDSFFTVTKVPQQTAAARAPLAGTKRPRDGKYVHVSGTLRKATSGHKKA
                     VKK"
     gene            complement(<63790..>64776)
                     /locus_tag="LDBPK_270270"
                     /db_xref="GeneID:13389145"
     mRNA            complement(<63790..>64776)
                     /locus_tag="LDBPK_270270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861836.1"
                     /db_xref="GeneID:13389145"
     CDS             complement(63790..64776)
                     /locus_tag="LDBPK_270270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861884.1"
                     /db_xref="GeneID:13389145"
                     /db_xref="UniProtKB/TrEMBL:E9BIW1"
                     /translation="MWRLHISTSLPAAPTHDGVSILIGQRSCVSSSAHEAPCTVCVLA
                     GYVQCDDPSVAEEQIESLENVLPFGIEVLGFAGGTAALTSLAAELPDLKRKELIEAVV
                     PNGKRHLPPACRMFGAPAKKVEVSESDIAFVEARCALHTYNSTLPLLISCSNALPQVV
                     DGESYAPLTARAPSSSSKIELIQSGVVPNTLRIHVVMVPSLMSASGLYETLFRQLKAA
                     WTSRTTRLIELNSHNAHLSYCCRLECDADALDSTDTVTDDEWAVVLEMMEDATGQRVS
                     RGDVRGIKPLFQPCRKSKTSAAEAVKTSPAQLPHFLLLGLIVVIISVAVLMR"
     gene            complement(<66986..>70201)
                     /locus_tag="LDBPK_270280"
                     /db_xref="GeneID:13389146"
     mRNA            complement(<66986..>70201)
                     /locus_tag="LDBPK_270280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861837.1"
                     /db_xref="GeneID:13389146"
     CDS             complement(66986..70201)
                     /locus_tag="LDBPK_270280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861885.1"
                     /db_xref="GeneID:13389146"
                     /db_xref="UniProtKB/TrEMBL:E9BIW2"
                     /translation="MHFVAGGASRRAGRVSDDEYETSSYEETEASDLLSDNSEDYVPL
                     TFEYISSNPRRRAGAPAYSKVPLGALEVEERQESLSFSDAPLEVFLERSRTRRQCGPG
                     AKDVNRVEVKSSVSSHHKDEDGTSSTNSGALPIAFERRKKTHNIGKVKQSTYEILDTE
                     LSVSLPDEEEAPLNAQLIYTLIKRLRNPSDEVSLEAFDFVDFSDENFKEELGPLKEIK
                     ALLEEKASNPIMENTKHNHAVKEAVQSLPPDNAIAAKVKAIKSCPIRPSKPRIRLHRG
                     GEAEMEKAEAIADLVRRLKDPNTEVPLRAFEEVDWSNRDFDMVLALLKPIRAYMEAKE
                     VAKEKPAEGTMSGASVLDNKIKKAIMSLPSEEAVAAAMRAVKNRAMLSSPSNGDAIRH
                     LVARLKGSGQTVKLCEFDKLDWNDRNFSRELEPLQQIRACMEAMEALEQKPGENVMAT
                     QPALDEQIKAAIMSLPPEKVISVKTQMLKMYERASTRAQGSQRVKVTKLSAPAGTQKK
                     LKDSFIMSNPSKKLKTKEGNLSASSSQVMQVGARVMSLKQPKYAAKESTALSAPAKKV
                     RRSRIRGDRSVSISKVDDDTPPGEIIDDNQELPESRESPRLEAVTTSRCLSRMPSRPA
                     GAKKPERRTRNYRQANNISFSSVPTEEPGVIQEENELIGTKRKAGRRRAPHKLCRSLS
                     ITSLPDLEADEVLEEPSPLNTRGVPPATLAPARKAKSRRSHTKLPGDNAQFDQPSNEV
                     ASGLDDNNTALQGKAHSATKKKRRPKVNNKSCSFIEVYLDEVCEIHDESATELKGVEL
                     QHDTSPPKRTQKLLRRRRPADEGNGRALDYSKPETGEAGKLDDAQHSNAATAKGRRVN
                     VHRTRSAHTSMIGELKSGEIVERPDETHILYTSSAASTPIPEEASARRVNRQAIPARA
                     QKVSCMTCDFSSTARKRRPRLHMSKELSVSAIPENLVGEIVENAPDLLAATAPVSGSF
                     SNARLSKVHTGPARRLPLLKGSGRGSLRYTDPPNSSLRSSAKSRKEVIMPSVDASFIP
                     DTVSSSPTPPSSALRRSTEAIPHVTMVAAKLCDDIQCISSV"
     gene            complement(<70352..>70519)
                     /locus_tag="LDBPK_270290"
                     /db_xref="GeneID:13389147"
     mRNA            complement(<70352..>70519)
                     /locus_tag="LDBPK_270290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861838.1"
                     /db_xref="GeneID:13389147"
     CDS             complement(70352..70519)
                     /locus_tag="LDBPK_270290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003861886.1"
                     /db_xref="GeneID:13389147"
                     /db_xref="UniProtKB/TrEMBL:E9BIW3"
                     /translation="MFTLLRKEHLECYSLFQIDCSACCLFSFPLHNLLCSFASVTTQH
                     SRAIAFSHLKK"
     gene            complement(<71152..>71604)
                     /locus_tag="LDBPK_270300"
                     /db_xref="GeneID:13389148"
     mRNA            complement(<71152..>71604)
                     /locus_tag="LDBPK_270300"
                     /product="acyl carrier protein, putative"
                     /transcript_id="XM_003861839.1"
                     /db_xref="GeneID:13389148"
     CDS             complement(71152..71604)
                     /locus_tag="LDBPK_270300"
                     /codon_start=1
                     /product="acyl carrier protein, putative"
                     /protein_id="XP_003861887.1"
                     /db_xref="GeneID:13389148"
                     /db_xref="GOA:E9BIW4"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="UniProtKB/TrEMBL:E9BIW4"
                     /translation="MQRPVIRRLGNRSAFTLVAAVARSSQMRSAVRIPSGSHARVIPS
                     FMCSLRAYSGSHHDEPSSRSGQYLLDKNDVLTRVLEVVKNFEKVDASKVTPESHFVKD
                     LGLNSLDVVEVVFAIEQEFILDIPDHDAEKIQSIPDAVEYIAQNPMAK"
     gap             73375..73554
                     /estimated_length=180
     gene            <75276..>77447
                     /locus_tag="LDBPK_270310"
                     /db_xref="GeneID:13389149"
     mRNA            <75276..>77447
                     /locus_tag="LDBPK_270310"
                     /product="methylmalonyl-coenzyme a mutase, putative"
                     /transcript_id="XM_003861840.1"
                     /db_xref="GeneID:13389149"
     CDS             75276..77447
                     /locus_tag="LDBPK_270310"
                     /codon_start=1
                     /product="methylmalonyl-coenzyme a mutase, putative"
                     /protein_id="XP_003861888.1"
                     /db_xref="GeneID:13389149"
                     /db_xref="GOA:E9BIW5"
                     /db_xref="InterPro:IPR006098"
                     /db_xref="InterPro:IPR006099"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR006159"
                     /db_xref="InterPro:IPR014348"
                     /db_xref="InterPro:IPR016176"
                     /db_xref="UniProtKB/TrEMBL:E9BIW5"
                     /translation="MMRRVSVLLSAAYPQEWIAAAKKELKNRDPSTLTIHSINGFDIK
                     PLYVADDVESHPALPGFFPYTRGVHSTMYTGRPWTIRQYAGFSTAEESNNFYKTALKN
                     GQQGLSVAFDLATHRGYDSDHPRVTGDVGMAGVAVDSVEDMKLLFNDIPLDKVSVSMT
                     MNGAVIPVLAFFAVAAEESGVPQEKLRGTIQNDILKEFMVRNTYIFPPTPSMRILGDV
                     MAYLSKRQPMFNSISISGYHIQEAGGHGALELAFTIADGLEYIRCAEQRGLTVDDVAP
                     RFSFFFGIGMNFYCEIAKLRAARMLWATYVKKKFNPKNPKSLLLRTHSQTSGWSLTEQ
                     DMENNIIRTTIEAMAAVMGGVQSLHTNAFDEAVALPSIQSSRIARNTQIIIQEETHIC
                     SVVDPWGGSYMMEALTQEMIKKASAIIDDVEAKGGMTKCIEEGFPKLMIEESAARRQA
                     AIDSGAETIVGVNKYVNPVDKIPETLRIDDKKVRAGQIAALEKLKATRDTAKVREMLK
                     KVTEACRDEKINILEAAIEAARARATLGEITSAMEEVYGRYVARSQVVQGVYYNSYLR
                     GGNKEDQNHVAAVKARIDAFAAKEGRRPRIMVAKIGQDGHDRGAKVVATGLADMGYDV
                     DIGPLFQTPEEVARHAVENDVHICGASSLAAGHRTLIPQLIQELKKLGADDIIVTAGG
                     VIPPDDYQSLYDAGVKLIFGPGTPIPKCAEQMIEVLEARQK"
     gap             78413..78625
                     /estimated_length=213
     gene            <79446..>83132
                     /locus_tag="LDBPK_270320"
                     /db_xref="GeneID:13389150"
     mRNA            <79446..>83132
                     /locus_tag="LDBPK_270320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861841.1"
                     /db_xref="GeneID:13389150"
     CDS             79446..83132
                     /locus_tag="LDBPK_270320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861889.1"
                     /db_xref="GeneID:13389150"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013932"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BIW6"
                     /translation="MAPFSACSFLRGIKHVDKDLRLMALFDLRRHVQSADENSITNEV
                     VDKVLSCLSPDERCEEVQNEAANALPDMVVKCSQRDVILQYLLSTVTKTRVSEDGDGA
                     NLQYLSGMTFRKCCTEFASEARRNVAFWQKQIDVARHLCVRCAAQLEVDDLEDTAREI
                     LYTAVNALVPAYKDVLGERDALVKMAVRDFQKTNSIRHASLTLVESLLTLLRAATQES
                     VVAESLKLLVTATSSEQYVAYLQLCEVEMRVLRWPPMPVVQQIIDSACERLAHAAEHY
                     DEGEDSTETLLEVVCSLLQLNASGGAPSWRGAFAAVKDLVAFDPYASGAEEDAYAADG
                     GYDGDYDEYYEYDNGTSDSTWKLRMWAVRVLQVLVAQHDDKELGMQSLNIAATTLQDR
                     VQVVHLEAVKLVRTVVRHSYVHDADCVALVTNRCHELCKLVGIEDEKATASLMKALED
                     IFATFAHAVAFCESTVPLLLNQVRAHFSAVAADAAALEGCRSIVASIIRARGEGALLS
                     SETVNLAKELPVLCLRGGNSSATAACITKVSDTLAQVYSATHDVSVPAALGSNYGALL
                     ENGTFPAACRAAAAESLANWAAAHGLSALEQPAIALWRALDYDEVKLPVLRALSIMTG
                     SSASSASVPTSVLEKVAALVESESASVRAASVEVLLRRLSVPNTPPLTASFMQHLTTL
                     FAPGHPLSLSSCELAEMCALALLLAQLFRHQTEQGVSFYETYFAGVWEHVARLADAVL
                     WSRSLMNPALDSLMALVGTVYEHEYASRLPIEDDVRQFLVSNQSHIPCIFTVVRCVGA
                     GSPSAVNAFLHTLSPQLVERAHFLLCVGEAGQASGLSADWSALVLDSVQSKEGELVRS
                     CGERSLSLCMLHPGNAETILMPCGERAVDSGTTGRYYYVKSIKEAATLALSRYNTAFH
                     DAAVSKRLLSLFLQSSASADLVELYGACAGILSMFMLDAERGVMIADTLFKTEASLDT
                     RVTCMVALRYFLSTLAERSASIEIHRHIVLRALLQLHRPTDTKESTAPSLPLRSMALR
                     LLTTVLQHRPHWLLCEETRVTIFPNLLTELREDTKLQGTFDLSGYTHRVDKGLECRKL
                     AFESLSAVFRAARQHNVDLIEYCEAEASVISTLIMACSSHGSGDREPSINDTAKDLIV
                     RFVESKPRFVFTPSQLDSLVSKLLHDIQWGTSSTDAQKTTLLYTIRCVMRLSSHPVFA
                     YHTGFQEVAEVARQSALLSQSLKL"
     gap             83576..83674
                     /estimated_length=99
     gene            <84824..>86308
                     /locus_tag="LDBPK_270330"
                     /db_xref="GeneID:13389151"
     mRNA            <84824..>86308
                     /locus_tag="LDBPK_270330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861842.1"
                     /db_xref="GeneID:13389151"
     CDS             84824..86308
                     /locus_tag="LDBPK_270330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861890.1"
                     /db_xref="GeneID:13389151"
                     /db_xref="UniProtKB/TrEMBL:E9BIW7"
                     /translation="MRRCIRLVYARSSGAMTGAAPPPAVLEASASSSVGLYQKCLNPM
                     TSAGDVASLTAALLPAIGRGELSLHQQVQLLHALAARSIRYEDVMLRCLWTVFKAPSP
                     TDDDVSVESSKARGCYSLSELSAYTSSAFQVMAEQRFLNDPQMTAVALGRCVELIPYA
                     SLDGLRSTYRGLSAVNHMFFSVAEVAHHSSEVTERMTTKEFYQTTDVPDEETLRHQPN
                     LIDVLCGEVELQLRRLCDTFARAAPGPFEVEDDLPAPVATGALLTPSDARDTHEAQWF
                     LDVLEALAVVGVLHAGTLDSLTDLVSRYCTQSSAGFFIKALAHATLIEERVVDPLTYE
                     ESAAVRDARRRLTLHLSGKILQARGIHGYLRRHPQELLLLRRLFEHDTAQPTLSPDLW
                     DAVRTIHVAHRHTVAASQTSRRPVGALFQKMYDVKVKPISVDNAEPERFVPPEFKTWR
                     SPAATPRGGHPRNRRPSRRMAFGTRRISKNYIKNKRRKFCPAVF"
     gene            <87468..>89393
                     /locus_tag="LDBPK_270340"
                     /db_xref="GeneID:13389152"
     mRNA            <87468..>89393
                     /locus_tag="LDBPK_270340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861843.1"
                     /db_xref="GeneID:13389152"
     CDS             87468..89393
                     /locus_tag="LDBPK_270340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861891.1"
                     /db_xref="GeneID:13389152"
                     /db_xref="UniProtKB/TrEMBL:E9BIW8"
                     /translation="MWPAVTSSRQRRRQAALNSKAPFALQLEAFIRREHQQYLREHPL
                     CSRADCLHIFREVFSTFVNHFSEYKGILSIIRDEYDAALNEMSEKVKRMQVEYLESQT
                     DRELHAMEIIQLKESMNATISNQKAQLSAAQELVHAMRDQVTAAEHANSLLTLEMEQK
                     HKTHMEAQQQVKLLSHAMIEESARTAAAREATRKMEKESQLQEARITVLKEQVAELEE
                     ALRRQTYAQIEGLEHLPATGAAAVALRGTSLCANRIPCEGGDATAGTYSKHFVTRILA
                     RIDALEMQLAMVPKKDTVAPAGAFSMGDVALHLKSQPNPASGDTVAREFPAARSSVDA
                     ALPVIREWLQREGVGEAEVESTDVIVPPGRNPSEAMGFLCATVPVKHRHLSLPVTLQL
                     MESMWTARAKAPESSRLPQFFLEWLQTQAGNPTEAKALGVNLLDTCQHNIHHPDCRAL
                     LAVLRGFLPEELVRMCRRRIAQLRLSTATSAATLHNKMAFDAFFVEVRAVCPEKSLAN
                     MLHLRFTVFRSRNEAGEVELDRVLSEDSYFVTLFKQQWLQEVEAFTLRVVEGIRDESD
                     EKRNSASLAKATRVLQRLDAALGEEVYTYVSLASQRPVIDVSATEGTTVPLDAMLRRF
                     RTSVLLYRRSPEELVDI"
     gene            <90396..>91517
                     /locus_tag="LDBPK_270350"
                     /db_xref="GeneID:13389153"
     mRNA            <90396..>91517
                     /locus_tag="LDBPK_270350"
                     /product="MP44, putative"
                     /transcript_id="XM_003861844.1"
                     /db_xref="GeneID:13389153"
     CDS             90396..91517
                     /locus_tag="LDBPK_270350"
                     /codon_start=1
                     /product="MP44, putative"
                     /protein_id="XP_003861892.1"
                     /db_xref="GeneID:13389153"
                     /db_xref="GOA:E9BIW9"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:E9BIW9"
                     /translation="MAPPQTTLSLDANLRNTLRSLLIERLCSPTQPLPAKQLYDELTN
                     RSRLVEEFHFSKTSRRITRQRLALQFLRRYNVLLHGLLFYSEGTRTWNTTTEFHRLAI
                     LGESVLLTEVRTRLLKLFPAMPYAAYVQSLPHMVGEEALAAAFDRYEMQNIVGAKPSN
                     RRSGTPLTRMQKSHMLCAIVAEMYWFTARTKPTDLTHNNALFPPSDVLILHVLSTHLL
                     ENLPAELIYNVVEPIVADIKRVWVNEPMSLPSQLRLTPRTVCALSLNAVPVEPQYTAK
                     EDAVMSLQKKHAEAHRRQHALTCEPDHSCVKSFMRPLCNYRIFEGPRYQILSSDNRVA
                     PLPLAQERSSLPASAVCTVVGDAESAARAMELAKMAEQW"
     gap             93027..93554
                     /estimated_length=528
     gene            <94813..>96300
                     /locus_tag="LDBPK_270360"
                     /db_xref="GeneID:13389154"
     mRNA            <94813..>96300
                     /locus_tag="LDBPK_270360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861845.1"
                     /db_xref="GeneID:13389154"
     CDS             94813..96300
                     /locus_tag="LDBPK_270360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861893.1"
                     /db_xref="GeneID:13389154"
                     /db_xref="GOA:E9BIX0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BIX0"
                     /translation="MMNVKQAKAWEDISLCRSVSTISSSASTAEATAGNDVSSFLFED
                     YRDDAFSTKSRCKHWLSVGHLGLTTTDAELKSLFYPYGADEAFTAWEGAIMTGFVGFD
                     SPEMADLAAQKMHAFVPRGQSQALTVHAVTLEEVSQAHSKSPKSLLAALCSECPTQGI
                     SAMIRRSKSPVAVARDVAMEVARASPVILQRLLAALSDLSPQWFGFASFTEELLKSLL
                     GLLLEAGELNAAQTINCGTVAGNLFQMKMTTGDPYYLAGRLLLKAGHRLGQLEGICAL
                     AHTCAMIPNCHMSRASFWAQVADIATKVTDPEASHALLGHLRRYTKTSAHVATTATSL
                     LSSSVSSPSVFSTMPCAPATATQQQLVRQLVPLQYPRQDEMKRRTIYVSHLPGLLPQS
                     MLLELLTTAGPVNKVRICAGAGYCTLFAFVEMRTLEGAQRAMCMNGLQLMGFAIRVQT
                     ARNAVQDVLEEDARFDANGALIQPCLFGVSQAPLSKCLSPAEWIH"
     gene            <99607..>101577
                     /locus_tag="LDBPK_270370"
                     /db_xref="GeneID:13389155"
     mRNA            <99607..>101577
                     /locus_tag="LDBPK_270370"
                     /product="ATPase, putative"
                     /transcript_id="XM_003861846.1"
                     /db_xref="GeneID:13389155"
     CDS             99607..101577
                     /locus_tag="LDBPK_270370"
                     /codon_start=1
                     /product="ATPase, putative"
                     /protein_id="XP_003861894.1"
                     /db_xref="GeneID:13389155"
                     /db_xref="GOA:E9BIX1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BIX1"
                     /translation="MIRVPGNWTCAQSPCAFVEVRDECYLCRLVPVFTATLTYELETS
                     VRVNLLEARRFASQDFALAETHQVVYASCSSGIEYRPCAPGDRSREAMVIRCPVFHYT
                     AKEVTVDGPRRAARATAAHIAAALMGRYVVVGAQFRTLDGFYTVRQVTLQKGYRGIAL
                     VSGDCRVRVNDARRAGSSSLGGRGAARPIGLESETDQLLQLLACADKSVGAIVGVMAR
                     GPRGCGVSSTVRYALESVAATHTVLGWSSCFSPSEAFQEGWGGTVVLVVTDAEHVFAA
                     AEPEVAKLHLRKLQRDAAVLRGGGNGAARSVVVLCVSHGYGLCAPDVLDELVAFHLVF
                     YFPGALQRAVLLASVRGGSAMDWLSAAQGLVGRTCAETLEAARRPDIASVLPFKAVRW
                     SEIGGLAEVKDRLHRALVWPQQQPERMQRFHITPPRGILLYGPPGCAKTTLIKALCSE
                     GNFSLIYLDSATVLSAYVGESERYLRDVFTRARRQAPCIVFFDEVEVLGGRRVSGGHD
                     SEHVRLLSTLLTEMDGFADIHGVCFVGATNVPHLLDPALMRPGRFDYMVHVPLPTLAD
                     RESILQLLLCRTAADTRIIAEQTEGFSGADLKVFCSEALLALFKESAGVPQVLQERAS
                     VTAYLLQKASGFKRTHYDSTALDQFQREHASA"
     gene            <102430..>103014
                     /locus_tag="LDBPK_270380"
                     /db_xref="GeneID:13389156"
     mRNA            <102430..>103014
                     /locus_tag="LDBPK_270380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861847.1"
                     /db_xref="GeneID:13389156"
     CDS             102430..103014
                     /locus_tag="LDBPK_270380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861895.1"
                     /db_xref="GeneID:13389156"
                     /db_xref="UniProtKB/TrEMBL:E9BIX2"
                     /translation="MNVEVTGRCFFTGDDYYISLPITNKAANRGEPRQLLCSEMIHWD
                     DYRQERGINDGKPPMQQLFASSYAEPLVRTFALGNDTYVTQVTGVSATQAGSSSQMFS
                     AEMLHWDDYCAARGIHTGEPTMASLFRPFESKNILVFDLNERKLTEFEGNSVALISYG
                     ADRQTYCSEMEHRDDYVRAKTGQAPQPSMASLFA"
     gap             103427..103525
                     /estimated_length=99
     gene            <104477..>109135
                     /locus_tag="LDBPK_270390"
                     /db_xref="GeneID:13389157"
     mRNA            <104477..>109135
                     /locus_tag="LDBPK_270390"
                     /product="nucleoporin, putative"
                     /transcript_id="XM_003861848.1"
                     /db_xref="GeneID:13389157"
     CDS             104477..109135
                     /locus_tag="LDBPK_270390"
                     /codon_start=1
                     /product="nucleoporin, putative"
                     /protein_id="XP_003861896.1"
                     /db_xref="GeneID:13389157"
                     /db_xref="GOA:E9BIX3"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR021967"
                     /db_xref="UniProtKB/TrEMBL:E9BIX3"
                     /translation="MNAFGGGFNQNKPGGFGQQAQPAQAAFGQQAQAGGFGQQPPQQV
                     GGFGQQTGGFGQPAQPQSGFGQAGMSQAAGGFGQAQQQPVAGFGQQPQVSGFGQQATQ
                     QAAGFGQQAGGFGQQATQQAAGFGQQAGGFGQQPPQQMSGFGQQSQQQVGGFGLQPAT
                     AMGGFGQQPQQAGGFGQQTGGFGQQSQQQGGFGQTPPQQQSGFGQAAAGGFGAGRGGV
                     GFGAAGGFNQSTAQGGGFGASQTAVNAFGRPQQAQGGFGTQTTAGAQLGGGQGTGGFG
                     AAPQGGFGSQQPAPGGFGQQAATGGFGQSAAPGGFGTAQQTGAGGFGAGRGTTGFGGP
                     QATAGGFGAGRGATGFGQAAQGGFGAQQPAASGFGQVQQQAAGFGAQQATTGGFGQPA
                     QGGFGNGASQTITGGGFGGAQQQQPQGSAGGFGAQPSAAGGFGQATGGFGAQQPAVSG
                     FGQAAQGGAFGQQSQPAAGGFGAGRGTTGFNVGGGFGGSQQQPQTAAGGFGAPKGAAG
                     GFGQAAGGGFGQGVGGFGAQQPKAGGFGQAAPATGFGQAAPATSFGQAASASGFGAQP
                     PATGGFGQAPAAAALASAPAAGSGVNVGRPTDLAFMSLPDYNATPYGNVLLFDSYERP
                     QAAKQTAKTIEDDLKPVVPPARRAMHTWMVTQMRVPDENTLMKQVPASLASSALSPVA
                     LKEMLVPAVQLGGAAAGEPAGAQKRVSHDSPRRPSPATADAPIVNAAVPRCTNPEYTL
                     EPSLAQLATYTPEELRRVSRFTISRLDGSCEVRFLEPVNLVRVDVAAVVHLGSDGHVA
                     LYPDGDAPPLSSGLNVRAEVRVRDPTGKATEGIARYCAETRAHFVGHRQGCCVYRLND
                     SSSAAGASRAALGQDASDTAPLSIIHDEDEHSHNLDRSSDDSEEEDTDDIRSADQPQA
                     ATGSGGALAIADAEVRTYTVPPPPATRRPVVERRLTLASAADFDLPYALPDMSVESKC
                     EPFSVKLGTSRRTTEPRVYYVRAQESIIQRTYVNHPPRLQPSERTIRGMLARSVRAGW
                     STAGSVAFPSHAELRDGAEVGGAVPEVVGACAVAATPFHWHKPSQKALTQCAVALLRL
                     FLQHTDVADDAVCPLASIHLHRNKSHNTLSAEKLKVASNAIEGVISAAGKASLSRVEL
                     LSTRQTCTVLSLLSALYALPEADAAVPNAMEEARYLTQLRHRNLAGWLKTELAAFLDS
                     SATRAVKLSPAEELVQAMLCHRLREARASAQSVANAELARVVRVCGEGNQFGGYIEMA
                     KSGFKDGEEVRQRVVSLLSGKVEPFIRDEEYTGLDEETAEVRAAPTAATWKQLLGIFT
                     FYGCVPDTPAEDIIHAFLERLRAPSSRKLNPLPPYAERVDTAVLRTHRGKDVVRRGNT
                     FQDAALLLLEGFANGSAPPAACLHPHASSYSGADYLTAFVIVAAIRAVQVPREQAYRD
                     AELSVLLGMTAELECNDETWFWGLLPLHMIESPANRLDAVRAFCKRNAMRASVQKQLG
                     EPQADYDRLVSLMRVNEGWLEPVYVPPEEERSAAENMPSVRTHAALEKALAKLAIEPW
                     "
     gene            <110576..>112894
                     /locus_tag="LDBPK_270400"
                     /pseudo
                     /db_xref="GeneID:13389158"
     mRNA            <110576..>112894
                     /locus_tag="LDBPK_270400"
                     /product="hypothetical protein, conserved"
                     /note="contains an internal stop codon"
                     /pseudo
                     /db_xref="GeneID:13389158"
     misc_feature    <110576..>112894
                     /locus_tag="LDBPK_270400"
                     /note="contains an internal stop codon; hypothetical
                     protein, conserved"
                     /pseudo
                     /db_xref="GeneID:13389158"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="UniProtKB/TrEMBL:E9BIX4"
     gene            <113860..>114282
                     /locus_tag="LDBPK_270410"
                     /db_xref="GeneID:13389159"
     mRNA            <113860..>114282
                     /locus_tag="LDBPK_270410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861850.1"
                     /db_xref="GeneID:13389159"
     CDS             113860..114282
                     /locus_tag="LDBPK_270410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861898.1"
                     /db_xref="GeneID:13389159"
                     /db_xref="UniProtKB/TrEMBL:E9BIX5"
                     /translation="MNSTTTAQFEAAWCEVERQQRERLSASTERLNAEVERELTLLLA
                     GVRDALTEDQRDIQSEFDKLIRMVEQFQQGVDMWQLKAKSSIKMIEEKQRNFALLVEE
                     TSIRAAANRRDSIDRLQKRAIETEAHCQQLIAAASKSM"
     gene            <115472..>116608
                     /locus_tag="LDBPK_270420"
                     /db_xref="GeneID:13389160"
     mRNA            <115472..>116608
                     /locus_tag="LDBPK_270420"
                     /product="heat shock protein DNAJ, putative"
                     /transcript_id="XM_003861851.1"
                     /db_xref="GeneID:13389160"
     CDS             115472..116608
                     /locus_tag="LDBPK_270420"
                     /codon_start=1
                     /product="heat shock protein DNAJ, putative"
                     /protein_id="XP_003861899.1"
                     /db_xref="GeneID:13389160"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BIX6"
                     /translation="MRRLLGRSMCADPATIRAAAGSSMRFMRNTRTAPSATAPFLRRW
                     QLPSTRLSSSCAFVQTDRRWQSDSAGQQDLYVVLGVRPDATQDEIKAAYKKLALEYHP
                     DRNHQPGAEEKFKSISAAYSVVGNREKRREYDAQRAMSRGMGGGSYNSGSSGRAASGY
                     SAGFPGGMDRGNYQYHQMSKEEADQLFRELFGGMRVDQIFRNLEEEMRLGGIKGNGLG
                     GHVGRSFPDSEQAFRPFFSVESSTANVFVDDHGNRMEETTYTDSRGKRFTVRRMSSTD
                     PNASVNQTADEFYRGRHAGKDGRYRFGNVSSQFQRPDNDFTQNMLGVRSHGRSPLVAF
                     LILAAWTVILGTLLFCCIGFLTRHPLFFASVLVLILLGRAARPF"
     gene            <117882..>118871
                     /locus_tag="LDBPK_270430"
                     /db_xref="GeneID:13389161"
     mRNA            <117882..>118871
                     /locus_tag="LDBPK_270430"
                     /product="ribokinase, putative"
                     /transcript_id="XM_003861852.1"
                     /db_xref="GeneID:13389161"
     CDS             117882..118871
                     /locus_tag="LDBPK_270430"
                     /codon_start=1
                     /product="ribokinase, putative"
                     /protein_id="XP_003861900.1"
                     /db_xref="GeneID:13389161"
                     /db_xref="GOA:E9BIX7"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR011877"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9BIX7"
                     /translation="MHRARNVRSHTGEYAPDILVVGSCFLDYVGYVDHMPQVGETMHS
                     VSFHKGFGGKGANQAVAAGRLGAKVAMVSMVGTDGDGSDYIKELERNGVDTAYMFRTG
                     KSSTGLAMILVDTKSSNNEIVICPNATNHFTPELLRAQTNNYERILHTGLKYLICQNE
                     IPLPTTLDTIKEAHSRGVYTVFNSAPAPKPAEVEQIKPFLPYVSLFCPNEVEATLITG
                     VKVTDTESAFSAIKALQQLGVRDVVITLGAAGFVLSENGAEPVHVTGKHVKAVDTTGA
                     GDCFVGSMVYFMSRGRNLLEACKRANECAAISVTRKGTQLSYPHPSELPAGVM"
     gene            <120913..>122745
                     /locus_tag="LDBPK_270440"
                     /db_xref="GeneID:13389162"
     mRNA            <120913..>122745
                     /locus_tag="LDBPK_270440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861853.1"
                     /db_xref="GeneID:13389162"
     CDS             120913..122745
                     /locus_tag="LDBPK_270440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861901.1"
                     /db_xref="GeneID:13389162"
                     /db_xref="GOA:E9BIX8"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:E9BIX8"
                     /translation="MTDVTSSLRPSSRQGSPVPRRQLGILPVNQRSYSRVGSKGMIGD
                     DSPLMSPLPYYPRRRSVTFAGDQSVREERPNYNAAYSASAPVSPARHGSPPPVSILKP
                     NSSFPAAEEEDSGAAPAYQAAAATVGGVLDRKDRARNSPVPVRGRSNSRQRLAARRKE
                     AQLHRSFYDDSFVEEYVLRAKTELEQEEAEQRRMQEQLRTEQERAKRAERRVSEAAEK
                     INALQHAKEVLMTATVRRHTSVTPSPQRAPAEKSKRNSSLLRELEEDPDPEVQAALKE
                     LARNSLAKQQRRVHSSAHQRRRSISIVSADALAKSGEADDGDDNDTRKRARLEKIVST
                     LLAKKAKSKSKRSVMVIDWSDLDSDADGDTATTEEDGEETAVALKRRRGRPAKSRSIA
                     LGTEATLVSSAKHVQRPSTKRAASSRKRHASAEPELGDSLLFEDEAEQPILLPRRQNT
                     RPPPTRSISYIEMGSGDDLLRDAASVERVVRRPPRATRAPVTRQRRGRLASTSTREGA
                     EDMSSFTDATAWRGRAPQPPAATTGGPTGVPPRRRRGSAPRADPNDPMAVFFEAAFPS
                     PSKFDEMMMQAGGLPETRRGGGGGGRGQGRHPNLVLPSSIGRRR"
     gene            <124174..>125844
                     /locus_tag="LDBPK_270450"
                     /db_xref="GeneID:13389163"
     mRNA            <124174..>125844
                     /locus_tag="LDBPK_270450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861854.1"
                     /db_xref="GeneID:13389163"
     CDS             124174..125844
                     /locus_tag="LDBPK_270450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861902.1"
                     /db_xref="GeneID:13389163"
                     /db_xref="UniProtKB/TrEMBL:E9BIX9"
                     /translation="MSFSPPCTQVPLLLPEELRDEVVSGAAEIIVERGSRNRCFLHVY
                     SEEERLAKVEDIADPDDVVRHAHEKHLSELRWARGVLWADSRVQRFVRYADHILWPAY
                     ESLSKVVNVVRQLILCEEGDNATALKRARDVAVANGILRREATLPGLHPLKETRMEGQ
                     AILYDVQQVRKRSRDAWAATMPSVLLRVDEEPVDSVAWIAEVKQASHTVSDILQLQLA
                     TTPLTRLVELLSQPRSSPAAADSASTASAARQQWRCLLEKHRQWAEYHSLFADVEEAC
                     RGWGASEACVARDVHAALTSGSSVQLRTGVHASVLQRLELHILLSPRFRKLDSFAAAE
                     QAAFSAHCPARSWRECVEEGMVRVVVLPPTGLTPAKLDTLVRQHFLTPALCDVPLAEC
                     CTVSEARSITADLQVVHVTSTFNPFVVVHGSRVSSGFAGDVPYFRSLQHERDRLVTDR
                     TDAQLRQGLHEAPSRGISGAANDFVSLPSSSQPPQRAPLRITGDAAIAAFHRALISAL
                     AVSPLTRAEIQHHPAMREYRDAANYEAVLKVALKEHAEFKGRKYQLRN"
     gap             126524..126622
                     /estimated_length=99
     gene            <127626..>128618
                     /locus_tag="LDBPK_270460"
                     /db_xref="GeneID:13389164"
     mRNA            <127626..>128618
                     /locus_tag="LDBPK_270460"
                     /product="RNA processing factor 1, putative"
                     /transcript_id="XM_003861855.1"
                     /db_xref="GeneID:13389164"
     CDS             127626..128618
                     /locus_tag="LDBPK_270460"
                     /codon_start=1
                     /product="RNA processing factor 1, putative"
                     /protein_id="XP_003861903.1"
                     /db_xref="GeneID:13389164"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:E9BIY0"
                     /translation="MGKGARSKRSTRPYAKRQHVLESKAQEVDPALLERYRNTQQPIR
                     KSQLFTEILKQKKDTKRARRESRENERRHLKDKAPVKATPKTKERKRRADVTIIENKE
                     DAEIINDEADDEFAAFFRDRKNPKTLITTGEHPCFRTKQLVKELLWLVPNSIYRPRKS
                     YTLKEITLFCCNREFTDLLVVTDRIKEPYNLIVSHLPEGPTATFRVSNFLSYTQLEDP
                     APRTEHYPELIFKNFDTRLGRRISRMLECLFPATRDYAGRAVATFHNQRDYIFLRTHR
                     YIFDGLEAVRLQEMGPRFTLRLLSLQSGTFDRQFGEYEWYRKKEHDADTLEWYM"
     gap             129550..129648
                     /estimated_length=99
     gene            <129747..>131609
                     /locus_tag="LDBPK_270470"
                     /db_xref="GeneID:13389165"
     mRNA            <129747..>131609
                     /locus_tag="LDBPK_270470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861856.1"
                     /db_xref="GeneID:13389165"
     CDS             129747..131609
                     /locus_tag="LDBPK_270470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861904.1"
                     /db_xref="GeneID:13389165"
                     /db_xref="GOA:E9BIY1"
                     /db_xref="InterPro:IPR028131"
                     /db_xref="UniProtKB/TrEMBL:E9BIY1"
                     /translation="MSDKVLAIVEQLSQQNPFHDQEDLPDPPRPSETAIPRDRPSAEQ
                     VPFIQKQISILSYNHLPRTFFSLEKHRSLQSILFTAKEVLCEALPIRCLEATFVALHY
                     TQTLRDIDRIPLSFKSEANGHFYRHIVLVLRTRSTPALYGALGLSRKPTLMYKPLAYH
                     SLFDVVMDYKHEYEALGHELLDIKLGIAITHDEHSRWDPCWRFIALKLDHYRDGAKER
                     SLKRSPKEHHKPTSLGTLQTHARKPSSRVANDSFSSSNGGQTALPPLSPGPPRVETSA
                     HCINGDVLLERSAKAVGASRSETVAPEYSERFPPLSTCDSTLSPPNSVSNASPSLPHP
                     PSTTDAAVETYAPLAQLLSNYMRLLPTISEQYYKGIATVDNNNRALKLCFMDLDTAER
                     DSGAENQRRLQLIGEMQSPLSAEAKRVAANRKLKPPKRDRGIAKNASGSGSGGARHRQ
                     INSGAAGRGKTNKRTSLALPPSVAAADGKGAVPSAVVQPHRSPQMQPSLVAPDLSYQS
                     ASLSAALMGNSHTSRPCMPFERIVVDAQNTGSSASPLCSGDGGTEGCLSPCDASPDSC
                     SEDAFAAPPLTPRNYDARKPLSHYEPSLRSTSSASDLFSTPFSLKATAMCSPRR"
     gap             133234..133376
                     /estimated_length=143
     gene            <134085..>136151
                     /locus_tag="LDBPK_270480"
                     /db_xref="GeneID:13389166"
     mRNA            <134085..>136151
                     /locus_tag="LDBPK_270480"
                     /product="ATP-binding cassette protein subfamily D, member
                     1, putative"
                     /transcript_id="XM_003861857.1"
                     /db_xref="GeneID:13389166"
     CDS             134085..136151
                     /locus_tag="LDBPK_270480"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily D, member
                     1, putative"
                     /protein_id="XP_003861905.1"
                     /db_xref="GeneID:13389166"
                     /db_xref="GOA:E9BIY2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BIY2"
                     /translation="MPRPYSDLQKSGSVSTAVYSMPLVHRLVVACTSAVFALALLTQR
                     YHLRLYGQTISTVHTEDDTQVTWDLCHRFFQIARIALPTWRCRESAGSVIFILLFAVK
                     AVLRVWVSKANGEVLAAMLHGVPSERLPRFVSKVIARIAVGLTAGMTNGAIEGLRPWL
                     IGCYRERLSSTFQRRFYNRLVYYQGTMLDSRLEAADTAISTYCGEFAEHFAELPYYFV
                     LPALGCVTSMAALVEQAGLKSALMMSSIATTAVFVLRRAAPALGRIHSQLLSREDDYR
                     RMLTNYLNNVESIAMHGAGKYILRQLDISLAKLKESLDHMALAKGNFEMMESAFSTFM
                     TVVAQCVTFAGARRSPYHRSINAVYLEIQLIEDLNSSVKDFVVNFRELSHLTEFATKM
                     SEFDNTLESIAAGTFIHSRQNTNYASLPGAPLVYTQMKSIAHAPDAKTFPLVKMEHVV
                     LESPAGQQLFSNMSVEFRSDEDWVIIGENGCGKTSLLRMLCGLWMPKSGVLSQDTSVR
                     FLLSPQHSYMAPQCTLYEQICFPDAVEAPTPEIRAAISEAVEMAGAQTVVCVIGGYDS
                     AVMGLDLSNTDESYDWSSLSGGQKERISMARVFFHVLRMDRTKETPVAILDEATSMMD
                     DTEQDVLNHLRRMNVRMISVTHRDVVIRHHTNILRIVHGGKWTVEKVRNPVKIGERVE
                     TENAVV"
     gap             138415..138513
                     /estimated_length=99
     gene            <140824..>142623
                     /locus_tag="LDBPK_270490"
                     /db_xref="GeneID:13389167"
     mRNA            <140824..>142623
                     /locus_tag="LDBPK_270490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861858.1"
                     /db_xref="GeneID:13389167"
     CDS             140824..142623
                     /locus_tag="LDBPK_270490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861906.1"
                     /db_xref="GeneID:13389167"
                     /db_xref="UniProtKB/TrEMBL:E9BIY3"
                     /translation="MPIAPSSFMVERTGTCAVLDVRHRTVIVAIEAELLDSWASAADG
                     EPTPYALWALTIPMRVACFADGFYTATAPVPLACANCVPGAPRCRIVVSLHRWDLCKG
                     TRSALLLAPLDAPSVLVREALEEALGMRRAEAQLPPPLKIAPVVRWRLSGTEMLSPGL
                     LAEVEWQPLLHRRWYELKSYVRQGTVVPHYSARAGRRTTNGADSYDGSAGSLNGGSPA
                     STGVMFAGDVKEADAVSVNRACIRWTDGVVGLWDEVKPYYRVYQPARPEKTIRVRRFP
                     HRYADVVGEVPFGQRIEAFGRATDPFTAEQYALVYLPAEEAFATHISTYHLTYVEEGR
                     YIWGWSKLSGASGLPLLVEAEGNDAKAGHIPAGSGNGCAIASPARDTRSRVQEGDGSD
                     VMPLPEPTFYTPVRDGRPVSIRSMPCMSSSVVREMEMNEVRAAVALVTVPLRLPADPA
                     SAPVSHVFLEWQGGGYSLLRNATESFLAPVQLSRVPRRFPIRTRSGGDDGTAAAPEVL
                     DLCRARSHAHRHSSAASEDKDEEAKLAEMMRPHRTPARVAVDTSLLSPHSLPACLQEA
                     LRRGVVRLEDLPAVGGDGEANQSDSSGDCSSAC"
     gene            <145188..>145391
                     /locus_tag="LDBPK_270500"
                     /db_xref="GeneID:13389168"
     mRNA            <145188..>145391
                     /locus_tag="LDBPK_270500"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003861859.1"
                     /db_xref="GeneID:13389168"
     CDS             145188..>145391
                     /locus_tag="LDBPK_270500"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003861907.1"
                     /db_xref="GeneID:13389168"
                     /db_xref="UniProtKB/TrEMBL:E9BIY4"
                     /translation="MAASSIHETPDSGEVFADHEFNKNNAGITDDWISIRQLYPAGVN
                     QPLLPEVFSREQFGQGNHYECFML"
     gap             145394..145492
                     /estimated_length=99
     gap             146354..153411
                     /estimated_length=7058
     gap             153572..156449
                     /estimated_length=2878
     gene            <172455..>189107
                     /locus_tag="LDBPK_270510"
                     /db_xref="GeneID:13389169"
     mRNA            <172455..>189107
                     /locus_tag="LDBPK_270510"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003861860.1"
                     /db_xref="GeneID:13389169"
     CDS             172455..189107
                     /locus_tag="LDBPK_270510"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003861908.1"
                     /db_xref="GeneID:13389169"
                     /db_xref="GOA:E9BIY5"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="UniProtKB/TrEMBL:E9BIY5"
                     /translation="MSVEEVPDSNKLFSDAVFDRENAHIAREWQRITEVYPAGVNQPL
                     LPEVFSREQFGQGNHYECFMLSALATLIRFPDVIRNCFVTKKVRQDGRYTFQFFRGQE
                     WVKVEIDDRIAMEEGEVLYARSPTEHWWPLLLEKAYAKFYTLYQNLEDISEGEVFHDF
                     SGCPVIFIPMEADKAKVVNYDIQSAQFWRDLNNELDQTALAALALGEQAEQYGLHHEG
                     SYAVLGFIETRNAINLTPADVLVKMYNPYEDSPYTGPMHRDDSSWTSEMRSICNPAQR
                     NIFYIPANVFLDVFANVQQAYIKAPLHPSYNFNSEWGDTTSGGNVSLVTWRANPLYVV
                     RNKAEEPVQIIGMIRQPDQRHLLHRQTNHELNYIQCALVVAESISAERIPTYLVTGNN
                     HRRLRSGLYLHNREVADVMTIPADSLCYIIPTGMRRDRGKFIFSYWFLRKGDKDKLDI
                     ERLNTDVARQLPAIAHLDLMNRGHARVDILVDVPTDLHILLKQEKPFKHASGGDAIAQ
                     DFLSMYLYDANDKRISPSTQATNNREIGLVQHVSKPGRYAIGVNCTSGTGDVPCKVEI
                     VAQERAHVRITEAPDNARELGELDLSFLDPEPEGVPLADLPLEEDLKFQEQLDALKRL
                     HHKPHRNEDEILALERKMNARAHELARALLGKDRCKYLTGQDIEKLAPLLDSDPEYMN
                     AERERHNLKKDPRNAGKVRALEEELRDRAAALADTSAGIDLGFMDLEYEGIPLDDIEL
                     LSDPAFEEMAQARASLLSDPAANARKINDMEDKMHDRATEMARDMHKKERTCLDPEPE
                     GVPLDLLPLNEDEAFSRMEDELRALNRKPKRDAKAIKDLQRTLNDRAHELASVLKSDE
                     RELFLDPVPLGIPVADLPLDTDPEFHLKEIERLQLRKEDPLGNRDDIKTLEDELNDRA
                     RELAKDQQANQRAFLDQDPYGVPLEKLCLDYNDDFLRKESELRALQKNPRCSATAIAD
                     LKADMSEMVDALAAAEAARDRNFLDPEVEGRLVHLLPLLENPEFKELDTKRRRVLNRG
                     GDTSKVPDMEDRMNDVALEIAHDMNVAERPDYMDTTYKGIPVEDLPLDEDPLFRSLEV
                     KRQQQKQDPRRNARGIADTEQELNDRAMELAAEKLKGDRNYLDPEPEGVPLRLVPLDS
                     DAAFAEMEAQRAKLKKDMRRNTKPIAEIENLLNDRAHELAKSLKEKERPKFLDARFSG
                     IPYTELPLDADQPFRDMEVQRLLLKEQPHKNATAIQDLEEALNDRAGELAKEKLAKER
                     AFLDPCPLGIPLEELPLDSTPAFIAKEERLRALNKDPYKNATAIKMLQGEMDDMVSAL
                     AAEELARMRGFLDPEPEGRLVESLPLNDDPQFHKLEAQYRDLKKSPKANPQDVADCEE
                     LMNDRAHELAKDMNREERPDFMNMTPRGVPLEELPLDTDDEFSNLEAQRARLMRQPAK
                     NKKAIDEIEYALNLRAEELAQEKIQADRAFMDEAPQNIPLKYIPLDKDKEFGRMEAQR
                     MALRAQSQNARALIPKLRELEDAMNQHANDMAKALKQQVRASVLPPRIGGIAREALQL
                     DDDVPFTDLEVAQIAANGDGDLDKGRDLGDAMQKRAADVAAKLRWEERANLGNPLGFS
                     PEDLPLERSPEYLQKESALVEMRANPKKNAQSIKSAEEDLHALAMEMAKEKAAEERED
                     YIDPEPEGRKLNDLGLDDDPTFVGIEEQYRRSRKDPYADQDRLRDLEQMMNDRAHDLA
                     KMKNARDRDMYLDRAPRNVPIVELPLDTDEEFGRLEAQRAKLCQNPVRNAQSIRETED
                     ALNDRADVLAAEALKNDRIFLEAEPEGVSQRQLPLDLDQTFRSLELKRAALKSAPIKD
                     DRAIRAVEEQMNDHLRKMAREVKMDARRDMEPNSLGIPSEDLNPYLDEDPHFHELEDM
                     YRDAKNNPTKAKKASQLLDQMNERAREIAQAVHDMERLPLNQAPNGIPLETLPLNEDP
                     VFNALENEARALRKGPSGGKKSAERLADVEDRLNARAEELANAARKQYVDAMPEGVPM
                     ELLKLGDDPSFVNAEAELRRLEKNPVANRQGIKDLKDELNFMAHEKVKRLLRGDRGYL
                     HQTPDGVDLCHLPLDTDPVFHELETRRAKLKSEDPRAHQKAIAALEDQLNDRAHELAK
                     EVKEGELRALEPDPHGIPYAVIIPHNDVEFNNCAKHLRDLKSDSKRNAAAIRETVDRM
                     NDRGAELAEAMLKQDRSYLKPQAAAVPLKYLPLDTDPQFNRIEVERAKLKARDSVKNA
                     KKIQALEDQLNERANQLAEAQKQEDLRGLDPKPEGIPLYVIDPHSDAKFASFLPQLRD
                     MKADPRTRPEDLQQVVDAMNDRAHELASEKLRGDRLTYLEEEPKGVPLDLLSLDTDPQ
                     FHDIEAQRAVLKAQDPRRNAAKIRDSEDRLRERSYELAEQQRTKDLENLDQVPEGLPI
                     TLVNPHDDPAFAKMVNQHRQLAKDSVKDSAKNSELLTKLEEKMNDRAHELAKLMLESD
                     HSFLDPAPQDVSLAELPLDTDPEFHRLEVERAKLKAQDQRRNTAKIKDIEGQMNNRAH
                     ELAREQLAEDLRGVDPAPRGLPVELLNPHADSQFAEAVKQIRVLKKSPIADPKAKLAM
                     LDKMNARVRAMADEAMDRDYLDPEPEGVALADLPLSSDPEFHDMEVGRARLKLRDPKR
                     NARAIKDLEQRLNDHAHELARRQLEEDLAGCDPEPEGIPLALLKPAEDPKIAGMIPQL
                     RALKKDPKKNAEAIRRVENEMNNRANELARQLLEGDRGYLEPNPENVALEYLSLDKDP
                     EIAEMEVERAKLKAQDPRRNQRRIADLEDRLNDRAVELAVAKKAEELAHFAPQYNGIE
                     TAAMRPYDDPEFAALVDQLRKLEKASAGASPEAEKVLTDMDARLEVLAKEKVEGDLWF
                     LDKEPEGIPLEEVEVELDPIFQQLRQECANLKAKDPRRNADKVKSLEDQMRSRVHELA
                     KHLKESDFDGVDTSPLGIPLELLQPLEDPQVARILPELRRAKKSLRDTQRAQGLLNEL
                     NERIHELAKNALSGDRSAYLDPDPAGVPLSDLPLDTDGIYSGLEVERAKLLLKDLAKN
                     AKQIEDLEDRLNERAHDLAQQVLKDDLKNVDPKPHGIPIEAVRPHNNPDFHNLATRAR
                     ELRKDSRRNADKLAAIQEQMNDLANQMAAEMLGNDRGYLDPEPEGVPVEMVLLDEDPE
                     FHEMEVQRAVLVAQDPVKNRQAIADLEGRLNDCAHKLAEAQKREDLRGLNSAPLGVPV
                     SLLNPHDDPRFAAKLPELRAQKKEGFPRAQSRLNDTQAKLDEILEELAAQYLEQDRAR
                     YLYPTPEGIPVAALPLCADPEFHQLEAERLDLISKNPKANKDAIKDLEAALNERACEL
                     AREHRKGDRGYLNAEPLGIPLDVLPLDTDRQFSDLEAKRAALKTKDAVRNAAAIHDLE
                     DQLNDRANQLAEDQITEDLRAVDPTPEDIPVRMLKPHDDPEFARMVNALRLLKADPSA
                     DPKKVSDLEQDMNDRAHELAEEALAGDRPMYLDPKPEGIAIESLPLDSDPLYHRLEVE
                     RAKLMLQEPKKNQAKAAELEGRLNDRAHELAKEQRARDLQDLDEAPRGIPVDLLNPHE
                     DETFASLAFQRRDPNNTLRKALDIGGTNGDPTRDMLNERLDEMAKQMLEGDRDYLDPN
                     PEGVPLRVLPLNEDPEFHEMEVQRAVLKAKNAKKNAVAIKDLEDKLNDRAHDLAKDAL
                     NGDRGYLAPEPRGVPLADLPLDKDPQFHQMEVERAKLKAQDLTKNANKIKDLEDKLND
                     RAENLAEAQKKEDLRNLDGKPRGIPLESLNPHDDAEFASHLPELRRLKNEQPNHPKIK
                     DLQAKLDNRADELAKAQIDRDRAFLDPEPEGITLAQLPLDSDKLFTSLEKQLRQAKQD
                     LKRNADKITDLQDCMNKRVHELALNLLKGDRRYLDPEPENVPIADVPIDADAMFRELE
                     AQRAKLKEDPKRNADKIKDLEGKLNDRAHELAKAQKEAARGFLNPTSHRVPKVLLPLD
                     EDAAFVKMEQQLRRLNKDPKRSASAIDNLKGMMQDRADELGENLLKGARDKYLDPNPE
                     GVPVGYLPLDSDPQYSHAELQRAVLKAQNAKGNAAEIADLEKVLNDRAAELAKEQRQK
                     DRAFLDPEPEGIPIADVPLDDDPNFLRLEDYLRKLKKDPRRNADAIADTQESMNDRAH
                     ELAKGVVAEDLACLPRAAYRGIPKEDLSLHTYLKFRDAANRRRDAKRRRLPTTDIRLI
                     EDEMDRIASEIADDVIDSERAFLDPEPEGMAIANVPLDADKEFAALEAERRRRSKDPR
                     AAKRNKDVIRDLENQMSDRAHQLAKEEFAKQRDFMDQEPEGVPLERLPLDTDPEFKDA
                     EIARYKAKTDPKADPKKVAALEKRMNDRAHELAKVELAKDRAFLDPEPEGVPLADLPL
                     SDDPEFNVLAKQRQALKNTRRGRDPEMKDLEERMNDRVHDIAREFLSKHRGYLNPEPQ
                     NVPIADIPLNRDPIFREMENELLKAMKDPRSNAGKIAELQDDLNNRADDLAKDLRRKE
                     LANQEQEPLGVPLEELPLNYDPILNPLERKRRDIKKNPKRNADVLRNLEREIAARIDD
                     IARDFLAKERAFLDQEPEGVQLERLPLSDDREFHEMERDLRALKKQPAKNKDAIEDLE
                     ERMNDRAHHLAKDYLAKDRDYLEKEPLGVPVEELPLNEDVTFRDAEEKRRALKRDPRG
                     NAKAIKDLEDQLNDRAEQLAQQKLDKERAFLDPRPEGILLKDMQLDRDKAFKDMERQL
                     RQLRKDPRKNANAIRDMEEDMNSRAHVLAKRQLADDRNFLNPEPRGVPLVDLALEDDP
                     EFRKTELARREAKRNPKNADRVRELESILNDHADRIAGEYLKKDRAYLDPEPEGVPLE
                     ELPLDTDPDFHGMEVDRRKLNKDPAKNFRTIKDLEEQLNNRARELARDKKGYQDPVFH
                     EANEDIAEQWPRIRELYPEGVYDPVTPDTTLPSDISSAPQDMGFLAPFIAALARHTVL
                     ISRLFQDKAHPQNQPYRVTLFNPDSSPVTVEVDDRVPCDDKREPKFTQVPSRMWYPLL
                     LEKAYAKFVGGYENFNNCNAHDTLRDLTGRPVLHISLEDPKHAAATNMGDYTTPAFWR
                     RVMEDLDRGDVFVCVANGNVPDGLHPQCSYALMDVVEVKPCTSDPLDIVIKVHNCYTD
                     APHYNGPLRKGDSNWTADVKRACSFSPDESDMIYMPLSTFLNNFSCMQRCHINCGDRL
                     SSPGEWNDYTAGGTSKYTTFRSNPIYLVENKTSRPATILAEVRHTNPLYVDETNCKQY
                     PYTGLTLMQPSNAKLPPTPFITNGTHKFLQKGMMLDSREVCAEMELPPSSTCYLIPYT
                     KDRGTMGEFFVSIYPDMAKVTLTPLRHAGLTLKPLRTSLSLHPGDEEGERLDFMVNDA
                     SDVHILLHQTKISDPNSIRKGDAVAEDEVTMTVFNEYGIKIGTTGDSSNAREHALIFK
                     APQGGRYALLVNCTASATGGPCTANLEIYTPTDVSADFVPVAPDAKPLNAQAQSRFPT
                     LSRTATAPGASRAASRTGSNVRRTDSLPPINQRSVSSRRGSREEAGHRSSRGRR"
     gene            <200354..>204919
                     /locus_tag="LDBPK_272520"
                     /db_xref="GeneID:13389170"
     mRNA            <200354..>204919
                     /locus_tag="LDBPK_272520"
                     /product="cysteine peptidase, Clan CA, family C2,
                     putative"
                     /transcript_id="XM_003861861.1"
                     /db_xref="GeneID:13389170"
     CDS             200354..>204919
                     /locus_tag="LDBPK_272520"
                     /codon_start=1
                     /product="cysteine peptidase, Clan CA, family C2,
                     putative"
                     /protein_id="XP_003861909.1"
                     /db_xref="GeneID:13389170"
                     /db_xref="GOA:E9BIY6"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BIY6"
                     /translation="MSSLFTEVPDSNTLFKDTEFIASNQDVADQWVSIRDLYPSGVNQ
                     PLLPEVFSREQFGQGNHYECFMLSALATLIRFPDVIRNCFVTKKVRQDGRYTFQFFRG
                     QEWVKVEIDDTIPLEDDAVLYARSPTEHWWPLLLEKAYAKFYTGYDQLEGCTLQETFH
                     DLTGNPVLNIPMDAKLAKAAGVNTKDGPYWLLMGECLLRGDHVLSALTKDAELESIGM
                     QSEQQYAILGIFSLTGSSALDDIVIHLHNPFEDDEYEYSGPLNKNDSKWTEKLRQQYP
                     VDDRYSIFIPLKLFLKSVNSIQHCFMRTIDAVSQTYSAAWKGESAGGNPTSVLWRKNP
                     LFLVRNSGPAEVKIVTMIQQEDQRRFSNPDSDTTYAQCGVVVTRFTYQHPIPTFYVTG
                     NSHKTIFKGLFLNSRDVSNVFTIPGHSMCYLVPCTMQKGVEASFQLSLYHLKDQDYSQ
                     LSVEQLTIPGMNWAGPATKDIELCQKKKDRADFYVDEGTDIHILTHQTKPYVSKSGGD
                     AMTEDFMGMYLYDDTDRKIAGVHAATNFREISIIHRLPRSGRYAISITCPRAKGEVPA
                     YITIVGSHASNVRIVDPPEDATMFDDEDIIDEGEDAALVHNPIDYVPVVFDVAHHDEQ
                     AESDSPFEDKRFYVDNRGATSEPWVHIGDLYPEGKTRPLLPNELSRDQFGQGDHYDCS
                     TLTAFAALLEHHPDVIRNCFISKNPRKDGRYTFQFHRYGQWIKVEIDDRIPMVKGDTV
                     FCRSPTHHWWPLLLEKAYAKFYTRYENLENLSQEEVFHDYTGRPRISVSTDPAEAKVN
                     MSYFDEAPYWKELASKLPDLCTTALASGREAEQYGLLKGRHYAVLDIVSIADGERVSD
                     MLVKMYNPYEDSPYTGPMNAKDDAWTSELQSRFRPGDDSHAFYIPADNFVTAFSAMQM
                     GYVGGLAEPSRHFNSEWGQDTNGGDTSLISWRKNPLFIFSNPTNDVVQLVAMLRQPDQ
                     RHLLHTMPNQELVYPMKGLSVAQANPSAAGIPTYLVTLDNHRLIHHEKPLAVREVTNV
                     LTIPPQSVCYVAGHCNNRAVSKFLLSYWFMRGEDGEKLRIERYRPKVAQHQPAIAHVD
                     LGNRASERVDFLIDTPTEVHAVLRQEKAFESPQGGDVIAQDYVGVYLYDLQNNCIKGL
                     PSAMNYREVSLVTHLAKPGHYVFFITCPHSSGDVPCKVEIAADEDAHVRITETPQNAA
                     ALSALDMAFLDAHPESIPLSELPIDRDLPFQDDLAALERLLSDPSASAEEIQRLKDCL
                     NERAHALAKAILASERPIYLISHDLHALNPLLDDDQAYMDAERERYYLKQDLRNHYKL
                     PAQEAKLRSIADSIADELLHVDLSFIEARPEGIPRDAIPMISDKAFAEMTTDLLRLRR
                     RPEPNPSAIRDAEHRLNERAKELARAMHDTERTYLDQQPQLVPLELLPLNTDESFCAE
                     EDELRQLLQSSPSAQQTIAALQAKLNNHAHELARQLKDGERGKLLAASYEGIPTSELP
                     LDTDAAFHEMEVERLRRVRTCADADADA"
     gap             204922..205020
                     /estimated_length=99
     gap             208118..208216
                     /estimated_length=99
     gap             209036..209134
                     /estimated_length=99
     gene            <210457..>213210
                     /locus_tag="LDBPK_270540"
                     /db_xref="GeneID:13386835"
     mRNA            <210457..>213210
                     /locus_tag="LDBPK_270540"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861862.1"
                     /db_xref="GeneID:13386835"
     CDS             210457..213210
                     /locus_tag="LDBPK_270540"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003861910.1"
                     /db_xref="GeneID:13386835"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="UniProtKB/TrEMBL:E9BIY7"
                     /translation="MQVVVQASSLAAGESRRGTYQTALSDACCAEEAESETERNWGYG
                     ADGSTTSASHTGSSSAPKQAPVTSSLVFQYFSLLASYHGAGHVPRYWADMLRPSSVAG
                     AKDDDASTSEHARECADELISPVTEIDLSVCYVGPTMLLALADLLRVQCVTVQRGRSQ
                     RWPVGGKEGMGTLPSVMAPLWGAGARRSSKGEEVMCSLLPHLTTLRLMHLAMDFTVPD
                     DATGSKGGNAVLRSMLEALQGHPSLKMLDLSGNPVAAALVPAISRLVQVTPSLTTLML
                     DDTLVTDSEKEMLRAQCLLNELRLQRATADGAAATVSDDASSTTSPESVTRGLWAAQM
                     CENVLMAVERGVSAVPWLLGKSTALIRRYGTSKTSQVETSAFGRSARTSRTSDMTGGL
                     SQFGSSSVSPSSATNVAPSLEIAYLSYDYTSESSAAAVATVPPPAGATWSAECTEVAR
                     CAFMSRSLAQRTVLGGRPVWPNVPKPLEAVVSTDLAPPSAAAVAATDLLLTLRQQVLP
                     EPEAPPGLRRGSARDDTFLTTAEEEYWSVRKKQEVQWGYVLQKVSENLAPVFVRNGHT
                     LYAEGSVCDSIYLLPVSLQETRTYAELHVGVNPGQVNRVLPGQWVGEAEILDCLSIYA
                     KYPSSATDVSAAVPGSETVLQRSSTVRVFTEATDDVVLWALPFRVAFFYLYAPYQLLH
                     KQFVHRTPMSAFAHIHPVHLACAPVHMHASHGSCPASAGQGRDSGAAPVLCRYAFMSR
                     HVLLLEEGEFLLRLPSLASHVGPRNGGRTAASTRVVMEDHHLLSGVTVLTQPLLDLDA
                     ALRVTVAAELAAENGGATVTYARGPHGTLALGKQAELCRFRAAKVERTAASATISYSG
                     ASETAETVGDSDGNAAVLRQCRTGGKAAQWRYSAITNEEFTALCPALRVALTRHICVV
                     HDL"
     gene            <217775..>219136
                     /locus_tag="LDBPK_270550"
                     /db_xref="GeneID:13389171"
     mRNA            <217775..>219136
                     /locus_tag="LDBPK_270550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861863.1"
                     /db_xref="GeneID:13389171"
     CDS             217775..219136
                     /locus_tag="LDBPK_270550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861911.1"
                     /db_xref="GeneID:13389171"
                     /db_xref="UniProtKB/TrEMBL:E9BIY8"
                     /translation="MQNSNSSYPSQKPYRGRGITDGPSMGTPHSTYSQQKPPTSPLVF
                     AAPGSGTPPQQQDPLSASLYSEPLPMNYKAPLGRHNSRTLIEVEDSPIKVTCLTKGGT
                     RSPYMTPMPSDMAPDADRSGRHNPYTFSYSGSSSPIQVSTPTHSPQASAFDSSAAASR
                     RMQRSGPYGCTEPPLADARLVQGHSVRLDTTFALPPEVVHRALKDRCRYIQFPANLPV
                     FPKAGTLGPNANNGNNSSSNGSTGSGGSGESSLPIALFIGQVRFETTAAELLWLVHRT
                     CGACASHLESRGAGCYLLYCKSEADLTLVRSLHKRILFDIGGVWLARTADEVDAMCEY
                     IALDAPLLSKKARLPRDSMVVEELKADAINSGGRRGHEKRAMSDHSISGNRRGGGRGA
                     SAQGSGVDDMSQTASGDARQQPMQQQQQRRRDQEGLPTYEESAPPYPGYPPQSFGERP
                     LYK"
     gene            <222405..>223889
                     /locus_tag="LDBPK_270560"
                     /db_xref="GeneID:13389172"
     mRNA            <222405..>223889
                     /locus_tag="LDBPK_270560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861864.1"
                     /db_xref="GeneID:13389172"
     CDS             222405..223889
                     /locus_tag="LDBPK_270560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861912.1"
                     /db_xref="GeneID:13389172"
                     /db_xref="UniProtKB/TrEMBL:E9BIY9"
                     /translation="MLDASTWRRVLANSAGSHGALFPSTLILVCVFSSFRRRPRTNAS
                     MRLRNPCGVKGIAADALVDLVQGCYPSATVLFTSVASSAATADNSEVRISSSFDAWQA
                     KLHTRRAWRQGLTVETPGFQRILARRHIVPATWAEAGASSWWALLYAADATNSPPVAL
                     PQQPSKSLPPSDIAHPILCCPDAIVYIGGVEVRDVTQVVAPMLVNAVTRVEAPRSTVG
                     AASATHRAERQAPSYCRRSVDWPTIWADKRCAMRGADLLELSLAVPSGVDHRHADARE
                     RMLVSIANPDVTLADLQRQRHAERRGPLRTSFGFSLPCIQAALPAAVIRAVRVLRRWQ
                     QDVVHCIPSTSAFWVSSIGHLLETSVGDAASPLTQRAEACTRQEQELGMSETQVRHLF
                     AIVQPDSDQTKIRVPPPGEATKLLTFLLTSTVLQLACTSPLEAWNGINYFLPAERFDG
                     TTDAEVLLRTMRGGAGTHLTFPIFSTLYGASCGEEQGPLSQSSS"
     gene            <225631..>226866
                     /locus_tag="LDBPK_270570"
                     /db_xref="GeneID:13389173"
     mRNA            <225631..>226866
                     /locus_tag="LDBPK_270570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861865.1"
                     /db_xref="GeneID:13389173"
     CDS             225631..226866
                     /locus_tag="LDBPK_270570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861913.1"
                     /db_xref="GeneID:13389173"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ0"
                     /translation="MEYQIISSKGDKFALCIDDDMTVGDVKGVAAAMLDAPDDVVMTV
                     SLNGKLLKDDAETWGELRRRLFRSQQPHPMQRKLFCNVTDRPVVESQSAEMLRMLPSK
                     EEKKLEQEKEREKVAAMDSMVDTLADNPAFLEGMLSMNPMIKRMQKKSPEVARMLKDP
                     DTLRMLLKSSVDPQRRREMERNAELQLAHIAALPGGQQMINHYMDQLTEDEEETDAQR
                     QLRIGRSTAEVSDEIAHPDPTKEANNDPLPNPWATPAATASGAASQTGGAFPFGDAEG
                     FPFFSPFGFPPAAASSPNGAATDPVASSFVGGSAAASSSGPDQEVMNSMIQMMMQSMM
                     TPPSAPTTATTDAQSPSTAAAPVPASPSVLSEETVQRGLSALREMGFEDEALCREALT
                     ACGGDAEAAVDYIAEHQEE"
     gap             227394..227715
                     /estimated_length=322
     gene            <228359..>229348
                     /locus_tag="LDBPK_270580"
                     /db_xref="GeneID:13389174"
     mRNA            <228359..>229348
                     /locus_tag="LDBPK_270580"
                     /product="reductase, putative"
                     /transcript_id="XM_003861866.1"
                     /db_xref="GeneID:13389174"
     CDS             228359..229348
                     /locus_tag="LDBPK_270580"
                     /codon_start=1
                     /product="reductase, putative"
                     /protein_id="XP_003861914.1"
                     /db_xref="GeneID:13389174"
                     /db_xref="GOA:E9BIZ1"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ1"
                     /translation="MRFAVSCVAGVVGAWVWRRSSGQDAECYRGIQNALTFHNPDRKG
                     RVFSQRYEPYQLGEIIPITADVALFRFLLHHSEDEFNLRPCSTLQACYKYGVQPKDQC
                     QRFYTPVTANHTAGYFDLIVKRKKDGLMTNHLFGMHVGDTLLFRSVAFKIQYRPNRWK
                     HVGMIGGGTGFTPFLQIIRHALTEPVDSKEADRTKLSFLFCNRTERHILLGGVFDDLA
                     RRYPHRFRMFYTIDLAVDKGKWLEQENHFLGYVTTDMIRRSMPAPEEKNKIIMLCGPD
                     PLLSHVAGTPMSTMSSMSGSLNIQPMATDINNLVSLGGLLKELGYDNTDVYRF"
     gene            <232002..>232607
                     /locus_tag="LDBPK_270590"
                     /db_xref="GeneID:13389175"
     mRNA            <232002..>232607
                     /locus_tag="LDBPK_270590"
                     /product="NADH-ubiquinone oxidoreductase 20 kDa subunit,
                     mitochondrial precursor"
                     /transcript_id="XM_003861867.1"
                     /db_xref="GeneID:13389175"
     CDS             232002..232607
                     /locus_tag="LDBPK_270590"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase 20 kDa subunit,
                     mitochondrial precursor"
                     /protein_id="XP_003861915.1"
                     /db_xref="GeneID:13389175"
                     /db_xref="GOA:E9BIZ2"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="InterPro:IPR006138"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ2"
                     /translation="MLRFTRASFTGRAMISRGSPEWSHRLDLKKGKKTTLAHKLGTSK
                     PNNALQYAQMTLHDLTEWVVAYSPWPLTFGLACCAVEMMHSYSSRYDLDRFGIVPRPS
                     PRQAEIIIVSGTVTNKMAPLLRNIYVQMVNPKWVISMGSCANGGGYYHFSYAVLRGCE
                     RAIPVDFWIPGCPPSAESLVFCLHNLQKKIRWHEIQKYSVR"
     gene            <235507..>235839
                     /locus_tag="LDBPK_270600"
                     /db_xref="GeneID:13389176"
     mRNA            <235507..>235839
                     /locus_tag="LDBPK_270600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861868.1"
                     /db_xref="GeneID:13389176"
     CDS             235507..235839
                     /locus_tag="LDBPK_270600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861916.1"
                     /db_xref="GeneID:13389176"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR013097"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ3"
                     /translation="MLHVVLFKTDAKKLAKEFPGNSLEEAIESLRQAKIPGLVDFNIR
                     PKNTSPWPGYQDDSQGYTHALMSSHVSASALRTYAEHPVHKVLQARLLKCVTAPPLRM
                     DLDIHPNL"
     gene            <236670..>237053
                     /locus_tag="LDBPK_270610"
                     /db_xref="GeneID:13389177"
     mRNA            <236670..>237053
                     /locus_tag="LDBPK_270610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861869.1"
                     /db_xref="GeneID:13389177"
     CDS             236670..237053
                     /locus_tag="LDBPK_270610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861917.1"
                     /db_xref="GeneID:13389177"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR013097"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ4"
                     /translation="MELSPSNATEEAHHKSLNPQVNSVCHCAHLRLKGPLHVEKLREL
                     LKRVRTTVPGLIELHFGESMNVSASSADSAESNTHALFSRHQNGHYLKMYKTHPAHMD
                     LMNYLMSRAERPATVVDFVNVASSL"
     gene            <239023..>239625
                     /locus_tag="LDBPK_270620"
                     /db_xref="GeneID:13389178"
     mRNA            <239023..>239625
                     /locus_tag="LDBPK_270620"
                     /product="small GTP-binding protein Rab1, putative"
                     /transcript_id="XM_003861870.1"
                     /db_xref="GeneID:13389178"
     CDS             239023..239625
                     /locus_tag="LDBPK_270620"
                     /codon_start=1
                     /product="small GTP-binding protein Rab1, putative"
                     /protein_id="XP_003861918.1"
                     /db_xref="GeneID:13389178"
                     /db_xref="GOA:E9BIZ5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ5"
                     /translation="MTSEYDYLFKLLLIGDSGVGKSCLLLRFADDSYTDSYISTIGVD
                     FKIRTLNLESKVIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDTTDMESFNNVKTW
                     LSEIEKYASENVNKILVGNKCDLVTKKAVDTQMAKDFADSLGIPFLETSAKNSTNVEE
                     AFIQMASGIKARLAVSGEVKSASRPNLQNPPTVKKEDSCC"
     gene            <242642..>246643
                     /locus_tag="LDBPK_270630"
                     /db_xref="GeneID:13389179"
     mRNA            <242642..>246643
                     /locus_tag="LDBPK_270630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861871.1"
                     /db_xref="GeneID:13389179"
     CDS             242642..246643
                     /locus_tag="LDBPK_270630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861919.1"
                     /db_xref="GeneID:13389179"
                     /db_xref="GOA:E9BIZ6"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ6"
                     /translation="MVTSPKLLLGGLHKISDRSVFFTPLKKDHLDLTTLSIAPPSHRG
                     VLQRNGLVAKAFIGVTFYDARTSAAHPSSLTSPARHMCESDATDSAEHRKLSAAKRED
                     LWRAALVYGGLLHDKWDALATPEELAATPWPVHTEMQYAELMEELIARKACTTANTSS
                     FCVPVLSIDEFVYKHKGVRVCLGVAWMPRYSHNLREWAATFAQSGHCVPEASLLALLH
                     HVTTGALALRTATCTAAKKDATLSLSVTLEKVLVYRASEAEKKIAKEADPDETGEGLT
                     FALATGAFRWRRAEPHVDESIWTNVPTRSRIRALTNHLIVPEEGQLLYCTPEDRSPRL
                     YPTHGSAAAKQDVWTLGVVLYLLASGVAGTGHIATTSPPDRVPRLAPLRELTPLNSAA
                     LTPDSLWKRLRRELERRGYSSTIVTVVAQLLSLDPLTRPSLDTMDRMLQDLHRPTPVC
                     RFPFALGSYDLLRMPNPTDIHLNPGARRYTMEGVCVLCKKHRGSTPLCGKDGDHAPGF
                     SSPSWSDEELLPQLHGMDLHYITFLYPLCGSSDERRRRKQAALALRSCHDGINASSSI
                     ARDATPLLDCTMLFQVFGGFAVYERVPELNATGQVFHRVTVKEVLVPYPSQGLRRSEL
                     PLVKLTIDFSGGLPWPSCCTETLQKSGRVSRNVPFGFTGAHHDVKWFGWVLPGERFSL
                     PNGGHWTAPHDGSFVFWFHSDLRPTDRDRYFALTSMRAATLPAKLPRTVMPDSLFRMH
                     AGDQRHASNLLPSRIGSGNRADSRLGRGCIAHRRSCQSVTDIALPSATHEIVEADEKV
                     RTLVTHRPLSLSAPRVQNTQEESPVHGRRRWSSAKDRVPSRHSSAFPAEVVGALEAPD
                     EARKSPGTARAPSTLRSVGETRSSGVVLTPQLHVPDLLLDMPTPDTHASADHESPKSP
                     DWERASDQARLSERNPTQSPVDGNTTAKRTQALAAPEKSISPAASQSLSSGRKKARKL
                     RDATVSSEEFCGGAALQFVASAPASVGAEHPIVSTVVPAQSVLTGQSSVLGGSPRLLK
                     LRPVSQHGAKKQSIQATASSATSMLPPIVDALPAGLGELHVCGLWLPSEAVDAAFRSL
                     TFCILSTGEHGYMHPPVKMSARVAHAIRAPPGAEFLAFLSNQVPLFRRNHPRLERAGV
                     PLMLPHHGFTCYAADGTLLGVLGLRCSTKGGPDVMAGEFELMMRTSAAFRGSSAASWT
                     VYASHLSESVGVEAHVRRAAVNAVKARNDCEDEDRWASTLRHVPSLLRRASGSRNMFA
                     NTPENQTLTFTSARHLVGEFTPDESGDVLRSREGEGEAALPACWISFDGVSTALLFAD
                     APQSVWVPYRIGG"
     gene            <249148..>250107
                     /locus_tag="LDBPK_270640"
                     /db_xref="GeneID:13389180"
     mRNA            <249148..>250107
                     /locus_tag="LDBPK_270640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861872.1"
                     /db_xref="GeneID:13389180"
     CDS             249148..250107
                     /locus_tag="LDBPK_270640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861920.1"
                     /db_xref="GeneID:13389180"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ7"
                     /translation="MQPVSGTIFRRSGGLLPSAQSTSTLSHWRRRLSTLGRRFATARA
                     AHASAPTSSALSAHDFAAITPLLLLRQMLQQHTQLDGIDLGAQLHPGKQHIVISRTKF
                     CHFCAASHVEDPDAALADLEAAGVVVVLDGGSMVHLRPVLYLETLEMICNVARPSSSG
                     NETSETNSKPSVAVRSFMVEEAERRVATLTEREKAMRNRLQPAIARAARWRRTVWGAA
                     LLYAGAQLAIISRLTYFDLDWDIMEPVSYMITVANTLFFFLYYLRFNEEHSYTAFDQR
                     FLPRKVRQYAPRDFDWAAYADVCQQLVEERAMLDSMSKWSAKH"
     gene            <252334..>254988
                     /locus_tag="LDBPK_270650"
                     /db_xref="GeneID:13389181"
     mRNA            <252334..>254988
                     /locus_tag="LDBPK_270650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861873.1"
                     /db_xref="GeneID:13389181"
     CDS             252334..254988
                     /locus_tag="LDBPK_270650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861921.1"
                     /db_xref="GeneID:13389181"
                     /db_xref="GOA:E9BIZ8"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ8"
                     /translation="MSHPSLPSTRRMTRERADASVRTPSIGHGGAAPVLVFDAPQVRE
                     SCVKQRHYGTMQGSSNVMVRSSSMPERSSRMAYVRKHSRQLTVGQQSARLAEKAKRNY
                     FHGSFTSAHGSVFTVPNKAQQMATNRPSRAPLMAYSSVSRSTLAARRRPTPISLDVSP
                     AVSAIKKTATSPIKAGSSSHEGNDTDTSLTIREPNFLDGSIVLPRRAVSADARLGGHH
                     SLDMSTSISKLRLSISGADLSASQLSEMTFRDSSPDFLAVQLMRDHSAKQKQKQLLSP
                     TTISRAVRALRAFEERKMRFGGGAHSNARDVNNADDVVSALDRTPSAQAVKKSETPLI
                     PAVARCVRIKPDAEGNVAEEAIAGFEEDEDESFESGDSFSWFGATMDLLYLAVPAAVS
                     ICFTFSMSVVPLSFVGRYLGPRQLTGASVGYFLLSILITYPTIGLTFALDTLCSHEYG
                     RNPLSPEMGLVLQRGALINLIILIPLCVCIYTLDSILVPLYGKVLAEEAEEFLLYSPL
                     YLIPMVLFISMNKFLNNQMQPHIPMIALTAGVILTPFLQLKLTPMGVRYTMLGMAITA
                     WFQLAIVTVITVFKRETRITLGKWRIAEALDWTDVKEYMKLAVPSAIFVAAEASSFDV
                     TVLMCARFGEVDGAAWSGIMNCLFIFASFPGGLSASACANIGRCIGAYEPASAKRFVR
                     VSILITFVVGLVDSALLVAFFDRLMSFFGTEGTTLELAREVLYLLPILHVCDAVQFTF
                     QGIFSGMGKNYIGALILLTSLWGVGVPLAFLLGEYLGYRTFGVCVGITIGLCIEAPVM
                     VYSASTTNYVAVCEKFMEDEEDEETGESEESEEYDDEYVEEVMRRSGISINSAELTEG
                     NLEHYRKLLPPRRCGRPRRVVEYQDEDD"
     gene            <256201..>257517
                     /locus_tag="LDBPK_270660"
                     /db_xref="GeneID:13389182"
     mRNA            <256201..>257517
                     /locus_tag="LDBPK_270660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861874.1"
                     /db_xref="GeneID:13389182"
     CDS             256201..257517
                     /locus_tag="LDBPK_270660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861922.1"
                     /db_xref="GeneID:13389182"
                     /db_xref="UniProtKB/TrEMBL:E9BIZ9"
                     /translation="MLVCSCAPRFRQARSGRRCRPRRNPTLQQFRFDLAIEHRQSGAC
                     VCACLYDRHCTRVYAVPLFLLRPSRAVPPSLLPYFFLHLSVVMRAHLREALLASLQRD
                     VEKHQRVAQRNVAPPGFVLKVHGVQLQSSVAAKDRKRHRDRADHTPPQLSENTISKGE
                     AWTSLVLATLSSVLQQLESDAQKKQNESANESAAPSAVSVLRSVARVEMRHCRLQAHH
                     LCADDRGATDSVSLADILLSPQRLWNSAAHTAPSPAYVRLVTLDLECNELGDAGMRLL
                     CSGLLVHLRGLRRLLLASNNITIDGLLFLVDSARSHDEGHLPPHLETIGLSNNPLGTH
                     ARRTVHSQPTENAFCDAFRTLALRLSSTLRRVHLNHASLSTREVSSVLQALFECVVQH
                     SGPCAFDIVYLRENERVDKEEALRLLRSKVEDLEKLDTFLRRHVSM"
     gene            <258244..>258570
                     /locus_tag="LDBPK_270670"
                     /db_xref="GeneID:13389183"
     mRNA            <258244..>258570
                     /locus_tag="LDBPK_270670"
                     /product="glutaredoxin-like protein"
                     /transcript_id="XM_003861875.1"
                     /db_xref="GeneID:13389183"
     CDS             258244..258570
                     /locus_tag="LDBPK_270670"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="XP_003861923.1"
                     /db_xref="GeneID:13389183"
                     /db_xref="GOA:E9BJ00"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:E9BJ00"
                     /translation="MLSSRFLYRPSTMPATVAELIHRHKVVVFSWVHCPYCSRAKEIL
                     KSLAKDIQVYECDQMDNGEELRAQILQAYNHDTVPAIFINGEFIGGCSDLQAIQKSGE
                     LAAKLA"
     gene            <262021..>271896
                     /locus_tag="LDBPK_270680"
                     /db_xref="GeneID:13389184"
     mRNA            <262021..>271896
                     /locus_tag="LDBPK_270680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861876.1"
                     /db_xref="GeneID:13389184"
     CDS             262021..271896
                     /locus_tag="LDBPK_270680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861924.1"
                     /db_xref="GeneID:13389184"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR006633"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="InterPro:IPR022441"
                     /db_xref="UniProtKB/TrEMBL:E9BJ01"
                     /translation="MYEEAGYAVVQRYSRWQKKKVRTIIVNAHAKIASQKSIAGAIAL
                     AKPFDRIELTGGEYHESVAVQMPLELVASEGEDPHIFSRLSTITIATSGIEVYMERII
                     VSSRSGSKLNAAVVAVAGNPILFRCHCSSLVIGGNAVAHVDECTVKESSSGVGIVVHE
                     SGGGIIKSSTIRNHRNVCFDIDTRGGLAVTECTIDNSTGGDAMSISGAVSSISRDSGF
                     SSTSCSQVEVTHCHFSISDDPSSGASGGVSMSSVGSACGIILTQGAAPTIASNEFIEG
                     EIGVLMEGPGTAQLKGNVIRCQRRCGILALVEESFGYAPNHQTLRITGENVIDRCRVG
                     IDAQCAMSRASYIQQQNSATAMTGAGSGVGAPAEAGLNVSAIGGSMSGADRFLSDELP
                     NPKRAFAWTPVQGSTSSPSSCDAACFLPSTSPTTPLVCIESKWCSLDQLRANLQQLVT
                     MTLQANPTCLQPAFEIGTSTASIVNEGLDATSANPFAGILNDMLGTQLSHRKDTPASQ
                     REVLRLRGNKGIDIINTKFSNCDICAIRFGRQGYGLVEDCVFEDCGTYAIVVDCAAHP
                     LITGCRFLRSRGASILVSNFANPLIIGNEVASGKRDGIQLASMSRGLIIGNIIATHVG
                     AGIRVDKYSQPLICANAISQNRKGGIAVAEGSKPTILLNKLAANLYAQVNCTEGADAF
                     ISHNRITASTDTGIRIDSCSRCTVLSNTISFNGDGILVELDADPYVEDNDITDNTCAG
                     VRACNNALGVFVGNRIRKNAGPNVLLTEGASSVFRANRIENSSQGGVVVCNEGHGFFE
                     RNTIATNATANVLVAGAYSEPEFLRNVISSSRSGCGIVCGRSAGGSFLRNSIHGNYQC
                     GVFILEGSNPTFRGNNIAREAVGVLVSDGGKGLFTQNIIEDCYGSGVLAQRQADPVFS
                     QNRVTRSQMSGLHIAPDSAGLFERNEVTRNDIGVQFGSSMDSAVIQIHSAYLDDADTS
                     NKDLSASLQRKASRTAQHRSSVFATNTDASVLRSLASASLQRSASVVRLPTSVVRGNI
                     ITANLRGGVLLDAFPNGTLEENDIFQNNAYGVRGDATYGAARALAILTTTLGVADRTS
                     VIRPRSLQQQQQQSSFEQLQTLMLIRANNIYGHDEANIFLDHFDGDKHETAITENTIY
                     GAPYGVCVANNSTVYSMSKNEVHTCMDGFAFASGGHGCYTANHIRDCTYSGVYISDKA
                     YPDFTDANRIEKCGFSGVLVDVNGQGVFLNNTICHCATGVVVFCGPTTPFHVSYEEVI
                     HARILSSTPTFTANTIEENELHGVLLISVISGCPLRSPLLLSCSDAGGKSAEVLPADS
                     STDEPLHDEPAPYSCAVGGTVTARGNRLCATFEKNIIRRNRMMGVYHDRFEHWDLSAL
                     EKTHAETKPSAGNPVKNAHGGYEILLGTSQILDNDEHQRQRQLKQVSLIENIITECSV
                     GVGAGYGCHPYLQRNKIHHNTFFGLLLRFGSAVSAYANDICDNGLAGVYAAIGAKGYI
                     AKGIIESNNGWCRPEASPHTPRSFDDCTFSKSFFTQAMVGTVEEKVRATAVTAGRTLR
                     ACCRAYEQMTRLAEVHVFTMTDALRYLAELVAASSGGLTLASGCAPSSLFEVVEDASS
                     SAKGAAASGRRWLGGVALADYADVSTADGGIGVWVQAGSRVTIQGNRIGKHQNSGVLI
                     TKGVLQHHSVLHKSFNMEEGSKGNKKLEMVASLPGRAKSMKTTASSATVDIFAGQREA
                     PPLACAEPGALFTTQMLYATGILAAVQVAASTTFESLDADFASFLHHSLSLSSSNGLE
                     AEEKRQRVDSLHHVHIADNVISSNRDGLHVEVFHRLQACATPSAATAAAASISRIKPH
                     SGGGANSTIDLMPHAPTEAHALPRFQRARTPKFSAAPTAFANDTASEAAATSALRASS
                     HDIDVMECAYSTSDFTIVVEGNTVTQNRRYGVYAVHVANVHCERWLSGRSVLNETIAS
                     QYDSIRSKLVLGQETTRVSVTLPFELHALQQKVGHALFRKNDLFRNQHMQVCVTSRYV
                     ALTQDGDRTLLQLDTTTPLSGSNYASQVLVGVPVMASLLQLPPPGLLLWDENKVRDAK
                     SGVLLCGYLGPHSVRFQRNTFANIASDALCVQGHLACATVGKGNVFERNGVGLRLAQQ
                     QRIRLVTSPATVLSHLRTRVFHNTFREANGSSILLECVGEEAPLVYQNEFSRHTAGTA
                     ALYLRSERAGGAAVVQGNVFSENYIPVFLVGGSESGVEGPLHASPITLVENRFTCNYV
                     GAIACSGAAPTLERNIFEKNARAGLEVVGSGTRPQLRHCVFREHRRAGDGGDLTMPCP
                     NQGTLQLECRNFSLKLLPENARVLTATSQARLPAGLLIGPLTEPVVDACGFINNDIGV
                     DAVRDAASPAIALAGPKAHFKGCLFTQHQVCGVLVRGFHGAADGSGGGGRGVDERGGG
                     AAKGTTEGRKPTDGAVDVSSALSMAGTTVFERCVFTNNATANGGGDVVAMEDGCATFR
                     ENVFCGAVVGKTGGVACFTQNSFIALSDGDAATLRGAAHDSSPCSGAANGAAAAVVIQ
                     EGGRIVAGQNTIVHRKVGVQCLPGAEGVVTDNRIVQCVTGLVLAPFNRTDVNKNRVLD
                     SVDCGAVAYGGRMEDNKIIKAPTGILVQHSSVYKGINAVPSHKRDALGFLCIGNRIVD
                     CAKNGLLITTAGVFDGNSVSRCKSGIHIASPLNGGPAGSCPVIKNCSVYDNGVGVCME
                     HESESAVRDNDIFDNETVGLLVAATATGTLQDNHISSPVDQGAVEMAVESRLKSFGNV
                     IRNQFSPAFQRGTRASRAKDYQLEQADLDRELRDLDGTVEQAHHSMEAVSSGLWSLQQ
                     ELISMHSRSIANFAALMAGPAGSALRVASARAGTTTAAAFSDKKDDRPTPGKQSISNA
                     KSTLESGSSVTGAAASRKRSLGSVGRWTTGAGTSRVPAVSMGIRKQSKAGLSTKADPG
                     GKATRSAASADPMKVLVHVFTSAATSSGADAVGQAITGVLAKAPLSKYNFISTVSTST
                     SQLLRLLGGPHPMQPFLCVVVVDANFGHFSPSDHDALQQLHKSACVDRLTTHRGATEA
                     AGRDSQEVSSLFYTVLPGSFCKKDEASPSGDGVMSMEAYAAAHHPFTYTASVEEVLDV
                     LHDRISQDMNASTASAANCLSRSITLQDVQVSVTESTVGNPPIDDDGSRSRSASVSGG
                     CSALTCESRSGSTFLTVEHVSSLFSKLTPEALGLEPSKDSRNMKRQKSSVVLSVHEEG
                     DIGELDHTKRSGGGSVHHRRGSTASKSAGQGAPAGRRRSSVVSSRSGRRTSVASKKS"
     gene            <273089..>274507
                     /locus_tag="LDBPK_270681"
                     /db_xref="GeneID:13389185"
     mRNA            <273089..>274507
                     /locus_tag="LDBPK_270681"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861877.1"
                     /db_xref="GeneID:13389185"
     CDS             273089..274507
                     /locus_tag="LDBPK_270681"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861925.1"
                     /db_xref="GeneID:13389185"
                     /db_xref="UniProtKB/TrEMBL:E9BJ02"
                     /translation="MPSANAHFSLSAGSAEETRRSIDSDCPLFNCFGVLSGGVIIDPI
                     DGSFVEFTDAAVYTPSTVAAPVGSGNDIQDDLARCTLQQANEQAFRTGEAHLIRPECP
                     LILCTSELPLPPRSSDPPLKRFKCCSSPFSAAGGAGPTVTSARHAAQMGMENVEKWLK
                     RLAPHPGHRPQSPRRQAWTTVWADAEEFRLSMRAHSDVRASEASLYLPPRIPFPLRFR
                     GQPISLMEEKTNESPTASQQQQPDREVSSATAVPPDGVRCAAASFTCYTGVPRFASAT
                     DTAPRFDLAEFAKGTAVARLRKRLRPYCETASLGRRRASDDYDEEDKERFLIPFTDST
                     PRHAAFALFLLYFNHLGVLCNGVRVTGETAASSCLDGLDVGSTTWSLCPKYLYDVRAE
                     VERKRRVTRELRERPERTFAGGTRWSTTARNRDAVAAAWTALLLSSRTALLERITELN
                     RHIHKLHDEKQRRRHADDQENQ"
     gene            <276233..>278155
                     /locus_tag="LDBPK_270710"
                     /db_xref="GeneID:13389186"
     mRNA            <276233..>278155
                     /locus_tag="LDBPK_270710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861878.1"
                     /db_xref="GeneID:13389186"
     CDS             276233..278155
                     /locus_tag="LDBPK_270710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861926.1"
                     /db_xref="GeneID:13389186"
                     /db_xref="UniProtKB/TrEMBL:E9BJ03"
                     /translation="MTGVPSESLNLLRNNLLRFIFENASVLRGAHWLNVARALLNFPR
                     EFSELRNFVRDYPAIEKEVRSALDVSRDRTVAPSSHDAAAPCAVNCETVGAAAMQCVF
                     QYAEQRSAIPDVEVESPVSAEFPFDLSYGDLVKLLPLLDQFPCMTSAQKAQQRAELVL
                     QVMCANVHRLRLQDLVAALQVLRRIQPSATTTAAVETIAHEAGNRLTVSSAEEVLGAI
                     SFRTVAQLAAALAALRVTRCDGFVTFVTTRNDIFPSSLTVDTALSFINALAALKMTRS
                     SLCHGALESILRGVLNFYRQQLRNGPLLDAFPIFVARMLRGCVLLDYIPPAPILKSLL
                     GSAEAPLRMSEEVHGAGGVLVFDLSRSLSHFLKQARTTAPERERDLWDNGVVRVALPL
                     AVACTEDTVHAMESYRQTSSSSHTAVSWRSTVEMLALFIDPQMNSTDRGTMVQRLLEV
                     FSEVEALLRAAATATRAHLEQCSRHIHHADEARQRSRQTPFNANCNMHFLSALLIFEY
                     VIFHANTQAGRLLSSMASQPNTSVRDDAEKDMATLAGLKDQYCEFLGAPIGESVADTP
                     MHIVRRIFECPLSGPVAGSAAAPSTVALLEKRDAVEITTTLPFALSLVMDPGPVNEFF
                     TERCMSIMVGDAEDAH"
     gene            <279064..>280779
                     /locus_tag="LDBPK_270700"
                     /db_xref="GeneID:13389189"
     mRNA            <279064..>280779
                     /locus_tag="LDBPK_270700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861879.1"
                     /db_xref="GeneID:13389189"
     CDS             279064..280779
                     /locus_tag="LDBPK_270700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861927.1"
                     /db_xref="GeneID:13389189"
                     /db_xref="UniProtKB/TrEMBL:E9BJ04"
                     /translation="MPSEADLDRLRSRLHQSGAIVSSRSVASRADANFDLEVVNVGDG
                     RRATPVEHLLARLEQHGLRRRLVAEDDAAAYAVDVAARADTEENADDDSDETHASGDG
                     NAEDPRAVSSCSSGDGAFSSPAPSQAPETREAYYYLCVPCELRLTRISRRPPRWRALE
                     DVHFHFSSAAHRATASWMADDDIDETLHSTPLITPTNYYSRIYVNGVPTLLSRRPGGG
                     DMFYPLPHEQDLVAPYSAAAARDGERVDCWHGSQTVSNSSGASGALAGRFFPSSTLRG
                     AQGGAPVLWHRALPSLYTRTVQVVRRARSSCLADLPADRRRYRVARRRSRVMVGVDHC
                     SLDEYREQSWMPLHKVPLWLAVYRLRRERVPKPLLARPESAGPHGQAVPLRCSESAVR
                     AAQAADVAHRTVYTQPYHPIAEGSRDYQRQGDAFTAAVPVPTTVFEDECYRVALVSAA
                     EQARHEGLSHPVTSRPLSRSLCPADVASEEINRPVLTLELLMQHTQSTAQSWRPAVGS
                     STALNSSFVPTTAPPSPSRRSSISHLTRSSSSGSTSSSPSFEHSSTSRSLTHTRKRVK
                     RDGCL"
     gene            <281574..>284681
                     /locus_tag="LDBPK_270690"
                     /db_xref="GeneID:13389188"
     mRNA            <281574..>284681
                     /locus_tag="LDBPK_270690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861880.1"
                     /db_xref="GeneID:13389188"
     CDS             281574..284681
                     /locus_tag="LDBPK_270690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861928.1"
                     /db_xref="GeneID:13389188"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BJ05"
                     /translation="MQGTLFSVNVLRSPFGVRGAHLVPPPDAEVAVGRVSTVTDAKVT
                     DSYAQVLPLHTPVGRTTRQSYAVSGTRGIQQLVANTRSASFSAPSTLVAAQRVNSRGH
                     CMPSATPQLQVISKHEKGRLLVWNGLTGAVVAACIFPPTFNVDHCAVAASYVYTTVEG
                     SAVKSVAEEEACVYVWSRSTLRSVTVLRGHSGRLTALGVWPMETSTLIATASLDGTVR
                     LWRHQHSPGPWDGAVANEDPVQLLWVLATAELGSVHSLKFLAADTVVAAATRCALAFV
                     RFPDAPAKRKGRGSMVSMGKADALAFQMVRSIVDPNGGTTFLHVCPYNRTSGGVVAVT
                     PALGNFSLSSLASSSPARVSAAAPVSESSTVYLLTGSTSGYMQEWTVDVENTASAEAP
                     PKPAASSAEPVYVDIKCRWHHKAHSATVDCVVTDEDVVVSTSLFDRASIYHRTSGATC
                     AIASTAAIPVLVPQLKELVWGTIDGTLSVASYARFASGVENELQLLWTARPHATAIRG
                     VCLSLTPDLRWDTLCTGAADGSMCVWRAMPESGRTAAGSTAAKKEGAAPLIAHLLHVF
                     ALPPNTVEKGDADGKRVAAVVAGLKASTAGTQGAIIVVELAATGDVGQVAAVLLKDNV
                     EVSCAHLCRGDKGTLSLWVGTRCGQLLHALHKPAQKVWTALMPVQWDGKPNGSVVAIA
                     DDAGSSSIMVAVAEAPDASRASQRLFLSALQLEPGATVKTMLSRWESDIALPCTVYAA
                     SHRERTFAMTWVSKVLSGEQASPRAISGLLVCCSDGTMVRCLRTSMADAAPSVGPWST
                     PEVLVMAAASGQANTIQRNFDESPSFSATAVASPSRNSDLLCVDMFENSKRLLMPSKV
                     RTTQLTAILCDVGTERVRLAAVRQEKPDAASEVALFDNAGREFGRVTHDGAVLHSNDV
                     SAASASKGPISYTPKVQGASLRRSSAAAVATAAEAANCTAIAAHAGDRIAFIGYDDGL
                     LQMVDTADVYVFCRRWATDATGVARRIVDVRYAGSGVVVVLLANHHLCSFAVPPRSLL
                     DQPSL"
     gene            <286184..>288454
                     /locus_tag="LDBPK_270720"
                     /db_xref="GeneID:13389187"
     mRNA            <286184..>288454
                     /locus_tag="LDBPK_270720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861881.1"
                     /db_xref="GeneID:13389187"
     CDS             286184..288454
                     /locus_tag="LDBPK_270720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861929.1"
                     /db_xref="GeneID:13389187"
                     /db_xref="GOA:E9BJ06"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="InterPro:IPR010554"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9BJ06"
                     /translation="MAYSQSQQMQKEFRLPMVPGLSCGEEMMRRNYDRRQIHGVKLDC
                     ATAIAGVPADRTLTGGSSDYPGSTLKGAVMAVAEAARADEQGAEDPTGRVLRYYGYCI
                     EPVSDSALETERVRKVILNFYLEDGTMSVTEPKQDNSGFAFPANLKRHIVPNPDGTPI
                     TAAQLKVGGSVSFYGRTYELYDADPFTRALLKEGGEEVPQAIVPPTDVYTTMRGRPVA
                     KAHDVPSIAASSPLNTMLSPAQVRATRQFLEFDRKVLRCDCTWDDTTSLYGTKHFLTL
                     YYFLSDGSIAFVEKDVQNSGRDPFPKFLSRQRIAKPTSASGKFDSSSLGSVTFKEDAN
                     TVYYTDEDIRIGNVLNLYGRQVKIHDYNQYTRDHMAKKFGITAYAPIPGATPPPFVPP
                     CSTRREISEETVREHHNEKHEELRRHRFANSVVKFLARLDNGKEEDKVRRFVLAVYLA
                     DNSVSIFEPVIRNSGIVGGKFLQRQKVRRADGEYFRADDFYVGARVVLNSFPFVILNS
                     DEHSLNYMEHNPEEFGHSDINKIVRKMQAMLQSSTTGLAEAFRLADENRSGGLDMEVF
                     LSIMKELNLDITEQEILTVLRYFDKNNESYVSYEEVASRIMPEGSAVASDNRSWDAIY
                     QEGADHATASFLDDPKEAEEKERKSRENAAASRGATEFLKLYDQRRQLFMKEFHAITD
                     YAKDSLIGSDEFKMCARRKLELSSISDEEMCALAKNLFPVVAPRVSYEEFMRLLNGTS
                     TYAHTVAAIASHGASK"
     gene            289776..290279
                     /locus_tag="LDBPK_270730"
                     /pseudo
                     /db_xref="GeneID:13389190"
     misc_feature    289776..290279
                     /locus_tag="LDBPK_270730"
                     /pseudo
                     /db_xref="GeneID:13389190"
                     /db_xref="PSEUDO:CBZ35233.1"
     gene            <291811..>294831
                     /locus_tag="LDBPK_270740"
                     /db_xref="GeneID:13389191"
     mRNA            <291811..>294831
                     /locus_tag="LDBPK_270740"
                     /product="2-oxoglutarate dehydrogenase subunit, putative"
                     /transcript_id="XM_003861882.1"
                     /db_xref="GeneID:13389191"
     CDS             291811..294831
                     /locus_tag="LDBPK_270740"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase subunit, putative"
                     /protein_id="XP_003861930.1"
                     /db_xref="GeneID:13389191"
                     /db_xref="GOA:E9BJ08"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:E9BJ08"
                     /translation="MMRRALSGAVAVRASAMRSYTDARTIRKPNPYDQLVNAENQHYV
                     EDLMRQYEADSALVDPSWVPVLEAIRSGSDDSPVVATFSRPTDAKSLSEKQRHDNMRL
                     SWMIREYERFGHHMANVDPLSGYHADNRILGSRTLAPEEFGFTKDDLTHVFNVTFGAS
                     HEATFVSGGTAMTLQQIIDQLRRLYCGPIGFEFMSSGFFELRNWFRQEVMDSLQPLPA
                     EERRLYYNDVVKACGFEKFLQLKYATKHRFGLDGGEALIPALKAAILTSSDLGVQSAI
                     IGMAHRGRLNVLANVLRKSLRAILNEFEGRVAIEDAHLTGDVEYHLGKRKHVKLPNNK
                     SIELDLLPNPSHLEAVNPLVLGKARARQIYTNDVECTAVLPILIHGDAAFAGQGSCYE
                     TMGFCELENFHVGGTLHLVINNQIGFTTNPKDSRASAYCTDLSKVNNAPVMHVNGDDV
                     DACVKAAKIAARFRQQFHHDIIIDLVCYRRYGHNETDLPDFTQPQLYNQIRQHPSVVD
                     IYTKTLIRDGVLTAEEAKAKDKEWEGVLRQAYDRMNSAQNFVKVMPVFDPESENTSAD
                     LSYAKIAATRVPPPVSAVDTGVETQTLRMAGLRLASIPKEMQKPHPVVERTYAARKKG
                     TEQGDAIEWCQAELMALATLSMQGVPIRLTGEDVERGTFTQRHAGITDMKTNLKYFPV
                     KTLSPSQALITISNSSLSELGVCGFEMGYNMENTRSITIWEAQFGDFANGAQVIFDQF
                     LSCCEEKWNEHSSLVLSLPHGYSGAGPEHSSARVERFLQLSDDGDRVPSDFRHFPNDQ
                     ALEIRIRRHNWQVTYPSTPANYFHLLRRQGLREFAKPLINFFSKARLRAPNLSKLSDM
                     TQGTSFKAVIDTARAKDTVARKVVFCSGQIESIVNDAKAARQKETPGVHDDVVLVTVE
                     QLAPFPWEQVADVMEKYAQRNLNTEFVWLQEEPRNMGMWTHMRPRMNSLMHHLGLKQK
                     RINVVSRPSAASPSTGYGSVHVAEEKKLIAETLA"
     gene            <297147..>302234
                     /locus_tag="LDBPK_270750"
                     /db_xref="GeneID:13389192"
     mRNA            <297147..>302234
                     /locus_tag="LDBPK_270750"
                     /product="phosphatidylinositol (3,5) kinase, putative"
                     /transcript_id="XM_003861883.1"
                     /db_xref="GeneID:13389192"
     CDS             297147..302234
                     /locus_tag="LDBPK_270750"
                     /codon_start=1
                     /product="phosphatidylinositol (3,5) kinase, putative"
                     /protein_id="XP_003861931.1"
                     /db_xref="GeneID:13389192"
                     /db_xref="GOA:E9BJ09"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:E9BJ09"
                     /translation="MPTDRSLWVEDKYALRCRGCGKKFTVFRRRHHCRRCGQVFCYEC
                     LNPLPTAASTPQNIVFSVYQWFSPSPATPLSTPTSAQARKTTEKTEVVGSSRDGAAAA
                     AGATAAAAELSMRLCCRCAATIAENAAREASVSHDEFEPSSLPVHSTAPLGPMMPSPL
                     MRSVSLPCPPLSQLNTPMRLSGRGLPEGAPSPAPRRTPPSFEAARQSEAEGPPYMVAP
                     ELLEGTARHAETAEEREVTYSIGRVRRPPPSVMTQWWKAHQEALTNKEARTFPVQRTG
                     PCASTLESAGALVRTLSGHADFHARFFLEEDVTQSPSDPNGGVMGSAAVVPVAAAPAP
                     PRGFLDDFGAACTTHLEARIQHMLQSYFPNLGGPRLCCHLADVAWHIVCHTVVALDAN
                     ILDHLSSFFILDPAQPAQCIVYPGLVNRRRLPSKRVMSPCDHPRVLLLAGHLSYPVQP
                     AEDLVEYVRSYSGYLDKLFQRLVMWHPDVIVVEGGMHHYLRARIEEEGQMRLVLDVGR
                     DFLVQLSWCLRADIIADLQYVGVGDLATTAPLGHCTRFEVLELAEEVHCCGFRGFDAL
                     SFHTLVLRGGCPSGGVVAHDSSDGEQQWETMEKVVREAVVVAYHLALQAHGAAALVRK
                     GLPVSVSGAAPTAEEAAAAAITMNLGCHFPSSVQSACRDAASPAALSALKDNIVVNIV
                     HMDELFEGGSGGGGGGAAVSTLAKSRSTELSLERGASRGSLTLFQGGSHLDLPASGAA
                     SASPSASLLSPPLGRAEAPATNAYAVVQQKSALTFYGSGDESLFHFLVNRCAGMESQV
                     LYLHGAHRVKVITSTSALLPSAAAILTESGLAGVLGAAQMLAFHKVASRQSAARALAA
                     AEPLDAHALAAFVAHLKGYFSLRIRMADEDAGVAAADAVVVAAAPVDAVVEVCEPHLL
                     NLSTAAFLEWVVYGWIPALSRQFAQPSVQLHFQFHSLGMAAQRQQPGATNVSAYANTV
                     TFLVEAVPLFRIEYPRTVMPRAAPAPQAEGSSEEDAMSIVDCLYAGDDAEEMEGLLAE
                     LQQVTRASLDRMEQVENAKAGVPAAASPVNTTHVPEDAEGKAAAAAGPSSMPTLERST
                     RDLHQLSEDIQHALSVLQDARQRGHPDVVLLLANMRSHLLPALLAAYRGWHVAQRRAT
                     TKSAATTPADAAAATAPEYPSCLRQLDGCLYHKERAQWIRLAEPSSILAAALLHLYRP
                     LPPSTPCTPLITKGSAAGREFELKKPVGSEAAAAASATPHIAFAVECTHTASSPDMSP
                     ATRSGQPPLLSMVSQLSPAEALAVLRHSGRADAASPTSLKCTLSGYQSVVHLGVGGPA
                     GLAGGAVATLSGAASVASMIGGGTGNAEPTITVDVLFPLSFAALHVLYTDGAPFDICA
                     ALVRCRPFSTDGGKSHSRFFVTQDGRFLIKSVKPMELRHFREWAPRYFARMEEHYTSL
                     QRAQQPQPSDGETCAHLFEAQSTLGKIMGLYTVHVQGSRGRASASPATSSGAGLGDTT
                     PQLWGLLTDGTHCFMVVEQLLFQRPVREKWDLKGSQRNRTTEQTAAVRLDVDLVQERL
                     RLGNFFFCTPEAKSLLMDHLSRDTALLADSGIMDYSLMVSVGDGSVCVGMIDFLHPYS
                     SAKVLESKMKSSLDTMLGYTRRDPTIIDPASYAARFMLWMDGYFNGVPDRLFPLTSVR
                     QLKEDQESGVVEKRPHLPPLSSETAKR"
     gene            <304262..>304852
                     /locus_tag="LDBPK_270760"
                     /db_xref="GeneID:13389193"
     mRNA            <304262..>304852
                     /locus_tag="LDBPK_270760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861884.1"
                     /db_xref="GeneID:13389193"
     CDS             304262..304852
                     /locus_tag="LDBPK_270760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861932.1"
                     /db_xref="GeneID:13389193"
                     /db_xref="InterPro:IPR008496"
                     /db_xref="UniProtKB/TrEMBL:E9BJ10"
                     /translation="MESRTKFKADTPVQLPPAIDPVREHYPFCIVWSPIPVLSWILPF
                     VGHTAVCDSQGRIYDFQGAYRIGQDRMLFGNPVKYWDVSRDYIPSFYNADQHNSAERE
                     EAVKREVAAYDAALMSTISHFRQTEVYNFFTNNCHSFVAASMNEQQLKKQHMGIVSIA
                     IGMMRHGRYISFSRFLKAHLPSVLLVVIILILATLL"
     gene            complement(<306195..>309470)
                     /locus_tag="LDBPK_270770"
                     /db_xref="GeneID:13389194"
     mRNA            complement(<306195..>309470)
                     /locus_tag="LDBPK_270770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861885.1"
                     /db_xref="GeneID:13389194"
     CDS             complement(306195..309470)
                     /locus_tag="LDBPK_270770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861933.1"
                     /db_xref="GeneID:13389194"
                     /db_xref="GOA:E9BJ11"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:E9BJ11"
                     /translation="MAQAVPHNSRSHVEALHDPVAPHFELVSYPLSDSQDAIEDADCQ
                     GGVLAVLRRSGRLEVRDAEEDRVLLRTVVRNPHKVFVHPQGTYVVVTASDGEVSVQNT
                     FDARMCATAQLQATDVLGTVVQGSQDVVVGECVGWLPQDSYGVAPADYPEASAARAIS
                     ASATQGSSTAGAAEWSYLMGVNKGSAIFALHVWVSSSSPNRLKMRAVLAWSLPSPASC
                     AFPIRSIAFAATGAGGCVLLISTTINLHEAHSSSIAAPAPLFHALRSGTVKLRTQTVP
                     LYAGSASAPVANGRVLLYRGSYAAAPQSYVWNSAAGVVHGLFDRDVSTDMVDENERLL
                     FRTSSVPETSVPSVGEAGARVNEQSFSLAKVADSTDAAGAGVDRAALPPSAVPIAVAP
                     TAFHMIVLYPQRCIVLHQPPGASWRSPADCGGAVERFTPPLPAEVAQRIRFDPFRASP
                     PPSSELCGVIHDAEARRFFLFSRTHLWEVLIEDEAHQQWRLFLERGRDAQVSLAVRKR
                     YMDAACRLAFYSDTQRNLCLFHCGQFFLDCGATRHAIAQFAKCDWFEDIYALLTTYRN
                     TNVRTAFVEARFQFLLSHLASLDDWAPQLTSMFVILMLAKLDQIARTAPASAAAEADF
                     HKFLLSTVEQCGVFLKEKAVYELVLRLLEEQGRPESALIFAKAMQHTRYVVASHIVQQ
                     QFDEAVKALGACHGSVARLQPWYEFTSVLIQHRPVALTTALLRALTKEARAGRVLPLQ
                     MERLMPSFVRYDVSMNEVADNTEHQVVVLLDQCIHRYDCSSGAVHNYYVRLLAQTHDA
                     VRLDDFISTSLFVDTGYALRMCLKHGCTTAAVALYKHMHLYRDAVTTALYAPHERRNG
                     GSGSADEDASVAARSEDKDVLPGLVAAEDTLRGLVGKVGNDELRQLWMLTAEQALASH
                     NVAAALAVVQESGGVLRTEDVLRKIEDVNLIDDFRDVICEYFDAYADQKRQLSRTQDE
                     VYQTAEDVKKDLRQAREQFGYITASQRCPLCHRTLLQSSTPYFVYPNCGHVVHEACAV
                     SRLESMGGLERFLADEGIAPHVLDGISDVHQLAQQDCVLCGEAVVVEVDIPLFRKDAS
                     WDL"
     gap             310381..313572
                     /estimated_length=3192
     gap             314571..314822
                     /estimated_length=252
     gap             316122..316475
                     /estimated_length=354
     gap             318160..318319
                     /estimated_length=160
     gene            complement(<318748..>319674)
                     /locus_tag="LDBPK_270780"
                     /db_xref="GeneID:13389195"
     mRNA            complement(<318748..>319674)
                     /locus_tag="LDBPK_270780"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861886.1"
                     /db_xref="GeneID:13389195"
     CDS             complement(318748..319674)
                     /locus_tag="LDBPK_270780"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003861934.1"
                     /db_xref="GeneID:13389195"
                     /db_xref="InterPro:IPR010721"
                     /db_xref="UniProtKB/TrEMBL:E9BJ12"
                     /translation="MESLSGAVAAVTATSLALSGTLMTLTALVLFIAAHRNDNYSWVD
                     RSWSILPVVYTWIHVYYTHQQARGAAVRRAAGQSFPLSTATLFGLVITVWGCRLTFNF
                     FRRGGYSRGGEDYRWNYVHTWRIFSRSPVVWTLFNFFVISFFQTWLLWAITLPVMQFP
                     ATPATAKEATFAVLLVALIAFETICDEQQWRFQCAKVRTPHQAPYCYGFCVTGVFGYS
                     RHLNVFCEASLWVMLAVAGRSCGATSMAWWQWSGCTLLGLLILFSTAMITEQLTAKKY
                     PGYAVYQSITPMLFPSLYSTSGKVLLALKKMG"
     gene            complement(<321713..>322945)
                     /locus_tag="LDBPK_270790"
                     /db_xref="GeneID:13389196"
     mRNA            complement(<321713..>322945)
                     /locus_tag="LDBPK_270790"
                     /product="isovaleryl-coA dehydrogenase, putative"
                     /transcript_id="XM_003861887.1"
                     /db_xref="GeneID:13389196"
     CDS             complement(321713..322945)
                     /locus_tag="LDBPK_270790"
                     /codon_start=1
                     /product="isovaleryl-coA dehydrogenase, putative"
                     /protein_id="XP_003861935.1"
                     /db_xref="GeneID:13389196"
                     /db_xref="GOA:E9BJ13"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:E9BJ13"
                     /translation="MRRVLQSSLGRRSATCGWTAAATMTSASRAFMDLYNPTPEHAAL
                     RETVAKFSREVVDKHAREDDINGHFNRDLFKQLGDLGVMGVTVPEADGGAGMDAVAAV
                     IIHHELSKYDPGFCLAYLAHSMLFVNNFYYSASPAQRARWLPKVLTGEHVGAMGMSEP
                     SAGTDVLGMRMTAKKDSNGNYVLNGSKIWITNGTVADVFLIYAKVDGKITAFTVERGT
                     KGFTQGPKIDKCGMRASHMCQLFLEDVVVPAENLLGEEGKGMVGMMRNLELERVTLAA
                     MAVGIAERSVELMTSYASERKAFGQPISNFGQIQRYIAEGYADTEAAKALVYSVSHNV
                     HPGNKNRLGSDAAKLFATPIAKKVADSAIQVMGGMGYSQGMPVERLWRDAKLLEIGGG
                     TIEAHHKNITKDLLKGLK"
     gene            complement(<323933..>325645)
                     /locus_tag="LDBPK_270800"
                     /db_xref="GeneID:13389197"
     mRNA            complement(<323933..>325645)
                     /locus_tag="LDBPK_270800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861888.1"
                     /db_xref="GeneID:13389197"
     CDS             complement(323933..325645)
                     /locus_tag="LDBPK_270800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861936.1"
                     /db_xref="GeneID:13389197"
                     /db_xref="GOA:E9BJ14"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:E9BJ14"
                     /translation="MGVKGLWSYVEHHSIQYAFPNKNARADCYAANPRHLLVDMNAVL
                     HIAYDPTRPTTAATLRAVTAKMDELLTRVRARDTLVLVYDGVAPIAKLKTQKERRNSL
                     SVHPPRPATAVASSKGSGNSSIRVSPWYTCDPVLGEVPLHREEILCGAEFVLACEEYI
                     TTYLQQRKAHYSWAKLIVSGCCEPGEGEVKMSALLRRLWAETVADGSYSQDDVVTMVG
                     NDSDLILVAMVAVPYSYYTLIDPFDLSLTSLWELMNHWSQAVPNPPLPAELLPSYRID
                     FVFLMLLSGDDYYEGIGGDSIALWRRYRHLRVNEGYFRRALISGGHLELDVEFLRAVL
                     ARSGSMATQLLRVPRNKRKTTKALLRGGGGCGGGGAKEGTQLLAAALWSLRSYVFGRC
                     PDYGFFPHREGPPSVGSLRAAAHVRGLSRKIGCGIAEGAANAETADAGKVEEVTSPVG
                     PVFAPLEQCIAVLGIRGRFSVELSRAIRVSTQDDGHRLTTSTSIGLLTENVRNIMTSV
                     DTARLTEAERRLSHCHSAGAEDEDVGAFMRLAAILSRKAAPAAFEGEKRLNQSDEVHQ
                     ARTE"
     gene            complement(<328792..>331530)
                     /locus_tag="LDBPK_270810"
                     /db_xref="GeneID:13389198"
     mRNA            complement(<328792..>331530)
                     /locus_tag="LDBPK_270810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861889.1"
                     /db_xref="GeneID:13389198"
     CDS             complement(328792..331530)
                     /locus_tag="LDBPK_270810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861937.1"
                     /db_xref="GeneID:13389198"
                     /db_xref="UniProtKB/TrEMBL:E9BJ15"
                     /translation="MDMPRSSRHGATKESATGSSSVTTQRVGSSLYLGPEMAPEEADR
                     RSAHPRKSMTTPREQLLYLQALYPYAPYDELMAVISNTDGTDEAAERAYEALNPDYNG
                     FAYLKEQHDLFTSEKLPSAKRATAFAGLKESLEERAASAFRPGHFGNLSQLQEYHDTV
                     GLFIVDTSDWDRATLLPSRDLAEMAFMDLPLLEEPTSYEAATATINGDSNDVNGLRRE
                     SWSQVCSTSLAASNNGTCFLDLQPSRKLHPVSNTASASLSGGNTDKRSRASSRGASEE
                     RPAGGLNGSGAAGDGGDSAAASVVYVQRNDPPRAAPIIAWAPEAIRVGPAEARRECEG
                     ILHVFDEATFKNPLLRLATPPPASTGVLPHAHMSRPESAAAARLAAEGEAHEPVVNGL
                     VGSQTSALAAPPSPQMTYPSFVGEESEAHEPFDPGSSVAPNCGSGDKVNDANAEELLS
                     AQASFALQSHHRRRTCLPKPYADRQPGATANTSTAYGATNGTRQISGDDDNAASSNAL
                     SAQSSMRDAARKTLKGRKPHPLTTSETVWQRIRSRTSIGNLIFRATSQHTPVLSPRQK
                     KSSNGRPNVVCSPGFALPRAAARNEASALNGTAQSTERQQAAHNSCEDIPVEGSGADD
                     GDAGAPHDERPSNAGTLAIPAAHSGCSSLDPVTFLNAEEERWGTIATMLAPYEEVFGS
                     KSRCALVRCIHDECPKLRDNATVILQRLLHVLGKALCGKELVEGMTEEPVEVPLLGPI
                     LLSTSPIKLTELSFREDKCSLEFCEDGTRLQAKLNLKAMSLEAIQFAYIGEADAARQA
                     RTAQHSQRRIPGSYWRAAARTRRGSEQDQYTTGVTRGTATIKAANVRVKGRVCIWLMT
                     SGKMHAAFQKTTVSVGSFRVSTTVRKLNVLCTLGAPILRLMVQRGIKQVLQSGHSL"
     gene            complement(<332949..>337250)
                     /locus_tag="LDBPK_270820"
                     /db_xref="GeneID:13389199"
     mRNA            complement(<332949..>337250)
                     /locus_tag="LDBPK_270820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861890.1"
                     /db_xref="GeneID:13389199"
     CDS             complement(332949..337250)
                     /locus_tag="LDBPK_270820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861938.1"
                     /db_xref="GeneID:13389199"
                     /db_xref="UniProtKB/TrEMBL:E9BJ16"
                     /translation="MHAWRLCLLASKAVCYLRVYDPVDASITVAALGELDCQLPGSTT
                     TFFLSLAPLLPHYDSTQLTRVFAGLSRLRVAHYMITAYILKLFLTSLTRDRGSATAST
                     SPVHAGSRPRCAAAKQLAAVAGMVHILQLHHTQRTMRAFLAAAERALAPVMASRGDAW
                     SVLERRGQKDGEACSTSPASARPMALQVLFLLEVYVNARVRVAAPHTPLWLLGMVSHT
                     PWISFTLSELLHVYSRLFPAASAHRPAGCAADVSAAFLVQELLTEDILYRAGGAEREG
                     GARCRCAPPAAGAADAAVDASLSSSVFSVAVPNRCRVWRRRSPEEQYVLLRCTVWRLA
                     QQPTERARDADASELLRFLTPALFCQLSAEFGGRMRGSALRWWMKMLPRSAVERCDGM
                     DSRESHALPEGAVGEAVQLCIALLQLLYTQYVAAGEEASLSTYSAVACHTEDSLGARQ
                     GAGVLVSVQRLVACLRTVASLVANHMGDEREWELLALLLDVHAPSSCTTTGGSFAHWL
                     GTEAHQSGDASHMWRCLSTAQENARDVLLARWCHFWAHHRSTNTFGSPMAKSKWPSET
                     LARSKEDEGVTHLLCELAGDALLLHWCIANLLDEWLQRSDQASQLRGCPTSPPAHLTS
                     PRFPFQQIWREMLAETVAELDGSHQRAAAGVSPYPVMNLETDLLVIMAESLDPNRTAR
                     VRSDDAHPVPLLGSLADAIGESVLPEALCAALEQAQTHSTAAPSRTIPSYAEAWAQRE
                     RWRRRMWWAASTSAPGTSMSLEAAQVLLLNALFSPSANSSTCASASLASLRRLSVRWP
                     YHMLAVCLRSSASPQQPGATHHAAAEGCGSEWRARIPPWEMKDIRNLDAEHHALGSLT
                     PCGRANPTEEPPIPAIEEPPSTQWSLFECAKGLSNTLMCSIESLIAWQQRSGVLPANT
                     LRGRGEDGRFLPPDLCGATAAPYRMWYRDDTPMTLARGHFLAPRPFADPIRGFVASDF
                     AESVPGAASAHGRDVLVPLCETVALLTRAAMPLNASCASLFARPPIRSSPCWTFCTDS
                     AASSSLFGPLPPLRPFAAAETVYAELCFRFWECCQRLAEVLLPLCAVSKPNSRGDEEV
                     STYATAAEALAIAGAVEWRLFSRYVSNASPPTESSSCTYALAAAQDRALALLLPLMWR
                     CVHCYAAEPSPATSRMSKCHRPIRGVLLDVWRLQLFATHLCGKLPLPARCERAQERLW
                     WCLQAALSDALPVEQRVSLSDEPSVASEDQAALELAMGDLKASLRERHWLDGTTQSTE
                     RPLIFLRDTVTSMCDGLDAAPVVSRDGDTAVTSPMDTYVQQLLPSHPFVLAGPSRVRT
                     HLLCGVRLVVLTWMHILLLESIVAYHPRIFSHECTQQLSWVRRRIRAYEQGLCLAVPP
                     TALSCDHSIAHPTGSSTRAESRRHGMLAECLMRELDAAVSELMTWSRGPPCISAP"
     gap             337932..338030
                     /estimated_length=99
     gap             342313..342411
                     /estimated_length=99
     gap             343814..343912
                     /estimated_length=99
     gap             344427..344525
                     /estimated_length=99
     gap             345521..349749
                     /estimated_length=4229
     gene            complement(<349752..>350726)
                     /locus_tag="LDBPK_270830"
                     /db_xref="GeneID:13389200"
     mRNA            complement(<349752..>350726)
                     /locus_tag="LDBPK_270830"
                     /product="ATP-binding cassette protein subfamily A, member
                     8, putative"
                     /transcript_id="XM_003861891.1"
                     /db_xref="GeneID:13389200"
     CDS             complement(<349752..350726)
                     /locus_tag="LDBPK_270830"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily A, member
                     8, putative"
                     /protein_id="XP_003861939.1"
                     /db_xref="GeneID:13389200"
                     /db_xref="GOA:E9BJ17"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="UniProtKB/TrEMBL:E9BJ17"
                     /translation="MPGAGPLVPSPNSTTTTQNPLLLFASPGALPGLSFSRNNSEAFG
                     EGQLFTPAVGGEYSPMSGGGSAFLRSDDRMIRGTALRTGEMRATTLEAGNHASPSAAE
                     NDVNDGSCVEMTAEQIPLAQADDQYDVLHRRSASANSPARCRPRAGCCQQLGHTILRV
                     LILMKREWCSTLCEFLIPILFVFGSVMLWAVFGTAQNSAGVYYSSTGPEKVSAMTDKI
                     SSSLCYNASLASGIAGLTPCLEGQKYYCPHGRGIPTGFCYDPPLKNVVAQLLGALPLT
                     TSPMLPLDTLIACQWVAMDQSIRASTPFSYGGLLYFAPRTPEVESLVSY"
     gap             352891..352989
                     /estimated_length=99
     gene            complement(<355870..>361509)
                     /locus_tag="LDBPK_270840"
                     /db_xref="GeneID:13389201"
     mRNA            complement(<355870..>361509)
                     /locus_tag="LDBPK_270840"
                     /product="ATP-binding cassette protein subfamily A, member
                     9, putative"
                     /transcript_id="XM_003861892.1"
                     /db_xref="GeneID:13389201"
     CDS             complement(355870..361509)
                     /locus_tag="LDBPK_270840"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily A, member
                     9, putative"
                     /protein_id="XP_003861940.1"
                     /db_xref="GeneID:13389201"
                     /db_xref="GOA:E9BJ18"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJ18"
                     /translation="MRAPTNPLAPSSHANAYNAYLPAFLPSPVQRPASPLVDLDDMFH
                     DVSTFVLHDEDLSTAPAPAYAVPAYLAAAQCPHIQPQRTLTAGAPSEAKDDADSNDME
                     LIMLDTESRSSRISLKQRQQPRRNRRSSTESTREERSQVSYARASTGTHSHGASDYGS
                     YDYSLYPRRQSSIYNVYSDESLSAYSRRSGSCQQLGHTILRVLILMKRDWCSTLCEFL
                     IPIFFLGGSILLWALYGKTSADDFDYYNSLGPLAVLQVAANISSSLCYNASLASGIAG
                     LTPCLEGQKYYCPHGRGIPTGFCYDPPLKNVVAQLLGALPLTTSPMLPLDTLIACQWV
                     AMDQSIRASTPFSYGGLLYFAPRTPEVESLVSYMRTQSKLFDNAYGGTFATAADATSH
                     ILSLTHDDPPTWGVVELDSYTADTFNVKIMVNSSALPATSDSILSGYLGGLDMSTNSP
                     YIFSGYTTLQTLVYNHYTTSVLGKPATKPLTYTAMPTKAYNTSSFLLTGASLAPLILV
                     LGFLYPVSQLTKRIVVEKELRIREAMLIMGLSEWTMYLAWLVVYGVWYTVVSIIITVL
                     LRLTYLPESSPGYVFFMFLLFSWSTIALSGAIAAVFSKARLAAIIAPLIYFAMAIPLF
                     AMERASGGAKMGIMILGPSAFAVGFALLFEHEVNGGAGVGALAYFRDEPKLIVVFVLL
                     FVDIFVYLLLMMYFDRVVPKEWGTTKNPLFFVIDPVRWCFCRRRAGDADNDGDVPGDG
                     RAEDGVFEAVDPAVEEAAAVRIRGLRKTFRRGGKAFAAVDDLCWSLNEGEISVLLGHN
                     GAGKSTTMNLMTGMLEADGGDCYVYGHSVRHELSAVRQEIGLCPQHNILWPQLTVREH
                     LDYYAAIKGLRGSEKEDAIRRLLAAVDLEDKEHYMSKALSGGQKRKLSVAVAFVGGSR
                     LVILDEPTAGMDVGARRHTWSLLKEMAKWHTILLTTHFMDEADLLGDTVAIMSKGRLQ
                     CAGSNMFLKSKLGVGFVLTMSVVSHARRGPIEQMVQALVPAAEAIGSGAGEVAYRLPM
                     ASKPMFPDLLCAVEEGIPGLGINAYSLSATTLEEVFIKIAEGPDAERDADALAAKEKA
                     EATDAVWNVEMEKGRWARRRLQFRAMMVKRLWNALRDRRTQFFQIVCPVACVLLAMLL
                     TLVRLFSTPTIVLSSDVYGTAVDIPLANCEGVLDVTTPFSTKAHMDIWTDVPDASAFS
                     TKLNRTYQTHAKERYGGVSCAAAGSGELYHSVFYNTSALHEVAIETANVFAAHLRVAT
                     GRDNVSVTTAVASLPKTSQQRAVESSLYAMMIAVIIMIPFTFIPSTFVGWIVRERECK
                     ARHLQNISGLSFYIYWLSNFLFDLCSYIVTMCLVIVVFLAFGRDEYVAVNNIGATFVV
                     FLLYGVSGILMAYALSFAFDNHSTAQNVVMLVNFIVGFLLVLAVSALSLKESTRNLAE
                     VLRWIFRIVPSYCVGEAINNLASLKVTRAFGIDTSTWDMDVVGWVCVYMAIEIPVFLF
                     ITLFIDHPGRRQRSQRLFHNPDGAAEVIEDEDEDVAAERRAVLEGGEREGDLVRVLNL
                     RKEYPNGKVAVRNIALGVRPGEVFGFLGTNGAGKTTTISILCQEFYPTSGRAYVCGND
                     IVTESSEALRCIGYCPQFDACLDLLTVEEHLYLYAGVRGISSRACDRVVRGLMKLCGL
                     TEYRRTKSHELSGGNRRKLSVAVSLIGGPRVVFFDEPSAGMDPVARRGLWNAIETVAD
                     NCSVVLTTHHLEEVEALAHRVAIMVDGTLRCIGDKTHLKQKYGTGFEVAVRVADESPE
                     VMAGVELFFEEEFPSSKLTEVRAGRFTYQLPNTVRLSSVFTALEQQKEKLQIRDYSVS
                     QTSIEQVFMRISEKAELEHEEEHRQRMESKKSCCRCC"
     gene            complement(<364543..>365385)
                     /locus_tag="LDBPK_270850"
                     /db_xref="GeneID:13389202"
     mRNA            complement(<364543..>365385)
                     /locus_tag="LDBPK_270850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861893.1"
                     /db_xref="GeneID:13389202"
     CDS             complement(364543..365385)
                     /locus_tag="LDBPK_270850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861941.1"
                     /db_xref="GeneID:13389202"
                     /db_xref="UniProtKB/TrEMBL:E9BJ19"
                     /translation="MKRGREEDTEAEVGGSRVGPSDPGSAATSTVHKPRRLVKGVDVG
                     LPLHASVIEEICEVEETHTVLVRFPCFDFFRHVRVCERTRDPQPATSGDAAKASASLV
                     SALSDTTFRSGAPPATSPHDTADAAFAPEAAVFISGTLETDAPRLLLNGGTPHEMLFE
                     GQWTEVAGEGVSVTNRAVVHVSAKTAGITVPPAAPPLNSSPIMSDAAKSPEPARATAE
                     SFPASASQATGTPALPIASLLTHTLAGVTADEERRQRAEQQKGWAYDRIDVPSAVLVM
                     HRMR"
     gene            complement(<366175..>367314)
                     /locus_tag="LDBPK_270860"
                     /db_xref="GeneID:13389203"
     mRNA            complement(<366175..>367314)
                     /locus_tag="LDBPK_270860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861894.1"
                     /db_xref="GeneID:13389203"
     CDS             complement(366175..367314)
                     /locus_tag="LDBPK_270860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861942.1"
                     /db_xref="GeneID:13389203"
                     /db_xref="GOA:E9BJ20"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:E9BJ20"
                     /translation="MPAAVPVRTPPYLVDVAANLTDCVFRGVDWKGNRLHDDDFDYVL
                     VRAQERNVQQIIITGTSLAQSVKAIALCRRYSDRRLLCTVGVHPAHCGEFLRPLDRDE
                     VQRVAESAASVVMPHHERPAAAMTAEQEEAWAQERLDYLVDLATRNRDVVVAMGEIGI
                     DYAEVACCPREVQEKYFARQLAAFAPLQLPFLFHSRACGMKFVSHLQDTWARIASDAA
                     ATEAVADNADASAPLPHAQLRGVVHSFNGTLEEQEALLSMGLYLSLNCSAFREASLAA
                     QVALIPLSRLMFETDAPWCDVRSKDYGAQFVRTVFKTIKRKKPFEMGACLERRNEPCH
                     LVQVMEEYLGCAKASATSPEDPLSRMDEATLVAAVYENCKRLFHL"
     gene            complement(<368690..>371494)
                     /locus_tag="LDBPK_270870"
                     /db_xref="GeneID:13389204"
     mRNA            complement(<368690..>371494)
                     /locus_tag="LDBPK_270870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861895.1"
                     /db_xref="GeneID:13389204"
     CDS             complement(368690..371494)
                     /locus_tag="LDBPK_270870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861943.1"
                     /db_xref="GeneID:13389204"
                     /db_xref="UniProtKB/TrEMBL:E9BJ21"
                     /translation="MSRSITKGQQRATDVVSGPRNGLTGGGATGSSTSKASAAFTKEQ
                     FYTAEELLPYISEEEKAILKQEVLNSINTELLLNTDLEVTVPRLLRSCQNESRELRRA
                     MNSIASSQIVEAQRALQIVKSNYGKVQELRELFLKQGDLIQGLGADTLSYKHLRQLHC
                     LRDNVSSVIKWSEALKEVRYGNLYMLVEQQSFRFMYDRLRNLQLIRRTVITKAGARYR
                     SFQAVFEPYFEKLDVILSMFVNQVYKFLREDAMVIAIQRALEDGPSDDASHCGTGFAG
                     VGENKGHEEAPEPFECLRQCIAICGDEIESPVLNFGSDGVETESQINEEAVYSAVAKG
                     IEQLWEEQIMQDVVDSFGQISVYLEQMKKVEPLLGAFELTLFPLSTKLPLFSLVVKAV
                     HAEVMNVMRSYSDPGAELEANGLIEASLFIQWYEEMMVTNSYAQHVDFSAIDELSASF
                     MTAAVGGLSAHLTRLCRACAITVCNDLKGPTILSSGLPITTGPVDVFSVLQQSLAGMN
                     TAIDVTVMRQIGKACADAIYSYLDECKQRSDFDYWEDENNSLPNPQPAEEWQQRRMLF
                     LYAFCNDCTTIESNLDTIELKFAPCWDYDSPGAGDDQGDDTSAEAGGVGGDIFSTPFR
                     KLQDVLLEDAFYYLDEIAAQVERIVEDEWEKVFRTEEWYTDATNPVQLIVNTEAEYIE
                     EEFATMLQDQRSRKLTRQMLIRNIVKYINTLVEFLADVIRNPKKNTVDSWLTFVDCVQ
                     RDIDISLSMWREHLSDRQGRLLDLAQRALEVLKQLLSVKKPVDFGYLLQDKLLDDFGD
                     CPTFVIRFCFEARSQEVDRETRERLMAVWAERTAYQKRDSKDKPTVGWSPPPSFLGSV
                     DRSLAELEKPSGFFGRSIKKKRAAERQQKVMEEKNAKRAARKARRDADAAATKILTPT
                     ASPKANAGAVEVASLADILK"
     gene            complement(<372442..>373062)
                     /locus_tag="LDBPK_270880"
                     /db_xref="GeneID:13389205"
     mRNA            complement(<372442..>373062)
                     /locus_tag="LDBPK_270880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861896.1"
                     /db_xref="GeneID:13389205"
     CDS             complement(372442..373062)
                     /locus_tag="LDBPK_270880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861944.1"
                     /db_xref="GeneID:13389205"
                     /db_xref="UniProtKB/TrEMBL:E9BJ22"
                     /translation="MFSQGKQGSLFSLGRGPGGMTANDKTRNKALTQAEKYEQALVTA
                     KVFLEDSRARMTKSMDKYSAVVNSNYWFYGYFGGNMVATMAACLALGNRWAFFRSYSG
                     WIAVFGGYFGGRACLAAHSSMLLGGVVAQLNHEIEEAKRMDEQTDHIVPDYLREAERL
                     TQVKYELVPTLPEAVEARAHHTEQTLDDRADALIEAYMKRKEALGK"
     gene            complement(<374111..>376801)
                     /locus_tag="LDBPK_270890"
                     /db_xref="GeneID:13389206"
     mRNA            complement(<374111..>376801)
                     /locus_tag="LDBPK_270890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861897.1"
                     /db_xref="GeneID:13389206"
     CDS             complement(374111..376801)
                     /locus_tag="LDBPK_270890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861945.1"
                     /db_xref="GeneID:13389206"
                     /db_xref="UniProtKB/TrEMBL:E9BJ23"
                     /translation="MRFDKAAPPPAPPPPPPPPAGSTATSSSTAASALPRVSYRTLPS
                     SMYPKEVSSDFIPFPLPKHDASMGFGPVRLRNVPDIEEARARMAKAAQGPPRGSASTQ
                     LQDDDGDNAEAASALWAELSGETTATSVGLSTTSVTGVSPEDPEALSCLADARDEDFV
                     GYHVHRHFPLLDVLECDRSVNDLLAQFWNRPQREARTATVLDFAATLQRRSNDELTRV
                     LYELSSLFEWDGNGLQFIAAKVLKYGRSYTVSSELTKAFVQLVDAMTVTFVEEQPHRL
                     AESPALLAQVLHFLALVKIMEPNKWYTLNPNAPQNRADYTHPRGVNRTSAHVTTGRVL
                     LDFLEDMVTSGHNWTSEAVVDDQQGSLARPPVPQHATCRFTEGWSEDDILDVMAGFSG
                     VMPDGKASSPVLYALLGELWMRWSKVGFVLSGSEQAARLERLYMLLQVMDVQRDAVLN
                     ALLGGQLRAHGTAPSTSTLPTLFCERDDTPPLTLAQSLTQTRGPDFFSAVSRDKRAMV
                     KAAALRLLRASLAKARDDSDAALHQALVESGTELLQSLTSKSAALSFAQREQFDVMTL
                     RAVPHMADVAERLAEQRAETPFFPLTASAGGLPDTAAVLAHLSSHPAPYIVLYKGRRV
                     HPVRTLVSNLDHVAAVENVFLLHSSGVSKCVDALVAVARRLRSGKDALIVTASCLRAL
                     QAAAQYGATEKRRATADRALNIVSYELETGRAILMPVTDELYLHDAGTYCDEDLMLWT
                     LAAYLARDVPLVKVHTIMSSRSRARNPQHTLRGEHSPLTSSGDLYNKSTPLLQSLRSK
                     ELRAVTHHPVVQRPVRDPPQTLYNVNPIRARFVYRRDKALFDKYHVTARNLAPGFSQG
                     ALNSDLRALGFYTPDHPQVPYTPSSELRCCPVPAIPPASQ"
     gene            complement(<378359..>379615)
                     /locus_tag="LDBPK_270900"
                     /db_xref="GeneID:13389207"
     mRNA            complement(<378359..>379615)
                     /locus_tag="LDBPK_270900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861898.1"
                     /db_xref="GeneID:13389207"
     CDS             complement(378359..379615)
                     /locus_tag="LDBPK_270900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861946.1"
                     /db_xref="GeneID:13389207"
                     /db_xref="UniProtKB/TrEMBL:E9BJ24"
                     /translation="MQPNSVGDFPVPVATSGAPTDDGQSTRQLHANMISSEEVPTASF
                     RAHMPYERSTISSKQRRGGNLVLFVKSSENESEAAPRGTSFAPQQQQANSSGADGDVE
                     SVTDEGDENVGKDREDAPSLVISTVADAVGSVGSMATGATRRPLVTAALVLLYFILLD
                     LVLLSGNERLNRVLRRMRAAEDDALILLSTSLVRQMAEAKRELRDAVTQRGGKVKTEL
                     FEMARHKVEALERVCNRSISRLHAKLMFPGSVEDLLFLIEAHATYDERLRELAANELH
                     WATTVMTGHVVHAGGDGVEESRPHGLGTARPAAHSSAAGGDAHPSEEGDTDAALNPLR
                     NVRLQHVRQYRAPTKFAARSYARRPSTKAKSAATSRRQSGGTSTFTSAVSVVKTTARG
                     LLEVVSNKLVAFLLICVLLSAVLRMG"
     gene            complement(<380552..>380992)
                     /locus_tag="LDBPK_270910"
                     /db_xref="GeneID:13389208"
     mRNA            complement(<380552..>380992)
                     /locus_tag="LDBPK_270910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861899.1"
                     /db_xref="GeneID:13389208"
     CDS             complement(380552..380992)
                     /locus_tag="LDBPK_270910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861947.1"
                     /db_xref="GeneID:13389208"
                     /db_xref="UniProtKB/TrEMBL:E9BJ25"
                     /translation="MLRRCFSRLEVPRPAVERRKRRGRAEVGGAKKVGSRNPGMPDLP
                     KSAGGYVFQQLRPRLPIRWQYGWRWSSLKAVWVGGWSSFICYVAYVMFFKYTDSEIAE
                     QATQYTYVRNDRGDVVDIGFKPIVDAGRRARRRADRLLDPDERD"
     gene            complement(<381737..>383737)
                     /locus_tag="LDBPK_270920"
                     /db_xref="GeneID:13389209"
     mRNA            complement(<381737..>383737)
                     /locus_tag="LDBPK_270920"
                     /product="vesicular transport protein (CDC48 homologue),
                     putative"
                     /transcript_id="XM_003861900.1"
                     /db_xref="GeneID:13389209"
     CDS             complement(381737..383737)
                     /locus_tag="LDBPK_270920"
                     /codon_start=1
                     /product="vesicular transport protein (CDC48 homologue),
                     putative"
                     /protein_id="XP_003861948.1"
                     /db_xref="GeneID:13389209"
                     /db_xref="GOA:E9BJ26"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJ26"
                     /translation="MPGMSDRLKDRLKQMARQTPNGYRKQRPGSGPRHFADDNYPFHA
                     KRPRDEEEEGPQSSKSGSSRVHSGKEAGKSASGDGEGEVLGVIPKITLEDMGGLAKEL
                     PVIKELIELPVRMPHLFNCLGADPPCGVLLHGPPGVGKTKLVHAIAGSLQVPLFFVAA
                     PEIVSGISGDSEAKLRNLFMDAIAAAPSIVFIDEIDTIAGRREDAQRAMESRIVGQLL
                     TCMDQVSQAWRQHNKVVCVMGATNRPEALDTALRRAGRFDREIALGIPSIDERQSILS
                     IICAKINLSDGVDFFELANMTPGYVGADLHLLVKEACILAIRRKYKELDERGAVDDVK
                     TEELSGFCVTFDELKEATTRVQPSAMREGFTTIPNVSWDDVGALEDVREELMTSILQP
                     IRAPKLHHRFGLDHPVGVLLYGPPGCGKTLVAKAIANQSGANFISIKGPELLNKFVGE
                     SERSVRMVFARGRASAPCVLFFDELDALAPRRGSDRANPSSERVVNQLLTELDGVEGR
                     KDVYVIGATNRPDMIDSAMLRPGRLDKLLYVPLPSPAQRESILRTHARKYPVDAEVSL
                     ERLAHDERLTGFSGADLAALMREASLTALKGVYKSHTKDELEELERDITGKSADTADL
                     PTITADNFEASLAKIKPSVSAADRANYENMSIEIRNNAKNTD"
     gene            complement(<385879..>387201)
                     /locus_tag="LDBPK_270930"
                     /db_xref="GeneID:13389210"
     mRNA            complement(<385879..>387201)
                     /locus_tag="LDBPK_270930"
                     /product="cysteine desulfurase, putative"
                     /transcript_id="XM_003861901.1"
                     /db_xref="GeneID:13389210"
     CDS             complement(385879..387201)
                     /locus_tag="LDBPK_270930"
                     /codon_start=1
                     /product="cysteine desulfurase, putative"
                     /protein_id="XP_003861949.1"
                     /db_xref="GeneID:13389210"
                     /db_xref="GOA:E9BJ27"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:E9BJ27"
                     /translation="MRCVSRVFFCAAASTANSAGAASKAAAAVAAPPSTLPVFKTRPI
                     YMDNQATTPLDPRVLDAMLPYMTEEYGNPNSRTHQYGWSAEEAVEKARKQVADLIGAS
                     PKEIFFTSGATECNNIAIKGVGNFLKAKKNHIITLQTEHKCVLDSCRYLEMEGFEVTY
                     LPVQKNGILDLKVLEAAIKPTTCLVSCMAAHNEIGVLQPIREIGALCHSKKVLFHTDA
                     AQALGKVKVDVNADNIDVMSMSSHKVYGPKGCGALYVRRRPRVRIRSPVSGGGQERGV
                     RSGTVATALVVGMGAACEVAMKEWERDAAHTQRLQERLLNGLQSRLSHLVVNGDLKHR
                     LPGNLNISFSCVEGESLLMGMKDVAVSSGSACTSASLEPSYVLRALGVDAENAHTSIR
                     FGIGRFTTAKEVDLVIEECVKNVERLRELSPLWDLMQEGKTLADVQWR"
     gene            complement(<388628..>391621)
                     /locus_tag="LDBPK_270940"
                     /db_xref="GeneID:13389211"
     mRNA            complement(<388628..>391621)
                     /locus_tag="LDBPK_270940"
                     /product="vesicular-fusion ATPase-like protein, putative"
                     /transcript_id="XM_003861902.1"
                     /db_xref="GeneID:13389211"
     CDS             complement(388628..391621)
                     /locus_tag="LDBPK_270940"
                     /codon_start=1
                     /product="vesicular-fusion ATPase-like protein, putative"
                     /protein_id="XP_003861950.1"
                     /db_xref="GeneID:13389211"
                     /db_xref="GOA:E9BJ28"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJ28"
                     /translation="MFHSLYRLCQCAKLSFTILVLSVCILPCVDVLARAQAEDAAPEI
                     LYVRGCRDGAAEARETTGCFAARAGASVSSPTALAPIASVTLSLQGVHLPSEVRDTDN
                     GDSQAVLHRVLLQEHRRPPLLGQEQSEADTRLLEKIVLTCSRPTASLVFPTQLISCEL
                     ENPLLSLAGVESMTPQLLRLVSQPMWFDVRLEERRSGEEAYRTVTVLRRAVELRVSNT
                     TSAKDETAAETPRGHAEKVSWEEVRQHPLERLYAPLPASQDRAKRVDEPYDGDGAANG
                     DEMWAELGIGGLKRELRTLFRRVFLSRLPSLAPLAEALHLQHVRGVILYGPPGNGKTL
                     IARNLFRLLGPNTRLSVVNAADILSKFVGESEKNLRDVFEGYDIGTTSKEETAQQENE
                     RFDRSAYKRSDATKKGALLVLVIDEFEALFRRRGHSSDESSAKAVYDGVTNTLLSLMD
                     GVKSRNDLLVVGLTNRLQAIDSALLRPGRFEVLIEIPAPDVPGREDIFFIHTARLREQ
                     NFLAPDVVLRDLALESGGFSGSDIAGTVRSALSYALLRYRRDGLFQGGPQSKEANEGS
                     SGLADAEMIGHRAGDVGGLDLEGTGGSGSMSSSASSPSLFKVTREDFEHAFKDIRSAK
                     DETSVLSQLSADGDRASAEIVDHDGTVSNNIKRATAVIERVMKSNRTVTGMLVITGAP
                     GTGKSTVARALTRVYDFTTVRYLSCRRVAQLPDHEEQLGKLRDALNDASHTESGIVVL
                     DDYDVLVGVMGTGGYAGNTLRSLLYEYMHRSGGVSRALVANSPLAVADEAGGNVAMNA
                     ESRVSADRNHRILVLTSSLSSVLQQFSFDAHLRVHPVLRRGAEALLQEYRVADPVQSV
                     KAAAAYPVSMSYRTFLRITDMSLQRWVQEVENTAAAIGDSQSSDVESSESTMELPAYF
                     ATSDQMRAVYNEMRARQVAANFYAVGDDAASHSFVPAVRTTVADMGLIDPYQGWGGEG
                     SDDEDGKEAAVDVDELVGAADELLW"
     gene            complement(<393934..>398643)
                     /locus_tag="LDBPK_270950"
                     /db_xref="GeneID:13389212"
     mRNA            complement(<393934..>398643)
                     /locus_tag="LDBPK_270950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861903.1"
                     /db_xref="GeneID:13389212"
     CDS             complement(393934..398643)
                     /locus_tag="LDBPK_270950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861951.1"
                     /db_xref="GeneID:13389212"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:E9BJ29"
                     /translation="MKRLSTHQGSRLASRHTGVSVTAGTGVTAPEATGPILGRLTGMQ
                     CHSGMGVPSSSLWHSCAFFSTQSSKAASLAKAAAASLPVAMPGGAAAMPAASPPSAAV
                     AASKPAGRSGRGGGASSRGRKGGSGSAAPQEQLPRKQVGRRHRISPAAAKVAENADVK
                     PMRSRRASDSPRRRATPKQEAKRLLRSLDHNASCAPAAAGNPISIPTKAKEGKGLRQV
                     AFAATAAANARAATPSAAAAKAERTEAASLTTAQLLQHLQLTSFVERVAERVKAWASS
                     LAEWAQPAFDPALRGWERQLSLSLRKDSFADCTAVQNAMQQRYEDQFGHNQDDVAFLT
                     LYARVLVNNAMFCLVSFETYRSTQLLHEAVHVAKEAYVLQRRLTQGQEDGAAAAAQGK
                     ARGETGTSTAAAAASASKQPSLVGDPECHLFLLRVLLANAYASDQQYWKASEQYQLAL
                     SAMERNPMWCPEQVAPGLASPLPFNHTLVTEDAKLFYEDSVRVAHAISQGRAQLLLLQ
                     SKGPTATSARLLQVQLAMARLHRRAGQYAESQSLYESYLDGVTEHMESEDVGGAMLEL
                     GRLLLYKVNNSEAAVIYLEAASSILLEDAEALLQVAEAHGDSSGSNRSNEATAAEARI
                     AAGNATHRAAGGLIDAAMAFHTVGKTGQAIGLLEGCLQLLDRADLGFISGWVRRQYAD
                     MLASVALVDRALEEYSRTIELLRNGCGDAVAQLGTAGEMVPLHSAEVEGHMAFCLQTY
                     VGDHKRAMKHYRNIVKGSHKKDASVTSAQVRLNKRARRQRASTATVAATAAGSTGASD
                     GVAFTSGQARAGSSPALPRVDVSLQPDVLHWVLSNYVACCERVGAYAEAVGVQSRLIE
                     IEGALGGGVVDSYLKLISLARQAGDMEKTLALCFYIFFLPDDMMASETRLSVANSFAS
                     CCHRLGNSRMGSVLLQAVQQVRGDHDASSLARYAMGLKTLDPSDRVQLDCVDIEASID
                     TIGRVFRRAASIVVADMVVNGIEDEERTTRDGRRASSSDSSAAAAALSDGGNESSAPS
                     STSPSLWTRERVDRTLNSLIVLSRGAFFFHQNRFIKDAEELYAVALQHVDHIIASMPI
                     LTERHQREMGILLVNYATLKSATDPELAATLYERAAAVCPTYLEVAEVVADVFVQSGD
                     YAKGSVYMKRVMRANPSAATEMHMRLARLGTGSAWDTMSHGQRMEVMEHLLKGLGVAP
                     ERVAAAFAAGVQSQLTNANNTNVVMSLGNLAPLLLDGVATATSEDAVCFATYVVQTRF
                     QEPQLLNRMYRRALLRFPQHATILVNYATLCMHSGCHTLARKYIAKAYAASSGDLNCT
                     MCYAHYLCRSFDDRQVGCGEALYAHFLERYPNAAQAHAAFANYMAGVMPTPFKTEQHF
                     KAALELAPSSEDVVLQYGQFMWACTDSKTVYTNDEVRRRVFDRVEQLFKEAVAINPNS
                     FTACHQLGTFYANGQHRFEDAMAMLQRAHRLQPGNIEVVRHILGVLHGECMRLKKEEL
                     RRGSAVALQGANTQSFSGRLRSLVDATKEMFEHVLRMDPNDKASLEGYARFAVETLQD
                     PKLAATLYRRIEELNRK"
     gene            complement(<401272..>401865)
                     /locus_tag="LDBPK_270960"
                     /db_xref="GeneID:13389213"
     mRNA            complement(<401272..>401865)
                     /locus_tag="LDBPK_270960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861904.1"
                     /db_xref="GeneID:13389213"
     CDS             complement(401272..401865)
                     /locus_tag="LDBPK_270960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861952.1"
                     /db_xref="GeneID:13389213"
                     /db_xref="GOA:E9BJ30"
                     /db_xref="InterPro:IPR007905"
                     /db_xref="UniProtKB/TrEMBL:E9BJ30"
                     /translation="MPQAALPLLAKIWFLVVAPVVILDAIFVLTRAKSVNLPHPLAEV
                     VPFRYWAIYARYDRRYAANDDPFVVVQSWLNLVEVAMGLFVTLLAICDAQNLAIKLAI
                     VVCLMTLYKTVFYCLIEIAEGGKHTRHNTVSEKLTMLIAPLSVWILIPSLILRQCFRA
                     LAVASVPGSFKPKATVSQHYQQQKHHGNNNNQGKKKN"
     gene            complement(<402705..>404645)
                     /locus_tag="LDBPK_270970"
                     /db_xref="GeneID:13389214"
     mRNA            complement(<402705..>404645)
                     /locus_tag="LDBPK_270970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861905.1"
                     /db_xref="GeneID:13389214"
     CDS             complement(402705..404645)
                     /locus_tag="LDBPK_270970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861953.1"
                     /db_xref="GeneID:13389214"
                     /db_xref="UniProtKB/TrEMBL:E9BJ31"
                     /translation="MRSLLLRSSPRFAAAQVTPRAAYALCLHTPHRCVFVRELSTPAT
                     LESGDSSVAPFPARLLWQFSSKRPRHLVLCVREPLPAVAPLSPENTFEDLSAAEAVGA
                     SAARTVAVDGAPRAQEDFMYGRLFLRPYNVAQLLTVLQGWSDLPAVVERPRSSLTLSA
                     VPPSSTSEKPANSSSVDERPREVMLKARVTRKTTLAAPGDSGRAAIRGVAAYSTDADP
                     GAEEDQPDAVYVDGDMSTLHVILRDADLVLLTTHLESVLSDLFAIEHCSRKMERRKSF
                     DSQRSRVSHRTGARPSSFERSSAKQPQYLSDRCAPAKRTHGNMMEEGYQSRRRQRGNR
                     GGSRHHGVTAAPAQGEWSLFEAAPAKTAPTAVTNEAEDDDYQEIVEDVEEAEDGEDDH
                     KDATGTCSGATPSSQAVASAASAAFSTSYITTHTRERGKMTMESADRYAEARFMRDGS
                     VAASEVEEVGRVGDFDVRRRTRQAQGSTEKGDSRTTVHATATTGAFRSTSGEVTGSFS
                     YERLSTTTEATSATTAAAAAAATAVPLRCETAEGDSEAAATIDITAVESQPSAEVDDR
                     KHGESELHERQVGEEKSAVAGSAKPTRKRQASGSAAAAGKKKAAKRKSRKAPAKRKAA
                     PSNTASVSAPQGTAEFADTRVL"
     gene            complement(<406293..>406997)
                     /locus_tag="LDBPK_270980"
                     /db_xref="GeneID:13389215"
     mRNA            complement(<406293..>406997)
                     /locus_tag="LDBPK_270980"
                     /product="mitochondrial RNA binding protein 1"
                     /transcript_id="XM_003861906.1"
                     /db_xref="GeneID:13389215"
     CDS             complement(406293..406997)
                     /locus_tag="LDBPK_270980"
                     /codon_start=1
                     /product="mitochondrial RNA binding protein 1"
                     /protein_id="XP_003861954.1"
                     /db_xref="GeneID:13389215"
                     /db_xref="GOA:E9BJ32"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="InterPro:IPR018539"
                     /db_xref="UniProtKB/TrEMBL:E9BJ32"
                     /translation="MFRLVSASLSLATASASSVRFQSSSAMPAMNQNRRSQNRRNFIS
                     TNSLPKFEIHDVRDDPEHGSMTRVSVDGKQLLVSQFPQLGPRKADPNDTTPQFDRGRR
                     ISMRFRHIDLAGFVSVVENRIPSHHVKNNAFEMAFEKTTNGYVLKGQVHRSNSQANEE
                     WAVRFENQFAVTMEHFLESALTESFGFAQHQRALARGDSPPSDSPQNNQDRNRNQNRN
                     QSRRRNNNSNAENQES"
     gene            complement(<408266..>408931)
                     /locus_tag="LDBPK_270990"
                     /db_xref="GeneID:13389216"
     mRNA            complement(<408266..>408931)
                     /locus_tag="LDBPK_270990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861907.1"
                     /db_xref="GeneID:13389216"
     CDS             complement(408266..408931)
                     /locus_tag="LDBPK_270990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861955.1"
                     /db_xref="GeneID:13389216"
                     /db_xref="UniProtKB/TrEMBL:E9BJ33"
                     /translation="MQPNSAPVSYGAQLRASMQTLRANDIQFEQFTRGLGAVLQQWTA
                     LQLVAQHCDSRAPAVLYEDLCAWHKRDGEVYVDDMEVYFEEFFDNIHSARIEDDSMQE
                     VGSVLHDMYCRCCLNDFSMVEHYLQTLTMYAQTNPVAMSVNGGTAENLEDDAEEDAEV
                     GGDADSEEGVDNEDEESEPMQTSAPQAPQQPPQAPRHQQQPQRKKRKNASVRSKDGWN
                     IVQ"
     gene            complement(410746..410805)
                     /locus_tag="LDBPK_271000"
                     /pseudo
                     /db_xref="GeneID:13389217"
     misc_feature    complement(410746..410805)
                     /locus_tag="LDBPK_271000"
                     /pseudo
                     /db_xref="GeneID:13389217"
                     /db_xref="PSEUDO:CBZ35260.1"
     gene            complement(<412496..>414931)
                     /locus_tag="LDBPK_271010"
                     /db_xref="GeneID:13389218"
     mRNA            complement(<412496..>414931)
                     /locus_tag="LDBPK_271010"
                     /product="intraflagellar transport protein IFT88,
                     putative"
                     /transcript_id="XM_003861908.1"
                     /db_xref="GeneID:13389218"
     CDS             complement(412496..414931)
                     /locus_tag="LDBPK_271010"
                     /codon_start=1
                     /product="intraflagellar transport protein IFT88,
                     putative"
                     /protein_id="XP_003861956.1"
                     /db_xref="GeneID:13389218"
                     /db_xref="GOA:E9BJ35"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BJ35"
                     /translation="MNGNDEDIYAAFQTPDIGSNPWTTSTNPFEAPAQEAMGGNPLMQ
                     APPSQWGRAGMGSAWGVPGSRMNTRGCGIPGAARPMTSNRAVGFNSASNGAAAVLFDP
                     TGQARMANMAMGPAPPLKKRSENSQEEELAEMEKQVNKLIEESAMLALQKDYGAALEK
                     AKDAGKLERLLCKKREQYGLAEQINVDLTYAVHFNLAVQYQNHQLYTEALNTYNLIIR
                     NVQFPQAGRLRVNMGNIYLAQQNYLLAIKMYRKVLDETPTAGKELRYHLCRNIANAFV
                     KLGQYRDAANSYETVVEGNGDANATFNLILCYYALGETEKMKRTFTRLMNCRLAGLDG
                     EEDFEEEEKRKDVLVDDSLSRMRKERRARYLKYIITAARLIAPVLHKDWCVGYDYIIS
                     QLRTYEMRDPTSHVASELEMCKNLNYLKHKRYQEAINGLKEFEKKDRSLRARAATNLA
                     YLYFLEGDYENGEQYSDLSLVANQYNAKALVNKGNFSFVKKDYDKAKELYNKALAVEA
                     DNVEAIYNLGLAAKKLGLYEEAVRMFKRVQALVDSSEVLYQIADLSDLVGDPAALEWF
                     NRLIGRVPTDPNALARIGSLYARDGDDVQAFHYYLEAYRYYQVNMDVISWLGAYFVKN
                     EVYDKAVQFFERASHIQPQEVKWQLMVASCHRRRGDYVQAKRLYEQVHRKYPDNIECL
                     NYLVQLCKDAGLNEEANEWFKATKKVERQQIHSSSSSVGGESGDDDVESSVEGGNNIN
                     GHHRRRTSGTAAPDAAVAGRRAGGGAAADKDFSVGLSDDDIVDGKANQNGAKRPKKAK
                     NSDSDDEIDLPGI"
     gene            complement(<417894..>419645)
                     /locus_tag="LDBPK_271020"
                     /db_xref="GeneID:13389219"
     mRNA            complement(<417894..>419645)
                     /locus_tag="LDBPK_271020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861909.1"
                     /db_xref="GeneID:13389219"
     CDS             complement(417894..419645)
                     /locus_tag="LDBPK_271020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861957.1"
                     /db_xref="GeneID:13389219"
                     /db_xref="UniProtKB/TrEMBL:E9BJ36"
                     /translation="MSIRAVCWLQSKLGLDIGGRSSGDDGSGTLGSGELAGFSTTQNR
                     SYSTDPVATVNGDPEPSRSGRGIGGGAGTFSGLASGWESKLGLVWRQASDKATQYWNT
                     NMRRRGSKDPFGFGPAGAQGDFGGNTAAGDSPELDENGLPVTRNWYYYDAQLGRWTVS
                     RDAPESVQQEYYEKLEEAERERLGQKKVGPPPPTAIAGGPPPLLGAAGGGHGSQSPHY
                     AIPDYFGNAGATSAAPPQQAQPYGVYGGTPPQHAQSTSPGLSPPSAAISTQPGTYYPP
                     TPLISSTTASATIQATTYRQPLSAHSQVAPPPPPAQAYLPAMPSISMSTYPVAGGAYP
                     AASASPTSNTHALSLQPLPHMAVSEPPKTAMTVSSPPPPILASPTPSHLLSQPHVYSS
                     PAHNGMPVSPPAPAVSQQYASPLLQSQSTEHNRSASGNSGAGVSSLSFAHASAPAPAP
                     CASAAPDAYPYGGGSVSNNVQDSTTAVASVGIPTPSQTSFVLKAAAHGLQPPPPTSDP
                     YAYPAPVTTAATAQAFAPAPAAPVQPQPLKAEANGYDEHPSAPSMGTFQTTSAAAVRP
                     SAIGLPPPPSFKPFSPS"
     gene            complement(<421582..>423042)
                     /locus_tag="LDBPK_271030"
                     /db_xref="GeneID:13389220"
     mRNA            complement(<421582..>423042)
                     /locus_tag="LDBPK_271030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861910.1"
                     /db_xref="GeneID:13389220"
     CDS             complement(421582..423042)
                     /locus_tag="LDBPK_271030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861958.1"
                     /db_xref="GeneID:13389220"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:E9BJ37"
                     /translation="MLELDGTTLTYEGFRDACLRPNRPAVIRNACRDASGGICFDLAA
                     LKRRLCPRELCRCLGSQTLAPVYPVPSTAQVTSCDSTPAARDERRHEPPTTVRDEVVE
                     ADEEGCCKTVPLEAVLHSWAASTSAAACSPSPPHVYYLKDWHLQAALESTAATETVTT
                     SSAASSRLCEYAKSRASGTHGDGLYRVPRFLGADWMDSFCCRHVVPSNGVLSKTAPAH
                     DTDASTQIGFGNGESDYRFCYIGPVGSWTPLHYDVFGTYSWSFNVCGDKNWYFPTVAG
                     NAYLHDHLFPLFPTPPDIRVLTGFELEAVVQHPGDLVFVPAFFYHQVHNITGEVFPLF
                     AGEGAAVEDDRDQDAAEPVAPAEANEHLSAALTVSLNHNWCNTFNVERMVKAFLADAR
                     QLASHLSIEDLALICDTRDSAVWRRFADRLLHNGTNWSFASMTCFLDHCLAQLDSGVD
                     AAVGAEDERGAAADELHRLRGQVAEEYAHLLEEKRP"
     gene            complement(<423873..>426833)
                     /locus_tag="LDBPK_271040"
                     /db_xref="GeneID:13389221"
     mRNA            complement(<423873..>426833)
                     /locus_tag="LDBPK_271040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861911.1"
                     /db_xref="GeneID:13389221"
     CDS             complement(423873..426833)
                     /locus_tag="LDBPK_271040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861959.1"
                     /db_xref="GeneID:13389221"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019384"
                     /db_xref="UniProtKB/TrEMBL:E9BJ38"
                     /translation="MSSPAGTVAQPGAAAAADVSGGPLRSMQATTGAKSAAAATTSLA
                     PLSTRGLPADHHSPASMVAVIQEQWLQLCEYFQRVQCANTHDERTSLMRELGSVEKAL
                     SVILDALLTDRAMLATNHPALHQHSYVFGGPFRSESAPPSPPESSVDMGARGTAETMT
                     TATHIGTSPSASLSSSCLLDGLDGACLALPPCYRFLFADSHSVPIPPPPTDERGEASK
                     TKDPAAFGNEPPPIGNIFLLMLCQYAKQDEPPGVRSVILDFLVRLLQEADLPTDRSAY
                     PAGERAMSLLQLRPSALIVPLLDMVRKVSKALDPANAAAHRPTTTSTSGSPSTAAVTE
                     TYRWAIVDQRDGTLLQDAGRTQFVIFLSTLAEKMERVPALANFFVVEDGSQERNLLVL
                     LDALLLYLTHDCSTQEWTHRRDTCRFALSAVVSLAKCSDPWIQDVVAKEERVASRTLN
                     AARTTLLTLCKIPENDDGATQLLYLRDVMRFWATLLTMAPSVADTLRLLPLIEKEFVC
                     QTLLPLLQSPDSHVYSAACVVVSNILADLQGSAPLLKVCFAKALLSTTIRKASGRIVP
                     KKQFYEVLVQNPVTAASATRTGDLAVTRGQQEEKAAASLPEHPITSFFTYYILPHLSS
                     NPCLSEEDKESSTLLGFTTTRWSATKATLLLVQTLAEHVPHVFLREVFLMDVNSLSDV
                     QRKQMACALHTADSGGCKSAESWGSAITPPHLNIHDCFLSSLLSAAATNPKIGLQPDC
                     VGEAVLSRLLRVEANMPVAALRARQRMMSAMKPPCSSSSTAATAATEPVNCWFHAGVQ
                     TSPFTTALCEMVQHLDSSPYTVSSLVADLVVSIAVMPDLRVLYTLLDSKRGPLMTALC
                     GLRSVLQCHLERKVTETSPIKKITGGSEPSASTSTARRPLAVSIPFLYDMLLQHWDLL
                     VDDDTERTKSPVTPNHSSSGSEVSAEALREAIREHGNVLYACLYSEYLHAYLDAVIGY
                     TALSQNLMYLKVSG"
     gene            complement(<427580..>428305)
                     /locus_tag="LDBPK_271050"
                     /db_xref="GeneID:13389222"
     mRNA            complement(<427580..>428305)
                     /locus_tag="LDBPK_271050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861912.1"
                     /db_xref="GeneID:13389222"
     CDS             complement(427580..428305)
                     /locus_tag="LDBPK_271050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861960.1"
                     /db_xref="GeneID:13389222"
                     /db_xref="UniProtKB/TrEMBL:E9BJ39"
                     /translation="MSGAGRKHRAKHLTQQYLDASGWAGPKEGERLAICMESPHGQHV
                     RVLLLAPPNSAPASLSTETPTPGGSSSSDAPHGAEESEAVVSAAPLLEVEQVVHLPRK
                     FHKVIWLSIKDVVVIADGTVSSKPSPEQVENFLKDPRNKGWRERVATAQHRAEDQRAV
                     LQRMPHYAATAQTTTSVLTGPQVRSGVRATANGASEQDGEGSESEADDVCNPNWRNIK
                     HQQQFFYGLGDDSDEEVEEEEDA"
     gene            complement(<431346..>432614)
                     /locus_tag="LDBPK_271060"
                     /db_xref="GeneID:13389223"
     mRNA            complement(<431346..>432614)
                     /locus_tag="LDBPK_271060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861913.1"
                     /db_xref="GeneID:13389223"
     CDS             complement(431346..432614)
                     /locus_tag="LDBPK_271060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861961.1"
                     /db_xref="GeneID:13389223"
                     /db_xref="GOA:E9BJ40"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:E9BJ40"
                     /translation="MLRRIGSRYGKRFSFFCRNVRAVPQPEKAERGGEDAFLSLSNVQ
                     AVLDGVSWWKENADLNAGLYSAALARCMYEYVEDELLGDAPASSFRLLERGYESCKHS
                     DVLGTCTALVATLQEPQEDIQSKDHYEVVLLDGPSLPIVGVSTTGGPLAATYAASAAA
                     AATAAVAAADDTMSSAETAKESASDSDAAATRVKMTTDLHQAFARFQRTDGAENYLLD
                     VVYVGDCTMMLIRNGRVCYVTEEQAHQLDYPYQLGTGSNDTPKDGVRLLIPVEKGDVV
                     VMGTDGVFDNLYPNRIAELIWPHLERVFCQHGYLQALGGAATAKEPANSVSYVKNRNL
                     RTLLDDIMAALDMSANAVMVDAIAVSRDVRCDSPYASKCIENGALFEGGKPDDMTLLI
                     SVIGESADDEPSEQFSGSEAAFPLPYRDWP"
     gap             436022..436120
                     /estimated_length=99
     gene            complement(<436124..>436336)
                     /locus_tag="LDBPK_271070"
                     /db_xref="GeneID:13389224"
     mRNA            complement(<436124..>436336)
                     /locus_tag="LDBPK_271070"
                     /product="histone H1, putative"
                     /transcript_id="XM_003861914.1"
                     /db_xref="GeneID:13389224"
     CDS             complement(436124..436336)
                     /locus_tag="LDBPK_271070"
                     /codon_start=1
                     /product="histone H1, putative"
                     /protein_id="XP_003861962.1"
                     /db_xref="GeneID:13389224"
                     /db_xref="UniProtKB/TrEMBL:E9BJ41"
                     /translation="MSSDSAVAALSAAMTSPQKSPRSSPKKTAAKKAAAKKAGAKKAG
                     AKKAVRKVATPKKPAKKAAKKAAAKK"
     gap             437871..437969
                     /estimated_length=99
     gap             438764..438862
                     /estimated_length=99
     gene            complement(<441116..>442363)
                     /locus_tag="LDBPK_271080"
                     /db_xref="GeneID:13389225"
     mRNA            complement(<441116..>442363)
                     /locus_tag="LDBPK_271080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861915.1"
                     /db_xref="GeneID:13389225"
     CDS             complement(441116..442363)
                     /locus_tag="LDBPK_271080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861963.1"
                     /db_xref="GeneID:13389225"
                     /db_xref="GOA:E9BJ42"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:E9BJ42"
                     /translation="MLSTMDSSASPVCRSPSSKSYATRRVRSPVVLNLVEDNLKESCS
                     GEAFGSSQPASLTSSGGGPRTSALSPSRMGKSVLTAEERENVLTTLTPNSRPRRKSDN
                     AVTLSSSSSVRGSQEKGSNSKLRAVKLCKFSALPQAPHTSANLDTCTSPVQRSVSSRR
                     VRRSVSLTSSVLTSRPTEELATSSTPSNPPLMPELPAPLSSREHSAAISEEVDECCIC
                     LEVYTNENPMFRGACQHHFHLPCLMEWKQRSSLCPMCCAETLRGIGEFEGSHQCAAAD
                     PAEVARQRAIAKRDAEIAHNLQHNYLLQAQLRGRQYAYATQAVRSFQGLHSGSPSSST
                     SRTPPHTAEVEEHPLSTLQAHNRCNAQRSGGIVRQSPPPENVHQPRVTANAHSQLTAP
                     PAHPSMEESRRSRSKSQAGCAVM"
     gene            complement(<446076..>448085)
                     /locus_tag="LDBPK_271090"
                     /db_xref="GeneID:13389226"
     mRNA            complement(<446076..>448085)
                     /locus_tag="LDBPK_271090"
                     /product="translation initiation factor eIF2B subunit-like
                     protein, putative"
                     /transcript_id="XM_003861916.1"
                     /db_xref="GeneID:13389226"
     CDS             complement(446076..448085)
                     /locus_tag="LDBPK_271090"
                     /codon_start=1
                     /product="translation initiation factor eIF2B subunit-like
                     protein, putative"
                     /protein_id="XP_003861964.1"
                     /db_xref="GeneID:13389226"
                     /db_xref="GOA:E9BJ43"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:E9BJ43"
                     /translation="MSSSSEKEAKKQEELRLAGSDSEGARAAVKAQRELKKKRDAMRK
                     LEKRLKGIKDDAAKKVEYDAAKAVVDEVAAEVNAIERKLAELTGKALESAAAPEPAPA
                     ASPSSPISLTSATVTATGKEAAKESQMRFVGQSGDEARSAVKTQRELKKKRDALRKVQ
                     KKMRSCGSDAEAAAAMEQEAALLAEIGHLEALSGASSAPSTAHVAAAPSASTPATAAA
                     SPTALVTVATNKSSGAKAVISGEPAKEITAEERAASAKRLHDLVQGAMDANRLKCLHV
                     LPRDAVVHPRIAEVAVLMEQMILVGGSARALALISAFRELSRATTVLAVPSLNEVDTT
                     AFEKLIQINFDFVRRKREASAGMRHVKDVLVRRFVALRDEVIHPKPSMVDLIKDLGGP
                     REVTLKILDVIEAELKMSFKSIVEDRSLPYVSSSDTILVFGRSSLVEYILLSRSRDPQ
                     CKPKRVIVIDSAPLFEGRQLAEKLSSAGIGVTYGLITACCTLMPKCTRVFMGASAVLQ
                     NGDMFGRCGMALVAACAKLFRKPVLCFSESYKFVPEVWVGNLAQNTKLADMRPAAEVH
                     GSDTGTHSPLVYHTPPTLSPPQLRASGGWGTPARGADFLARSGGGGAVPFSSSASGYL
                     YDLTPASYVDMIICEMGCLHTSAIVAAIKDREGRDTSQLVNLVRG"
     gene            complement(<450828..>452063)
                     /locus_tag="LDBPK_271100"
                     /db_xref="GeneID:13389227"
     mRNA            complement(<450828..>452063)
                     /locus_tag="LDBPK_271100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861917.1"
                     /db_xref="GeneID:13389227"
     CDS             complement(450828..452063)
                     /locus_tag="LDBPK_271100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861965.1"
                     /db_xref="GeneID:13389227"
                     /db_xref="UniProtKB/TrEMBL:E9BJ44"
                     /translation="MSSPSVLELSKQLMQLDNQAKALRNEVEYLRATKRSLEVSNTTE
                     GKLSEMRDSTGSTAKSQRSRASARRSGTAGGTSISLPQDFIDDLAQKRSDVEASIRTH
                     KKLLREKEALQTALAKAEDATEAAEQEYLGIVEVVGIDTDGNSNSAVGLKKKNAYGIA
                     LKNAVAVYQQRENVRIQMEGQSRELLRLAAILQETTDAESQRAEAVEVLAERKTKLEA
                     LRHECNTIARAAARREKIADRNQHGLTSEDYIRHSNFDRRVALHELSKEDNLIKQNNL
                     AIRYRAMQIAKIQAHLELIGDAVTGDDMEEEERVDADIVEELAKEINDLYDSHLVANL
                     RMDTIDCEIEKMVWRASALQHAKESTVVEMGRVRREHRRYLDELQKTVDKERVSNGQT
                     IMQLQDELETLHRSSARKK"
     gene            complement(<453351..>454907)
                     /locus_tag="LDBPK_271110"
                     /db_xref="GeneID:13389228"
     mRNA            complement(<453351..>454907)
                     /locus_tag="LDBPK_271110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861918.1"
                     /db_xref="GeneID:13389228"
     CDS             complement(453351..454907)
                     /locus_tag="LDBPK_271110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861966.1"
                     /db_xref="GeneID:13389228"
                     /db_xref="UniProtKB/TrEMBL:E9BJ45"
                     /translation="MGAAAAKPVREAPVRYVAKQMPRLDKIPVEQQFKKPQFTAQGIN
                     TRQDDVNTEPLMYVETSKDASSTELTDHVAPRWYLNTYLEMSDNMRTDQTVISGNLPL
                     AWERDKHEPYSLVRGRIDDEDLRWVLQPEQRKKPLDELLGHTKLERQVLQDILDTVEL
                     PRTQYRNYKGKLHKSIDDANTHMTARKEQIEKAREAEILRQIGYTEEEVLKEEQYLTN
                     RCRGVRTLDELGASDREKRRQQRAAEASELEDMLKERRIEQLERGEATVTAEEVAEKP
                     EVLQMRNKHFSTHKNVYKRMYAADIGKDERNQSKFVWWLDRTRRIKRAVDTIHGVPVY
                     NDRLSANEEQTRKQMQEAAEFNFSISRSQGAKGFTDPRGHYDQFMDIMRYNKEEMQSD
                     THVEVHEDSSAEHPIFQFPHTREHGAKPAPTRFADRRDHAQRVDTDVTKLFGFEGESP
                     AATAATPAAPVHSKSSPSKQATRGADGLTYPSGRASAGGWEKAKGASGSTPAACTEAS
                     PPTNRDEREH"
     gap             456344..457588
                     /estimated_length=1245
     gene            complement(<461993..>462958)
                     /locus_tag="LDBPK_271140"
                     /db_xref="GeneID:13389229"
     mRNA            complement(<461993..>462958)
                     /locus_tag="LDBPK_271140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861919.1"
                     /db_xref="GeneID:13389229"
     CDS             complement(461993..462958)
                     /locus_tag="LDBPK_271140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861967.1"
                     /db_xref="GeneID:13389229"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BJ46"
                     /translation="MSKYVAPTGKVAPAAPAADNGVADITKVKICSGHTRPVCHINYS
                     EIIDGTFWFVTSCHDAKPMLRNGQTGDWVGTFEGHKGAVFCSAFNSGATRLVTGSGDY
                     SAMVWDALTGKKLHVWSHPKYIKSCDWMDQRIATGCFDGNIRIYDATRYDADPLSFGS
                     PDAINVKSTYFLDTNTMVTACENVIMKWDLRDTSGPYLRREIPGLNFVEYTHRHSIVA
                     AHEKSISFIDITSLEVKDSFTTSEDVECASLSPDGQRVAAGSKLKAKEFTLDGVEVES
                     NRGHHGPVFHIRWASDGNSYASGAEDGMVRVWPSHEIIEKYDTDA"
     gene            complement(<464203..>465792)
                     /locus_tag="LDBPK_271150"
                     /db_xref="GeneID:13389230"
     mRNA            complement(<464203..>465792)
                     /locus_tag="LDBPK_271150"
                     /product="T-complex protein 1, beta subunit, putative"
                     /transcript_id="XM_003861920.1"
                     /db_xref="GeneID:13389230"
     CDS             complement(464203..465792)
                     /locus_tag="LDBPK_271150"
                     /codon_start=1
                     /product="T-complex protein 1, beta subunit, putative"
                     /protein_id="XP_003861968.1"
                     /db_xref="GeneID:13389230"
                     /db_xref="GOA:E9BJ47"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9BJ47"
                     /translation="MFFANQASQVLRQGASEEKGERARLMNIMGAVSVADIVKTTLGP
                     KGMDKILQGTDRTQSVRVTNDGATILKSLFMDNPAAKILIDMSKTQDDEVGDGTTSVT
                     VFAGELLRNAEKLLDQSIHPQTIIEGYRMATDAAQKALAESAEDHGADEKLFYEDLIR
                     IAKTTLSSKIITVESDHFAKLCVDAVLRLKGSGNLEMINIMKKLGGTLRDSYLEPGFL
                     LDKKIGIGQPRRLENAKILVANTPMDTDKIKIFGAKVNVESVSQLAEVEASEKAKMKS
                     KCMKIIKHNINCFINRQLIYNYPEEIFAQHGIMAIEHADFDGIERLAKALGADVVSTF
                     EDTSNVQYGFAERIDEIMIGEGTVIRFSGLPKGEACTIVLRGASRHILDEAERSIHDA
                     VCVISETVKETRTVLGAGCSEFLMANAVEEKAKAVAGKKQLAMMAFAAALRTLPAIIA
                     DNAGLDSNDLVTRLQAEHYQGHKSHGIDVIRGDIADVKTLGITESYKVKSSVVAYASE
                     AAEMILRVDDVLRAVPRQRTQ"
     gene            complement(<466517..>468349)
                     /locus_tag="LDBPK_271160"
                     /db_xref="GeneID:13389231"
     mRNA            complement(<466517..>468349)
                     /locus_tag="LDBPK_271160"
                     /product="cation transporter, putative"
                     /transcript_id="XM_003861921.1"
                     /db_xref="GeneID:13389231"
     CDS             complement(466517..468349)
                     /locus_tag="LDBPK_271160"
                     /codon_start=1
                     /product="cation transporter, putative"
                     /protein_id="XP_003861969.1"
                     /db_xref="GeneID:13389231"
                     /db_xref="GOA:E9BJ48"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:E9BJ48"
                     /translation="MHIPAAVLTLTASTCLVFASHCARLSGTSVVWLSSFVALLTFLA
                     RFPRALRSKAAVCDTPRHKSRLLSAGACALFCLSATYGLATLGALRFACACACAAGAD
                     HIARTRRSSRNAKMACTALSCVILALTSDPGQETRPFILFGALGVLCAACAISLSTKD
                     VVKKADQTAFLFAACGLSLVGFIATLVQHKPIVENEMLLLLVFCVSGIVLAGCVNAGL
                     VLQGNAFTFVAAAAGMSAGSVVCGEKVFPAVYDWESLALLTSAGLIFAAHKGLTFADS
                     SVASLSGVSLNPTQMLKTKQHREESGIIVSLLSNSRERKLFVFLLLTVGIMLLELIYG
                     LAVNSLGLISDSFHMMLDGASIIIGLYAAHAASWLPDEKTHPFGYGRYEVFGGFVNGI
                     LLLFIALYVMVESIQRFLNPPEIEGPYLLLVSVIGLAVNVVGIIFFHDSHGHSHSHSH
                     GEAGSGHVDHNMRGVYLHILADLLGSVSVIISSILIYLFGLWIADPICSAMSAILVLL
                     SAFPLLEETGKVLLLSAPNHESNYCDKLREALLATSLLQDVESPKLWIHSTPPRELTI
                     CTVAGKLRNSTEYTSARKKITETVTAHMMHHLDVHNVSFVLHLE"
     gene            <470064..>471791
                     /locus_tag="LDBPK_271170"
                     /db_xref="GeneID:13389232"
     mRNA            <470064..>471791
                     /locus_tag="LDBPK_271170"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003861922.1"
                     /db_xref="GeneID:13389232"
     CDS             470064..471791
                     /locus_tag="LDBPK_271170"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003861970.1"
                     /db_xref="GeneID:13389232"
                     /db_xref="GOA:E9BJ49"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9BJ49"
                     /translation="MFKFDYKISYDEFVRTIYHHARQYEIKVSDPYKQCVTVNALITK
                     AKDEESKRNYANAYYYVNKCLLFFDKEENPVDFTQRDPSTKRVFAEALDLEAKLKLKE
                     LPIEYKAMIEEIDRREPERRRIVAQQLESDSGDGDGNKQLSRAVDMHLTRQQQLLSSE
                     NSSVDELLQRLRWASVPGTRNITLRTVSNGPPAPPPTYDTVSRPEPSPAPVNPVTGDS
                     HALPASASHRSYTTCILNPSNASLSVRRRGIVNLGNTCYMNSVLQVLNSTPLGQYFLT
                     DAYVSHLLNTKGKLTRLINSFSFVIRELNRSDCKFSVSASPFKSALGDYYEGFQNSSQ
                     QDANEFLRVVLDGIHGALNVNDSNRIEFPEIDNSKGTDDELARRYWGQYYQKNSSVIV
                     DYCAFQERSAIVCPSCCHQSRSFNVSLSIEIPIPRTSSKVSLDDCFAAYCREEILDDS
                     SMYMCPNCHQKVNARKQLLFYSAPPVLFITLKRFRCYGDFTTASKVNSSVFFSKTLNI
                     ASYMCSSFSKTKYHLVGIINHQGNMYGGHYTADAVGADGVWCHFSDEQVTKAEVADNN
                     LAYILCYVR"
     gene            <472362..>473690
                     /locus_tag="LDBPK_271180"
                     /db_xref="GeneID:13389233"
     mRNA            <472362..>473690
                     /locus_tag="LDBPK_271180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861923.1"
                     /db_xref="GeneID:13389233"
     CDS             472362..473690
                     /locus_tag="LDBPK_271180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861971.1"
                     /db_xref="GeneID:13389233"
                     /db_xref="UniProtKB/TrEMBL:E9BJ50"
                     /translation="MQSRVFYFPGKESKPDYEPRISRRVNEILRQSSPQARSRTSLQS
                     NWQPYAPILSIHSQLRQEAESRSPSRANVKHPMRASSVSSLTPHGSQVVSPSRLRYVG
                     AELTKRVSPSDLLRGASVTKFRQQSSSQCIWDSPRHPKASNTLPVNNESFSTVLPCSL
                     HPLLQQALLLVESAEFEERFAFCQEEMDAFDSIITVLGVAKEVEVIRLAAFEMFHIER
                     ASRRALKRQERHERQILRLWYSESYEDALLSEEVRVIRQQSEESRSFFSNSLSRSRST
                     SLKQQSQDLFDMAAPRNGSPSSKKVPRLQKRDKIAHMASLLFSASIRQGEGIRGSSPT
                     DNCDEVLHSSPRVLSPMPSEPYFSHTIGSSHLSHRSSDSVNVADRRRYYREYGDHCRR
                     TLESMEADLEDRIARQEALLLPARQSYQSSSPFSLIRRQAPLLLPKSAED"
     gene            <474391..>475068
                     /locus_tag="LDBPK_271190"
                     /db_xref="GeneID:13389234"
     mRNA            <474391..>475068
                     /locus_tag="LDBPK_271190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861924.1"
                     /db_xref="GeneID:13389234"
     CDS             474391..475068
                     /locus_tag="LDBPK_271190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861972.1"
                     /db_xref="GeneID:13389234"
                     /db_xref="GOA:E9BJ51"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:E9BJ51"
                     /translation="MRRCCKLQALPGVLSILSDLAKPRTSTSYQELLRNSHLPAQPLP
                     FLPPPRWAAELSRVLHRTFPDVVQHHHTRFLQVFVHPSFTTAAGVSGTMQPLVAIGES
                     LLERIGGLWILATFESTRREEYASLLALLTSDTALCRVLRDHWRLEHMVLTDASADLF
                     SRQRLSSTKGLMCWLSSHGSVNGAQPLPEPYGAGCVKAMVAAVLLAHGNDAAEHFVKS
                     EVLPYVL"
     gene            <475691..>476881
                     /locus_tag="LDBPK_271200"
                     /db_xref="GeneID:13389235"
     mRNA            <475691..>476881
                     /locus_tag="LDBPK_271200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861925.1"
                     /db_xref="GeneID:13389235"
     CDS             475691..476881
                     /locus_tag="LDBPK_271200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861973.1"
                     /db_xref="GeneID:13389235"
                     /db_xref="UniProtKB/TrEMBL:E9BJ52"
                     /translation="MVDSATGEADPALSSSQLILLAYEEEAPRCKPPEELLAERLQAL
                     KRYKYPIPEDPESDASGAKAYLAVCAELAKATGVKGATSSIAKDLAAENEVLDLSYAG
                     LGVKGCTALAAALRVTSAVQSLILVGNYITPSAALELVRAINDARNIQSLNLSKNQMG
                     RVEAMRKGAHHLNTFSGGAVVNEVLAPGSTLRFLALSDNDLGDTDIAAFADTLAENIT
                     LQELDLSYNRIGFVGATELAKVLSRNSDLRVLNIEWNPLRAAGAQLLLSEGLLQNNTI
                     KQCNLSSCGLDDKCGQLVARVISENAIEEVIIANNRIGRVGAEAIARTLPSTSALTTL
                     IMDGNPIGDTGSAVLLDVALSGSVSTLRVISLQHCCCNDPAILRRGQEASTATLKIRI
                     SESV"
     gene            <478099..>478590
                     /locus_tag="LDBPK_271210"
                     /db_xref="GeneID:13389236"
     mRNA            <478099..>478590
                     /locus_tag="LDBPK_271210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861926.1"
                     /db_xref="GeneID:13389236"
     CDS             478099..478590
                     /locus_tag="LDBPK_271210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861974.1"
                     /db_xref="GeneID:13389236"
                     /db_xref="UniProtKB/TrEMBL:E9BJ53"
                     /translation="MTHGALNAVSGFLSTISSRSAQSRRTHRPCIPYVLVAMTHHLPE
                     MDILFGGAVTPSALTMNDEGGKFVAQRGSVQILVDAFHYAHCMETSKERAEEAKQKRC
                     SAARCCQRAPGLDHWRSRPFSAATLKSGVVTRFSRCAARVRIRCRLPRSRQTSTPTDA
                     ASI"
     gene            <480467..>480736
                     /locus_tag="LDBPK_271220"
                     /db_xref="GeneID:13389237"
     mRNA            <480467..>480736
                     /locus_tag="LDBPK_271220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861927.1"
                     /db_xref="GeneID:13389237"
     CDS             480467..>480736
                     /locus_tag="LDBPK_271220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861975.1"
                     /db_xref="GeneID:13389237"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:E9BJ54"
                     /translation="MSQQNAVEALLARLQMGDTIPAFQSMGVDRIVSLRKMSEEALRQ
                     AVPDPEQRQALMDAIESRGHLQSRRAGPPAGQPHPPRRAPADFAPI"
     gap             480739..480837
                     /estimated_length=99
     gene            <485435..>487513
                     /locus_tag="LDBPK_271230"
                     /db_xref="GeneID:13389238"
     mRNA            <485435..>487513
                     /locus_tag="LDBPK_271230"
                     /product="arginyl-tRNA synthetase, putative"
                     /transcript_id="XM_003861928.1"
                     /db_xref="GeneID:13389238"
     CDS             485435..487513
                     /locus_tag="LDBPK_271230"
                     /codon_start=1
                     /product="arginyl-tRNA synthetase, putative"
                     /protein_id="XP_003861976.1"
                     /db_xref="GeneID:13389238"
                     /db_xref="GOA:E9BJ55"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:E9BJ55"
                     /translation="MCAAAATVNVELALKEIVKATIAKAFPLVPAQEPLITLGKVSEY
                     QCNNAMGLVKVLSQQQQPIKMSPQMVGEELKKNLVGNDIIDEFEPTPKGFINVSIRKE
                     WVARMVKEVLKQGIRPPVVTKQRVLVDFSAPNIAKEMHVGHLRSTIIGESISRLLEFC
                     QHDVARINHIGDWGTAFGMLILYIKRNFPDYTTNPPDISDLTAFYRAAKKCFDEDQEF
                     KEKARLEVVKLQALEEDSIQAWKYICDVSREEFDKVYTRLGATIEERGESFYNPLIPK
                     VLDLLEEAGQIEVSDGAKLIVSKEARKLDSLDARDMTKLASQHLALVSRDGPSYHPNL
                     LAAMKKAGILTGTEGEESVALSKKEVKPWNKFDIRVDLDKLMAQLAPLYKKQLDPLFL
                     EVFEAAGIVKGDSILVPRFSFPLMVVKSDGGYTYDTTDVTATYHRFVIEKMNRVIYCT
                     DLGQYEHFRMCMQTAKDMGWMEHATWDHAGFGLVTGADGKKIKTRSGETVKLKDLMDE
                     AVERSLAILKEREAGERSQGHSEEEMQKLSNIIGIGAIKYFDLKQTRTGDYAFSYDKM
                     LDMSGNTAVFLLYQYARICSIKRKAGIADEELLEITDISLETPQEKSLALCALRFQTV
                     ILKTVEDLFPHHLADFAYELMTNFSNFFQNCRVLDDPLQNSRLCLVELTRITLKKTLE
                     LLNIETAERI"
     gene            <488889..>490691
                     /locus_tag="LDBPK_271240"
                     /db_xref="GeneID:13389239"
     mRNA            <488889..>490691
                     /locus_tag="LDBPK_271240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861929.1"
                     /db_xref="GeneID:13389239"
     CDS             488889..490691
                     /locus_tag="LDBPK_271240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861977.1"
                     /db_xref="GeneID:13389239"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:E9BJ56"
                     /translation="MQTWYRPHPYGIYPRGNAVKRSDIFDRLGTFSIFTAATTDDDKE
                     HTEQPYLELVQCFLAFLEVPDLCRLSRSCTGWYVLVHCTDAFKAAYTALSPSYLRFRG
                     SWKETAVRGYVAVHGGTPNAVPAASITNSTPSKKRSKVESKRMRATPAPAGETSAAFA
                     RHTPVCVRRRFFCDQLFQAWMCTILPPYYHLHPVAEEPQEASPSLSSSAVRTEKSAGQ
                     NAGSKSRKRQQVAAWPAAASTSSTAELADSVDAPQSRSPRYMSKFRPVERCSRISVDE
                     FHDRFEKPNVPVVITDVATEWPLFKILQGRFTNLADKKDSLVRSGCPVTSPLRCEHTN
                     MDLEDYVHYATEQNDERPIYMFDAEFGSVLDAEKLYTVPPYFARDDFFSALGDRRPKF
                     RWIVAGPQRSGSSFHVDPNYTNAWNANMTGRKRWLLFPPGATPPGVVPSADMAEVATP
                     VSLTEWLLNYYDACLQELQHCGYECICEPGDIMFVPCGWWHFIINLEDSIAITQNYVS
                     RCNLPKVIKFLRAMKGSISGIDEDADTATEESTERRQRGFAKEFEAAMKAAHPALMQD
                     VARQLEEEHQAREKRRLGRLTLLDPSSGGFTFSF"
     gene            <491864..>493165
                     /locus_tag="LDBPK_271250"
                     /db_xref="GeneID:13386712"
     mRNA            <491864..>493165
                     /locus_tag="LDBPK_271250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861930.1"
                     /db_xref="GeneID:13386712"
     CDS             491864..493165
                     /locus_tag="LDBPK_271250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861978.1"
                     /db_xref="GeneID:13386712"
                     /db_xref="UniProtKB/TrEMBL:E9BJ57"
                     /translation="MGILTNWYESLAQEKQLELLMTLGMYDERVYEVVERHHLAPDIL
                     QTLPSPLTAHFLARGMCYDAINEEVVRNFVRICMMLSRYRTVEEASTLAELIGSCGLP
                     EQYRMQMFNFSETYRHMILSQSYFPQRAVLRLLSYIFCDDVLSDAVAQLQYKSDILNH
                     VNKVFVTTPDFVSWRFSVRCMSLAGGFNEDRSDVEYTELLTRAVSQALPEFFSYLLVA
                     FCYARFRLYPQRVRGITPRWLVRQRACFSALYCALLGVYCNAILEYRVHEHRVLYELR
                     KSREMRRRRGAERRGLPYENNPYFDNLEGVTRRVYMMQLSAYTFTALGLAVSMLPLTS
                     VKFPKFMGDVAWRHPFVPRLFPALLGMHAASRCLIPFVVAPFTAVSLAMHGNWGTTLY
                     DRYVELRMRLWHRKVDVAFDTSTEMDEVDIIGADTTRKSAS"
     gene            <495929..>497011
                     /locus_tag="LDBPK_271260"
                     /db_xref="GeneID:13386713"
     mRNA            <495929..>497011
                     /locus_tag="LDBPK_271260"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861931.1"
                     /db_xref="GeneID:13386713"
     CDS             495929..497011
                     /locus_tag="LDBPK_271260"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003861979.1"
                     /db_xref="GeneID:13386713"
                     /db_xref="UniProtKB/TrEMBL:E9BJ58"
                     /translation="MKTDDHLSQIHTMCRALGIRPAAAAPFIQPALALQRRRLHTPIV
                     AHEKPAAKIALPMLLSDSSGDVSYLAGQDSVGTLSMTPPGSPRTRTLTPMSNIHHHAH
                     LATSELPVSVLAASALNFAAAWRTEDSTCAARKDLIHRCLKARRDLELEEAGGRHRLS
                     QLLLTVSEQMHRFVVMGEYSKFVVFCVDQEPVWRQAARQLQKENEARLHTAENIYSRF
                     LMEEVALSEKMRMFQEASDFVVSQGYAAREQRQRAQIRAARRRCDRESASQETPMPFE
                     PQSHLHPHQHNNESNAASLAGGRTPPQLQRPRDDFTDKRSESGKERSAKNAKPHSTTK
                     VDRYRQRWREIIWFLSNGERGKAAQH"
     gene            <500575..>501522
                     /locus_tag="LDBPK_271270"
                     /db_xref="GeneID:13386714"
     mRNA            <500575..>501522
                     /locus_tag="LDBPK_271270"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861932.1"
                     /db_xref="GeneID:13386714"
     CDS             500575..501522
                     /locus_tag="LDBPK_271270"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003861980.1"
                     /db_xref="GeneID:13386714"
                     /db_xref="UniProtKB/TrEMBL:E9BJ59"
                     /translation="MLNTRVQRPPPPRRAPPAAAMIKDVSPDAYISTHVILRLSGAAV
                     ISQQLLQVKDWVSDIKMAVTTADDALKAISTNPAVQPPSLSDGATTGGDDVQSLAFAS
                     VALSKLAEEEETQDAFYAKLSETAFVRAEVQMGSQDARLQRYKQQVECQLASSMADGL
                     LPPQQRKNSVPPEKRQMLLNPYSTVRRKLPNTASNGNSALPSANTPMPPTITSPYRTS
                     TSSAVPSPQSPSYSTPAAVNGGCTSYSPHSSDAAGSPSRATARYGATATQQPLTHGAH
                     DHRRPLRRGNAIAGMHFGQPPQPLHQNHQQSSRPHYQAL"
     gene            <503285..>505345
                     /locus_tag="LDBPK_271280"
                     /db_xref="GeneID:13386715"
     mRNA            <503285..>505345
                     /locus_tag="LDBPK_271280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861933.1"
                     /db_xref="GeneID:13386715"
     CDS             503285..505345
                     /locus_tag="LDBPK_271280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861981.1"
                     /db_xref="GeneID:13386715"
                     /db_xref="UniProtKB/TrEMBL:E9BJ60"
                     /translation="MFPSPVSGLPATTLLAKVDVAPQLADIHKEFAPLLRLSGICAAS
                     SGSTAVGPNGTSSGAGVSNGGLSGSEEEDLRGRRSPAASPVRTADSRLAELMAPVMVT
                     LPTPMSKEDAASIAHYVHRFHVQEEYERSYVALIFQEYKKRKSMEQKWESDLASWRSE
                     LKQLQQRELPPEVRAAASVIVSEEAAARKAVHDAYDKFLKWVEETVPQWIETAQRQEQ
                     RRVDNENAKKAAMAAAREALAHELAMGKRLSDVNDRTSFQNTGAVTGLKEDGTLSYEP
                     AVSVETQVQASREATEALSPTELRRKAIRMLEAEEAEMKRRREEQLRLLRVQEEQLRA
                     EIALKEKYKQEEAERRQREAEQKRKDELARRYDALLKEEFTLQSRMREREEMEVRQEA
                     ERRAKLAQVAAEEEELRRRIQETEDRRKASEEEAARVARDKKMREVREKEEMLRQRIA
                     ERAAAAEAERLEREAEARIHAEAEAVRARQEEALRQARMQQEEREKKQQLAYLRDQEE
                     AYKRRIREKELAEIEKKRLAAESQWQHRASTTSALAAHSVSSTSATPIVMPPAAALPA
                     PHLMAPQIPMSSYTTVMPSNVYQPIPAAPAPSAVAPGGCYLYPNPVATVVPTAGMPPP
                     SRPEYGVYPFAQPPCVPVAQQYPQPYPPATVGYYPGVPQGGAPPGVMTLQTSPYSPAA
                     MHTL"
     gene            <508064..>512638
                     /locus_tag="LDBPK_271290"
                     /db_xref="GeneID:13386716"
     mRNA            <508064..>512638
                     /locus_tag="LDBPK_271290"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003861934.1"
                     /db_xref="GeneID:13386716"
     CDS             508064..512638
                     /locus_tag="LDBPK_271290"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003861982.1"
                     /db_xref="GeneID:13386716"
                     /db_xref="GOA:E9BJ61"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BJ61"
                     /translation="MSSSPSDTHSSAFPDATSVAAAFSRDDFFECPRCHRHCKSRTWF
                     LKHLEACSKSASSSSTHGNTVSGEGSGGSPRTAAFATKVKNHHRHPSRSSATEDVTPP
                     LLESATSTTSSSSATSYSHVHSHKPSGLTHPTGSSGREVAPSHLIEAGLSADTGLSRS
                     SAVGFGGYRDGRRESNNTTPTATSQASPHWPIDDLPIASSASGVGTGAGGSIVANGMS
                     RPTSPSQGSSLYAGSPRGLRAGESCGESGSAHASTAFGRTSAPAAAAASSSFSTAQRD
                     EAEQHRQPARQDSFRLQSDFTWTQYTPSASEEDGDDEALGEHDGSILDHSSRQLLRSL
                     GRVQRGNNPAPREAGTSLCSIGADRLMAPGDADKTPDRWAYEQQLSGKSSHHRSTPPS
                     AAGDVGRHTATGMLQGASFPLEGEQQMQRRFSASISEFSPTECNVIGAADGSQSVGSG
                     SNSDRFHRSARDSASPVSPICMSSASPMFVQATGSPSLLHINVSPTSTTAAGSSMSRL
                     NGMNASSSGGGGRTPRHGDRSGAVTPRAISFQRGRAVGSGGFGIVYQAILSDGSLAAV
                     KELKLENANLKAIDREVRAMSSIPPHPNCVRYLGSRYSAHHYYIIMEYISGGSINSLR
                     KSVGRFRESVFQRYAYMVLLGLSHLHANGILHRDIKGANVLLDESGCAKIVDFGCSGN
                     LNQATTTLSGGGTPLWMAPEVCRGEPATEKSDVWAFGCLCLEMTNDTGMPWNFPPGMT
                     LQGVVYALACAKSPPAIPTDLSLEAQDFLRRCLRIDPGERATVAELLQHPFFDVDLME
                     DSEEDELLSSYGASARQSAVKRAVRQVNLSSALDAAAHQQERQQYRGEGDEVGGGAKD
                     MQVSSPVQVFAGMSLPSQGMHSSGHRPISDPDAGALLRSPNSHSKSASGPQLDHYTRS
                     VNIGFSLQAVDEDDDDDGGGAEKAEDNVGPSHNLLGGSPPAIPGTAASTDRCRTTSFK
                     SAGVEEDENEYTQMITEIITQAREAYTDEERRLTERRRRLNMMHRSSDEDTSLTATMS
                     SGSDTSNNGGSAGSDGSAGCSFAEEGERSEHVDIESDLSTLSGSDGDVGARSRSVGGP
                     RRHSLGTTWRDQSARASAATENSEELLQNTDREVPHHEPACAARVKDPTAPSASALSA
                     CRSRFPGSDARASTTLAATSPTSAHVGSWDTSISLYATSPSSSTRGLEAGPQFQRSPH
                     GVVLPLPLASSYPRQQQQQQQQQQQQRPCPVSPPTRQREVMRRELPRDKSRSRGGASF
                     GKSPYDGVVAKAAGGVARAPREPGGPVGVATTIRQPAGSSPLSPHTSASAETPPPLSS
                     SPATQSSTICGAVLSERSSSSRTPPLTVGGPHRQTPPQPLATTTATSSAHSDIVACPI
                     EWYTGGSGRLDVSSATWRTGASGHLPKELSMAQKEMQEMLDWGTSSDRHHALSSSSPD
                     IGRRSSKALPTATNSAVRGGEGHHNHHRLHHLSHNHGDDLDSECTAEAESLSHHESRG
                     LSATETVAAAQQPAKRKLWGLGIFRNLRSK"
     gene            <514584..>514922
                     /locus_tag="LDBPK_271300"
                     /db_xref="GeneID:13386717"
     mRNA            <514584..>514922
                     /locus_tag="LDBPK_271300"
                     /product="60S acidic ribosomal subunit protein, putative"
                     /transcript_id="XM_003861935.1"
                     /db_xref="GeneID:13386717"
     CDS             514584..>514922
                     /locus_tag="LDBPK_271300"
                     /codon_start=1
                     /product="60S acidic ribosomal subunit protein, putative"
                     /protein_id="XP_003861983.1"
                     /db_xref="GeneID:13386717"
                     /db_xref="GOA:E9BJ62"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:E9BJ62"
                     /translation="MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRA
                     LRGKAEFIMGKKTLQAKIVEKRAQAKDASPEAKRFNDQCEEYNLLSGNTGLIFTNNAV
                     QEITSVLDAHR"
     gap             514924..515178
                     /estimated_length=255
     gene            <516815..>517249
                     /locus_tag="LDBPK_271310"
                     /db_xref="GeneID:13386718"
     mRNA            <516815..>517249
                     /locus_tag="LDBPK_271310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861936.1"
                     /db_xref="GeneID:13386718"
     CDS             516815..517249
                     /locus_tag="LDBPK_271310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861984.1"
                     /db_xref="GeneID:13386718"
                     /db_xref="UniProtKB/TrEMBL:E9BJ63"
                     /translation="MSRVLTVLLTYDDPECGGAADALVEHLERDAVAVEGHCQLSVKP
                     IQVLQNGSHRDALYGSLQDLFQMKPQDIYVIAFLKGSQPEEYRKVNELCNSVRPNPVK
                     CQVLTHLANYNDVGLIIRNLVRLVLDEMTKEEASLGSTEPSK"
     gene            <518521..>519648
                     /locus_tag="LDBPK_271320"
                     /db_xref="GeneID:13386719"
     mRNA            <518521..>519648
                     /locus_tag="LDBPK_271320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861937.1"
                     /db_xref="GeneID:13386719"
     CDS             518521..519648
                     /locus_tag="LDBPK_271320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861985.1"
                     /db_xref="GeneID:13386719"
                     /db_xref="UniProtKB/TrEMBL:E9BJ64"
                     /translation="MEEWIMASLKDKYIDRVDASSVQSGVFCEAFTSPWYDGGVVFDW
                     TALHQRLTRPTVALPDVTKAVTALRRFGAEALMAASGEGDKKCFSTVVELREPWTLHP
                     LSEQAQRLSVFDVLSVTASSAPTEAAASSSPAPSSSDSRQLYTFLRGPPGQRTVREDM
                     ARVLSSAEEQFRRSGVRVVSFLSSFILFGSDFTDMLHSTAAVFRALTEAGFCIDSHGS
                     CLGPRVVTPLRVDADDWWTTSPLQQIESEEDVAALLVALFYQWLQDAYVWGCTAPIRL
                     FPDAKETHATQSTRLLERFVRGLVLPRARAIGLDALYASLPEEGGSLLELAAVGLEKK
                     QAPTGLQRWSVLELRVVLAQLGAYEHIPCEYLGQPQNNTRR"
     gene            <523795..>525714
                     /locus_tag="LDBPK_271330"
                     /db_xref="GeneID:13386720"
     mRNA            <523795..>525714
                     /locus_tag="LDBPK_271330"
                     /product="ethanolamine kinase, putative"
                     /transcript_id="XM_003861938.1"
                     /db_xref="GeneID:13386720"
     CDS             523795..525714
                     /locus_tag="LDBPK_271330"
                     /codon_start=1
                     /product="ethanolamine kinase, putative"
                     /protein_id="XP_003861986.1"
                     /db_xref="GeneID:13386720"
                     /db_xref="GOA:E9BJ65"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BJ65"
                     /translation="MVQFTDMWITDDPLLRQIQIVEVVLTHCASVLWRHNEEKLKSAP
                     EWAAKLRALLKTKAKRLGGDSSCRSPESCASQRSMTQQKKHNGLAAASADAIVYQKNS
                     KEDYPPQNTPTPQLLSSQQSFQVPLSHKHATAGAALPGAIPTTQGGSVFSDEPHSATH
                     TNLNTFSESSTCSSTSRLHYPEVGAGNNRVRHSPAGPLPSVTPDVLLSSCRSTEEHLE
                     ELGAPPTAATTRHNEVAAVRERSSPPIERSNTPELPSAPLQMKRLSGGITNELFHVYD
                     EDDPSASVVVRVFGKETDRVISRESELFYQSLFIPTYVHGSNFLVYDYLDGYYTLPYQ
                     DMSAEAMPIARAIAAFQVRATRAALRDHGHPLLRDSQNKDYWKIVDNQMLAAEGSTTS
                     SHDTYKDESRFDRESNYLIGSLTKWVDLVLSQEIVDRVREDKRESFLMTGRSLQSACA
                     WMLSMLERQKAYLPEGVCHNDLLSANVMIHKVRKDVRVIDFDYTKRSFLLYDVANHFN
                     EYPGLDCDYDTYFPSDAHMSAFIAEYRRGMRDALEAAWAENSSPTDCASREYEIFPNA
                     RELFWSDREEAEAQVVVHWTRLAKLLTLASHLSWSVWSLLQEAVSALDVDFLNYAQVR
                     YNRYLAVRAECSENL"
     gene            <527975..>530719
                     /locus_tag="LDBPK_271340"
                     /db_xref="GeneID:13386721"
     mRNA            <527975..>530719
                     /locus_tag="LDBPK_271340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861939.1"
                     /db_xref="GeneID:13386721"
     CDS             527975..530719
                     /locus_tag="LDBPK_271340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861987.1"
                     /db_xref="GeneID:13386721"
                     /db_xref="UniProtKB/TrEMBL:E9BJ66"
                     /translation="MEVDLSPFFAGAMCALVDSNGAELAISRAFASAANACYEAHQPQ
                     HSWNQQQPQRSRTSVTVQLCINSPLLSWTRQAKDVVLRCVDRAVTRIFPPLDVLQYIG
                     ADSPVFLAADASASREKAGSHLCVTFAVQPSAALWPSWVIKQHAVEGEVVTGVQLGDS
                     ETGAAAALQWMRDTLSDMDLWSRARAAHQLYDTSIALDGVQQRSGGISASDTTSIATA
                     VALPSRQQACEEKHTKLQWQLARWLTELFMNEGSWARLPASPSTGAPRSAQKRPVNAA
                     TRRLFQSPLRPSFSHVVEAALSAPHTTTQNTAPGSVVPRRLLHADVRGVECNGLLVGH
                     TSRYAYIAVPYFTAPGEAATTGASSPSCVWSFISRIPIPAILSESAGRDAEGRHGEKG
                     RLPRKRPRASASHHPDIVASEEEESSCAAAARSVLAHCLNVEEAMRHDTNAEAVFRLA
                     DAPFVVTVRAHRVYCARADPSRHPRTHPTAPSSDHFSTKPQPAASPYTLSLVLEDAYV
                     MQVRSALSNTGAAPTSSAPTTAHWATALLCGYDPQQSPENDGEAGHSATQQGVNATIA
                     RAPHTFPDVVSVVRESCHRFQRSHERFRALYARCVQACDPSSSPAASATPKAVEVVAG
                     GASSATAQQVPTTAAALVPEAAVKTQTLSPAVASQNLRLLSQAEAVYGALSDSVSVHF
                     GKLRGAARVPVPDVRTAADVAQLEECHNVEFKARVGRVTNGSSAGADSHQQRHPVLMD
                     AERLRNTMAAMAACRGGVILLGVADDGRILGHAKQLGVARQLRTSGFCPAMVKDTVQV
                     KELRWLSASGGLAGASKAVAGESGGNGASVPVKPAMPENWWKSGATPPAPGLPKASAT
                     AKAGASAGDQVITVVSVQKGQAPFYATSKNAPPYQRGCASTTMMPTMVLARRIMKELA
                     "
     gene            <532155..>532802
                     /locus_tag="LDBPK_271350"
                     /db_xref="GeneID:13386722"
     mRNA            <532155..>532802
                     /locus_tag="LDBPK_271350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861940.1"
                     /db_xref="GeneID:13386722"
     CDS             532155..532802
                     /locus_tag="LDBPK_271350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861988.1"
                     /db_xref="GeneID:13386722"
                     /db_xref="GOA:E9BJ67"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:E9BJ67"
                     /translation="MGLTDLFRRETPQERIRMYKRQLDRTCRDLDRERNKLSTQERKI
                     MMEMKKMAKQDQVDAVRIMARDLVRTRKYNQKMYRMRTQIQGVSLRMQTMQSSAQMAD
                     AMKGVTKAMRSMNKKMNIPEVQKIMREFEKQNEMMGMKEDMMNDAVDEVMDDDGMEEE
                     ETEQEIQKVMDEAGLEFRTKVGVTDTALPQKSTETQGETDEELDARLAALKASMK"
     gap             534369..534398
                     /estimated_length=30
     gene            <535721..>538279
                     /locus_tag="LDBPK_271360"
                     /db_xref="GeneID:13386723"
     mRNA            <535721..>538279
                     /locus_tag="LDBPK_271360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861941.1"
                     /db_xref="GeneID:13386723"
     CDS             535721..538279
                     /locus_tag="LDBPK_271360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861989.1"
                     /db_xref="GeneID:13386723"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BJ68"
                     /translation="MSSSSVLDLHKKWFMVPLPLRTCSLRDVATFTVTKEQMDKYYQE
                     AQSILDDEGKAAQMDRGRWYSSQFMSRGTTSDKIATAAVKLADTDFMFYLDGFTLLFD
                     TARTDTHHYEAALKALTAVWPRLLPPRPLKRFVSQYFATLPTDDVARKTTLVYWYLED
                     YLKRTYAQFLALSESMLKDRIVQRRDTWLDAVGKLLCSVAEGRSTAMAMMIDKLGDPV
                     SSVAHKAYHHLLKLLSESSTHQSMLFTELEKVIFMKNCPLRTMRYAANVMNQLVFSKE
                     ERKLALKCVQTYLSLFRQLALTGNVDSTVTTAIIVGLRRAFPYAGVDLAPLEEHLNAL
                     FILANTGNFQQRVATLTLLQLLAFNKGTAESFLNRWYRTLYGLLLLSPKQIPQSAQLT
                     NFFSLLHKAMRADKSKARIAAFVHRLLQRAVFFNDAMICAVLLLVGEMSQAHPHVRKM
                     LKAHANPLAAPAALAQKGKAGNGTGTASAASSGCNYDPKAREPLFANAAGECIWTLNM
                     LSRHSHPSVVKLSILLLFGEDIVFDVHPLDDMTPLNFLNMFVDARANSKDDDDAKAGN
                     TATGISVFHRAAHKASLPSTSDPYFINASAQDVDVAALFLHRYAVQRQRFLEGLSQVR
                     STWGDTSGEADVAMRVTNLDAALFGPSGTLADPVGTANAAAASRGTKKATAAPKRAAA
                     KDKDEEVSDEGERDGQGSTDGLAGDGDDASGDDLDDFDAEASDNGLEWGLDDEAACDA
                     ELDDEEVEEDDDEDAEDALGGSAAAAAAMADEGAKFGELIEANAKEMSKKRKRELDWL
                     EGRSAGGSGGRSGFGRGRGGAGRTRGASPYGRGRLRGRVSSRVQGGGGFKRGRY"
     gene            <539921..>540925
                     /locus_tag="LDBPK_271370"
                     /db_xref="GeneID:13386724"
     mRNA            <539921..>540925
                     /locus_tag="LDBPK_271370"
                     /product="proteasome regulatory non-ATP-ase subunit 3,
                     putative"
                     /transcript_id="XM_003861942.1"
                     /db_xref="GeneID:13386724"
     CDS             539921..540925
                     /locus_tag="LDBPK_271370"
                     /codon_start=1
                     /product="proteasome regulatory non-ATP-ase subunit 3,
                     putative"
                     /protein_id="XP_003861990.1"
                     /db_xref="GeneID:13386724"
                     /db_xref="GOA:E9BJ69"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:E9BJ69"
                     /translation="MPLAAAKTPINATAATKRAEAEQLTRLMTLYRAVCVRHDELGME
                     IVLNDILAFLTSTHQHEQAEAFIATCNITLPHRANNQAARYFYYVGLTRALRLEYVDA
                     HQCLQQALRKAPERAFGFRIAATKLSLVVQLLLGEIPPRSDFLAKDMRDSLAPYLQLA
                     SCVRFGQVDRFMTVLREHQVAFEHDRTHSLILRVHQHVIKTGLRRICQAYSRISISDV
                     CSKLAMSNVADAEYILSKAIHDGVIDAVLDNEKGELISSDSIDVYSTSEPLHALQRRI
                     QFLNLTHNDAKRAMRYDVTDPEIIEERRKEAKAERDELERAIQDESTGMDNVNFEDGL
                     "
     gene            <542294..>546337
                     /locus_tag="LDBPK_271380"
                     /db_xref="GeneID:13386725"
     mRNA            <542294..>546337
                     /locus_tag="LDBPK_271380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861943.1"
                     /db_xref="GeneID:13386725"
     CDS             542294..546337
                     /locus_tag="LDBPK_271380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861991.1"
                     /db_xref="GeneID:13386725"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BJ70"
                     /translation="MSAGTTSSEAKTATDDSQQRTPSIYTSEVVRKMSRHGSALPLCM
                     SRAQHEARRQSASVHSASKRRHRRSSGFFPSSNIPPLMAMPGGNGWGALISCAEANTE
                     VWRAIQMCSFYPSMRVSGTAFENSLNLAHRQNTHVASGSFCLPSHGRLGGVDITGGIV
                     PVLQDDGLRQRTMSISVVPDSSATLREALEESRSVLELSQGSIRVASAGGAGTYGSGR
                     NSLSTAADAAARTLSFTGGSSMVQMACAMKRAAMWEVLVVTALSHRAMEVRFRRQRLR
                     RVLERHLLPTLLKRKRETGSVVPNSARLKRSASTGSGDATSRGGLLDDAGAVPQGTYL
                     RDHDAFFDSLHNATLLQSFAETMTRERFLPGDIIARAGDSSQKAMYFLISGKCEVCTE
                     RGEKDGDDPKRADGATAADGNVRHHQRKIGGGAASRPIKEVIMAGTSFGGVFGGSALF
                     AGTYRALSQCIVWVLRAEEFEEIFRSFADRTMLDKYKEALRQHSLWWLQQWYHPAKCY
                     GSIPIYRKLTKRMSSYLSDFTPVVKVRGETIFSHGDVAGDVYCMLEGTVLRRTKGAAG
                     TYGDDGVAQRLGTNSFTALNVMGRYLMLGEEPHLVPGVQPYTCTVSSRVALFFKVSGE
                     RFVNALLDDPLLYAQLRGQLMRQRQENMRLHLECLAYVPLLQRFPAEKREELVQHARP
                     RVIGRSVSLCDPAQHISDLLIIVSGNVRDPRHYNQKATKPLEVPASCEVENPDGTPGE
                     DSGANSRVRSGKADRRHGAQGPKSGHAMDRDTVPASGTAIVDTNATARLGSQSRSCEG
                     GAMRWSAQNPLSDVPADREAAAEEDVVEWNFSFRDAPHSSAFSASATPSNNVANVKAG
                     GVFSTGSAPVISAQQQYLLMLDSAPLVYPDESEDINPALPVQPARRFVATLGGSWEAL
                     LLDKWPNGWESVTTVEMWAIPTRMLRLVYNSCTKPVQLSILNGLRHAQKEALQLPTLP
                     HTKLPPMSIYTHHGEAVMAAAATAAKGSGAPRTKGTSRCGGDRKAAQPAPSGLTSGIS
                     GEETGVMEVGTQHSALTRSTGPTKSATQAVAVTAVIKEGNGKARQLVSVSARQTTRRT
                     TLPLSKQKIAQTSRTGADAPQDTSSRGDETQASASARQTQDGRTRSLRRLREAATALG
                     AGKVMPAEPTVDPALLACYDGVVGAADPLMLRIVRDPVAVVPPPRGTRSAKPAPASMR
                     SAQRLPLIASSSETASAAAWPTLPVLRDRWFHAVPSYEPLPGTAHGAQTLASPPVFAP
                     NSTALASTCISPIPQHGKKLEGYVAYYAATVSPARPASRTSIGGTSVTGAAVAVPAPA
                     VTLTRSPSPTELGMNNIHLPKRRAYAV"
     gene            <548836..>550929
                     /locus_tag="LDBPK_271390"
                     /db_xref="GeneID:13386726"
     mRNA            <548836..>550929
                     /locus_tag="LDBPK_271390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861944.1"
                     /db_xref="GeneID:13386726"
     CDS             548836..550929
                     /locus_tag="LDBPK_271390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861992.1"
                     /db_xref="GeneID:13386726"
                     /db_xref="UniProtKB/TrEMBL:E9BJ71"
                     /translation="MPDVNWALEENGAHIAEVSHEAVHVASIASNLLKPREDQLWITG
                     DAPQYVTVSLSPSHPPLQYAGWHVWHDYLTNPHMVEIASGASPDTMSALLVCQALPGA
                     GTQVWKLPRAIPQDHQYVRFRIMSTFGPGPTYMNNIVLLENDPGPGYNAYGQHVEDSA
                     TTADDILRGESAARHPSAAAASPYMSPPTSVLRPPAFGGGMDRSPLPRRAPPTSALPG
                     ASPISTANPRDDRSADVGVFIAPGPSASAHRGERADGGAGGRSPGGARSSSRMSQLLR
                     DLDDDIKMLKPIKIVSPRKKMLLCVPQDSHAKSADSRSEDDYFEARQGGGHREGSANG
                     KAHHSGENDSSEHRRHHRHHRRSSSRRRNFSGREERSDNSRSAQLEGSHAPHSVPMGA
                     KQMALAVWPPPAVPPSAVELSSLHGERLSALEQAVAVLHATVQHQRDDLSMIKRVLLQ
                     QATERRKEAAQRCEEKQKMGTVAVALPAALAAPPGAPSSAVAADAKAPVLQIAAPDQR
                     LTHRSITVGFPEDALRTYVESVLDHKLRKQMKKVEAKLLQRLDKQLHDVIKVLSVTIE
                     GRLAGLASSSATAQQQAAPSHRPFYAGRSTPTQAGGLPTASSSAVRDIPRSSVMGGGP
                     GIDLGDAASSPSSSKGYYYHTPLTRTGSSARGPAGGSATAAFPVSYVAMRNSPNAYRA
                     TTGAPPVSITKGRFF"
     gene            <552701..>553174
                     /locus_tag="LDBPK_271400"
                     /db_xref="GeneID:13386727"
     mRNA            <552701..>553174
                     /locus_tag="LDBPK_271400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861945.1"
                     /db_xref="GeneID:13386727"
     CDS             552701..553174
                     /locus_tag="LDBPK_271400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861993.1"
                     /db_xref="GeneID:13386727"
                     /db_xref="UniProtKB/TrEMBL:E9BJ72"
                     /translation="MQARRNSMMRRVARRYARVPGEHGDASVPAFFPIAINPGWWGQP
                     FGKVKDGTSQLLFFFGIIFPVAFYWLFDVTFGQRTRIAQVGKRAMASNFLFRQLDLDD
                     PDHAIKYEQLQQEMAENKLDVRWGGTNFLASYLWQPGDPEPDIRRKEAPAHHHHH"
     gene            <554573..>555985
                     /locus_tag="LDBPK_271410"
                     /db_xref="GeneID:13386728"
     mRNA            <554573..>555985
                     /locus_tag="LDBPK_271410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861946.1"
                     /db_xref="GeneID:13386728"
     CDS             554573..555985
                     /locus_tag="LDBPK_271410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861994.1"
                     /db_xref="GeneID:13386728"
                     /db_xref="UniProtKB/TrEMBL:E9BJ73"
                     /translation="MLVECIEGMPVCVALVYWSMSFVVLLLRLFCAEFADLSSYGGRS
                     AAAAVSPGVCKAERDREGEYSAAVAATTLTRWCATPVHWLASSFLGRWRVTRKQSFTA
                     FYVTGLVTSTALFGIRWIANCSNAASGHPSLVARSPPAPAHPLLCVPQVLFTLHCAVR
                     LTETRLVQRFREHDTVTLFAAVAGSTFYVMAAISSAVPSHTIVPRASQWLHRLLVMRC
                     VFGAGTVAHLSLQAIQVTAHTILARLRQRPSHTVSSTKKTHMRGWEEGLWRRVQAHLA
                     TSSAAQGESPNRLSTPPELYGAWRRYRYPYFSNVCFQVVLDPHYTCEVAMYAVNTILL
                     LLCVLPDATEPATDIAAGAARGMGSRFKSGEPQWCRMACASVPWLSLLASVGVTVFTA
                     ANLGITSAEHRRFWMAANATRRLVGSALRKILDEEQAKPLSNGGGRLPAEIVDAAEYM
                     LREAVVEEVVPKWNVFPLVW"
     gene            <556646..>558877
                     /locus_tag="LDBPK_271420"
                     /db_xref="GeneID:13386729"
     mRNA            <556646..>558877
                     /locus_tag="LDBPK_271420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861947.1"
                     /db_xref="GeneID:13386729"
     CDS             556646..558877
                     /locus_tag="LDBPK_271420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861995.1"
                     /db_xref="GeneID:13386729"
                     /db_xref="UniProtKB/TrEMBL:E9BJ74"
                     /translation="MPPVGSGYTFADFLQRLERSPASQMSPLYHEHRLLFVNRPDMLS
                     RAVLSVSWERGLAILQAAYYTQPVAAETYRALLARMLRHNRHVSKTGAGQLVSWQAAM
                     KVMSEAVLAHGTSLPTRVSVSTLRLLAPHRQWRTAIDVLKLNQANGQLTKPMLLDAAH
                     ACATSAAWPHALQLLMHLHQQDPPLLFDAIQSMRPPGTTALTAAASAHALLPSVHDGG
                     APTPAQQHILSVLNSVVGSVPHEVAARSPLCTSYLTHLLASTTLTPELKVQRATAAMA
                     QLPWTAALALLSDLSEPALLTDVEWTRVRDAVLLHSNSGTGKGDGGSGAGEERQRRRP
                     LSAKRRSKRKRDASSAVTLPDAAEPEKDEEAAEGAVPSSSTSLNASISPLAPSVTTAA
                     AAHSQDTAVLSTAVLFSRMQLLRASPLTAAAMIAVMVDKLPTPEMAAAFLQSCAAHLA
                     QPVPAPSSAADALDTALQGGGLTVGSVAATRHPVVVHALLRNCSRHENGWAIAAPALL
                     RHSAAQATTPPELLSSLVRQLRQAKQVALAVRLLHEHIIPSGSLLTPTSWEDILECAL
                     AHNRAIRLRHLHRKTANSHDGSVATKAALRLSSVHWVSALSWVKTRQATSSEDRICKT
                     GTGPSQGATQRHPLEVVALERPLSHKMLSLLINVCVLGGSPQGALHVLGYARRVNKTE
                     LPHTSQIRALLYCMQYDRPCEAEAIVEQCAKREGEAAAQPLRHLLRLIREGKSDDDEG
                     DEE"
     gene            <560622..>560948
                     /locus_tag="LDBPK_271430"
                     /db_xref="GeneID:13386730"
     mRNA            <560622..>560948
                     /locus_tag="LDBPK_271430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861948.1"
                     /db_xref="GeneID:13386730"
     CDS             560622..560948
                     /locus_tag="LDBPK_271430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003861996.1"
                     /db_xref="GeneID:13386730"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:E9BJ75"
                     /translation="MSATPKQPSTATTSISSGEKWDHSLETLIRKSTIGFASGILPGL
                     LLARSPAARSAIIALCTGVGSGIAYGEARYLFDHDIMFDKRHLIQVQVVGGSSSQQNG
                     DQKPIE"
     gene            <561566..>562879
                     /locus_tag="LDBPK_271440"
                     /db_xref="GeneID:13386731"
     mRNA            <561566..>562879
                     /locus_tag="LDBPK_271440"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861949.1"
                     /db_xref="GeneID:13386731"
     CDS             561566..562879
                     /locus_tag="LDBPK_271440"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003861997.1"
                     /db_xref="GeneID:13386731"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR027365"
                     /db_xref="UniProtKB/TrEMBL:E9BJ76"
                     /translation="MLANTRTPPFPVCLPTQTQTSKAYTTTARSDHRRIGRLCESNAS
                     LRGSSPAARTLPSPLSLKCDVNADGPCECARNSSVASRHDKGSVCCAWRGGGGGVWSR
                     CSAPCQVRRTHATGAFTKQRAHFHHPRHVFFYLGRRCVYAFRFLFGSDLFSCANSVCR
                     AHALTCRYSAAFTPVCYAYHQGDMPARKQESEAVKALFHYPCHSFIVRSALEGHMGQV
                     TVRGSSAAATLRARITVGVFTVLAGAPDAELVSGITTSLVVPVQPEWIPLIEAHSPAL
                     KPYIRYPMVTATGSFDVRRLQQYAAACPAAYVIEPITEALAERTRKMKWSFDLCGNFR
                     DAADFAARGIGFVALERATGNIAAGASSFAICDGGVEVEVDTAESHQRRGLALACSAR
                     LILECLKRGLYPNWDAHVPHSAHLAEKLGYTRGTPYKAYVEELPT"
     gene            <563863..>564267
                     /locus_tag="LDBPK_271450"
                     /db_xref="GeneID:13386732"
     mRNA            <563863..>564267
                     /locus_tag="LDBPK_271450"
                     /product="DNA-directed RNA polymerase II-like protein"
                     /transcript_id="XM_003861950.1"
                     /db_xref="GeneID:13386732"
     CDS             563863..564267
                     /locus_tag="LDBPK_271450"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II-like protein"
                     /protein_id="XP_003861998.1"
                     /db_xref="GeneID:13386732"
                     /db_xref="GOA:E9BJ77"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:E9BJ77"
                     /translation="MAVPHGMLISRNDITPDSLVDLPGDRKIVEQISNTMANSSLFKM
                     EKEDHTLANLLRMKLHESPFVQIAGYRVPHPTKHNVELRVQTASNGTDAPVPAPKKAL
                     QDAIDGCLKDLEVFEEQLRREAQLKGLEASPS"
     gene            <567097..>571770
                     /locus_tag="LDBPK_271460"
                     /old_locus_tag="LDBPK_271480"
                     /db_xref="GeneID:13386733"
     mRNA            <567097..>571770
                     /locus_tag="LDBPK_271460"
                     /old_locus_tag="LDBPK_271480"
                     /product="diacylglycerol acyltransferase, putative"
                     /transcript_id="XM_024473472.1"
                     /db_xref="GeneID:13386733"
     mRNA            <567097..>571770
                     /locus_tag="LDBPK_271460"
                     /old_locus_tag="LDBPK_271480"
                     /product="diacylglycerol acyltransferase, putative"
                     /transcript_id="XM_003861951.1"
                     /db_xref="GeneID:13386733"
     CDS             567097..571770
                     /locus_tag="LDBPK_271460"
                     /old_locus_tag="LDBPK_271480"
                     /codon_start=1
                     /product="diacylglycerol acyltransferase, putative"
                     /protein_id="XP_024329243.1"
                     /db_xref="GeneID:13386733"
                     /db_xref="GOA:E9BJ78"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:E9BJ78"
                     /translation="MLASQAQLSRSHGPASISRPHSDVGLDGEPAAPFEVPHFSTVSL
                     LIVWMLDCAVGLFSLVLSDVYVNQYPEFPLMFFLALGSHLNVLAGFFVYLLGREKYGH
                     KVYRFYQPFAGGVQFVTLQCFGVTCVSSSLLLTAAYALLFEPSVNHSHGFMSTIGVLA
                     LFGNILLLLSLRSFTFHDCAKASEPGSTTASSGTGSAFLADKGLSAFLRYLRRRPNAE
                     SALEVALLTAQSAFSMVAIRFPRLQEVIFRVNLAITLACGTLSLCFVGYRRSLGFISF
                     RLRMHRTFDTVLLWLSRFLYVAAAFANVLLLMDAGVHTVTPLSVLAVQGLSVVSCVAL
                     LMFLRTMRYEALANTPNVPSSVFELGGVVAVATAFLLACLNVSIFFYVQNYPDGLDEA
                     VEGTSWTYQGVLVLVSQLAQLVSLLPTPMVYVSGVIMHDDHFRMLARNRSVETLPVLL
                     LQALSYLLYVAAIISFTLFLSSSAPAIAPLEAVLSTLSVFCMTCAVRLCSSLTYKLRA
                     FLAAVVEEPPSEPTTVGKKPATKAVVSLDSVLPVHTEPSPGLRSRMAEELANTAYIMN
                     GEMIFSYLLCLTNLLLRLLVDISLHHVWGEVELPHARLIMIANACFIACVPLAHYSGR
                     DKGVQVFHPFTGSGSFVALQVLGWMIYAICVIIIILGTIVSSNSNSVPAEWHALIAEG
                     PVMYTLFGVLELIPVVLITLSIAIEARYTMATALQQRLAKESFLELRRFMREELADKS
                     DEEKAVAQVAFRTLMTAALHSFDIPCTDGLLRIYKDPAAARRTGRGSRAQNSCSTGSD
                     DDDGSAEENESRESSDWSCSGEDLTIRRRRQEGARVLVFLLCCASAAFFVIAAFMAKV
                     MVLSLAFAVTAMLICTISCIGLHAGYGMVLHGEPSVYVPFMPFRGGSQFVVRQMAGWC
                     CYAGAFLVTLITSIESAEVSATAMLIAALLSVTSQVFIFSSVPLFSHRRGQPTFLEVN
                     GEGIVALFTFSGAMAFGRVYTPLVAFFGRDTQHYLHYGDESSASRRTRVPFVLAVMSL
                     SLAVPCTLIALSRTKLQWERVMHTGTAAEAVSKQSPSSTRRERHRTMLAKGISNLIEV
                     LAIVLATFAPLSIGFLIFYFFTQYTPRLVQVMEAYLPVCFVLTALTLVLSVVPYVVDV
                     GVPLFVVTVRVTVVTWMLYCMPLLAGGLLLLPALIAPRHSTLFLACGAFVMLMAGNFK
                     KVRLAMKLAVYAVIGYLTYQRCMLHAVGGPSWGMARALGVHVVDCAVLGAWLWYLPLY
                     SGKPYHTGSQRSLRFTEFARNYLFADAVKYFNFRVIVDDPAVQMRDDTSQYLFSFHPH
                     GVFPGTALFASLTAEWALKVGVNAQRYVSTHVASVVFNAPLLRDFNLRLGALSVSRRS
                     VEASLKRGNSVLIVTGGQAEMLRTQVSSERMILITQHTGFIRLAIASRVPLVPLLCFA
                     ENNVLGMLQFPRIQRLSLKLLGFPFPVIPLGRFGLPLPFRTPLTLVVGPPLAIPEGAD
                     ENNPDDMRRVSEAYFQSLKDLFYRRRAEAGYPGMELVLLNEKEEARKRRQAREAAAST
                     AKKAA"
     CDS             567097..571770
                     /locus_tag="LDBPK_271460"
                     /old_locus_tag="LDBPK_271480"
                     /codon_start=1
                     /product="diacylglycerol acyltransferase, putative"
                     /protein_id="XP_003861999.1"
                     /db_xref="GeneID:13386733"
                     /db_xref="GOA:E9BJ78"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:E9BJ78"
                     /translation="MLASQAQLSRSHGPASISRPHSDVGLDGEPAAPFEVPHFSTVSL
                     LIVWMLDCAVGLFSLVLSDVYVNQYPEFPLMFFLALGSHLNVLAGFFVYLLGREKYGH
                     KVYRFYQPFAGGVQFVTLQCFGVTCVSSSLLLTAAYALLFEPSVNHSHGFMSTIGVLA
                     LFGNILLLLSLRSFTFHDCAKASEPGSTTASSGTGSAFLADKGLSAFLRYLRRRPNAE
                     SALEVALLTAQSAFSMVAIRFPRLQEVIFRVNLAITLACGTLSLCFVGYRRSLGFISF
                     RLRMHRTFDTVLLWLSRFLYVAAAFANVLLLMDAGVHTVTPLSVLAVQGLSVVSCVAL
                     LMFLRTMRYEALANTPNVPSSVFELGGVVAVATAFLLACLNVSIFFYVQNYPDGLDEA
                     VEGTSWTYQGVLVLVSQLAQLVSLLPTPMVYVSGVIMHDDHFRMLARNRSVETLPVLL
                     LQALSYLLYVAAIISFTLFLSSSAPAIAPLEAVLSTLSVFCMTCAVRLCSSLTYKLRA
                     FLAAVVEEPPSEPTTVGKKPATKAVVSLDSVLPVHTEPSPGLRSRMAEELANTAYIMN
                     GEMIFSYLLCLTNLLLRLLVDISLHHVWGEVELPHARLIMIANACFIACVPLAHYSGR
                     DKGVQVFHPFTGSGSFVALQVLGWMIYAICVIIIILGTIVSSNSNSVPAEWHALIAEG
                     PVMYTLFGVLELIPVVLITLSIAIEARYTMATALQQRLAKESFLELRRFMREELADKS
                     DEEKAVAQVAFRTLMTAALHSFDIPCTDGLLRIYKDPAAARRTGRGSRAQNSCSTGSD
                     DDDGSAEENESRESSDWSCSGEDLTIRRRRQEGARVLVFLLCCASAAFFVIAAFMAKV
                     MVLSLAFAVTAMLICTISCIGLHAGYGMVLHGEPSVYVPFMPFRGGSQFVVRQMAGWC
                     CYAGAFLVTLITSIESAEVSATAMLIAALLSVTSQVFIFSSVPLFSHRRGQPTFLEVN
                     GEGIVALFTFSGAMAFGRVYTPLVAFFGRDTQHYLHYGDESSASRRTRVPFVLAVMSL
                     SLAVPCTLIALSRTKLQWERVMHTGTAAEAVSKQSPSSTRRERHRTMLAKGISNLIEV
                     LAIVLATFAPLSIGFLIFYFFTQYTPRLVQVMEAYLPVCFVLTALTLVLSVVPYVVDV
                     GVPLFVVTVRVTVVTWMLYCMPLLAGGLLLLPALIAPRHSTLFLACGAFVMLMAGNFK
                     KVRLAMKLAVYAVIGYLTYQRCMLHAVGGPSWGMARALGVHVVDCAVLGAWLWYLPLY
                     SGKPYHTGSQRSLRFTEFARNYLFADAVKYFNFRVIVDDPAVQMRDDTSQYLFSFHPH
                     GVFPGTALFASLTAEWALKVGVNAQRYVSTHVASVVFNAPLLRDFNLRLGALSVSRRS
                     VEASLKRGNSVLIVTGGQAEMLRTQVSSERMILITQHTGFIRLAIASRVPLVPLLCFA
                     ENNVLGMLQFPRIQRLSLKLLGFPFPVIPLGRFGLPLPFRTPLTLVVGPPLAIPEGAD
                     ENNPDDMRRVSEAYFQSLKDLFYRRRAEAGYPGMELVLLNEKEEARKRRQAREAAAST
                     AKKAA"
     gene            <573031..>574332
                     /locus_tag="LDBPK_271490"
                     /db_xref="GeneID:13386735"
     mRNA            <573031..>574332
                     /locus_tag="LDBPK_271490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861953.1"
                     /db_xref="GeneID:13386735"
     CDS             573031..574332
                     /locus_tag="LDBPK_271490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862001.1"
                     /db_xref="GeneID:13386735"
                     /db_xref="UniProtKB/TrEMBL:E9BJ80"
                     /translation="MLRRVPLRLARRKHGQTAWSPNNTSSGAAPTNGITAQEALQIAY
                     RPMPPANTVEYEEDFGPNMMIHREFVSSRHRTRMASDISALAYSDVELARARQQLAGV
                     MNRERRGALVGSGGEAGDRVLFNSDVDETTREVKSARFLFNEQRMRFCDRFQTFFRER
                     IERRAAGGAGEDDHPYFSLMEACAVLHGCDTVDAREVYYRRFLGLDLDTLEAEEAAVR
                     ARATDAAEVGARLTRGEAGAGGGALAAAAAGGAGGAGSATDVVQDIIDALPPLFPRPA
                     AAEVGEAGEAVADAPPAHAWAVGAGELPPATAAAPAHLAEDAAPLYKAYLAHARGESP
                     VGSYDVTTLGAHAAHAERRRWRSLMDKIAAEDYHELTAAELEDAHVLNGQLHTVKFFD
                     LKVGDTVREIVQLLERETGSSASGDRDVPVEMSPTHPERRV"
     gene            <575062..>576507
                     /locus_tag="LDBPK_271500"
                     /db_xref="GeneID:13386736"
     mRNA            <575062..>576507
                     /locus_tag="LDBPK_271500"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_003861954.1"
                     /db_xref="GeneID:13386736"
     CDS             575062..576507
                     /locus_tag="LDBPK_271500"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_003862002.1"
                     /db_xref="GeneID:13386736"
                     /db_xref="GOA:E9BJ81"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BJ81"
                     /translation="MTQSTHCPDTQMDRVSEGGASFSDDAVMVNNVGEAQLKDMVDRP
                     IMLDTDELVYATRYRPRSWLTTLLSKAVPHGGTLSNAYNLGAVTLGSGVIALPSTFQA
                     TGVATSVIVLIAITMSTVYSVYIMMQAADKTGRRLYSYEALARGLLGRGWDYLAAFHL
                     WMFCFGSCVSYVISTGDLLSRATDDPSVNSFVRSVWGNRVLVIIIWSCVMLPLSIPKE
                     INSLRYFSVVGVSCMMNFVAVIVIHSAMNGFKNGRPIHQPHMFKTGNNAIVGFSSILF
                     AFLAQTNVFEVARETPNPTPGRISKDLAISQVVCCALYVLAGVFGYLEFGEQITDSIL
                     LYYNVRSDVLVAIAYVGIGVKMCVGFAICMQPSRDAVYYCLGWHFSMFKDIRTVPFWL
                     NAVICTGLSVFALVLGLFIPNVNVVFGLVGSFCGGFLGFIYPALYVMYAGNWGLRQVG
                     WLHYVSTYLLLIAGVVAVVFGTVASIYGEVH"
     gene            <582304..>582960
                     /locus_tag="LDBPK_271510"
                     /db_xref="GeneID:13386737"
     mRNA            <582304..>582960
                     /locus_tag="LDBPK_271510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861955.1"
                     /db_xref="GeneID:13386737"
     CDS             582304..582960
                     /locus_tag="LDBPK_271510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862003.1"
                     /db_xref="GeneID:13386737"
                     /db_xref="UniProtKB/TrEMBL:E9BJ82"
                     /translation="MAASACSSAVHLDNFRLLAAGNDTASAAQSSAPLTAPLSFSLTF
                     HFQRYDGADFESLITSLGVSVDFVADVASEKTTLILLPLTPVSGSWARPDSTTANGAF
                     LMAASASDSATSSSDHEAGAPLDGAAGAVPGVMYQLRVHLSDFRALEEVPLKHLLQVS
                     MMRVRLAHLGTGDGVANSDLSDPRTEECSVAAWNVIWRVRRNPQNEQELIRTVLDPLA
                     "
     gene            <585139..>585312
                     /locus_tag="LDBPK_271511"
                     /db_xref="GeneID:13386738"
     mRNA            <585139..>585312
                     /locus_tag="LDBPK_271511"
                     /product="ghistone H1 like"
                     /transcript_id="XM_003861956.1"
                     /db_xref="GeneID:13386738"
     CDS             585139..585312
                     /locus_tag="LDBPK_271511"
                     /codon_start=1
                     /product="ghistone H1 like"
                     /protein_id="XP_003862004.1"
                     /db_xref="GeneID:13386738"
                     /db_xref="UniProtKB/TrEMBL:E9BJ83"
                     /translation="MAASPHAAMKKAAKKAGSKKAMPKASAPKKSKKAAPKKKSKSSS
                     STKRGTKRAAAKK"
     gene            <591692..>592333
                     /locus_tag="LDBPK_271520"
                     /db_xref="GeneID:13386739"
     mRNA            <591692..>592333
                     /locus_tag="LDBPK_271520"
                     /product="eukaryotic translation initiation factor eIF-4E,
                     putative"
                     /transcript_id="XM_003861957.1"
                     /db_xref="GeneID:13386739"
     CDS             591692..592333
                     /locus_tag="LDBPK_271520"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-4E,
                     putative"
                     /protein_id="XP_003862005.1"
                     /db_xref="GeneID:13386739"
                     /db_xref="GOA:E9BJ84"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:E9BJ84"
                     /translation="MSAPSSVPPHKMANLHKLQRAWTLWYDSPSTYNTENWEMSLVPI
                     MTVHSVEEFFVMLRYMKPLHALRTSSQYHFFQEGVKPMWEDPANKKGGKLWVNLDITS
                     ANGRSSNNTSGTAAADGSAAEAKTDLDKAWENVLMATVGEYLDCVEKKDTSAEPFVTG
                     IVMSKRKYHNRLAVWVSDASATGKIEALKKALTKEASLAPIASIVFTKHGEAS"
     gap             594446..600263
                     /estimated_length=5818
     gap             602010..602108
                     /estimated_length=99
     gene            <602892..>605417
                     /locus_tag="LDBPK_271530"
                     /db_xref="GeneID:13386740"
     mRNA            <602892..>605417
                     /locus_tag="LDBPK_271530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861958.1"
                     /db_xref="GeneID:13386740"
     CDS             602892..605417
                     /locus_tag="LDBPK_271530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862006.1"
                     /db_xref="GeneID:13386740"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BJ85"
                     /translation="MSATAVPKVLTPHPAKLASDVFVAAAATAATKAASAASGSAAAA
                     SAAPIELVTKELLQLAEELRVVVPQGTWMSQGSEEEIRKRTDKDAVGAPAIPSRLPIT
                     VHFEVARHAILRHRTSAHKNYVTKEASEDSRDLRSVDNPLYEVMRDEVDTGVQAVPRR
                     TVASTQTHHARRVNAVAQAEPTAVDACIRHVPPPKEEQPNLRAFMEKVLPRTLLCLTQ
                     NYQIPIYTDDFRNFTEDDAVIATHDELVLIEKANYVHSSTKGRKVSGVSWRSGRKRDH
                     FVCVATIGLQTLPERLQANRRCESSVSLVWDLSDPMHPRYLLEAPEEVQVLHFHPSEP
                     NLVAGGSLNGQVFLWDLSKADVASFFSSAKQHKQKQKSNTAAAAAVDGGGGETGEFRD
                     VGEVPRMPDSLKGVSLEVDGDVQVPCLQPFQQSRVEVSHQGPVHDLQWLPDRLEFGFD
                     GKQTVVNETHQFATISEDGTMLVWDTRPQYLPQDKLRKIKHQSRSGGGEQPWVPLLRY
                     QLTKPDGTGEMPGFRFFLSGCTVDAAPSYAAAVASADGELGFCSMITQHERRSSIVVP
                     TFGYTKDTRFVRSVAPVAHAGPVYSVQQHPTIGDVYLTCGDGCFKVWRYGLLMPLYEC
                     PQRPGSVMCAAWSPARPGLIIIGTGNGMVEVWDLLDRNPEPMLTHHLVQDAITSIAFQ
                     PLPHRVTRRYSQQLLLGTNLGSFHWYILPPALSRASSGERKYMRAMLERETRRVAYYD
                     WRWSERQSEIDRFGLQGAAARLRGTIAQTASSSGVAGVPGKEKSESDDPLLVERRPDK
                     EAADLRDLDNPYAQDPQRDEEFLEMVEKLHQKELEHMELESAA"
     gene            <607146..>609893
                     /locus_tag="LDBPK_271540"
                     /db_xref="GeneID:13386741"
     mRNA            <607146..>609893
                     /locus_tag="LDBPK_271540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861959.1"
                     /db_xref="GeneID:13386741"
     CDS             607146..609893
                     /locus_tag="LDBPK_271540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862007.1"
                     /db_xref="GeneID:13386741"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="UniProtKB/TrEMBL:E9BJ86"
                     /translation="MSGSEALNHTPDRFIFLPFRLGEKDVPDWSLCSRYIATYHSSNN
                     TTSVDDAIKSMAAYHNTIVKTCTLHESKRTPNESFIKHTLLRYCRLVGQAQAHLPLHS
                     GHVSKNLKFVWCDSFDESTKYESTNSNSELVSCVYNLAASYVYVAATQAHTGSMDEVK
                     EAYKHFQNAAGYYEMVTSMLDRLPPDQLTKGDMKRDSLAMLTRLCLAQAHHCGYLKAE
                     ETMKGKHDMLSKIAAEAAKQYEDVLSSFKTSVWLTKRTANAKEVEAHLGADVCIFKAR
                     AHLHLGVKNAEEGEMGVAIAHYRKAKAHLMKLPRMTTQSLTVWVNSIVTSANTAEDKA
                     ERANTSVYFARIPKEVPEPEGLPRALGIATEHPSFVRFVSTRGEDPFFGIVPAHIAKT
                     VSTWREKQRNLVNVCTAAAAHARKSTQTKLQTLGVVAAIQAMSGEFEGRGRVPEPLRS
                     SILKLREENKSQSGATYSVTDILMSNVNTCSEMYQVADSKLKEVSAELEKDKMTDRRY
                     VEAYGEKMWRAVHPAADQTPDYCAISAAISEHEKGLQQWLVTPFNEAKKTLEENMRNI
                     ARLDWPIADLDALMPFVETKEARQQSGKVMELVAKLKELVEAKVRIESEQAAEEKVLH
                     DKLESDDVVFGISSVESTQRDTILEKASKDISDVIEKVNEKVRQERELVPKAEELMEQ
                     IGTLQSTDPISAEIQKVSNGLENACSIYQELMKDFASMVQYGSKAVDEIEATLRNAKS
                     YTMSRELQAQEVQSRLDEQIAAKMSQMQDAESQIAESRRRQEILQQQIASLEQQVTQQ
                     PAYQYPPAPLHQQLPQPPQQPYQPLYQPPPQQHEYHRMAPAPSAAYQYPPPVMQQPPL
                     QQEPPLPPSYDQLSSMASVPVAQPPPPPPQQTNAYQYPPPSLQQPVNSGCPSYKPPFT
                     L"
     gene            <612436..>616308
                     /locus_tag="LDBPK_271550"
                     /db_xref="GeneID:13386742"
     mRNA            <612436..>616308
                     /locus_tag="LDBPK_271550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861960.1"
                     /db_xref="GeneID:13386742"
     CDS             612436..616308
                     /locus_tag="LDBPK_271550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862008.1"
                     /db_xref="GeneID:13386742"
                     /db_xref="UniProtKB/TrEMBL:E9BJ87"
                     /translation="MSTTDPYSLSPQNSAVEATLFQLLFPVHVTPATRVAVGDVIAVK
                     TLSDNSPERIAGALAVSSPSVSERIRAWETVPHGRAARSFRRTERTEFHNPDDPTLLH
                     TVHAQQRHGASAAKGSRARHSGAVGPDRSTDASAGPNTVPFSMRLREVERRFQEQMKV
                     HRGLTAASRQVDVLERSVQLFQAERRTRAFAHALAERQDAIWARVWPGGSLPKTEDTV
                     ATVHRQTAASSRAAPMPAARRGDSSATPSTSSAISPPPPASPTGFLLKDILDTYSKPR
                     ELREASGSGRSAAAAAPAASKATKAPKGVPLALAREARRTAAGVEIIRPEKTPKPYTV
                     IRYVEARSKHASATHDAVDRQGTSASSAVTPATSAAVSAAYSKNVARGEVKGDSSQAF
                     SSVVSEVNEAGEVGGGKASDQSSASVADEAAPMNDTYDADTFDSHVSSGTAADASMSS
                     AKSSAVSSMIPTEEATPSSLAQSITSEEIESAAAGRPLRCNRRDGNKSSGVSVADDAR
                     AAPFAETLQTFLDACRCVSAASARLLQSPYIRESSHDAGQHRQNTPKPAKKDAPRSAQ
                     KAVEDAVSCVTADAATGADVSPPAWRDALHRQLRNIRRLQRFREHLLRHLKRIDVQRQ
                     THCKATRLLRETQALAKVRRKLLSGSRVGGEASLGSMLRHVKGVSTGTGGRRGPRRGG
                     GAHGHGAPRQQHSLPSWLRMSVVSDADTISEVVLTDMNSSVGDGIISADSSVVEEEMQ
                     YGSNQSETFVSGSIIQEEVASWDGASGHSDVASGGTVLTEVSRSHEGDGDPSYGSDSF
                     EAASNSDAAGRSAWIARSGMVAEVRLDEIEEELADRLAEISSDAISEGSSIPSEVEEL
                     VDLLPSSLIPSEIEDDDASPQGSSAATMDSYIATDMSSSAAVLQGQQRRMYVAANGST
                     AWYAAAGEGAAGGVSGALTDHKAYIRDSPGSSVYSVPEDADVDTSMPQSTDVRSEGAR
                     DSLPRTSGRVADLDAAASLAAANEKRIYGRPSPTPSAKGDGSSSSSEDALTMLEVDMT
                     LTKGRRHHALRCASDVPTFEQLYSPSMPPLDEGPLTGSGNASTTSSAGSGRSSKPDRR
                     KGGSAHSVGIGWSNTAVSSLHERGAAHLVHHPTARMEAGTQAEMRAVGSHPTAICGAS
                     RMRATYPTKDYVAQSAWKARQLHLLRQLRSPIVDDSEGTAKNSAEATDSPSRAFEQRH
                     RPPKDKADAVLDAAEAVALEEWAQHWGVVESLLQTRFSASSCIGTGEPPSSSRRTGKA
                     LLQRFPSDSTPPTWDASQSSVPGSSASR"
     gene            <617038..>620916
                     /locus_tag="LDBPK_271560"
                     /db_xref="GeneID:13386743"
     mRNA            <617038..>620916
                     /locus_tag="LDBPK_271560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861961.1"
                     /db_xref="GeneID:13386743"
     CDS             617038..620916
                     /locus_tag="LDBPK_271560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862009.1"
                     /db_xref="GeneID:13386743"
                     /db_xref="GOA:E9BJ88"
                     /db_xref="InterPro:IPR019393"
                     /db_xref="UniProtKB/TrEMBL:E9BJ88"
                     /translation="MVHRSRATADTSSDHEERVNFLDDDCGRNALQLAARGSTIVATL
                     QRLAAHIPAEFTAPSGTPYARLIFDFRYFKHQDQIEKSIADSAELLVLDKEFYDTHME
                     LLEKFMSLFRGIYGYVTELNRYVREIQDGQYVAQTLDTVLESLDGRQLLCELYHLYGV
                     MLLLMDHKIGGLVRERIIVSYVRYRGSGEAHTVEVAELCRATSQGAGGTAAIAGSPVK
                     RAPVSPRAAAGSGTGISNYPIDYFERVPVQKGVVARLLACIRSDDIYRMSSHYPNPDH
                     RSAAMALQGGIAFVLLFFCGDVLVQQLPVMKELVEKHFADNWVVHYYGGYTADLSVAW
                     AAFPAARAALQRTLESHSVTYHLQRMRGALARSTERVQAVLEEGMLTENYVLDNVHAS
                     LLPIITESNVVLRWFVLQGVCSASASSPPASPVCGDPDEASLRAAASAAGQAVRASFE
                     NDELLTLLLATAQLERHVHSRFAVVLQEKTARWTGARRQAVSRVQKLSHFFSEDNLLD
                     TSVHDAELERWFAEVGARIANLHMKRQSAKATRRKLQRLVAALENIQEFAQVNQQLQV
                     LQYVRETCADLHQMLHYLNAERRVLGRLATVTDFSYAWELLSAHGYLVRELQARIRRQ
                     PVVAAHMQALFAKLSSLLHLPCIRIDEGIAVTAASVLGVDVRLERALQFTSTFYSEEV
                     VSFLRSVLQVIPTSIFEVLNKVMYLLTNALRECPSKLQRDEWKHWSQLETREQLCACT
                     ADIARYAAGLLAMEETTVGVVRVNPHRLLEDGIRKELVEHITRELHAGIWFDRSKPST
                     VEDLDKELVQLGARLRGVRNSFEYIQDFVNVHGLKIWMEEFQRIVRFTLQMECNAFWP
                     KKVYPWSSPYQSASITIPYFAPASPKDAYSFLGHLVQHLLYLTDPRESIYFPAYGAWF
                     TRRRLCECVGPRLFSRVADAVDCTGLACLDELLSSIAAKDMQLLVQRLAESVASLESA
                     QRGAAQEVWARCMPTSGTPEKDAFLKDYDQLASILEASPAAQEVGVVAMRLGRIALIR
                     QLIAHQLRSDSKQDSSALVACVQAVNNAVVATLDSHLAKDPFEARAAGPSRSCAEVSE
                     GLVCGTAPLLRSVGLTDPFATVYDVADGGGGVSPSGDNTTGEFSFGAPPPAAATAGSG
                     AARPVAVPTKLPLPLFVLPLCVVVLLHVQKCTYSPRFDSCIPAGKEDDVDPTMLAVGV
                     VTLLQQFPLEATRLLLQLLAQVVRVSIIARTPTPKGKGKGAAPPLVCRCADALTMWIE
                     VLQGYLPRYPEKERSHGVPPSVPDRFAQSV"
     gap             621146..621244
                     /estimated_length=99
     gene            <622213..>623604
                     /locus_tag="LDBPK_271570"
                     /db_xref="GeneID:13386744"
     mRNA            <622213..>623604
                     /locus_tag="LDBPK_271570"
                     /product="molybdopterin synthase sulphurylase-like
                     protein, putative"
                     /transcript_id="XM_003861962.1"
                     /db_xref="GeneID:13386744"
     CDS             622213..623604
                     /locus_tag="LDBPK_271570"
                     /codon_start=1
                     /product="molybdopterin synthase sulphurylase-like
                     protein, putative"
                     /protein_id="XP_003862010.1"
                     /db_xref="GeneID:13386744"
                     /db_xref="GOA:E9BJ89"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028885"
                     /db_xref="UniProtKB/TrEMBL:E9BJ89"
                     /translation="MNAGAMEDILPHAAFVSSVPTLTKEDVERFGRQMLVEEIGAAHM
                     EQIRHAHVVCVGAGGLGSTILLYLAASGVGRLTIVDFDDVELSNLHRQVIHTTAAIGQ
                     PKALSAKASCLRLFPAACVDAVVEALSPENAERLFATCDVVVDGTDNVAARYLINDAA
                     MRCGKPLVSGSAMGWEGQLSVYGYRGGPCYRCLFPQPPPQETVGSCNDSGVMGPLPGM
                     IGCLQALEVLKVATGVGETLNGRLFLFNGLRFSSRVVKLRGRQPHCVACSAAALADAT
                     PLPQLAAQARPEYVPYSCPITSVPSPPGTSCSASEYAAHARGSAAAQRRVTLDVRVRL
                     QYDMAHLAHSVNVPYQSLLQWKRAGTVVTQLADVLDKALPPQSDTPDCMKEGSAVVSH
                     GDAGPQVVVYVLCRRGLNSLKAVALIRAALAEAEARGDEAAVARLGRYVFRNVSGGLN
                     AYHREVDSAFPYY"
     gene            <628038..>629651
                     /locus_tag="LDBPK_271580"
                     /db_xref="GeneID:13386745"
     mRNA            <628038..>629651
                     /locus_tag="LDBPK_271580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861963.1"
                     /db_xref="GeneID:13386745"
     CDS             628038..629651
                     /locus_tag="LDBPK_271580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862011.1"
                     /db_xref="GeneID:13386745"
                     /db_xref="UniProtKB/TrEMBL:E9BJ90"
                     /translation="MSRPYGKKGYAFHSRSGPGGGGVGILGNGNNNGGRSGGDFGRGG
                     GGGRFNNHHHGGGNRNNSHSATNNSGSSGGADVMKVLLSLLFEKSYSQIFNEANGLLN
                     LSNTRASPDLEPVQKRVDYNSVAFCKVLAEVLREKFADRIRVLQLDDNSIRQLKVLLT
                     ALADADIHRGITAISARNNSINDLSFVSGLKRYDGLNELLLIGNPVTNQKDYSTRLSR
                     DLPRLNMIDGVAVDRALLRLPNPVNSAPPSQQQLSVLHYLEQTMFQSMASRNYDAITY
                     LYGSQFSALSISRGPEPLPQRVPVSAVLNTGDLEKQLRNQMQADVSKLRSSQDFRNLA
                     TDSAGSMRNIAKGPQEIVSKLRNMCGGDKSIAVEIEFNPNFNVVMMDQSYHMRVPVCV
                     VTVHGKMRYLWNPIRPETQQPTFPAGKAPMISTFFDRTLTLTWDGNTNAWSIANDMVL
                     MRPDRAVVHDDGTPSSPLFFANTPSRIEQMRRRLMPGITADVMAVIVNATSSDEEVKQ
                     SIMQLLMLPQDQLHAVASDPEAAKRALGM"
     gene            <636399..>638249
                     /locus_tag="LDBPK_271590"
                     /db_xref="GeneID:13386746"
     mRNA            <636399..>638249
                     /locus_tag="LDBPK_271590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861964.1"
                     /db_xref="GeneID:13386746"
     CDS             636399..638249
                     /locus_tag="LDBPK_271590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862012.1"
                     /db_xref="GeneID:13386746"
                     /db_xref="GOA:E9BJ91"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BJ91"
                     /translation="MPRPYKKSKSDVGTAKYSTPCKFFLRGSCSNQRCPYLHVRNQTV
                     IRSVRHKEVAAQQGNGTVKVMSTMLKLFFEKQTQLIYNAETGMLNLSQLTSFDDLSTV
                     ASSINFNTRTFCVALCTCIRELVSPPPTIMQLDRNDVKGFHNLGKALEEAGLHASLRA
                     LSLAHNKITSTDIAQELRHFANLTELNLVGNPVTESTDYKLKFKKHLPWLQGLDGASM
                     AAPPLELPWPRFFDPKHAPIDVMNADHGFSSSVRVYDSGQKALLNFIQSAVLNPLEME
                     PAPGLLTGVDAVSDVYALNATFTFSLVSNEAAVSTPSRTVGGGASTAQRDVVREIVGF
                     RMRQTESNHNVLLGLKSTTVAIGRTSVCAKLEHVLYPKNFVVGHYIHDSPDVAVLDNK
                     GFGPSAVVGMKQPLSVITLHGVMLWRYRTAGSGADVQHSTLVRDAIVIKRNFSRVITV
                     SSTDPGRWHIVNDMVTLYPFRGGSGDEDELEASNAASSGAGVSTAPSTPENILFRDVH
                     PYDVLFSPATDPKRTARIARRYRVPAPIVAILCSFVHSDRELGVILMDLTDIPLEVYE
                     QCATVVEMDPLASIFLCRIGNRFSMEPAEGVALLRRCGLDWSAIVQAIGR"
     gene            <640761..>642827
                     /locus_tag="LDBPK_271600"
                     /db_xref="GeneID:13386747"
     mRNA            <640761..>642827
                     /locus_tag="LDBPK_271600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861965.1"
                     /db_xref="GeneID:13386747"
     CDS             640761..642827
                     /locus_tag="LDBPK_271600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862013.1"
                     /db_xref="GeneID:13386747"
                     /db_xref="GOA:E9BJ92"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJ92"
                     /translation="MADVEMPSPNSGPRSSRATVLRPSPPPRLVQVGHANPSAESMME
                     LSVRSRPFYDTETPPAQTDADEECGSQEPLADSSGATHHYGGIELSMDGVTLRRRKPW
                     WLRRRMVTQLDSCSLRIPPGSVHCITSLSSTYSRCALAVLAGVRAVAHAEGAALANAY
                     PTTVLRYRRQVGYVTSLDGILLEVTVFENLLFATQLRFHVDAQTERELIRKAAADALL
                     TDYLDIRASLLNPARRYLLALAMELVAEPIVLLLEDPLSFFSLAHLQLFVRMLHRLRH
                     RNPSGTVVWSGSAIPWTLFDDIDSLTLLSTEGRTFYTGHKKDVEAFLQEDLGILRVPG
                     EDVVDIMAQTEVDTLAVTRASFLFRNSRYHRQLQQGLQAHRARIATNAFATLPDTTRA
                     PPRYLRVQWLLLAYALRGNVLGRVALVLWAGLFVVILLVCAIVALTDGEGQGNMQNVR
                     GTLFLLLSCSVQINSIFLKAELRNWRMFQLLKKNLYISVTPYFVATIVRVAAPRLCFA
                     LAGWICAAVIFQKAAVVSLSITMALTSFTHACLGLVAVYWFPRFDYLLLLNHIYYGYC
                     VIISGFLVSLTSIPRFLQFLSILRIGYGGLLAAELRGRTFGCDSASSGSEMESGSRIS
                     SRASAFLAPSASCYTGQQYLDFIGLSDDSWGMSVLILLALSVGITITLGLSMHITSGA
                     TLLSST"
     gene            <643881..>645242
                     /locus_tag="LDBPK_271610"
                     /db_xref="GeneID:13386748"
     mRNA            <643881..>645242
                     /locus_tag="LDBPK_271610"
                     /product="eukaryotic translation release factor, putative"
                     /transcript_id="XM_003861966.1"
                     /db_xref="GeneID:13386748"
     CDS             643881..645242
                     /locus_tag="LDBPK_271610"
                     /codon_start=1
                     /product="eukaryotic translation release factor, putative"
                     /protein_id="XP_003862014.1"
                     /db_xref="GeneID:13386748"
                     /db_xref="GOA:E9BJ93"
                     /db_xref="InterPro:IPR004403"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR024049"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9BJ93"
                     /translation="MSGEKELTDAEKTIERYKVKKLIQMLESARGMGTSVISVYMTPK
                     EQIAGMVAKLNNEYGTASNIKSHTNKLSVQSAITAALGRLKQIPRVPANGLLLYSGTV
                     MTADNKEKKLTLDIEPFKAVSRSLYLCDNKFHTEELRRMLESDDKFGFIIMDGSGSTF
                     ATVCGDVKEKLGSFTVELPKKHGRGGQSKNRFARIRMERRHNYVRKVAETAVSYFITN
                     DRPNVRGLVLAGSADFKEVLFQSDLFDPRLKEVVVKIVDVAHPGDVGLNQAIDLSADA
                     LSGVKLVQEKKLLQTFFDQIAMDTQQYCFGVNDTMRCLEAGAVETLICFEDLQVNRYV
                     IIKNKGAEDEATEIHLLTEAEANKKNIHAHEAGKTQNEIESENFVDWLAQNYQKFGCT
                     LELISDRSQEGTQLVRGFGGIGGILRYKMDVMALRDHEKKEEDDDRIAANNEEFDFDD
                     DFM"
     gene            647553..648095
                     /locus_tag="LDBPK_271620"
                     /pseudo
                     /db_xref="GeneID:13386749"
     misc_feature    647553..648095
                     /locus_tag="LDBPK_271620"
                     /pseudo
                     /db_xref="GeneID:13386749"
     gene            <649288..>650307
                     /locus_tag="LDBPK_271630"
                     /db_xref="GeneID:13386750"
     mRNA            <649288..>650307
                     /locus_tag="LDBPK_271630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861967.1"
                     /db_xref="GeneID:13386750"
     CDS             649288..650307
                     /locus_tag="LDBPK_271630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862015.1"
                     /db_xref="GeneID:13386750"
                     /db_xref="UniProtKB/TrEMBL:E9BJ94"
                     /translation="MPLCASIPATVDTDTNTRALYLDDLDKCMKNFNSALASTMNAYQ
                     NLLTAFDQVAQVYGNVAQECGDEVRKPVGEFRDGMRDLKDKGGFETFNHEIHVGTIAV
                     MEPVKLDLKKALKSLKFLRLKQKEYDTVRYELEQTEKSYAKKNKPLVASNSYKKTLAK
                     RDKVKASYDASREAFGDEMNALQATTKSVLLQSLNNYLHCTAAFCGQLEATMDGYRTD
                     VDHHGSTTFANDQMDKLKEKAEAESMARRAQRKNEASNPFQTGNDVTSNNSHRNLPSV
                     DDGLYQKKDSLVDTESANRYPNAELAPPMQNGGDDFTLREQYENEAPGDADAVNPLVD
                     ANDDE"
     gap             652253..652351
                     /estimated_length=99
     gap             653026..653823
                     /estimated_length=798
     gap             654734..654832
                     /estimated_length=99
     gene            complement(<656374..>669741)
                     /locus_tag="LDBPK_271650"
                     /db_xref="GeneID:13386751"
     mRNA            complement(<656374..>669741)
                     /locus_tag="LDBPK_271650"
                     /product="dynein heavy chain, putative"
                     /transcript_id="XM_003861968.1"
                     /db_xref="GeneID:13386751"
     CDS             complement(656374..669741)
                     /locus_tag="LDBPK_271650"
                     /codon_start=1
                     /product="dynein heavy chain, putative"
                     /protein_id="XP_003862016.1"
                     /db_xref="GeneID:13386751"
                     /db_xref="GOA:E9BJ95"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJ95"
                     /translation="MSGLVSVESQLVSTAQRHFHIRCGHVQSRRGDGWLLISFAPLGP
                     DARLELEVQALCSALVRDVTGGRGASVRLTGEDEETQFGKLADKSVSFAKLLRQSGVS
                     LGVGSDPGKDDDNSASVDALPNAPGVAEMVEMLYHDVVAESKQGARAIVQFPSLLCPQ
                     GARCDVALQGAICVKAFSRTASPLVAEVETATPTAAVTGNADDDDTDDEAETLGDTAD
                     GGAQAPHRSHASELEDKATVVEPKSTVNGKAFRSRDDSMLRNSYSSLKLPEGELAKVW
                     IDTRVWAQALASNAGTSVEAELPAAWRSRTFNLAEAPEALRMVHRTLAHYWNENRAAN
                     RDRVKVTTLSLLSIVSGDLREYLRGQVELYGPDWRAPWRMPVEELSCAVDLCKQWSRT
                     VARLVRQDWVGWEGHMFYDESFDAFAQRLHTVLRIRETLASMQELGEAIPSTLHPEHI
                     FAEVNAVDMRGVSTTAWESRVAQFEKEFSFAEPALRNRVKQLFQSPASDAQLRLLRKH
                     CALLRPCEVRSAVTREMDGVAAYLVEQLNRIYARFENNGRRATTPLQKLRAAKGCAAE
                     CVMVPEEAAKVFGATDALTEKVTAHARELILKAAQEEAVIMKDWCASVESTAKKMLEL
                     QDAVVVAKAEDAQLQQQRPYLLTCTVHLSLRKFVQEVRNVRAWLNDIEVRQGQERRRG
                     GTVDRGNSTAQDESATASQLWRLSSSTESAICACEHLCAAALRTQQCVANHNTVIAQI
                     LPCTRRMLLPAIEKSMSQVLYDDTATRAVAVANYQELEGANLRFQNTIEALSNANRQV
                     RRFHEEFGQHVIALMGVDLTSHMEQWRITVDDLRSRMEDFLARQHLSDHEDWRRHWDG
                     QIYKALEYQYRRGLERLHEEMTEFKVELVLRQGVVHFKPSLEAIREAYYVKLREFVSV
                     PLRFRGLQPKRQDASTPYEMYPLMPLTNNDRILTVHTKAMELFAKLNRVRKAFRSHIV
                     VGLCGINGSPHLDSIADAWMEKVAGKISQGFRTVEDHREKIGKIEDVMRIDCFAISTV
                     PVRASIEEHLHRLEEALLNGIRRHIQTSLNDIDEFVLGVSNIVERQPTTMDEVGESNK
                     RYKESLEQVSIYEKKLEEVLEQNKELRNHVGTSIDIGATRTRWDHMKDAMASHTKVME
                     AAVSKMRVSLNGLIQRFLKDEQRFADGWKRQKTQLMQAFLGKEAKTIRKVLLSLKDQL
                     HDLADLELQAKELESKCEFFGQVKPVFGVLRDTKKDVQATSAMWSLYDAFEEELEKLR
                     AEDWLTFRAHTFQFEDFCKEWRTTLNEKMKESHSAAVEDVAGEGKRRKSNKDSGDTAN
                     KANSAHNPIAVYLLNMITDWANVMPLLKFVRGEGWMTEHWNEMFRLLNIPKETTSTSL
                     TFGLILDHYSELLAKEGELKHLHARAHGEIQLREALQDMRKWALEAVFNLTAPTESAS
                     KVRLITDWKEIMTQVSDNQALVNSLKDSPFFVHFADEASGWESKLVSLSQSLTLLNSI
                     QRRWAYLEPIFARGALPHEQARFKRVDKEFVGILREVEADPRVMSLVNQTDVHEKLKG
                     ILEQTERCQKSLIEFLEAKRGKLPRFYFISDEDLLEMLGHSQNPSVIQVHLKKLFMGI
                     HAVTFSSDNTSITHMISADGEEVALRRPVAVTGSDVEDWLLALDASMQDTLHELLISC
                     VKQPDATTKDSVLAYPSQILQVAQGVHFAREAEEAIVAQSLNGLLASLRRRLDRLVAM
                     TPELNALHVLKVKALILDTIHNIEVVELLMKRNVRRVDEWWWTKQLRYRMSTDGTHRC
                     TVHMADTQFDYAYEYQGNAAKLVYTPLTDRCYLVLTKGMDLGYGGNPYGPAGTGKTES
                     VKALGSAMGRQVLVFNCDEGIDFKAMGRILVGIVKCGAWGCFDEFNRLKIDQLSAISQ
                     MIQVIQQALKNKEPSCVLLNSEITVNTNAGIFVTLNPVGKGYGGRTQLPDNLKQLFRE
                     VAMSVPDNELITSTVLFSEGFTHARALAKSIVALYRLSGQLMSRQQHYDWGLRPLKAV
                     LRLGGTLLQRWRKENAGAAATQTIEEEFILQSLNINTISKLTFDDARVFQGLLRDIFP
                     GVESRDVTYKELEAAVASAVKALGLQPIPAQQKKVLQLYEALQQRTGVVLVGPSGSGK
                     STLLNILRKALQTMQIEVPMHVMNPKAMTRRRLLGYMDADTREWYDGVLTAAARDVVK
                     QPKEARPWVLCDGDIDPEWIESLNSVLDDNRLLTMPNGVRIQFGTNVNFIFETHSLEY
                     ASPATVSRMGVLFFSEKDVQLEAVVEAGMAFKSLHAKNVVQPLILKYVFAAVDEAQRL
                     NDFSVATTRMGLLQTCLLHVMLTKNAQDFAYSLVRGLCGCLNAGSAAKLAGWIYTTMG
                     QKPCSDSRPFDTYWDDTLQRAVEFTADLSTPVTPAELLAGRPPVVQTVEVKRLVSTLQ
                     PLLDDGSCKPFFVVGPEGCGKGALLDYVFSTRPTLRTTTINCSAQTGSTHVIQKIEQA
                     CVLANTNAGPMYRPREGERLVILLKSVNLPKADRYGTVELHSFLQQLILYNGFYNQDL
                     EWVGVERVQIVASMNPTPSAGRYPVTPRLLALASIVTVSYPSKTSLVQVYATYWASLL
                     QQTNIGQGKDYEKGTQLAHFMLQVYDKVRRQFEGEEYAHFSFSPRHLTKWVTNVLLYH
                     IDTRTTLPAVLAYEASRIFTDCLPSAEDRRQALRTFSEQLATIGYAMPAKEDRFTTMF
                     VTWFDPENGAAAVAATGDGARGNRSDGGEEAGGASAAAATSHRAVLKLVQKRYDDVRS
                     EAERGLLQYSREFKELHVPLIPEILCWVTYVDRVLARPGGHLILVGSTGVGRRNAVLL
                     AAHQQRREVVSFNMTHDYNLKQFRLDLRGFIQRATVQNMPLVLLIEDHNIVDAAFLEY
                     VNSLLSSGEVPGLFSQEEMETMFSSMRDEAASDGHMGAIYAYFVERLQRNLRIALIMD
                     HRHELFMIRLHSNPALMSKCELLWMGTWSGDMTKTICKMYLADEIAALESNPTNKGFH
                     VHREVNAIHEGMGVRSTPHDVQVLLSTFRAILARKSSSSKDKMERLEAGLVKLKEAEE
                     SVEKVKKDVAEKKKDVERMQKAADKALNEIQSSMEESQEQRDEAATLQEHLKEEQTLI
                     AKSRGQVEEELGSIKPMMEAARDAISTIRSEQLNEIRSLLSPPEAIRVVLEGVLALLG
                     VNDVSWQSMRQFLGERGAKQRILDFEVKNMTPDIRRRVEKLLRDRASFFKAETIQRAS
                     VAAAPMAEWVKAMVEYSAIMERISPLTQQLEQLETNQKDGAAKLEHLQKRLKKIDTKV
                     KELREGFSEKCKEAERLRGKLQAAEEELKKAKDLLDKLNGEKGRWATEAAAIREANNT
                     MPKRALVAAAFLTYLGQETEGGRRRFLKMWCDRLGFPDVVEVTHFLRTEGDLLQYKSE
                     GLSADGLSLENAVVMLDTEQTPLVVDPANKAVEWMREHLKRANTVVETISLHDERFTH
                     TLELAIRFGKTLIVTEVADIAPLLYTILRRDLVPAGAKRVVQVGNKTVEWHDNFRIML
                     FSRQSELRLSPSAAALVTEVNFSVTSLGLEDQLLGVTLQQERPELEKQKVELLKDEES
                     LQLQLNKLEERLLSDLAESQGGLLENTKLIKSLNEVKVQAYNIQQSLARSHELQVELD
                     EKREVYRPFAHHGALLFFIVRDMETLNHMYQYGISDYIALFTQTLKTYQGDDEAGAKV
                     QALIASFTKTCFHSVARGLLKKDRIAFGLHVLHGLWPAEYPQDLWGALVGTITNVKAI
                     EDSQLPKWAPPSSRIKYASIVSSAAGQALAEKWHGGDPSRWAAVMNHATPESELGPRA
                     AGSSTDASAAISDMERLLWINTFRPDRAPATSLQIILRKLELASLAPVMSLENTILSN
                     GATAPILLITSSGADPSMEIQDVATHLVGKERFVQLALGGGLTDNALQQVRRCAVQGD
                     WLLLKNLHLVLDWASVLENELCSMPPPNTSFRLLLTTEPHDLFPSVLLRMSNKVTVEA
                     PPGVKQNLLRTYSLWDSAFLAAQSHAGARLLFGLAWFHAVVQERRTYVPQGWSKCYEF
                     SPADLKAATNVLTSLATKSQLDWVTLTGFLETCLYGGRLENAADEKVLQLLIQTYFNE
                     GVLLKEKSPLFSGVTAAHAGDHDKMVAVLQANMPDVDPPALLCMCDNADRTVQEDAAH
                     ATRESLRELCKKESTALTSGEKWRERLRQVMEVWKGSGIAANGVPQTVSSHTRDPEPM
                     EVFFISEVNLLTALIKDLSAFFDTLHGVAEGTIIPDAEVRAEATELMSGRMPSRWLDR
                     MDGPQEAKVWLALLWRKYNTTRDLARAPFSTTAAYDLSSLLRPQTFFNALRQHTARVT
                     KAPLTDLVLLAAVDNVAHGSVIVKVAAKSLVMQGAALTGDGRLAAVQANSPSSVQLCV
                     DIAVSWVPAVKVKHSSESVLIPVYADAERHTRIFPLRVKCAGEAEATKAALNGVACYL
                     VSL"
     gene            complement(<672747..>674462)
                     /locus_tag="LDBPK_271660"
                     /db_xref="GeneID:13386752"
     mRNA            complement(<672747..>674462)
                     /locus_tag="LDBPK_271660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861969.1"
                     /db_xref="GeneID:13386752"
     CDS             complement(672747..674462)
                     /locus_tag="LDBPK_271660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862017.1"
                     /db_xref="GeneID:13386752"
                     /db_xref="GOA:E9BJ96"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:E9BJ96"
                     /translation="MSRRPSGSFGRSVSGSSQLTSTSGSGGGDAGSSTAAPQAVFCVN
                     PIFFENCGALLNAPSGLTTASVLKVLQSTGSKTSISLAKWKETAMTVLGLRESTAYAI
                     FDVFFALSGGCIQNTPAYLGGERTSVAQLRQESNRALLQRMGGAVDQGRWPAASTARQ
                     VSLPGLLIFLLCQLFVERKRAGAPNKFTSEAVAEYVRQHLHDFISAVAVTRASRLTMA
                     DAAELGYLLREVVNGVEQPFGPSISFLWQFNEKTIDVAVLSQYLRVRIRSNGEIKKVG
                     SGTATVANAFGFNNITIQNLADTVHITPYALLPDMASRLLSSNLTISNCSQTHIYAPS
                     VLPHTLLSSLTNCTVSLGPVSGVLSVQNCHHCSISALCGAVIVSNCTNVTLYVCVNTP
                     PVLIPNEGLNGDVRASGTSSNRVNGATSVSSGGGVRFAPYNSFYPAMEQHISSSGISP
                     LLNVWNVGLPNHESILPPSEFQSVPFPLTQSANLSNVTRTNPCPLPAPYRDAMNRRLQ
                     RLRDVNDAIASATGRLREVGRSDLVDELHQRVTSMFRDWLKETGQEHVLADLTHTTAP
                     SKTVG"
     gene            complement(<677285..>681457)
                     /locus_tag="LDBPK_271670"
                     /db_xref="GeneID:13386753"
     mRNA            complement(<677285..>681457)
                     /locus_tag="LDBPK_271670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861970.1"
                     /db_xref="GeneID:13386753"
     CDS             complement(677285..681457)
                     /locus_tag="LDBPK_271670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862018.1"
                     /db_xref="GeneID:13386753"
                     /db_xref="GOA:E9BJ97"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:E9BJ97"
                     /translation="MRHVFYIPSSYAALIYALTTGYALFACLYMAGVLHWSDIMVTSC
                     GEHHYEFWPSISATIGDMMPERQTWRVAFALCAPFRLGASISLFNVFWQRASRGMADL
                     YGFRSSWKAFLSSNAFLALLALWADMWRLIGASVYSVVSSKESLTYHNLGFCPYLPFC
                     LVLQVAVTMLVRRNQFNMAIYPTPQDAAASYAVKRVCLCGEVVGTVGVVCCYSYYLRT
                     CANGSLSLSNICEWVFSIFNIIFDGSAWFDLRQEGWWLSGPPSFYRKLYARRAHRASG
                     AKSPPRVKGAKDGAKDRHADGDVDVGAPVFNGDGDATPERDSGAAAEDTMPLTSPPRT
                     TTGEFFLDRNVILHRFSFCSAPSRLSLWICDLYWAHMFFEMAVHLIQHMYFMPLIAMS
                     LSWEVSSLLVLGAPCLLRISAFRRWATGPCICARTWLKPSHVPIGLSYRTVPMYILFY
                     ALASISHFHQVIRWNPGKKILVVAVGPLFLSLALYTRFLYPSTVTLKRAWAMGNEDSR
                     RMTMTLPLGLVLCMLLRVQHVGVSPFFTNPFYGSIYGILLGLIFTTIIYRHAMMGNTL
                     KEEVQQQCSAPSAAQMSATTPRMRDSHRDSDAEEIQDFYVSTSSGGRDASHTDCIGKK
                     VADGADIRGVHFSLSQVDEVNENTVSAIATLYTPPSPALLGVLCGCITSIGITFLICP
                     NYIPRMLAVEPFPANLVIAGVFTAGLYYSTDVLPLALVLLRPKGHPDIVRRALYAVFG
                     GSWARFGVLLALNTTLMLFATRQTNFTYEVPHDGYPVTMDTPRAQVDVKYWEAQETFW
                     GSKHVAFMGGLGFTFCMGVLFPFAMEVTWAHQRDRRFAQIADATDTEAVISHECSFFV
                     SFEFTWLLCVTSFCVLYALCISYPFVPMAWLVREKSRPLILAHVGTLYLTAWIVARRI
                     RSSRAVAAAITDVAAARKQRSIQMMVIIIIAFSFVWVFIGRVTMGGADATFPANKKTA
                     IQFQEEVLHLHKMLIELRRERNIITDPYMKKFETIYYQERFEDAMASMGKNITESKDG
                     VPVDPKFNLTHLSREDRIDVWEAAKAMTFFSGAIWTVHFGLDNYNVDSFSRIVEELRK
                     TEASVIGLLESDSMHLTNGNRDMVDYVSYHLGFRYTDYGPTALDNTYGCALVTRYPIL
                     DVRRYVIPSPLGELACVIHAVLDVYGLPVHTYVGHFGNTEHWADGLLQSQFLGRLVLS
                     NPGPSMWLGYLVTHPGMKERYQEYTDPKAPGKFRDAGLEMYRQHPWARLWDRGGYEEE
                     LPVPTKQPVKKTDFDIEVKFQYVGYLEEGMQVDSHFRRPPADKPPRHFYYNDTGRYTN
                     AHPRFEFMDRYCQYCLYKTGATVDEVVGDAGKLQPYQVRLFDWWRIVDHGVELLSDTE
                     IQVIQLAFEKRA"
     gene            complement(<687292..>688998)
                     /locus_tag="LDBPK_271680"
                     /db_xref="GeneID:13386754"
     mRNA            complement(<687292..>688998)
                     /locus_tag="LDBPK_271680"
                     /product="casein kinase I-like protein"
                     /transcript_id="XM_003861971.1"
                     /db_xref="GeneID:13386754"
     CDS             complement(687292..688998)
                     /locus_tag="LDBPK_271680"
                     /codon_start=1
                     /product="casein kinase I-like protein"
                     /protein_id="XP_003862019.1"
                     /db_xref="GeneID:13386754"
                     /db_xref="GOA:E9BJ98"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BJ98"
                     /translation="MTLTSRTAQAAHAQNDVAAQRPPPPLYPSMNVGVSAVHTHQNRP
                     CHPYDSQPAWQHPQLGTAPPAVIAGASLAPEQQEQAPQPQQPQQTHQQGRSNQPQSIF
                     GGRFTLLDRLGSGGFGEVYRAEERDQLVPIAVKVERVTDTNALPEQSFLFHEAKVMQE
                     IHKSIQAYMAAQQQHQLMLLQQEKARSGNGRRAENEAAAAADETRQEKVGIAKLKYYG
                     QDGMSRVLIMSLHGQSVANVHRHQGRLSLFATVMIADQVLRSLEHVHRAGYVHADLKP
                     DNILFGREDPEQLYLVDFGLSVHFRDRKGKHRPLITNHSFVGTPRYASLRTHMGHTLS
                     RRDDIEQLVYVMIYLFRGRLPWSGLRISDPDAKEKRIAQMKAEMTLDSICAGCPEAFR
                     DVLNYARCMEFEEEPQYQFLHVLLCSLRDSCTELSSDPNGVPANGSGGVMPQMLTLNA
                     YCSTRQHPKAQNGGDAVANGGAVGMTAAEAGLVKNTNIASGVVEQIDGVAENPMMMSS
                     RGTGAPAFFSDAIGQGFLSGNGTDAGPLSPRIDCLNGQPFSPPPLDLQRPCGSPQLRQ
                     MR"
     gene            complement(<692162..>694687)
                     /locus_tag="LDBPK_271690"
                     /db_xref="GeneID:13386755"
     mRNA            complement(<692162..>694687)
                     /locus_tag="LDBPK_271690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861972.1"
                     /db_xref="GeneID:13386755"
     CDS             complement(692162..694687)
                     /locus_tag="LDBPK_271690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862020.1"
                     /db_xref="GeneID:13386755"
                     /db_xref="UniProtKB/TrEMBL:E9BJ99"
                     /translation="MCEAWCKGGPGSTWPEAPVLFFARVADGPPASLLTLCSTCAIAV
                     GGDTHATSQRVLARCHHTPVIRYRTAAYVNAVREYKLLLELMARKVVRSCERMQSIQS
                     SVARQKQEQQRLHAYGTAEEPQRYLNPSLDAARVPLTSLAPSLQEKVLSQLLEALEDL
                     LQRDGRAMRLAAAETSLSQERSPLPFSEVMAPRERHVLLEELAHVERQLMSARSSATS
                     AATMPAKPRVSPRSLRERHLYYVPSTSPAITHERADANDGCVVYSPRSPVQPHRSPPR
                     SSVSPWGRVAEEAADRLAAVADPRRCLYHRHDRMPGSSHAASVRGHRDTSSQAPRRSR
                     SRDCSPPELTSPQRSTRGKYDDRSSNAAGRKDSDNTVSGSHTRASGGIAVLGIRTPAA
                     TTATVPFPFSPAPRRARSTSGNHRREVDSASRADDESGSRDTRLSIQDGTNRHGAAPV
                     VQSRPPLDQDGRRSMWAVIDTAIWEAYRRPPPMEGESQEFTTHSSGEAGAGDDNGRHR
                     RHGAAAAGTRNPNRDSDLQLWDYFAGGLSTTPQLHVGGGGDGGRGTPPSTSPSPDSHP
                     LACEGRGPVLPRQRTDATSQTRVEAVAAGGFDGQLGDPSSDDTAALQRRVLHEQQLRR
                     EAKEAMLAAQAQIAALEMTTNDMAETLLTHRLAVTFRAHLEGMEMLVGRWTRLAQNFC
                     LQKSLLFAEEASAVVRQLFRVRFGVARLWSPRTQPQQLQSGRRQTSPYIEAPTSHEER
                     EEELWVSRGEEEASGTRWDRSFSCMSEEGHRNGAVVVTHHPLRSTGGEKEAHHHGRHT
                     DHPSTRSSPERQPLQTSPPSITPASPSFSFPTNLQLRPLSLRL"
     gene            complement(<699180..>704408)
                     /locus_tag="LDBPK_271700"
                     /db_xref="GeneID:13386756"
     mRNA            complement(<699180..>704408)
                     /locus_tag="LDBPK_271700"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003861973.1"
                     /db_xref="GeneID:13386756"
     CDS             complement(699180..704408)
                     /locus_tag="LDBPK_271700"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003862021.1"
                     /db_xref="GeneID:13386756"
                     /db_xref="GOA:E9BJA0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BJA0"
                     /translation="MTSRGEHIRLDKGALVKNHYEVVTSIGAGNFSKVYRVIDLQLPV
                     KDQRRNPLAMKVIKKEYSSDAKYEKQMLIVLHEHDKSRSARVSKMYECFVWQECPVFI
                     MPLHGPCLRSRRLGVNRGVVTYEKLLEFSYDLLETMAFVHFQCHMVHTDLKPENILIA
                     DRNVADNSMGDEWVVCDFGSASLWRMDKLDSDLISTRPYRAPEVLLGNKWHYAADMWS
                     IGCILYEVAVGHRLFESRDDLTHLHMMDRRIGRLPEAFAKHSKYSSKYFNSRGDFLST
                     PDAIRFSKCRLTPIREMFKEDREFLHLLKGLLTYNPDERMTAPEALALPIFDRVRVAR
                     KERQRRADAAAEECRQCHHSPGAVVPGDGKGLRLTGHIDHNTLEHIIADAKNGCTSHR
                     RHHHQNHTKDETSGNNMADSRLEAATNAETTPAPGPAAASPAVGSSPQLDRQASAGTP
                     RDTAAMTTTATTSAASATAENTNSFAAPNVSAPSAASLSKKRASKAAKVRGRAASVPV
                     VQGCSSHHSGSPLSRVAVVTKEVPHQRPCVNSHHSTSTRSSALVPQLALHRFKTSTLA
                     SDHDAAPLPSKSGQRGSGRSGGKLSGRSVSPGSKNRRSTPHKDTSCGLQHGCGSSAAG
                     DGGTQLNASSPLKSPHQRLQLRSGAAKRPNRTPSRSSATPYRLLETLSPAITRSPRML
                     LKASSAAGPSLGHSICISDIIATPPKQAFRAGALRSSSAAGRSPRNPATALGSRSHNS
                     VTKEGEAGMVTTSPLGPSVAAPKALPLPAAATGTKTPRQQSLSPDAPLGSQSPLQRGV
                     TAVCKDMQTKSLVVRGSPDVDDKFVDVGDATKGRSQKATSDDAGDEGDHGLKQVGSPL
                     ATSLAVMGDDNPDKVGDGNDDDDDSSLASPNAQLRDSVASPTSENCLGSLYNSDGSPR
                     ATDYRSPARCRPPVETSTGDTSGVSSPVMMSRSNARLSISSSEWRGVEVAPGVTLATA
                     TVKRGQRSFAAALATPLPPSQHNPRASQLSEVFYSPRELSPSARSPSSLTGPRSTTAG
                     SVASPPAVQTVESDENPHELFSTVPLSRAQLSRANSCSGSFGVTRNAAPASTVDSRSH
                     MAPPSTCTTSAVGRSARELPTARTSVSATTVSTPAAPTHVCQASSSASQLAMVTASVG
                     RLKSVPLPDVSDVRGSASPPPPSVTASRRAATKPGPAPVAATSAPAPACPSLEESTPV
                     APMNSMAMSRLPAALTRSRELSLSQDKGCLANPDTIASPPLLAAAAATPSTGAAGAAA
                     VLHSSPHLPYQPTHGLVHPSGSNSHVLSETKAEEANCKTESQPPGLHMPWRSLLLPDH
                     SPTCVSSPLPAIAAAAPATVTPTFTLPNKVHGAGERHEASTRNSGRIKVKSLSVQHPR
                     TSPGPSPRPPPSSSSTNISFDVAAGAKCSGSTTANFTNAGTTSRLNSNFNNGGPKKLG
                     TATSHYPAATSGSSMSTSFQAVSLSPRNATVPGAANTNSLRSSTNGVSAGPVRSPHSS
                     ASATTSPKISAMYQRTDSPRGIPPALMTTGLPISAIGGEVMPIVTVPLPAQPHYQPPS
                     QAQQQPSTAVASTGAGPSKSSISIVPRHMRSGVASTRSSIHRQPLGTPVASTPRPKAS
                     DSTAASASLKTNAAAISLPKQACKTSSGTLNTVSSRGSTANAPVNTIGADALTRPTAS
                     QLKHRRDARTLRRIIVPRPSTSSLSQASRAASSSSPGAEDSGEQTRDTSDNSHILKQY
                     DRDLSSCSSTTPIPLP"
     gene            complement(<707320..>707415)
                     /locus_tag="LDBPK_271710"
                     /db_xref="GeneID:13386757"
     mRNA            complement(<707320..>707415)
                     /locus_tag="LDBPK_271710"
                     /product="glycosomal phosphoenolpyruvate carboxykinase,
                     putative"
                     /transcript_id="XM_003861974.1"
                     /db_xref="GeneID:13386757"
     CDS             complement(707320..707415)
                     /locus_tag="LDBPK_271710"
                     /codon_start=1
                     /product="glycosomal phosphoenolpyruvate carboxykinase,
                     putative"
                     /protein_id="XP_003862022.1"
                     /db_xref="GeneID:13386757"
                     /db_xref="GOA:E9BJA1"
                     /db_xref="UniProtKB/TrEMBL:E9BJA1"
                     /translation="MFQASFQKRFAAKASEALKSAVPKYVETAHL"
     gap             707490..709445
                     /estimated_length=1956
     gene            complement(<711962..>718072)
                     /locus_tag="LDBPK_271720"
                     /db_xref="GeneID:13386758"
     mRNA            complement(<711962..>718072)
                     /locus_tag="LDBPK_271720"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861975.1"
                     /db_xref="GeneID:13386758"
     CDS             complement(711962..718072)
                     /locus_tag="LDBPK_271720"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862023.1"
                     /db_xref="GeneID:13386758"
                     /db_xref="InterPro:IPR018159"
                     /db_xref="UniProtKB/TrEMBL:E9BJA2"
                     /translation="MWGNNFYKAGTHQQSALCCDGQPATMSGSRTSLPSPSYAAQPAR
                     PPPAGVLSADLARPISVRELAQSRVPAVPPPPPATQAPRPSATTAGFAGFGVPTSSAV
                     YAATSGVSTSRPLSTHADAGDLTSLAHRDIDHLSGSELYNYASHLQESSRQYSGYLSA
                     AYAKRDQYRGEVAHLKEELHNRYVEIDALRREQERASDALLKVREDNAQLRQKLAEAE
                     GHARNMQAKMSVLSGADPSIAVHFYQSQLALKDAQLRELQQECERAAAASSQRRSSST
                     TAAEHGRRSANISGEGAAAPHTSPSRDLPSAEELQDGAEAASAALHTALEELQCLNTS
                     LSHRLEEEHTAHKAALAAHAEASATATADRAELLDTIAQLRQQCADMQSAEDELVAAL
                     TQRAPISKKDYASLQASYDDLTAALAKAEAQVAALQEKEQQHHHSAQQAQEELRHSLT
                     TGLEERQSMQARNEQMQSLVNHLERELELAERANQLRQEQLDVAISGNQQLAESLHVA
                     QEQLLSATSELQDLRDTRESLESQLRELRQRIEELEQGEQHQRHRHGGAEAERTLIHT
                     PAASAESEASQQRQESEAELASLRSQRDAVVSDRDDIIGEVRRLPDERRALLISPPAH
                     AEEQLQSRSSAVRAPLDVRADDREWQKQEDIAALEAAHQCIEQMKQTIAALQSERVRV
                     EADLKAEVNTLEAELASQSRALAEAEAAAAAQQAHLEEVMAALRDELVATQAQEKRLR
                     ASEEAHRERCAEHQRAVEQLQAHVEELERAARDAASSLPTPPPAHPSTAAESELRAMN
                     AALDSLAYQLEDAQHRVKELSAEHARTVEELARATRAVAELEARAADAEGKREVMHTA
                     AEVTEAELMARVAALTAENAQLREKLSTSRAAVTTFASRQTDGESAAASLEERCAAEA
                     RRSEAAEAEASALRETLNGTAAELAEVLQRSEDVQATLERTVARLAEQESLVGVLSAE
                     STRLQDELATAQRSVLLLTSERDALCEEAAGLRGKISAAEDRASDAAAAQQRLQACLE
                     EAEAAVRSKDVELSTALAALDRTASEVCDAEQRLQVYSEAKEQLAAEHARTVEELARA
                     TRAVAELEARAADAEGKREVMHTAAEVTEAELMARVAALTAENAQLREKLSTSRAAVT
                     TFASRQTDGESAAASLEERCAAEARRSEAAEAEASALRETLNGTAAELAEVLQRSEDV
                     QATLERTVARLAEQEALVEQLNYDASELNDARAVLTDEVTRLQKALAAAVSDKADVVA
                     QLLATQKELDRAAEAQDAQYRDEERLQDALATTTSAFDVQTTQVRLGMAHVVDMSRAF
                     CRVAEVAVQQSASQTDGASGTGTSVQEILSPWTRALEWVAAMEQRLEALDRGAMPNSF
                     TRTNGGRERRRRRRGRTTESENDDAVETESNSGSYVLGTSPLCRAVSANRAEAAFVRL
                     IDEQAAATNTIADLRRTLADKEVDLTNLRSAMDALASDLMSERDRADNLSAAIDDASE
                     KIASAQAEFEEQLRQRTAVTTAEVVEARRAEARATAAQLRAEEQLAAVEKDLKEQEAV
                     LRKLQDENHRLTREADRLLRTSRLEPSSRACSNVSGSVTPKSLSLSATSAENAAQRFT
                     TAPSTLEAIEQAQILQVSSLQADLMLSRRQARELEGREATLRQACAALEQQVSELRAK
                     AAESEHLREDLATLRADYVELEQRYSELELMATAAGGGTMQELKQLRQQLKVREAELE
                     EVKARMRDLVLSKAAPELQAARRQEALRESLSGITTQLAATQAQYGGGTGGSSKARSR
                     RDSLTAALSNSDLNLSSSRPSPQDVLNSRIEHLQTLVHDREVALEKVQAAQLESRAAM
                     DTLEDQLAAKTAALERAEGLVAEYADTINAFTMAAVARRGNRGAVSTTVPPLSSGMGS
                     PDAEALSASVPTLTPLTPRTRAAVNGQPHAAVAMVSPAPRMPNLDEVADDSDGSGEGK
                     QADSAGPSTDSAPPPVTHRRTSASGSWRGAKSCPAHRPSSSTERSAPSSPSNVPGRKS
                     FAGASVPATTRKRARSSTNS"
     gene            complement(<719046..>720164)
                     /locus_tag="LDBPK_271730"
                     /db_xref="GeneID:13386759"
     mRNA            complement(<719046..>720164)
                     /locus_tag="LDBPK_271730"
                     /product="GTP binding protein, putative"
                     /transcript_id="XM_003861976.1"
                     /db_xref="GeneID:13386759"
     CDS             complement(719046..720164)
                     /locus_tag="LDBPK_271730"
                     /codon_start=1
                     /product="GTP binding protein, putative"
                     /protein_id="XP_003862024.1"
                     /db_xref="GeneID:13386759"
                     /db_xref="GOA:E9BJA3"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJA3"
                     /translation="MLRLSVALWRRRAAGIVGLPNVGKSTLFNALTCSQIAKTGNFPF
                     CTIDANTSKVPIVDPRLRQLAQFTQAEKIVDVEVDLTDVAGLIAGASKGAGLGNKFLA
                     DIRNCAVLLHTVRCFESSKEGFDTPHPLDDIHVILSELVLSDLEMVEKRMRKVQKTMK
                     AQDVEYSFLKRLQQWLEEGKPAADMPAKAKLTVAEKGLLQSYDLLSHKPMMFVLNVDE
                     RGVKDGNAFSREVEAAFGAERTCRVSVAIEEQTAQLASREEQLMFLEEYGIDVPRGQV
                     LMKQVYALLKLQSFFTVGPKMAHGWTVAQGSTARQAAGEIHSDFEKNFVRAKVMTWDT
                     FIGRPNLESAEMQMRTVNDRYVMQDGEVFIVEHNTQRG"
     gene            complement(<720949..>726123)
                     /locus_tag="LDBPK_271740"
                     /db_xref="GeneID:13386760"
     mRNA            complement(<720949..>726123)
                     /locus_tag="LDBPK_271740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861977.1"
                     /db_xref="GeneID:13386760"
     CDS             complement(720949..726123)
                     /locus_tag="LDBPK_271740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862025.1"
                     /db_xref="GeneID:13386760"
                     /db_xref="GOA:E9BJA4"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9BJA4"
                     /translation="MGNRVSTAAAPFSLEDLEALARAPSLFDTLPNDAGNSAGSGASA
                     LFRKEIIAEMERQYAECDTSLHALRCVLDRRGTRHRLGSYEATTSPAPSGGAPKAISD
                     QGWGKQSAGASIPSLADTMTTNRSGPTQDLLQSPRELHGSRHSDPNEVADSGEAATAA
                     AIAADRSLPNANDDSFPQRPASSRLGALPESAPAETPLSPHSWLFREVSVQPVDLTRH
                     AEVQAAEVYVLVIVQRSTMLRTPPTSTTPATPFVSVTNTRSATPPPSSPSAATPSGAA
                     RSVATSAAMSANTNTEWPRDMVQLFTPRGLTTPFSSDMTRPTLANISHGSGASYWYSP
                     SATPRTNGSTSDRPTPRSTTAAAAAAAPSSATGNGSGAGGFPQASPRSTSSQATPRAT
                     SFHFSVHLLTGKQADAMAAAAGLFTARAIEKLFLDCAEFDRRLFYNLNAAKVEAVIRA
                     YSMHPTLDVTSGCHDDGSNVNAAGRNLRRSSKASSNVSGGGAASAVITGNRMGRDVSD
                     SNSGFGTSNSSLQYLISTLRASRELRRELLAITRPSSVAVPVMRFDKRSSTATPYTTS
                     PVSTGCHTGAFGGVSDHVTSTAVSSNPAELYSLNAIYRVLNGVRVGTPRWMHTGDVAS
                     PLNSAHYSVPGSASGAAAGGPNTSAALFGAGNWCSDPLSSFHPPRRNTHGDGAAAGAA
                     AASGIMPPIPSLNISSWLQGPQPLNVQRAAPAGTAATGPAGSAHPTATGSTTSRMGRP
                     LRHSWTTHSASPKPPPLLLPTLASGTPSGDCRVDSTIPPDASSAPPATLTSATSATQT
                     PVLSLPLDSLRPAAPAAAAAAKARSTLRSASAEEGSTDASTLSPQAAAVPKLQPLINA
                     EEKGQREKALQHTSGPARAADLPSVPRNRKDNAQLESCPAERHLHTRHQHHRADGGGQ
                     GRDEIASRHNAGTENVSTSRYRVALAPPFEDDAECNEVYNQQERAQRLKASQPEVTQV
                     LPYLFVGGEDAARDRAQLLRKGITHIVNTVSWCIDSFYPDLFRYLTLSLSDAADEPIF
                     SLFAVVNAFIEDAVERHQGRVFVHCQQGVSRSCTFVIAYVMWKQGLCYDRAYELVRAR
                     RNVCNPNLGFFMNLRLWEAQLSTPLLNSVFAYAPYTSTSPMPFSYQLTAYFDCETPST
                     VAGAVASRSSLPPSPPSPCSAEGRTLGFLSPRDKEAHQQLRSDVLTRAADMSGAPPAL
                     PNTLSLDPRLGYLFLFAPGARAAGEASSADAGRSKQKGKQRPRLSRGTDVGPGADPSG
                     DEDVDVVTGCVVMGSQCLNKVYSERALAACRQVLRFSFYHGEARTSVTNAGKTVHFNP
                     MRQVRLLPAISPASWPRSSSPFPVPTAAVSAEVAQRLLSLHVASQVRIRFARQSQWDA
                     LLSNTRLGAMLSCYTAEEDRLDASEGVRRHAREGATKGVGASSSGRVSGGQQTSATGH
                     MTLLPNPLLPVNPPAPASSSFRTGRHTPRTPRQLRVSSSGNGGSLRRGSEGDRLASNA
                     AAYSSSTGASASQYRNRADSLPAAAAGSVPEPAASEPQDVFLPSAASSAMAAVFTPSM
                     GPAGVSLPRQGISDLSLAAAAARNGDEQAHVAVRMAEGESFAYAYPFTAGTKVAVADL
                     DDLEEDRCYALGFQQRIGTTVYLWRGADAVESSADVVGAFVRHMLSSSEPAVQTAAVE
                     SLEAGEWTNCSIIFPGDSANAAGVAERADAVTEVLADVRALYVEQGDEPKEFFTLL"
     gene            complement(<728312..>730651)
                     /locus_tag="LDBPK_271750"
                     /db_xref="GeneID:13386761"
     mRNA            complement(<728312..>730651)
                     /locus_tag="LDBPK_271750"
                     /product="paraflagellar rod protein-like protein"
                     /transcript_id="XM_003861978.1"
                     /db_xref="GeneID:13386761"
     CDS             complement(728312..730651)
                     /locus_tag="LDBPK_271750"
                     /codon_start=1
                     /product="paraflagellar rod protein-like protein"
                     /protein_id="XP_003862026.1"
                     /db_xref="GeneID:13386761"
                     /db_xref="GOA:E9BJA5"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:E9BJA5"
                     /translation="MTATVSLFERNKRVYLEEESKLQAIVSSDQFLRTFQSWLDQSIS
                     QLDFQYERCEQQLSELQQHVTAPKGAFWNSKAVIEHCNLHIAERRLVRRNIELDGDQH
                     AELPAVIQLVSTLQQTKSHSFITPKQRRFIEECEAELKSVVFEPRDLVFITNALQTKL
                     IDDGNTRGVFGDLTVFQNTIEELSPDIDQCEQLLEASIANGEMGLAEDISKRQLDVYE
                     HILRLITDQYPAISNYYAESRNSERRRRWAVFRMVDRDITAVIEAKHRQIEACEEDML
                     KIQEQMANYNSDDAQQRKRYEADRAESDEFLQQNKEKQQSVWNRIFTLFQDLQTCSSE
                     LATLAQQRHKEVERRLEMEEREAGRRSGHESFLQAAAEHAQKLQDTIDNAAAARDLAT
                     SLNDFALDGCDSIAAKYDKQQNALGEMLRLVQQHHFKRFSDYYIAASRYLYRKERRLK
                     QMDEEMRANSMHREILSDTLDPHAKEYVEADQRLALQRHEVAEEVMRIRHKLERAERA
                     VTPTLRSLDFAGIAYVHPRIIVEKMNLSRWSTMLDYRTLINSESDSAATVVRETAAIE
                     KLRGDIETQKMSTRNQHRRQQRLCNVRNVDDMKSSRTRGSVQHAGGAAGIKPTATGTS
                     LVKSSPLGFVERVHAMIQQDGTRSGGASGTNTSLPSKGTASGATASPHTSRQVAYSTT
                     HVVNSNGSVIHTSAANAAAVVSAAPAPPPTHMEGTTFQALFDYRARAPDELTFEAGQQ
                     IVCISRAPEEGWFKGVCNQRTGLFPINYVQSVREAPEEP"
     gene            complement(<731872..>734466)
                     /locus_tag="LDBPK_271760"
                     /db_xref="GeneID:13386762"
     mRNA            complement(<731872..>734466)
                     /locus_tag="LDBPK_271760"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861979.1"
                     /db_xref="GeneID:13386762"
     CDS             complement(731872..734466)
                     /locus_tag="LDBPK_271760"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862027.1"
                     /db_xref="GeneID:13386762"
                     /db_xref="UniProtKB/TrEMBL:E9BJA6"
                     /translation="MPGRLKAAPSEVAFTRHFILSPHRRQPVHCHARHSPVRTPYPPY
                     TQPSSDAAPGGSSSSHLHQRHHYHDPFTHHSADGSPTKCRATLSVLAPPTPAADAAHA
                     RHIKHVPCSRAHCLHSAADASAQQQQGPSEAQALTLRSRRWATDGAAVEDRTLEAELA
                     RHRRGPQLPPPSSPLLDSPSRTATPTADITHFDASPSRPLPSRRPASRLQRLLRKLEA
                     EAHRTGCTVTDAADGQRNTVELYQALFLQALADSAAWERHARVLEASAQASAKREAHL
                     KRQLRHLRRSVELLVAYVKGSERVMDALGRGTACGTGASTQTERAAPDGTPPMSPGAL
                     AASAAAAETMMDVASSSPWSPTSLSAVSELVRGSFGRSLNLVYDISGSDSRHGEDDAA
                     VRKMDGRSHAAVVKGPGDLHELDGFHSESLAPAHEAVEAPWDQPSWDGSGDDVGTGVH
                     TRYRASAAWGDKDRGDAAQRLRRGGTEAFETGTPWSRTLPAAIRASGMAHRESTPSLL
                     HRGASAQATAVLEGGSSLHATSPSPLSSLLGHAATMNAAMETESVTHESAPLAAAAAP
                     QVAPTSAAQSLLELLRSRDTSTRGTAALGQGLADTSLGTISKATPQSAAAHQNDDHEV
                     TVAEATHSHSSSDVAHLNRAVPARALSSFSSASRPPLTPSCSSIPRQSSGPKGEALPS
                     HPASLPSLVPSSPPRPYSHSLAPSSPQMSRVGGSGGSNRAPPGIEAAAAAPIAVAELV
                     HTSSPAVLSFPPHQTFTNLAATHQRDGSVAAQPDDGPAYSSNDWEFLETANFADSFGA
                     SSSSSPTRRLDEARGGHHRLASSDSSSDTNGDKMTDERDELANGDGYTEWRTQLEAHL
                     NHEWVSGM"
     gene            complement(<736943..>738901)
                     /locus_tag="LDBPK_271770"
                     /db_xref="GeneID:13386763"
     mRNA            complement(<736943..>738901)
                     /locus_tag="LDBPK_271770"
                     /product="trypanothione synthetase, putative"
                     /transcript_id="XM_003861980.1"
                     /db_xref="GeneID:13386763"
     CDS             complement(736943..738901)
                     /locus_tag="LDBPK_271770"
                     /codon_start=1
                     /product="trypanothione synthetase, putative"
                     /protein_id="XP_003862028.1"
                     /db_xref="GeneID:13386763"
                     /db_xref="InterPro:IPR005494"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:E9BJA7"
                     /translation="MSSLPRASVSFNRPGHIPFGAVQGYAPGGVPAYSNKHDHYFSGE
                     RSIEGNIFFGFKYQCVEFARRWLLVRKGLVLPDVNWACHIFQLKEVRDAATAESFAVL
                     PVRNGTGTKPEADALLVYPSTATNPVGHVGAITEVGDDYVCVADQNYRFHKWESSYAY
                     KLKLDHRDGIWTIIDDIDADEIEIPLGWVTFPGRANRPEGAPPVALHPSLHFNKPPKP
                     YLLRRNFLPTESKANWLDMNNPAERLFVEEFGMDVSRTRLEEKAVSYYESNHEFHLRC
                     IAYGTQLHDIFMEATAQVIESDEKLRLFAIPEEFWPRIRHSWKYQQTYISGRFDFAFN
                     NETGEVKCFEYNADSASTLLECGRIQQKWAESVGLDKQGTRGSGFAVERNLKMAWANS
                     GATGRVHFCVDEEKEEQYTALYCMQAAEAAGLEGKLCVLFDEFRFDDNGHVVDSDGVR
                     VRNVWKTWMWESAITDYYAAREERGENWKPSPKEKVRLCDLLLGDDWEILYFEPMWKV
                     IPSNKAILPMIYHNHPEHPAILKAEYELTDELRKHGYAKKPIVGRVGSNVTITSGDGE
                     VHAESGGNYGKRNMIYQQLFELKKQDDYYAIIGGWMIGDAFSGTGIREDKSVITGVDS
                     PFAAIRIKTDKLPHPVTHKDIDEMVEDE"
     gene            complement(<739596..>741194)
                     /locus_tag="LDBPK_271780"
                     /db_xref="GeneID:13386764"
     mRNA            complement(<739596..>741194)
                     /locus_tag="LDBPK_271780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861981.1"
                     /db_xref="GeneID:13386764"
     CDS             complement(739596..741194)
                     /locus_tag="LDBPK_271780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862029.1"
                     /db_xref="GeneID:13386764"
                     /db_xref="UniProtKB/TrEMBL:E9BJA8"
                     /translation="MTFNRPRGRDTFSAAFESRLRIVPLTQMSDLYGPIDVSLLTAVN
                     ADDPTSSEGNPLEKKKYMAGDARMRKVLEDKQRAEAALHEKRDWHVLVVDPIELRMVP
                     APLPFPSPHPAYYHDWATVEGERWSSSRVLERRPTAEFGIPMPDALAETTGAGTGAAL
                     VADAAADVADGTVANVDAPESLAFFYTAGNRRHLQQNGDTTLLPAAQVRQTTPSIPNL
                     ASTAAQSLPSSPQTILQHFHTAVCVDPDISHDRFHREEAQVEMISAYRNILYEAFELG
                     HAPPSVSSASAAGSLRRTAVTQGTVPFVADVVRVPALCHYSCGRRFLHELGKLNQQAV
                     VKGFHRLSNEAKEALIMNRSFTVEIYVPPMLLEQFERAFLEEPWEVPLSTLNPGRTAL
                     YPGLAPPRSLLEYDGWVGKRPELVEGVATQGKSLLRGAKVGLDGRLIEEREVLANLRV
                     FGAREEQQQMLEGERKTAAEQLGVPLQPTYAPLHAGLLAEVEPHASEALPEKPSGIYA
                     DGDPAAVAMSAAESAKRTPVQHSR"
     gene            complement(<742346..>744922)
                     /locus_tag="LDBPK_271790"
                     /db_xref="GeneID:13386765"
     mRNA            complement(<742346..>744922)
                     /locus_tag="LDBPK_271790"
                     /product="endo/exonuclease Mre11, putative"
                     /transcript_id="XM_003861982.1"
                     /db_xref="GeneID:13386765"
     CDS             complement(742346..744922)
                     /locus_tag="LDBPK_271790"
                     /codon_start=1
                     /product="endo/exonuclease Mre11, putative"
                     /protein_id="XP_003862030.1"
                     /db_xref="GeneID:13386765"
                     /db_xref="GOA:E9BJA9"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BJA9"
                     /translation="MSESTFKILLTTDNHLGFAERDPRRGDDSFTTFEEVLRAARTEH
                     DVDAMLLGGDLFHENKPSLGCLVRACSLFRKYVFGNKAVSFSLLSDPATNFPTHALPM
                     ANFQDPNINVALPVFAVHGNHDDPVGGTSSLDLLATNGYLNYFGHVTSLEDIILEPVL
                     LRKGSTFIALYGLGNVRDERLHRCFRLKKVQFVYPKPVPGRKWFNILLLHQNRGVRGV
                     ASKNGIMEGMLAGFGMDLVIWGNEHEQLMVPQPADGFDVVQPGSTIMTSLSAQECNPK
                     QYGILEVRGTSYRLTPYTLRSVRPVVRRTVELRQDLPDGRTLDAVETFLHNVMSDMIS
                     EAEEHVSHIPDDVLAFHPNLKYPLIRLAVDFTDVTSAPYPQPNFNRFGQQYMDVVANP
                     GELLRPVKPKPERRPSAGALGTALGPGGVAASGLIVPAAPQLNTLDIRVKVADVFNQN
                     AKNACTLLSEAELSAAVYAFAEKGERDAIDERLMELLHTSQKSVWRRLGNGANDSILK
                     PDRVAEEVATHKRHVNERYARAAQLEEAQQQQQMGDTEENEDDGVAGEREGRGGAASP
                     SLHQAERRRELDAFEMTRVAAPPADLATSDSGSGSENHFHGRFAQTSVSRLVQHAIQQ
                     GSENGVDAAAGTPGQRARRCGGALVEAGADEDGQDDKSEELPDDGLDRMPIDSVIAQA
                     VQQVYPPSKRARSAHVRDVEAVLTGDKGSSCGVGGGGPHEVSTVHAFDGNDDDDSRVH
                     GISRHGRARNEAGDVGKAPASAKKQQRPTSARRGGGGGSAAARQGALSAANAGSLNAA
                     SATAADAGPTLTFVAHQGVSAVLPPGNRPATVTSSGSVGVSKGAMVNLLSKWTGGSQQ
                     RH"
     gene            complement(<746319..>750302)
                     /locus_tag="LDBPK_271800"
                     /db_xref="GeneID:13386766"
     mRNA            complement(<746319..>750302)
                     /locus_tag="LDBPK_271800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861983.1"
                     /db_xref="GeneID:13386766"
     CDS             complement(746319..750302)
                     /locus_tag="LDBPK_271800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862031.1"
                     /db_xref="GeneID:13386766"
                     /db_xref="UniProtKB/TrEMBL:E9BJB0"
                     /translation="MFLSFTSPLFRVFRCVCARASLSVSLSNQEYRITISGLRLCPQA
                     TTAAQQVLFTMMRRRCGATGGVLGAAVAAGSLTALSFYPVQRASCRAQSSNQGGGGGS
                     GAGRGLHTFIRDNADPTSSFPTPSTVAARDRGGSRRGAAGASHTMSSSGSSVPPPPHT
                     SSFGADVELPMSDWASRLQRELMSPVDPLGGLAHKDYYRDPATGYAPQYAPRDFVHGG
                     SIAYPHMQGSGSAHDSYAAAAARRNWLEHDVASTAFTSQAARATARQLSSDAERETFT
                     QRHMPADRHRSAFLGNASLAAMDQLRTSGPQSDEKVYQQAMLDRYRAAATSSSSSAAP
                     GVSYTAATGLSGGELVDALAEDYAAAMDDGMDEELRIAHGLRAKERFDFKVMQRTSRV
                     PFQGYDMDRFAAQREGRSHGAQQLPPVIPPSSMEEAMKNMRGGTAALPDTEAQAWQTY
                     AQNTTSEEPKLGEALTGDVINSLHARRRSMQDAKEQARKQRFGLGRQGALVQDGGPDR
                     RTLKKHTNDERLLDAANFASGAYRRTITDEHVDPYVRRSTETGVGHLLTNRFDMARRE
                     DRVAHGQQDLTERNTVHYGVPIQQSIDEFVFSHRNARGERPLDYFKPFPDFRAQRLFR
                     MYRDIEGFSLLKQRPEAFEWELFTRYRAHHQQRRELALLHGLEPVANETAAERTTRRL
                     ALDELCEKTPFDSSKLRLNDDEVKMDAETLRNWFGVYVLPSPTIVESVVRAEGGALNL
                     HLQHAADEMNTADTREHILSSRYMNRLLLFEGFQHRWNRGFTKEVAGKAPEPVIKYAQ
                     PQEVLKYFDADERAMYQQYVQQESDAQLSEWAKVTRGRRYIAEKEQYGEVAAQGYKVP
                     VVDVQHQETGAVLTVSAKLLEKSAAAALTDKEPAGGGSSSSSSRTTSSSSMVRFDGQS
                     YFVLPGSKRTVTPLSIRLESGESMEMTDEVFSAYPLEVPASAKYNHALNYGIGEYDYN
                     RGNYIETQDAIWEKATADQEEGWSPATHADGLCPGLPVRARRRLAAAGEDKTGAAITG
                     DFQRGRIVQYYRQPFFNPDPRLVTVAFYADGVVQEVPLADVMIWQRRYHGPERTVGDE
                     SRRYNPAGLRRYIDVADPNNEKASPSSSVGAGADGADDHFLEKYEGRLTNNAAAARYR
                     TTKQITEIDQWNRFDTSRADNHRPLSISHRRDYVRQGYLPRYTPWEWIVIQEADQPII
                     HETMRTDNIGASYFFSLNRSWRYKARPHGYLRNYENEVRDMLQFVDGVTPWKQAQKIR
                     TYWEVRQHHPMPQFNRPEVAMHRNSAGLLPSHMWETDKKTGKVRAVKDSVRDYQTKIP
                     VPKWVQL"
     gene            complement(<751906..>752643)
                     /locus_tag="LDBPK_271810"
                     /db_xref="GeneID:13386767"
     mRNA            complement(<751906..>752643)
                     /locus_tag="LDBPK_271810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861984.1"
                     /db_xref="GeneID:13386767"
     CDS             complement(751906..752643)
                     /locus_tag="LDBPK_271810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862032.1"
                     /db_xref="GeneID:13386767"
                     /db_xref="GOA:E9BJB1"
                     /db_xref="InterPro:IPR008564"
                     /db_xref="UniProtKB/TrEMBL:E9BJB1"
                     /translation="MNQDTKPNFYFSSDSAGAQGGADLVAERNSNYTTTPAGGSDGQT
                     IPVNTTDHGGYKGVHPIAAFFHVCFKLAAILVFLLGGVFGLKYVLILVITILLLTADF
                     WTTKNVTGRILVSMRWWNEVQEDGTTQWVFESSPEADQRVNAYDNWFFWVTTGANCVT
                     WVVLLFLNFLSFKYLPITLAGVLLSGANFLGYFKCRRDAQQKVTSFMLSQAAARPQAA
                     GHVASFFMGGGGGTNTNTAHGGGSANR"
     gene            complement(<753748..>754170)
                     /locus_tag="LDBPK_271820"
                     /db_xref="GeneID:13386768"
     mRNA            complement(<753748..>754170)
                     /locus_tag="LDBPK_271820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861985.1"
                     /db_xref="GeneID:13386768"
     CDS             complement(753748..754170)
                     /locus_tag="LDBPK_271820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862033.1"
                     /db_xref="GeneID:13386768"
                     /db_xref="UniProtKB/TrEMBL:E9BJB2"
                     /translation="MAEPVTNENLQILLTKLMTDRFCSQEASDLDACVQNFVPQHIDG
                     SYVDQSLQRRGIRRCKPYQEMARKCLEDDKKQTAIFRAAAMAPTCKNEQRALQRCQRA
                     KGRDCEAEALETVYCGMVYLVQRQKERQSGAAAPRLAE"
     gene            complement(<755130..>757148)
                     /locus_tag="LDBPK_271830"
                     /db_xref="GeneID:13386769"
     mRNA            complement(<755130..>757148)
                     /locus_tag="LDBPK_271830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861986.1"
                     /db_xref="GeneID:13386769"
     CDS             complement(755130..757148)
                     /locus_tag="LDBPK_271830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862034.1"
                     /db_xref="GeneID:13386769"
                     /db_xref="UniProtKB/TrEMBL:E9BJB3"
                     /translation="MQTYEVGAPDTANRHAMPGSSAASPPPAEHSAAAGIFSATPLPP
                     LPTNAHLLRQPLLLDIAFVGKVYVLLQYVALVLLTATVVLLAVFSFKRSRVSHVEDAT
                     ACNRYPFANVIPPDLAFSLICFLLNGVFAVRYAVRAVRYEKGGLLVVQVVVVALQVCR
                     AAYFLLFVARRCMRVSSVLLSSPFSRPPWPSLRAGTRGSIASIFSSGVATSGSEGAFI
                     VDDPAPAAGSVLQPLFTLTCASVATSVSLFLAASVLSPWVYASFGWRRYAQGIVQVSL
                     SRVRQRLTVLRTCVQLDGVITANAYLATVFLLDSWPDQRILLLMTLATFAVHYFLIPM
                     LRRSRHWWPLLCAAGVLVTVSAYYAAVIGGALRKDHRLQSVSTSPWYSDCYTDRLRKC
                     LYEISAEYPVSIFRDASAVHSDGDLRLSYNQLERARRQAPLAAVRRHASPFDAAHGAL
                     WRHGSQDARVSSGLTSPCVALAVPSRSALPVRRVNNATDTYLPTYGAYPDYFRIQGCN
                     ATCFLAREERDNIFFERRIASCCAEYGQCRLKDDYRTYAVLLLLVLMLCSSAVRVVLF
                     AVAWRRWVEEDDVAIDLFIQAHCRCHHLGGNCRQRRYPRQEHVHRHRRAAAAAVGGSD
                     PISQSPRRPHASHDVTFSASPLPTQNLPWDVEQYVAWRQQQCTAESTI"
     gene            complement(<763255..>764319)
                     /locus_tag="LDBPK_271840"
                     /db_xref="GeneID:13386770"
     mRNA            complement(<763255..>764319)
                     /locus_tag="LDBPK_271840"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003861987.1"
                     /db_xref="GeneID:13386770"
     CDS             complement(763255..764319)
                     /locus_tag="LDBPK_271840"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862035.1"
                     /db_xref="GeneID:13386770"
                     /db_xref="UniProtKB/TrEMBL:E9BJB4"
                     /translation="MSAYDTEAVAAIPVAVLPPGIRHATLSMEAHEQNHLAIGMGGEK
                     YLVVHPTYSLAPHLYSRRMLGAVLLVLLEVAVFLFTLLGLCTPCITVHKRKYFALLGG
                     HGGSMTDPPGRNLSLIACSVLIIVLFVFSFIFSVVVACCVRCDQRARVSEELFNRELL
                     ELYGAQVHDDGRVYSAGGEPSALKDEGMWGPCCGFEANERSRRSRNTGISCLQCIVVT
                     ASLILEGAAVYNMKWMHRTAVASGETATYEKGFSVTVFALVLRLFQLLFYCYMAFHML
                     YIGSHRSMPRCQLIHTSSTRAAGVLSTHGEAASSGDQLAKIDSESGYPSKPRHSAADR
                     EGDREMELIPNSRTTLHSCP"
     gene            complement(<765259..>766038)
                     /locus_tag="LDBPK_271850"
                     /db_xref="GeneID:13386771"
     mRNA            complement(<765259..>766038)
                     /locus_tag="LDBPK_271850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861988.1"
                     /db_xref="GeneID:13386771"
     CDS             complement(765259..766038)
                     /locus_tag="LDBPK_271850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862036.1"
                     /db_xref="GeneID:13386771"
                     /db_xref="UniProtKB/TrEMBL:E9BJB5"
                     /translation="MLFGNEAPFHLKPIPYRGVRKHQAEVLQHPPGYKHPIIPLPPCS
                     ALEVTAVRPSGSGTAAHLSRSSASLSPASSVNSGSTPGTLSCTSSNHRAVDPAAASAL
                     YRVAPPNLLQQQQHNPRMRRDSGRGGDAFLADAERLDPDITADAALRQERVCERRKLR
                     AYQQARRERAASREATLQASRNAAFEAECRRLANVAGTARSNREQDDRDPITHQCYTA
                     EAEQLLMDRNSHVRTRYAARQRFLDRQMNSTEYNILTWQLR"
     gene            complement(<767712..>770588)
                     /locus_tag="LDBPK_271860"
                     /db_xref="GeneID:13386772"
     mRNA            complement(<767712..>770588)
                     /locus_tag="LDBPK_271860"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003861989.1"
                     /db_xref="GeneID:13386772"
     CDS             complement(767712..770588)
                     /locus_tag="LDBPK_271860"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003862037.1"
                     /db_xref="GeneID:13386772"
                     /db_xref="GOA:E9BJB6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BJB6"
                     /translation="MQVNSLLERMRKVRQEKAAAAAAAAAAPPAVTNATATVPAANAA
                     IRDAPVSSAADADTAGGGGVVSSSLLTGVTVPAPPPVFASPSSARLEYRDNAKDPLCV
                     PFTCDMVVPVLNALLSNQQHGSTSTVAAAASGGLNGAVVPMMTEAVNSIDATGGDTRD
                     VSALSSASAEIPGAGRDSSGKESQSIVVAKAVVRMREVLAAQGPPQMPQKAAVESVPS
                     ITATGTATAAGAPVSSLRPSSASLFADAAYNTACAVARVDVSGAVRPICRDVNYYTRV
                     GRISQGVYGVVFRAVTTADYERQHRQQSRHRVTRPGSAASSAAAPPGHVRTYALKHIK
                     KMWLEDSQVGLPPYLMREIDLLLRLQHPNIMGALELVLLDPTPVPRRLASPPKSCSPS
                     SSSSESPSSSSSLSSESPSTEQHAEEAAECDRALRRLRSTAEDTAGQNLAKKAKIDNA
                     EEPLPQREEARPATQAQTKGEKGAAQDAAATRPLAAVGAASKAKDVFLVMDYCPYDLG
                     SYMRRYATAAELYGDGDDCKSTHASAQVPYFHITPRNAHPQAAASYVARAKSIVYQIL
                     RAVAFLHDSRILHRDLKTSNVLLGEDGYVKVCDFGLGRLYREGQALTPTVVTLMYRAP
                     ELHFGVVDYSHKMDVWSVGCIFAELFLRRPLFHASTDSHHLLAVCEVLGIPTEESFPG
                     LYHLPQTKTMMQSLPRWNRTSRLASLFQRGAVLPTVAHGDVPVAAEGALLPESGVDLL
                     ASVLQWNPRRRPSAAEALQHPFFKEEPLPCAPAELMRPMPWMDAAIAVGNAAPSAALV
                     PEDRRDQPGSRGSQGCPSTATHMAPSTTGRPSSASVPPAMQHVADIPSGVEATVAAVS
                     SASEGATAASPLASASPDTFLGGSRSVFVSDTVGGGYQQAISTRDYSGSDGDLAEEDE
                     EEQRLQLHTRRSTRDQVEDDDDSDAETERVGRQARFLANQDRDE"
     gene            complement(<771727..>776697)
                     /locus_tag="LDBPK_271870"
                     /db_xref="GeneID:13386773"
     mRNA            complement(<771727..>776697)
                     /locus_tag="LDBPK_271870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861990.1"
                     /db_xref="GeneID:13386773"
     CDS             complement(771727..776697)
                     /locus_tag="LDBPK_271870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862038.1"
                     /db_xref="GeneID:13386773"
                     /db_xref="GOA:E9BJB7"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJB7"
                     /translation="MAVAQKHPSTCPVLYVCVCPCYRQRSRLCPSLLLCICSRLASIL
                     SPSLRTLSRAYELSHPQVNPWPAHFTLDSTFSVSPLSIFPPAPLPRGRLQTTSPPSCP
                     RCTPAHTSCTFHPPLYLFPYFLSVLHQHLHTLGMKKVLVLNGDSYVGRHVVRAFHQSY
                     EYEVEITRTRTGERAATAVNAVMRATSSDWLWGQMKGLWDSLEKSLVAAAADAADDSS
                     VMVTGGSHHKSTRHAAPAAGAAQLPTSLPRAGLSAEERNTLPADIQFCVSSIVPKHND
                     NTEEFRKRLLANDVVIAVLQDDTYEAMCAIRILAGTHYDVEKTFVLVSSAVTWAYTLT
                     SERARARAMRQWEREEERNAFLEELLDAEDEENDDGDALGEGAAAVAEREARRAARRR
                     ELEQRLPLSLREPAAGEDEAELRELVPDRVFTDDAYAQRVPHPRFQHWHSLEHLVKRS
                     NTETLHTYVVFAGLPYGAGEGSDMLFGLLRSAWNHQVLPQYGAGVNEIPMIHVQDLAS
                     ILYKVGSAYDVLGERYMFAVDQGHITQRQLLQAVQARFGGSVQPAVAVSPSVANATAV
                     DLVRLDRLELPPPTSPQELFAAFGNKPCWGDGGALLTALVLSDIQAEPSTVLTMHAED
                     DWVALDGFLATLDVTCAQFRAAHADAFKPIRALITGPPLSGAETVAALLAQRCRAPCV
                     SRENIVADYKAHVADVRAALRGLLMRRLQRRRARVQARLVRQAAEEKAAGRLAKEEQR
                     RQRREERQQRGDTDDDSGGEEEPDEEGAATEGESEVGGAASGVASSASLISIFLPTTT
                     KSADSGSDDEEEVATQPQQQQQPLRPIALVVNEAYIRGAADADADGDEEGGAGIDEEQ
                     EEDEDEEEGGNWLAQLDAQDEAAQAEMQEDRELLPPVPLSAAAGDAALPLLALPPFAA
                     RSRGRAFARDVDRQELRCIAALRQEYLLGLKVLALKVSAEGRLPRPPPTPAASEDNGG
                     YNDEDGRGSTSGGSDEGSDEGSDEGSSQDSDEEGDEEVASDGTLQASPEGRNDAAEED
                     EEEDDDYESADPGDDTNPLLALDPADDSSAYLDCALAFMCRWRLRQSDCRCQGYILSD
                     FPQTLAQAVLCFRANGAELEDAELRRQRALAPLLARSDDHAAEDSSDADGEDDGVLAP
                     IDADFPLPDIANMEEEELLALERAHRRGRGPAGCNSAVGEVESMDDLTEGVAASGDTE
                     TVIEPVDESLFVDHVVALQADPAVLRATMDALQTNLVVAAEQQASSTSQSGAAPSAQG
                     AAAIGSAEAALAALRASLHTTPYVAQLEWYMDHHTATSPPTQSLLSWLSAITTTPALG
                     VQHARVIVPLSTSDDAADGEDADGVAVTTMEAPPTTRTAQMHFMPMPVLSTEEVKACW
                     CAASERKAQDEARAAGVGMDAHMVANRTCGDECGSALVDAKLPVALMRLAPLCWTGAA
                     APQSPLLLSQAPSPSAHARCPRHSRATSRRTPPPAASLAALAQDLCARIAPVRREPTA
                     AATTKATAAPAASTETDGVSDTSAKTAPPLLADAAAPAGQVDVATASETPADAALKEA
                     AGSISDAAATVAAGEEERQTRLTACSEAEASQILHELASLRRLQIVESSPDTVEMLEL
                     PVETYLMKYVLPNLTPVMTDVVRMRPNDPVSTLADALFERRRRVTL"
     gene            complement(<777632..>778924)
                     /locus_tag="LDBPK_271880"
                     /db_xref="GeneID:13386774"
     mRNA            complement(<777632..>778924)
                     /locus_tag="LDBPK_271880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861991.1"
                     /db_xref="GeneID:13386774"
     CDS             complement(777632..778924)
                     /locus_tag="LDBPK_271880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862039.1"
                     /db_xref="GeneID:13386774"
                     /db_xref="GOA:E9BJB8"
                     /db_xref="InterPro:IPR029302"
                     /db_xref="UniProtKB/TrEMBL:E9BJB8"
                     /translation="MASTGNGGGSKATASSLSPQKAGMAAPLTSAPPMTASTTSPSRL
                     NSMRTASSSVSSKNAPTGPSKKGGTAVKPSPEVDGKTAAGSSEPGPRASVNTDHQSKS
                     NANSVNASNVAGSTNAPSDNRPDHDRRGRRQEGSSWFDVEKPANAHRPADKELNENVQ
                     IVQDDIPDAEQAHREQAERAQRQKEKLAQHISESPTGFQATLPRLNELDVTNSWDKLL
                     RMMRSEFDMSCLTSCLARELDEDVAWNPEMLLVQLTSDMLDAAELQKDGGEAYVPVDA
                     SDIGQMTGGEVARKRKEKRSTITAAGAEPAAGAAEGTEREPEKGSEKPAAASPTPAFQ
                     AAASKALRKQTTTDPAAAAPSGKKARNTDNAGSTSTANSSSTRKRSAAGSRSGEAGGG
                     GGNNANVSSSTAKCDSTDDTKSTKSTSLKAQVSKLFSK"
     gene            complement(<780137..>780472)
                     /locus_tag="LDBPK_271890"
                     /db_xref="GeneID:13386775"
     mRNA            complement(<780137..>780472)
                     /locus_tag="LDBPK_271890"
                     /product="small nuclear ribonucleoprotein protein,
                     putative"
                     /transcript_id="XM_003861992.1"
                     /db_xref="GeneID:13386775"
     CDS             complement(780137..780472)
                     /locus_tag="LDBPK_271890"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein protein,
                     putative"
                     /protein_id="XP_003862040.1"
                     /db_xref="GeneID:13386775"
                     /db_xref="GOA:E9BJB9"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:E9BJB9"
                     /translation="MGKYTMLHNINKVLCVMLDDGRTVTGKLLVFDKHMNVVLGDAVE
                     ERPQSKKMAEEGVSPKRQLGLILLRGEHVVSVTVMKGSENGGSGAVANFGGAPKSAKA
                     TAVKRKRGA"
     gene            complement(<781648..>784425)
                     /locus_tag="LDBPK_271900"
                     /db_xref="GeneID:13386776"
     mRNA            complement(<781648..>784425)
                     /locus_tag="LDBPK_271900"
                     /product="FtsJ cell division protein, putative"
                     /transcript_id="XM_003861993.1"
                     /db_xref="GeneID:13386776"
     CDS             complement(781648..784425)
                     /locus_tag="LDBPK_271900"
                     /codon_start=1
                     /product="FtsJ cell division protein, putative"
                     /protein_id="XP_003862041.1"
                     /db_xref="GeneID:13386776"
                     /db_xref="GOA:E9BJC0"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BJC0"
                     /translation="MGVKSKKKAKTRLDAYYRLAKDQGYRARSAYKLIQLNRKYDFLA
                     KSRVLVDLCAAPGGWCQVAAQHMAIGSKIVGVDLVPIAPIRGVKTFVGDITDDKTRKM
                     IVTYLKKEPVDCVIHDGAPNVGGVWSRDLFDQNALVLASAKMACSMLKANGWFVTKVF
                     RSPDFHNLLWVFKQLFEKVEATKPQASRMESAEIFVVCAGFKAPKSIDPAFFNPQKVF
                     AEVGQEKIVSASGMLVAPKSNVPTGYDEFATVSHHVASFSDFLNADDPKVFLKTHHEL
                     RFSDDADKEYLKSKSSKKELVYLCGDLQQVGEADLRRMLRWREQLLREKTHRIQVDAA
                     GTEEGGDVDSMAGGNGSDDEDDEDDGKGKRDYHFDFDSPEGVTQIARELLEIRKKKAK
                     ELKKKQKKVVDRKLKQIKGLINYDPNMSVEHMTEADGLTYKGTNTDAFDDDGDAAAGG
                     EDGEADELDHFTVEQLGLIPEKELAHIMDKTWTEPEDRGNDPLNPVMSVNLAAQDDWD
                     LGDKKDGDESEAEGDDDGVPHSAQLVEGEEHFMDVDNYGNYVPAQRSTRVTLYEAGLE
                     GYEDSNDAEAADETPASKKKRAKAEKDAAQLEEAGKSSKWERHQLNIEKVLNDTFPKP
                     KDHDRAKNKKRQRTLEEERIIMSVPTEMADPDKRKHVRTRFEDKDDDDSSDDSVSELS
                     AELSDGDLDDYEINRGREDSRRKRKLIPDIGKVTTQELIRQQRKQTLQDNKEVRKQNK
                     RNKNNTNSGKNSSGKQDTEFEEIPIAMTDPDIRARTLAIAQKMLDPKARREILDASVN
                     RYVFNDDDDLPDWFVKDEQRNCRVVLPVTAEEIEEQRRRFQELNARPSRKVMEAMGRK
                     RRKAQRMLRSLIDKGKADPRAREKAENLSVRKLMRSQVVKGQGKKRHKYLDRQLMGRM
                     RREKQKLKRRK"
     gene            complement(<785522..>788599)
                     /locus_tag="LDBPK_271910"
                     /db_xref="GeneID:13386777"
     mRNA            complement(<785522..>788599)
                     /locus_tag="LDBPK_271910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861994.1"
                     /db_xref="GeneID:13386777"
     CDS             complement(785522..788599)
                     /locus_tag="LDBPK_271910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862042.1"
                     /db_xref="GeneID:13386777"
                     /db_xref="GOA:E9BJC1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9BJC1"
                     /translation="MEEDGAVGFLPFCVQRLRGPGRVRRVPPGTAYRSAGALLRRLLR
                     YNEDGEVRVEVVREAVGGMSLGAGYTEGRQTTAAVAAASEELREDPQHQHQQQQQIAV
                     TQRSQPKNQDTKSTRTRSQARRERASILAMETERRYAAEQESRLSFLLQALPLLRVVP
                     PQCLLQQAYTEEQVSEPGSDVFTPPNISRSFNPSPPASSSAVVAHRDPSQLGSGSSSS
                     SDVDGDGRNTGGNAGQRGAATATNSYVRGAYRLGLGFAVLLTPEEAAGLHETPPRRTL
                     AQRASTAATAGGSGVGDGKDRTSSLNLLSTVNTTAAPSRAESLLTTVHEEAASTRAAA
                     TSRSTDVLAGKPPVSVEVAAESAQAAAAAAATLNGIAIDSGFGVTIKVGGSCDEPNSL
                     RCVAWGGCRPALLRAVVWRLLSDYAPAAVTRQKAELQRKRRQYEGYTRQYCSALTMLS
                     LRESPSTLPSMLPLSCSHGGGGAAGAPGLREAASLSRLPGNGLPPNNGHGLTLSGGAS
                     STSAVTSLSPYERAILQQMLLDLPRHQSPIFHAGRSLAGMARCLFLWSQRHPAVGYVQ
                     GMDDVVAVFYHVFLADALRQLARVSAQAATCTRASHRQTATHEGARRTSVTAAAARLD
                     SGSDDGEGDDSDDKAASANGAELGSMACDKGTRAVMRLLVSSLSASVQRTSWSSTAAS
                     TPTALATPITMTTLGTPATRATTAAALSPYLSEEDLDVLSDTPAALDAMLAELPESYL
                     TQVEGDTYWCAGRVLSLLQDNFMPGQPGILRNVRRLEALVRAVDPSLIAFLDGYGLTV
                     MDGCFQWLHCLLARELPLPLLLRLWDCYLAIGIGGDRAPPTTAAASGAHTTSSLAATV
                     AAQGSSASDEEIMHFHVCVCCALLRNLRANLLDNSSQTSTLNAPAATSGRWGAAALAT
                     VLPIFGSRTTHQEGSSAAAPSAADAAACSGTSSTAEPPIDVVMNALKHPFEALFPQYA
                     SAKQEQQHPLDREDKHERCGERARARTLEAAMRWLDILIADAYCIWRKHPMHG"
     gene            complement(<791832..>792425)
                     /locus_tag="LDBPK_271920"
                     /db_xref="GeneID:13386778"
     mRNA            complement(<791832..>792425)
                     /locus_tag="LDBPK_271920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861995.1"
                     /db_xref="GeneID:13386778"
     CDS             complement(791832..792425)
                     /locus_tag="LDBPK_271920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862043.1"
                     /db_xref="GeneID:13386778"
                     /db_xref="InterPro:IPR008015"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:E9BJC2"
                     /translation="MSSSSVTPEQVLAFTAPTERFLCPLTANKYGVEFYQFTIRDIEQ
                     NKVLFEVGEAPDGSADGNVNDMLARVAQLSEEEAAAARTIRYRFAPSFLRKSAVGAKL
                     VFGVNGDQPVPKFRMIERHYFRNVLIKSFDFEFGFCIPHSTNTWEAIYDMPSLNPEWE
                     EAIVASPFEMASDSFYFVGNELIMHNKAYYAYDGEEP"
     gene            complement(<793318..>794073)
                     /locus_tag="LDBPK_271930"
                     /db_xref="GeneID:13386779"
     mRNA            complement(<793318..>794073)
                     /locus_tag="LDBPK_271930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861996.1"
                     /db_xref="GeneID:13386779"
     CDS             complement(793318..794073)
                     /locus_tag="LDBPK_271930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862044.1"
                     /db_xref="GeneID:13386779"
                     /db_xref="UniProtKB/TrEMBL:E9BJC3"
                     /translation="MPQRPHIPLASPSPLNAPPSLTSRPGPAKYCGAYAEPAAGLNYS
                     HYDDRRTVFRDQASCDPSPSQRAPHQQQVYRPLAVSPGPHDGSAPHVSAPAARSAVIR
                     ADELETILDEQNYIWQMEEYRFRTERQKRLTALQHRQHELTLESARYDQAVAEVERQL
                     ARERQRLEKLQQVMTHNATTSCSLIDREHGLQEPPIAMSDAPDAITRNSPAMHHGRAR
                     DHAYSAPHDAPYFPTGASDGVSAINEEEVISEV"
     gene            complement(<798359..>799840)
                     /locus_tag="LDBPK_271940"
                     /db_xref="GeneID:13386780"
     mRNA            complement(<798359..>799840)
                     /locus_tag="LDBPK_271940"
                     /product="D-lactate dehydrogenase-like protein"
                     /transcript_id="XM_003861997.1"
                     /db_xref="GeneID:13386780"
     CDS             complement(798359..799840)
                     /locus_tag="LDBPK_271940"
                     /codon_start=1
                     /product="D-lactate dehydrogenase-like protein"
                     /protein_id="XP_003862045.1"
                     /db_xref="GeneID:13386780"
                     /db_xref="GOA:E9BJC4"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:E9BJC4"
                     /translation="MTYPLKQAEYNVGTLEERQAKYATCIAELRKVLKNPEKQLVVSE
                     KMLDLYSKDESHHMHVLPAAAVIPSSVEEVVAVVKVCAAHKVPMTPRGAGTGVEGGVI
                     PYAGGVVIDTVGLTSMNFDIDNACVWVGAGVRKLALNRAASERGFLFGPDPASDPSVG
                     GMVSTSGSGMSTLRYGTTRENVIALRVVTPRGDVVQTRQAVRKSSSGLELTQLYIGSE
                     GTLGIVCEVCFRLFPETKYSAGGYAAFESTGDAVRSVVALRQRGVPQTLLRCELMNKG
                     IVEATNSYCKTALPEMAIVLLEFTGNDQGMSDIKRDYQYVEKIFKEVGKAKVMHYLRS
                     GKEMDDVWTARRTCHFSAMHSRGKAEKVFGTDVCVPISKLTEIIEYTEAEFAKANKKC
                     LICAHISDGNFHLVIPFSNKQEIAELRVLETKMIKRAIELGGTTSGEHGIGVGKVHLV
                     TGEHGQSHIDVQEAIKVALDRDNLMNPGAFYPFQQRLYPTAHL"
     gap             800334..800409
                     /estimated_length=76
     gap             801489..801587
                     /estimated_length=99
     gap             802259..802357
                     /estimated_length=99
     gap             803491..803589
                     /estimated_length=99
     gene            complement(<803591..>804793)
                     /locus_tag="LDBPK_271950"
                     /db_xref="GeneID:13386781"
     mRNA            complement(<803591..>804793)
                     /locus_tag="LDBPK_271950"
                     /product="branched-chain amino acid aminotransferase,
                     putative"
                     /transcript_id="XM_003861998.1"
                     /db_xref="GeneID:13386781"
     CDS             complement(<803591..804793)
                     /locus_tag="LDBPK_271950"
                     /codon_start=1
                     /product="branched-chain amino acid aminotransferase,
                     putative"
                     /protein_id="XP_003862046.1"
                     /db_xref="GeneID:13386781"
                     /db_xref="GOA:E9BJC5"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="UniProtKB/TrEMBL:E9BJC5"
                     /translation="MLLSRRWHQASAARGSRAPVVSFTAAALTKTLVADPPPLPPMKG
                     VAFGTLFTPHMVIIDFNDGRWGAPAIVPFANFSLPPQTSCLHYATQCFEGMKVYADIA
                     DITRAARGEKLEKQSLRLFRPDRNVARLRHSMRSLCFPDFDEAEMLKVIMEFVRTEKD
                     YVPKEHGYSLYLRPAAIGTADSLGAAPSRSVRLFVIASPVGPYYLPPEDQSGAMAIKT
                     VTLLAEDKRKRAWPGGTGGSKLGANYAGPLLVQEEAQALGYNQVLWLGSKDEVQEAGF
                     MNFCTLWKTKEGKTELVTAPLDGTILPGVTRDSILALARSWGEFEVSERPYYMSELAE
                     ALQEGRVMECFGCGTAAIVSSVSMIAYRGKEYSVPLSEPSYARRFLNEIMDIQYGKTP
                     SPWSVKVEA"
     gap             805179..805277
                     /estimated_length=99
     gene            complement(<806421..>807107)
                     /locus_tag="LDBPK_271960"
                     /db_xref="GeneID:13386782"
     mRNA            complement(<806421..>807107)
                     /locus_tag="LDBPK_271960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003861999.1"
                     /db_xref="GeneID:13386782"
     CDS             complement(806421..807107)
                     /locus_tag="LDBPK_271960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862047.1"
                     /db_xref="GeneID:13386782"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:E9BJC6"
                     /translation="MSRHGYGYYEDDDKGSWWIQPKRAYRPFGPFRLVSTLMVAVAIG
                     FIAFGLACAVMFVAEVAEEHPSRTKWILRALIFFNFAVHASILVVDQMSWWRSLLSLL
                     VNVLYLRLLRTFPFVPGMNSPLVLATMLAVLLESAMWYWFALRLMYYTSILLVFGFFL
                     MLWLVPIGLLSSCVIEDDRLPGGGGAGAMYSCSRGCASGGGSSAPDAMAGGRRRRTIL
                     NRLADLINNT"
     gap             810882..811131
                     /estimated_length=250
     gene            complement(<811132..>811719)
                     /locus_tag="LDBPK_271970"
                     /db_xref="GeneID:13386783"
     mRNA            complement(<811132..>811719)
                     /locus_tag="LDBPK_271970"
                     /product="ribonucleoside-diphosphate reductase small
                     chain, putative"
                     /transcript_id="XM_003862000.1"
                     /db_xref="GeneID:13386783"
     CDS             complement(<811132..811719)
                     /locus_tag="LDBPK_271970"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase small
                     chain, putative"
                     /protein_id="XP_003862048.1"
                     /db_xref="GeneID:13386783"
                     /db_xref="GOA:E9BJC7"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:E9BJC7"
                     /translation="MPSTEANLQPAAKRPREEDVEAEVACTPTDGAATDAAKTENLVM
                     KPVAAGAEVLTADKVAEGTNAEEEPLQQENPFRYVLFPIQYHDIWRKYKEQESCIWTV
                     EEIDLGNDMKDWATLNDGERHFIKHVLAFFAGSDGIVIENLAQRFMSDVKVPEARAFY
                     GFQLMMENIHSETYSVLLDTYITDSEEKLRLLHAIQ"
     gene            complement(<812695..>813843)
                     /locus_tag="LDBPK_271980"
                     /db_xref="GeneID:13386784"
     mRNA            complement(<812695..>813843)
                     /locus_tag="LDBPK_271980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862001.1"
                     /db_xref="GeneID:13386784"
     CDS             complement(812695..813843)
                     /locus_tag="LDBPK_271980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862049.1"
                     /db_xref="GeneID:13386784"
                     /db_xref="UniProtKB/TrEMBL:E9BJC8"
                     /translation="MAQQRGKKAALSKAAVANASASAPDPPPFFSMRSATFTDAIVIT
                     KVISVVLPLRHLRDRNILHATLLKKLLHRPYEASAEDLAQQQLLQQEAEDGAKHSRGA
                     HSALDNRAAPTSSSSSTPYVIVHIKSAEIHADTARQVNPRGDVQVNVMVTLVAARLQH
                     GICAGVSEASPFTSCMQVRVPTVAVSAAVAARGSTDDAATLLLGDASEAGTDNVSQEG
                     VKDEKAEPSGDDAALDASLPATTTAAAAKRRCCTGVPEDQQLRVTARCLEDEPIVPGQ
                     AVLLISEPAAMRCMGIRPPRAAPGPFYLTETTQPAAQFSSGEAEGGPEARPKKRARKP
                     RASAGGTGGATPARRIVSIECAIPKREEDGEGGAAASTRKGPRKRPHT"
     gene            complement(<814912..>817470)
                     /locus_tag="LDBPK_271990"
                     /db_xref="GeneID:13386785"
     mRNA            complement(<814912..>817470)
                     /locus_tag="LDBPK_271990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862002.1"
                     /db_xref="GeneID:13386785"
     CDS             complement(814912..817470)
                     /locus_tag="LDBPK_271990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862050.1"
                     /db_xref="GeneID:13386785"
                     /db_xref="UniProtKB/TrEMBL:E9BJC9"
                     /translation="MPSAEALSGGSGSDIGGLRTDSGSRARAGNTIASETDAATEAQR
                     LRSEGTRESRAGRGGCGDGRGDASVSCADVSIDLAEVLPLTSSPRLSAKRGTGGGGRS
                     ATARETDVSALREDEVFSAEHGAEVPSDRLAARAVPLDVPLLTTVEEQRPHGSASDIP
                     AVVVLRHRMGCSMVVLAPHQRASYSRYDLENFVLYKEQKYNAVNVLWRFCILMLLVLS
                     FTVFCLVLCACTTEWLSVQNNDSFLSVGLFFSCRDGFQRTCASWQSAWVEWIVLDNVT
                     GAILCHASAGFVRRFLGVMWTMGILQLLCEVVALFLGFRIAARPTRSGALVLLFFDLL
                     LSLCIGIVTVVLFDLYTSCVRRTCEGEHVPGDACNVHYRYGYRLYIGAVAVHGLLLVL
                     ALCMHSYIHNIRVTSRNQLRAERHRISRSARAEDYIVHMLNSSTTSSVTRDAAGGSCA
                     RSTWDAARTTSQLDGNRSTRQPSIVASVPRSATATISMGAVAAPFNSRRHGDQDGSED
                     EGANGDALRSVNSTSLQPAAPAPDNFLAGGVDFNVQSAHRGIGCGIDTATTAASTRPT
                     PGSLPLQHGELHVSFLGVPDDTDDDAGFGLLSDSESRRYRQHPSVPTLSFDDGGARAA
                     AAGAATAAFNASDHNTESSFVTRGRSAGAAVAAAGDNAQRQRRDRQRASPGDLSLPRT
                     GRQRSAGPQTEATESSLSSKQKRGLPDKRRAAPVYQQARKRQHKFLRFFNREYDSNYL
                     TAAELGVLIAGATDWVYDDRSDMYYSFDRNMFWDPLTQEYYNCALKSWQESPDQAVEV
                     RDMLDYVLESPASSRSRSDSRFNHESNEDSLMLIESPTRMATDGDDVNSSGGVH"
     gap             818098..818237
                     /estimated_length=140
     gene            complement(<819674..>819922)
                     /locus_tag="LDBPK_272000"
                     /db_xref="GeneID:13386786"
     mRNA            complement(<819674..>819922)
                     /locus_tag="LDBPK_272000"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862003.1"
                     /db_xref="GeneID:13386786"
     CDS             complement(819674..819922)
                     /locus_tag="LDBPK_272000"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862051.1"
                     /db_xref="GeneID:13386786"
                     /db_xref="UniProtKB/TrEMBL:E9BJD0"
                     /translation="MEPQLTRKEVDVVLAEQELQGQLARVYYNLVLRQRTYRAHLDYI
                     KKIHGMIRDMEGRVEALTPFHASSWSWRLDGSPRGDTT"
     gap             820294..820392
                     /estimated_length=99
     gap             821253..821516
                     /estimated_length=264
     gene            complement(<822030..>822476)
                     /locus_tag="LDBPK_272010"
                     /db_xref="GeneID:13386787"
     mRNA            complement(<822030..>822476)
                     /locus_tag="LDBPK_272010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862004.1"
                     /db_xref="GeneID:13386787"
     CDS             complement(822030..822476)
                     /locus_tag="LDBPK_272010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862052.1"
                     /db_xref="GeneID:13386787"
                     /db_xref="UniProtKB/TrEMBL:E9BJD1"
                     /translation="MNPNESNTGHKVLIADLPMMWPSDMRRFEKEGGVWGRQFRQRRR
                     QLTFALTVSAATTLLGSWYVVMRRRNTYFVLFSTFSGFSVLGFCVGMSLAPLWYENVA
                     NNKETSMMRRVWWAKECAKHWDYSQVNKERWIASYPKAAYPCKKIE"
     gene            complement(<823943..>825154)
                     /locus_tag="LDBPK_272020"
                     /db_xref="GeneID:13386788"
     mRNA            complement(<823943..>825154)
                     /locus_tag="LDBPK_272020"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_003862005.1"
                     /db_xref="GeneID:13386788"
     CDS             complement(823943..825154)
                     /locus_tag="LDBPK_272020"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_003862053.1"
                     /db_xref="GeneID:13386788"
                     /db_xref="GOA:E9BJD2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BJD2"
                     /translation="MSACTVYVTGMPTSATEDDIFDFFTRIGNVAEVHMPSAEHQPAS
                     GAAAAVEVVFDKPEDAVSAVSISGSDFQEDIPIYISAVAPTAAATEKPAGNATTTAAN
                     AGGDSNGNAAAAAASAEPGAGLLMRRSADAERTSKNKVVISSIYPHTTRAQLREVFSP
                     CGAICDFHLIPTRHMAFVGYTTEEACEKALKLDGAMVNGNPVVVRPCPPRDDAPAPAS
                     RRDATRRGNESTTASAPSRRQLDVRVVVHGVPSDVTKEALRAFFSPDCGPLTDVFIKP
                     EIGVAFVAFTSAENAKRAISKSGEMLMGTRVRIEQRLPLICRRCDKEGHVAAQCKERS
                     HGSRRRSNERRRRRRSSSSTSDRDRRRRRRSDSLDRDRRRRRHSRSRSPPRRRRHSRS
                     PPRSRSPPRRR"
     gene            complement(<827782..>831081)
                     /locus_tag="LDBPK_272030"
                     /db_xref="GeneID:13386789"
     mRNA            complement(<827782..>831081)
                     /locus_tag="LDBPK_272030"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862006.1"
                     /db_xref="GeneID:13386789"
     CDS             complement(827782..831081)
                     /locus_tag="LDBPK_272030"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862054.1"
                     /db_xref="GeneID:13386789"
                     /db_xref="GOA:E9BJD3"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BJD3"
                     /translation="MSASASASSEDDATAGSVTTTPAHGDCSTAPPSASADAVPSSDF
                     LQYLTEKAVALKLFREGQPQRAATRASDSTAAAADSTKTLPHTCEAEPHDAVGLPTVV
                     AANRPCTPPPAWATTLPSSISDKIPFNTFLSHLALPGVRTGAERMTDSPTPMQDGGLG
                     RGAEGADSTRAVPENRAPSSTSSPPHVHQLRSRQFFLPALCEVCKQTVLKAKMWPQPQ
                     PQQAMLTTLQSGTASSPPFALLSFLASPTTPSEAACSLLPATATPSSSSTFSSAVAAV
                     AAAPSQPFLGFGTEGYRCNICGLVLHIHCLAKMRLVHECEVLAPVAHQMPSTLPTSAL
                     SSPSTSALTTSAAVETGTTLSSMVRGPFSWDRAKAMLVSYLDPDDSANNLRDANAKAV
                     LKGVYALLDTIIARYPTLTPLTFLKRYSTMQDLSNAHQALYAACVASLDDTALLGSIS
                     WDEVRLHWPAQTGVAATTCSTPAFAALRPLRVDKSVLENLKTSVRGAGVKGFFSSPFL
                     RKGAATPMMAQRAASDDNDDDVASSTWPLAHYPVQLLLWQAMRYATAVYGEVYRRGSL
                     SSTFSVALLFTIKRSGAEISKQENDSAVTSLLELPPSALRLSRWASQATEPSYALLVD
                     DVAGRIVVSFRGTLNTFDIMTDLAAVSQPFCGGYAHQGAAEVVNTLFDQRASRYGERV
                     EQQRKAAAAATAVEAVTDATPTTAEDAARRVNMRATATPSSPAKRVVGVEEQTSLSAT
                     GSETDDISAPEATKEPVMVALEPYALQPLDTPDGLLDGLEQLAAEHPSYSILITGHSL
                     GGGVAVLFATRLHYDEVLPPAVLKRIHVIAFAPMPTLSLPAASCFDQVSCARADGGYS
                     RRDVPQQSAPAGACFPVWSVVNGFDCVPRLQVNTIDRLLRQVVGPQIAASAEVSSAAA
                     PAATDARQQALRDLRERDTATYGVASGAHAETEMVDMPTAPTKATATEVPLPCVHDNT
                     IPRAVDDTVEDGANTSVSEVMIRVCTSVDSGAQGASNLKSLPSKSEDRRHEARDLSHE
                     LHHPGRVLLLTSPWDGMRNRLVDVPRGHPVMHELFLMKSMLMQHMLDSYSASLGEIHE
                     NPRYASREERS"
     gap             832310..832429
                     /estimated_length=120
     gene            complement(<834256..>835269)
                     /locus_tag="LDBPK_272040"
                     /db_xref="GeneID:13386790"
     mRNA            complement(<834256..>835269)
                     /locus_tag="LDBPK_272040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862007.1"
                     /db_xref="GeneID:13386790"
     CDS             complement(834256..835269)
                     /locus_tag="LDBPK_272040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862055.1"
                     /db_xref="GeneID:13386790"
                     /db_xref="GOA:E9BJD4"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:E9BJD4"
                     /translation="MPSDTLQIKLSQDSLFFPLPFTNATIDNVVQVKNMLPVVQGDPK
                     ANVISFKILSRVQNRYSVHPPVGFIGAGEHATIIFSFNPEHVKMAKNPEERELPTEAT
                     KDAIHVDFAVVDAQSVQTALAHWVPGSKETKASREVVADASRFWKQRGQVKKNSPTTM
                     RYKLRCVFATRNNVPDSLVMCMKEEGGCCKPIADGAAPLPRTRPPVTSSTQPQNTAPP
                     EAPPHRYSESQRTTPTTRSPRSDACYTPCATGPPRIFTTGPGAAAAASAPSASPPSSA
                     PTQKSRTSAGSTCGDTTLKSIAEQVMNYKLSYRAVGVLLFLTLLCGLRDQSNLLTWLI
                     AKQ"
     gene            complement(<837186..>842747)
                     /locus_tag="LDBPK_272050"
                     /db_xref="GeneID:13386791"
     mRNA            complement(<837186..>842747)
                     /locus_tag="LDBPK_272050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862008.1"
                     /db_xref="GeneID:13386791"
     CDS             complement(837186..842747)
                     /locus_tag="LDBPK_272050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862056.1"
                     /db_xref="GeneID:13386791"
                     /db_xref="UniProtKB/TrEMBL:E9BJD5"
                     /translation="MSATTSARPPGRRSTQMYGVPSSMTPADVASAAGATAAPPSEAA
                     FHAVLPAEDGGVSPRGHNPPRMQYKFISKPPSPQPAYNRIADVSVNVAGSRSPAAAVA
                     AAASTMTIRGLRGRLSDGTVHRKPYPFTAAQPSAGGHKGTARPLLSRHGRCLSRARTG
                     MAVSALTAVSSASGAGADTATTESTRMVKEASLRNTWAANFNNTATLRETVSTSNGAY
                     TAFEEELVRELNELRRAPAAYAAVVEREATIGAPYVQENDLYFCDESAAESAAVELRR
                     HLEEQYCPVQCEVASTASSAVSRAMMQAMSPKKGMQAGQEKRRSKKALDGPPSSPALS
                     TGVGASSTARRRSGRPSPAPQRHTTGSGAPHGGGGPSPRRCTISSDLPGGGVTVAGVS
                     ALHATPATLRNQGLHELTLSQLRHQFRCQQRYRAALEVALRDMRASQRQAEAAQQAAW
                     ASEAEKALRKGRRLMTTNAFNVNMGASSTPQQDNTGEPSVPSVVPHSHKKLSHTSTAN
                     SAMRTSGSSEDPVSLRRCEDMAQLRSMHEARIRHIKQKLRDVRNACKRSLAAANIVLD
                     AVRALREAQPAPPVQRHRGLSLAAHDTAVMYYGDEERVAALQDLYAVSRATLVGLAEH
                     PGAPTAPLLTLEQLSRRLEQCQVEEAKPKITSVSSSPGRRSRSEDGEEGDVRERSGTE
                     AAPSWVLPLLSEEASLLANVAKNACTTYGYISGEVHGLHLQVVTGSPRSLLLQMILGL
                     LTPVLDLSNHSLPQRSGQATQRASTPATANSTNATRCYAGVRIEGHAYAAAGAPTGTR
                     DAATRADLPQFQVVSSQLGTGERDRADQVPAARLSKEEAQLAAPEHKSSNSGTDAITD
                     APHAQRAAAAAAQRLWPLLWTGAYTIGCAWQQVRGWRDVPTFAEACEERQSIRCASSG
                     TLSSRGAAPPFTEEAHTVTCTTLLFASGFEEYEVVRGCHHMSPAATRRVVQSPPVTVC
                     DGGPQSASHGGSIADSVEARRAAVDVHSTLGVTLLTPTMHPMHIHASDPSCRAVCVAV
                     RVPYTSPGFSFTHSSMCAGEDGRVCSGGCRDPSIRIVAQVTRQCELTPPHPTTCTAEV
                     LTQRSPVDPSVWLVLVDTAATFQRHAAAFTDNDGAVLKADASPGTGATTMSAASAAVP
                     LALHIYAKDMNDAMGEFEHVAFIRMQQYPQPREVNAGAVAIAASATPATPAPYVLMEP
                     EWRYLLNGLACVAASPLSTQTATRLTATSHTAAQASVLTKVASATPTARSVGWATLHE
                     PLLGRDGVLLCPLSADLRESERFGDMLEALRIRQETTISGRDGKAAGAAGRVIRVAVQ
                     LPAYSNVRWWRRRLMKLRCLQEKLTDEVVAEGDEQTAASTAQSPSAACTHQDRSPESL
                     AEGCHLPATEFAPPSDDGHADAKATPLGASNGSGEATTSAASVTPILGSPCSSANPAA
                     MDAEAGAAVEGSSSAEVVSEPPKGKGSEKKKVSSDGKREAKRSPTSAAAGSSGAKAQD
                     RHSPSNVAPSGMSKKKAQALHKDSDGAIASSTAAAAAAASTGSSLAPTQARLCTLSVN
                     TAPKLPESGALREYEIMVQRAAGATLVASRSSSVQPCLQPSLISIIGLRELCAQLHTD
                     LQVWEAHLRRVRPILCGERDRIAAEIVKKKGKEQLRLQHDHEDVVGELQVIERGVASL
                     NQAATAATDALRTRERTQMLRRARLMRIAEELAAIESSPPRLAPKDTSDKVVTAPLPS
                     TPPPSAAPKVTLRFFKTEGVAAGSGCKAAFAVARPPQHLSSQRAGVLDCTMREGAPKP
                     SEREAGEVTLTPQPSSAHDATSSSSPLQPLEGDGNSAADVYAATCSIPLTFTGCATLY
                     IDGEVAVTWRV"
     gap             843860..844183
                     /estimated_length=324
     gap             846345..846415
                     /estimated_length=71
     gene            complement(<847689..>850715)
                     /locus_tag="LDBPK_272060"
                     /db_xref="GeneID:13386792"
     mRNA            complement(<847689..>850715)
                     /locus_tag="LDBPK_272060"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862009.1"
                     /db_xref="GeneID:13386792"
     CDS             complement(847689..850715)
                     /locus_tag="LDBPK_272060"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862057.1"
                     /db_xref="GeneID:13386792"
                     /db_xref="GOA:E9BJD6"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="UniProtKB/TrEMBL:E9BJD6"
                     /translation="MPSEATVALVSKHEEAGTVAAVSPSIPSSLSVASSSHKEMREEP
                     RRRRAEVAEDVRVQQHRATSVPTSPLTPPLLLQRNREVVALGNYTSRGVEGSDEGSVS
                     TTVTSNVTDRAGPAGNCKSGTPHSSSSRVLDLTPFAESAEDDRDDRGSKWDRTAAFGI
                     PAPATLRISTYRTTADITTDRTRNSKNSSSTYLHLGDAWQEREKSSPDANTAAIPTAG
                     MTPPFSISLSSDSLSCAMRSVRRSSPELVRRGNGTTRQLSRKCLRNANSACGDSGRCT
                     GPVARTTTPTTAPSTALLSSSYVACFQGHNAMPISDKDGDSSLRLRPRRCRGGSSCGS
                     HEHWTMKPRLSGVNEVLLQSASASGEPQLFCQALAAFQLWDTLLRLELHSNSAGGTYM
                     VRLARPSSSSATATFAATDSDSHGAVVAVLKPCDEEIGQESNPHANRESDRTETFAPG
                     SGSRREVLAYLLDHGHNAGVPPTLEVASTYWAGVGATTANSNGGGGAATASLSTGTLG
                     AVAGGGDAPANSGLRSSRTGGTDWRGIGADDGDSVAARVAASTHLRIGSLQLFVPGCE
                     EAADVLPGHFDVDEVHALAIFDIRTLNGDRHGGNVLVCNYHRCRDGRKPVMARRPRCA
                     RLANAAGSDGTASSPSASSTAARLSPEMPATITTAKEDVPHLIPIDHSYICPSGYADP
                     DYEWLSWPQSKKPFSERNLTYIAALDAVADAELVRSALLAHSGVPTHDVSTPRTSAVC
                     NDFEMAEGQPDAALTSLTRDDAQYARAAMGCATFDAASAALASRHLPREFFGRGAAAA
                     SLDDLTGLPPLPTASTKRAVAPTTSAAAAPSASGAATAKKSSTMDGGAEAPSGHPYVS
                     TWDPAAVELMINFDRGDSLSTEAMHQDAAAVRARAMSTAWSASSSSSTPPLESLHAGP
                     RGHASNSVAYDRDAANTAAEVMCCTTRLLQIAALEFHMTAYEIGSLCRRPRVTQASVL
                     EEVLEQARDEQTWEPVWFRLDDVVRQRLADLSTSGQ"
     gene            complement(<854163..>854324)
                     /locus_tag="LDBPK_272070"
                     /db_xref="GeneID:13386793"
     mRNA            complement(<854163..>854324)
                     /locus_tag="LDBPK_272070"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862010.1"
                     /db_xref="GeneID:13386793"
     CDS             complement(854163..854324)
                     /locus_tag="LDBPK_272070"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862058.1"
                     /db_xref="GeneID:13386793"
                     /db_xref="UniProtKB/TrEMBL:E9BJD7"
                     /translation="MRWVSYQSNIYKYGLVFMCAASLLALMNDGGSTKESWDWMRQQY
                     DLRQAKKIQ"
     gene            complement(<855151..>856281)
                     /locus_tag="LDBPK_272080"
                     /db_xref="GeneID:13386794"
     mRNA            complement(<855151..>856281)
                     /locus_tag="LDBPK_272080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862011.1"
                     /db_xref="GeneID:13386794"
     CDS             complement(855151..856281)
                     /locus_tag="LDBPK_272080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862059.1"
                     /db_xref="GeneID:13386794"
                     /db_xref="UniProtKB/TrEMBL:E9BJD8"
                     /translation="MRRTLQTANNAMGGGLPIHRDTTRKPRLVTEVGTWLYKKETMQN
                     FSKWCRERQVRAYGNVKMTSTIHFARCLRASKPIRPGQAIITSPLSACFNFLTVAKEM
                     YDCPSTAFPLQLNWMNYNERLPFMRSACMYEFAQAGWMTRIASLEESVYTPYVHYLLE
                     DTRGRDGISNGMGKEREEESGVLDHYLSEMATDACEDPEVFLENFFRGLACVHLRSQP
                     IEAAAVEAFVPGTNFFKAKSSEMYVPTLVPLVDAVPQLENGSHNTVLEYYPFTDVATL
                     RAQCDELQISFFEKGKEEPIVAQETRTARGVAQRINLESELMDPALLEGGGFFALRAL
                     EPLDVGDVLYLRRFPDVWSRAGERMMDAQVMEANRLLSRDDE"
     gene            complement(<857863..>862638)
                     /locus_tag="LDBPK_272090"
                     /db_xref="GeneID:13386795"
     mRNA            complement(<857863..>862638)
                     /locus_tag="LDBPK_272090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862012.1"
                     /db_xref="GeneID:13386795"
     CDS             complement(857863..862638)
                     /locus_tag="LDBPK_272090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862060.1"
                     /db_xref="GeneID:13386795"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BJD9"
                     /translation="MDSRRALVKRYVFGTNHDGKNCLHWLDDGSLVYPVGKTIVLQQP
                     KSCTQRFLEAAYQSTAITAIAMSANKKFMAIAESGPHPQVQIIDTVTRKRRKVLSVTD
                     LDSDRYVALSFSSDGRHLVTQGGAPGWNLHYWNWERSQPLASVSVGQLYLTSAQAQGS
                     TSSGNAASIDSDSILQEGGTQKLDAAARTAARSALATLRAPPQVVTSIGVCPLDPLLV
                     TVAGIGFFRFYRYTEGLLQPQPSTGVPREQFESFSTHLWVTEHNVVVATHSGRLLLIQ
                     DGRYMSAIEIPPSPPSHLRGSTSEPLLEGAGAAVPVDVVMCIVPTHQQQHQRAQHHSG
                     FIAGTSQGNVLIFQGDNNAAGADGVADALNGEIVAGDTTGYTFVCRLEVPAYEAGELQ
                     QQRSPHAPHHASAGQKPAAPALMSITDTAAAAAVPPSTTADAERSDKGRTGRLFQLRD
                     QIDAKGARAKASAGTAAGRRGQSTASDDASAYKGGIDNAGQTMGSNGQRYRVSALALD
                     QAEECLAVLTASGKLYGLNFQQNWAAREAMFHTSNVSTMTSASAGGAGGDEAPVLLAQ
                     LPSLLEHSGGDLGRASLAAIPGHVSTRSMLFQSLYPFTHCGRVNGMDCSVRKPLLITS
                     GSDHSIRVWNTQTGQLLMCQFFASEPGAVAIHPDGLMAVVCFPDKVRVMSVLWSSLRE
                     RRTINLRNASDVFFAKGGQLFAIVHHNLVYVEDANTCELQGQLRGHPQRIKDFQWCST
                     TAYPTDNRAVTCSSDGMIMDWNISEMRKQTEHSDRRFQYVAIASDDRSVWAVAAPTPA
                     TALDVSWKVLLREIDRQSLGTINAGTNKGVAAGGPGARGAAGGMTATSSGGGGGISNV
                     LGNSVGDYEFTETALTRLLVAPHQRVLIAGAEDGSVKAMTFPLQAGIQEAPIAAHALP
                     VTRMALSFDETTLFTASADGSVIMWEIFAEKDKVKPTGAGATSTTGQHHDPASRRNMN
                     FTEEVLVTKQEMEEQRIEIESLQQYIEKLKTDMESEDKRRAHEQGTRTRERAEELQQD
                     AIALAAEYDALQHAKADQEQTFLDAKNEMARDAAQTLEDVEMERQREVDTLADECGAL
                     QHRLETTKVAHAAELKTLRASLAQARTEDEAHFQDVLSQRTEAVRKLHRQLEHSNETN
                     RVTLHQLELDTDSESQSVFQKQQGTLQRARERFLHLKGEGAVMRKNSMRLEREIEVRT
                     NELQLLDGAKAALQSQLTDLTQQVAQLHQDIDERDSVTEKKEKVIYSLKKRNQELEKH
                     KYVLDHQIRELKGQIEPKQREIAELNQETKQQNANLEEQHTSNLTLRQNTEELKKDIA
                     EQQRTLQARLRELQGLETYRSRAERDIGELAHQLQDPASLAAAVARLYEVHVAPRDVK
                     QIAPADPNVKHELQSQLEYLSTSVDALRRKLKSDEQRHKKEVSAMMTENLSLIREIHS
                     LRGEMDHLRARVAADTVSKQQQQYQMQRRAGAGGGGACRGAGRANDERSSVADAGATD
                     TMGSAVTDAVGRSIQLSPSEVDNTRGGNRTRRRGGTGGSAGQRPVTPQSEIEISSREL
                     RMLRAYIEKLERSLAGLPDSREVQKESVRLPPVDSLAIT"
     gene            complement(<863757..>864620)
                     /locus_tag="LDBPK_272100"
                     /db_xref="GeneID:13386796"
     mRNA            complement(<863757..>864620)
                     /locus_tag="LDBPK_272100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862013.1"
                     /db_xref="GeneID:13386796"
     CDS             complement(863757..864620)
                     /locus_tag="LDBPK_272100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862061.1"
                     /db_xref="GeneID:13386796"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BJE0"
                     /translation="MYASKENAWEGYTDDRFYGAKRFREYWQRMLADRGVRYYMFTII
                     ILMMAATAKLWQMQNLQREESGLLGPRKKQYRSRLTIVLDVDETIVSYGDKAFRLKAG
                     LVPRPYLAELLDYLTSIDAEVVLWSASSERYMRQVLGIIDPMGVRVSQYLSRGREWFT
                     HDNYYEKNILWLKRPLEDTLIIENRPLSVRNCNGNAILVDDFIRGEYMDTGQDYPAND
                     HALRTIKSIVQDLETSGMSVPEYLANHKVRHKEIKEIPCHLAIRQLPDEIARGVFYFV
                     GDKYKTKPNAA"
     gene            complement(<866152..>866640)
                     /locus_tag="LDBPK_272110"
                     /db_xref="GeneID:13386797"
     mRNA            complement(<866152..>866640)
                     /locus_tag="LDBPK_272110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862014.1"
                     /db_xref="GeneID:13386797"
     CDS             complement(866152..866640)
                     /locus_tag="LDBPK_272110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862062.1"
                     /db_xref="GeneID:13386797"
                     /db_xref="InterPro:IPR012932"
                     /db_xref="UniProtKB/TrEMBL:E9BJE1"
                     /translation="MIKFNLKLMGLCLVGFLLSSYAYSVEVHAERAKLLGITYNAYCD
                     IGPFSCTKVFSSEFSSVTHFFGLPKTSNALVGMLYYTVEMLCCWHPTLILMVSAPSIV
                     ATVCLAFILTVTLHDFCVVCCCTYVVNVTTVYVAYRWWKRSAASKAAVASSSSKKSKK
                     RA"
     gene            complement(<867637..>868356)
                     /locus_tag="LDBPK_272120"
                     /db_xref="GeneID:13386798"
     mRNA            complement(<867637..>868356)
                     /locus_tag="LDBPK_272120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862015.1"
                     /db_xref="GeneID:13386798"
     CDS             complement(867637..868356)
                     /locus_tag="LDBPK_272120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862063.1"
                     /db_xref="GeneID:13386798"
                     /db_xref="GOA:E9BJE2"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:E9BJE2"
                     /translation="MLGSGKSSGVVNEASNLKANENLTATIEQMNSKAYRQSRDMNDV
                     IPTHRRPVTEAVRDNGVPVYDPAAEKHAEKVERGNAAGAEDDDDELMELRRMRLQCMR
                     ANQEKQAEWRSKQHGEYREISQDDFFNIVVREKGGSERVCVHFYHKDFETCKVMDRRL
                     SELSRTLLAVKFVKIDAERSPFLVERLRVTTLPHCLLFFNDVCIDRIVGFQGCVTEDG
                     TLDANLLRERIVHALKLKGDE"
     gene            complement(<871189..>872247)
                     /locus_tag="LDBPK_272130"
                     /db_xref="GeneID:13386799"
     mRNA            complement(<871189..>872247)
                     /locus_tag="LDBPK_272130"
                     /product="dual specificity protein phosphatase, putative"
                     /transcript_id="XM_003862016.1"
                     /db_xref="GeneID:13386799"
     CDS             complement(871189..872247)
                     /locus_tag="LDBPK_272130"
                     /codon_start=1
                     /product="dual specificity protein phosphatase, putative"
                     /protein_id="XP_003862064.1"
                     /db_xref="GeneID:13386799"
                     /db_xref="GOA:E9BJE3"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9BJE3"
                     /translation="MPPKVSELPQQRKNTVHHLPDDDISLFFRVLRFLSAHSHLATLD
                     AATERLDDADRSPSTTPSAPVARRGVQCTQTGTSASVNNQIPTPPVLREPLEEFRMMA
                     TNLPIDQEGLEAARKTVCELLEGLCHKLADPAITKELRQKVLLTDGSELLGNSSSSSG
                     ALGISAVECGAIRSLSSFGIDSLNQMQEIVPGLWCGSYHPAIDRELMKRHGITHVCCC
                     IGTPPSFPGDFIYMTLSADDRPDYDMTPHFAHTFEFIENALVTNHGGVLVHCGAGISR
                     APTVVSAYLMRKLRLCSSAAIHLVQQHRPCASPNTGFRQQLYEYGMKIGVREQEPAAR
                     RELASESAWRAANALRRP"
     gene            complement(<873459..>874496)
                     /locus_tag="LDBPK_272140"
                     /db_xref="GeneID:13386800"
     mRNA            complement(<873459..>874496)
                     /locus_tag="LDBPK_272140"
                     /product="ribosomal protein L11, putative"
                     /transcript_id="XM_003862017.1"
                     /db_xref="GeneID:13386800"
     CDS             complement(873459..874496)
                     /locus_tag="LDBPK_272140"
                     /codon_start=1
                     /product="ribosomal protein L11, putative"
                     /protein_id="XP_003862065.1"
                     /db_xref="GeneID:13386800"
                     /db_xref="GOA:E9BJE4"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:E9BJE4"
                     /translation="MLRRSAVRYLKARPKTVNIEPGSNRFLDPNVEAKARDIFAVPEF
                     PNKAVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKAFNDRTKPHFKDDIELIV
                     RIQVYFDKSYIFRIEPPPTAWFLLRAIRKKRGETGPVALRGNYCAYLTLEMCYEIAKM
                     KQMSWGKVEYPPIEVRVRRVVGQARRMGIAIIGIDTVHSSPVKDMTEKQYLEESEKHR
                     KVHMIQYEALKAKELESAPLIERLHRPNMAPLTNTQLEEGLKDANLLNALWKSSHPKS
                     LFAQDTRDREMARRYLNTRGWFKEMTPEEMRVVFLNYRLPEQDRQRQLNMTDGQAQSQ
                     AFWSRDATSPQ"
     gene            complement(<875623..>882000)
                     /locus_tag="LDBPK_272150"
                     /db_xref="GeneID:13386801"
     mRNA            complement(<875623..>882000)
                     /locus_tag="LDBPK_272150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862018.1"
                     /db_xref="GeneID:13386801"
     CDS             complement(875623..882000)
                     /locus_tag="LDBPK_272150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862066.1"
                     /db_xref="GeneID:13386801"
                     /db_xref="GOA:E9BJE5"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9BJE5"
                     /translation="MAMPEQMSRGTPPPPPAKPSSQQEGDLVGLNREVRALGDLLRAY
                     HFSYRPLPMCVPKTTPSISNTAQRSRGGSRKDKRAPAQLVATSTDAEEAWLLPLQRDV
                     VQCVLRRLQVMELVLKRLVARGTSQKGGALGSPAKAVHEEVTAFFAEEIRVVAELVAL
                     RGVHERDAQSLTCLVHVLTAAADAGVVVSVATLVEAAAAAVQHSQCGVKEGRASVATT
                     AWRSCVPWLLHCYSTTDMRVSPSLLTTSVQTLGDDAASWSTASAWMTAAADRVCATQS
                     TELLQLTPTPAEARWKGVVAGSGADTSVQREKAARAHTFCPWQGVLDAEATETAEAQT
                     YTFEGDGGGNRRRAAGETWLRDWCAGCGITDVGGESNSDSTGTWHPYWKLVVSGMVRS
                     CARAVDAIVELSEGTGEERCSDELSSARPKATRHRSPASSNSTLATLEEIQFYAVGSY
                     VSLRRIASSLQRHHRLMPLLQLHEMVSGFVGPSGAVAGALLPPPQRRQWHENNAPRRR
                     ADGVCGSLSTGAAAAQWRRRLLSGELLQPLSTAPGTQGERRRHRRSDRPPPAYLPQRH
                     QAGAMLWREVALFDAYTLITIGHVSEHAVDGAEVDKNAVLQQLAWLQQECAQHLTVLE
                     ASDSEVTERVGTDSEPAESGGNIDSESSATKDRGASYSMPLARRSMLLRCLKQRTRAG
                     LIAKLQEGLRLSAKVLARWGTPEQICALYLRYPSMGASWEVGRALLQCGQYSVAVEVL
                     ESLLQASATARGASATYPSAVSSTSSPPLLLSNSAIAVRQLLLEAMEGAAAALVQHSQ
                     QCHAVPASGSSSDAAATSIDGSAGGEEVPLPAELRTRLHSLYAHLYSLPIPLPLCLHA
                     VVRGLTSASEEAAVYGIHNDADATSPLAARRHIRSKFSTSADSPSALRPPSRQPHTSA
                     EERARTTAVLCTYALRCHLAENPHKGLLAKTVELWASCVAPYLCRRSCDGAEASPASP
                     LTSLKLSLTDQYLRAVTARILCGYPQLPVARLLLSRLVQLMTPPPSMAPSGTLDAPST
                     DDADNVSATSDARVALTVVWLLGVLYKLAGMPAARHSATSHGSRSHANVAIPTSLAYR
                     LCVPVTTTTASTQDTEKSALMSCDTQLLAGCRAWNAGFTERYALDTLRLMPRIALEAL
                     ERLLRSLARHSAAVAATSPTGSLIAAVQRAATLSGRSVGFFHDRVSVILQYRRAEEEQ
                     RQPWQCSACYLWNSRYARACKRCHALSTVLLQCRACGCLTSSADDRDDHGLSCDVCGI
                     ALVPPLSFQSSGEVPQSSSSAADPLLCASTIDAGVVHVRTQDLTTAEGRRFAAAAAAT
                     VTGTGRAANRFTASAAIARVVPLRQWTCMHCRTVNDPQHVFFCRGCGRATTDPEKREA
                     AASAAGADGASNSAAALACEGCRHSPKSIEARMRPWCERCGALYQRVRELHKPAAGNC
                     TLSSSTNSPSHVPASATGTIPPTAASTGQHSPYLWWCAECTAALNPWTRTHCELCGAG
                     RPAASAAVPEATPGLSLLSEKYNAAAPFIVLPWLMQACHSCKAQSRVGMLHCWQCHAL
                     LTWPLEVQRAVSDGWRRWVTQVAHIVMDVRDTELQTEDGAACSSTGADTPLHVPCGTQ
                     WLCLHDGCMHVNVVHGAAADAYGDSGATPAPLCHTCTACAFAPRRPAEVLSPFHDRFA
                     WSEAAARLSPTNAALVVEALLLPPSSPLPGDVTMRHSESFGAVSAASEVLSAVRSEET
                     AATAPQSHERWLHRSWLSGVATTFVCTSCGASGASGAAAPSTPLPVRLRPLFMVNVCA
                     SCGFCAWGRSSCAYDIPGTPCAGAGDDVRQQPSSSPARGQAREGAMAQPPLLPGEHAM
                     ALRLLLKALAHAVREWVALELPPSKRVASRSSCTDGGKASMAASSPVSVTGPSRRLDW
                     AWLSRFVFSGVRLITSSASEALPHGDDSRGGSCALRHQHCLHERLPWRGCDLASPQQA
                     CSAEPRVAVLESRGHGTGTVHSAIVDVRQVLDGVCALAEHRVRGSLSCSRSPRRRHRG
                     KGDHAHQQHASPPALPPCLQDAWTRRLILAALELIDVVNASTVFDDIGFATLRRLCLL
                     LRPDEVEHINTETKWTYLQDMKLSRSHVLRGCVQCEQCLTTHGPDQPCAAP"
     gene            complement(<884920..>886596)
                     /locus_tag="LDBPK_272160"
                     /db_xref="GeneID:13386802"
     mRNA            complement(<884920..>886596)
                     /locus_tag="LDBPK_272160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862019.1"
                     /db_xref="GeneID:13386802"
     CDS             complement(884920..886596)
                     /locus_tag="LDBPK_272160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862067.1"
                     /db_xref="GeneID:13386802"
                     /db_xref="UniProtKB/TrEMBL:E9BJE6"
                     /translation="MEGRWPPTLFTSPAHVYTSEVARGSSHPCWSAIPPGQLNAYGAA
                     TQVELAFYYTAACLSNAVSLMASASDTTPPTTIPLDHIVPADVCVHRCQVDMRDVVYA
                     GSTMEEADATLSRVFHLEQQQHQQPQTRCCTRPIIFLRYTDGVFVPRVCLSDISAAAT
                     GLLEEMRAARTRTFAPPPTGAELQPTSSFPDTLHTIAGQSSIVATAAAEAAAACEELP
                     WSRAPSSVGWRYPPTAVPRAGPLRMTIGDVKAATLATVAWQQLADLTEERQAQLAADL
                     NREAAADPLERAGEARCAALRVQLSAAREQLTLSTLELEALREQVEQRQRRLQRQEEA
                     QAKLQSYQVYTVSPEAGEQSRVTVREEEAQRARLRAQLARIRQRRARELCLVYTVELS
                     SQYANEACTRAADAKDHINKCALPIMFAGRAEADTASHLVASTAEDMQEEAIALGHAG
                     HLLVVLSILYSCALPYPIVLASGQSQVLQSPNISAEQVLAAPYTLTDARKYPLSCHKV
                     AERPLMMAGVHLLLRDGIVLAKAMGKPERRVLACSDRLGALLDLLLHDVE"
     gene            complement(<888198..>888938)
                     /locus_tag="LDBPK_272170"
                     /db_xref="GeneID:13386803"
     mRNA            complement(<888198..>888938)
                     /locus_tag="LDBPK_272170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862020.1"
                     /db_xref="GeneID:13386803"
     CDS             complement(888198..888938)
                     /locus_tag="LDBPK_272170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862068.1"
                     /db_xref="GeneID:13386803"
                     /db_xref="GOA:E9BJE7"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:E9BJE7"
                     /translation="MGLVDAYDRAATTEIANESLKDVRPDIVHQCLLALFDSDLAYQH
                     RLRVYISLFVRQGKVIEVSPALRPPRTYARFRGLMSALLRDGRICSTDGQVLMRLMPG
                     SVAPIIPHGAEVVGLTNSLSSPIVTATQLAQQAVAAPVDDSLQGGIKHVTAFYCISCT
                     DDCNLDGIDYITKSVCLSAYPMTAHVQCARVCEGHTRVEPASSVSGSAAGMGAGGGQA
                     KTDRCSTPEPPKRRGEVFPVDQAEDNEL"
     gene            complement(<890020..>893415)
                     /locus_tag="LDBPK_272180"
                     /db_xref="GeneID:13386804"
     mRNA            complement(<890020..>893415)
                     /locus_tag="LDBPK_272180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862021.1"
                     /db_xref="GeneID:13386804"
     CDS             complement(890020..893415)
                     /locus_tag="LDBPK_272180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862069.1"
                     /db_xref="GeneID:13386804"
                     /db_xref="UniProtKB/TrEMBL:E9BJE8"
                     /translation="MSLSATRLVDVDEAVRILHAACQRRASADALAPLVQSAQHLASN
                     CTPALFSSVLEACDATTAVEAAPKKLTMLNAAWKLLLTIATQEGVGPAYYSAAVVHMV
                     EQLRWGVLTHDWSDTKRVRLAAFFASHVVSTVRAHPQLLLLRTPDATAVIGQLVRLYF
                     AVCVTVATSKRDTEAVSLLYDNIVVRLHAVFDCLGNAAAASTASVYSSEPEAEATCSA
                     EEANRDGAASSSARGEAASGPSAALPPQQRCESPSSVVEELLTHCVSTAVAREVEEAA
                     DGGMTVRMALATAALSLYLHVVRGALEATSPSAAGTGAGSATQEGDPRQRDAEEDEAA
                     AAEATPAQASSWPRLTPLATQELVMKSLMWWTHCTAEEGKAHTSATRASLLQVEVLTW
                     AAALPPDIFCSEASDASSAVPPMSLRALWTDTLATVWQQWLFSVCDASQQSNEPSCAG
                     AAGSLRASESHGAEAMAPAAELDTSGPRDGKTEPPVVVAKSTRFASLLLSSVAGTLHS
                     SSAALMVLEAWAELFRRAEEAVTDVASAVPSPGILSTADDAVTIVHLLLRVLADLRCG
                     ASSLVEGFLRLQRHHFQDGRCKAGSEQPADFGSAHAMVAIPLQWICAAVALLAYGEEV
                     LGLHSPCAVATAGVECVGEVDGAAAARVITHLTAVMRAHITPQLCASKASEMATITEA
                     PAVTDATAQMRELLMSVRQHASAGGTGQTSASVKLARRAQPALLLLGVPRAWRALAVA
                     VARHRPNAPADADGADAAERCAMELKTVLLSLAPLLASLTHILQSLECEPGLSEASEG
                     SEMPSGLPYASVARWVAARLLDEVAVVPLTDSPEDAVLVACVRRWTDIAFASGTCSAS
                     DGSAAVHTDDPVALADAAAALLHVLECTTLPLEKLHLSEHATHSLMELLQGGDGSISG
                     EVNKVGGDDDADGRCPSWPALWHREAVQWCEMEKWLLARRRAMEESEEAEELASAPTL
                     AEELYAAPLHMDATAPPSSNEDLRRGLLYCEAVLRHLQARNLVFLDDTENQSKRRKTE
                     NGDDPQAAVAAVVQSVERIQELSRAVLLRAGNASRTATSGSTAAIDRAPLPPPPPAGS
                     LKASAPPGSEEETCRDVPAITLTDTESVGCRRVPLSAQVIDVG"
     gene            complement(<895366..>897339)
                     /locus_tag="LDBPK_272190"
                     /db_xref="GeneID:13386805"
     mRNA            complement(<895366..>897339)
                     /locus_tag="LDBPK_272190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862022.1"
                     /db_xref="GeneID:13386805"
     CDS             complement(895366..897339)
                     /locus_tag="LDBPK_272190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862070.1"
                     /db_xref="GeneID:13386805"
                     /db_xref="UniProtKB/TrEMBL:E9BJE9"
                     /translation="MKRRHAATRPPGTFAAAEGASPLPATELCVHECSTETAALVESP
                     PWHEWGESSGCGDDGKLHNELFQLEETAPKRGGALQTTPADALSKSSSVIGSGALQTN
                     LPIGELLLQKEEFLERLVQRVRASCAGVPPEHSASTCNAEQDAEPGAVRHRETSPPPR
                     RLSLPGVELADGTGVRSSDAGHRSLGRSRSRSLSLMSASSTVKGSTLATAAEPVQAQA
                     DALAGRRVRAAASATHQRSRATSPDPRPPSTDLYATGGALRSSLQYGRCSGVSRGRRS
                     LSAERPEHSDTCAPLDTEMQETEEVVNSFWGRAAAASTGTPGAAACRSLSGIRSESVH
                     NQLSHPQWNPHPVQAARPAWNQRQPQRKQRPVVSVPGSKPPSSARRCASRSPETSTSA
                     QGLRGARSEERDSTGASHRRAGRALRRTDSLSLQLKQEQTTAPRRAAGQSPGGTAASP
                     LSPPSARALFQIHDAHSIAKTTSPLGKEQETALQSQCDAALARATQAERQCNILSHAL
                     EQLLVDHAAEKAAWEVRHAALEQRLVSITEWISGIDAEANLDAAPQEASITRTPETAT
                     SDTTTPQMFTKRNEVGDAALLAATKNTAWEEDVDIVDLTNNSSPLPGAPGATPTPARH
                     DSANADCGNASTCQVHLPPSPPLILHMHAAATQ"
     gene            complement(<899085..>899477)
                     /locus_tag="LDBPK_272200"
                     /db_xref="GeneID:13386806"
     mRNA            complement(<899085..>899477)
                     /locus_tag="LDBPK_272200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862023.1"
                     /db_xref="GeneID:13386806"
     CDS             complement(899085..899477)
                     /locus_tag="LDBPK_272200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862071.1"
                     /db_xref="GeneID:13386806"
                     /db_xref="GOA:E9BJF0"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR024774"
                     /db_xref="UniProtKB/TrEMBL:E9BJF0"
                     /translation="MDLRTSVETLRAGDWFYKWTSKGDSVHRRWFWIDTKSYLLVWSN
                     YETYNPHFCGSVRLDDICQVTSRDLSSVDEDGFPKTYYVLLIETRKRVLQLATELKDK
                     CDTWFEALNNVMGFIHRNDMARGALIPD"
     gap             901360..901458
                     /estimated_length=99
     gene            complement(<903042..>905201)
                     /locus_tag="LDBPK_272210"
                     /db_xref="GeneID:13386807"
     mRNA            complement(<903042..>905201)
                     /locus_tag="LDBPK_272210"
                     /product="acyl-CoA oxidase, putative"
                     /transcript_id="XM_003862024.1"
                     /db_xref="GeneID:13386807"
     CDS             complement(903042..905201)
                     /locus_tag="LDBPK_272210"
                     /codon_start=1
                     /product="acyl-CoA oxidase, putative"
                     /protein_id="XP_003862072.1"
                     /db_xref="GeneID:13386807"
                     /db_xref="GOA:E9BJF1"
                     /db_xref="InterPro:IPR002655"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="UniProtKB/TrEMBL:E9BJF1"
                     /translation="MPARLSAHLAPRRHFARRTEPRLFEVNPTRESYVIETAFEEPTF
                     RFICEGVDVDFKEDVREALAKVLPPSPSNFTQREEGTALQLPQILLALRSLCRQQLVS
                     FAQVRSTPRLLASYYEALAAANPVLAVLAAEHYTFAGLVATHAKKSVRDVVLAGVDSA
                     ATIGCIAEQELIAEGTPLNTEARYDVHERCFVLRGTGKFGVVAAACAQWAVVSATLTL
                     NKKEHNGTHLFLVQLREGDLLSASGQLRRGISVRPITGENTTMAGCGVAVLHFEDVRI
                     PSDHLLDPYCITSESKVGYVAGQESQEPATEVLRTRRRIATGAIYIGVTKKLLTDVVT
                     YTADKYVVGPDYRRNYPFLGLQHIQSPLVSMVAKSYVYLVAWQRLLPVFTNPSGSPSY
                     EDYMRLAGTVHFLQENLLDLQTFADKTMGLHGSFASTGKDAAVTLVHLRQEDLDTSAL
                     IREVAFRSVTKNIGTTHWGWWLTSLLQPVFPALNRFLKNPLYSPRIADLGRHLIFFSH
                     KHYSLKKRLRQSRELERRKGGSEHEWYDWVMFRHRTVVHCGEAFMEVYYLDVMMKETE
                     KCSDPRGRKILRDIAWIYALTRQMDRLDFLLSSKMLSPGKAETLVSHIDNIVTVLAPQ
                     CVHLVEAMQVPEFARAPCRSATYMEAYWTIPGTNTHIERGDRLTLRDASKASSSKGRR
                     GAENAKAAQEAIRESPEEFDLFHGLADEPSYARRKAP"
     gene            complement(<906471..>908573)
                     /locus_tag="LDBPK_272220"
                     /db_xref="GeneID:13386808"
     mRNA            complement(<906471..>908573)
                     /locus_tag="LDBPK_272220"
                     /product="transcription elongation regulator-like protein"
                     /transcript_id="XM_003862025.1"
                     /db_xref="GeneID:13386808"
     CDS             complement(906471..908573)
                     /locus_tag="LDBPK_272220"
                     /codon_start=1
                     /product="transcription elongation regulator-like protein"
                     /protein_id="XP_003862073.1"
                     /db_xref="GeneID:13386808"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="UniProtKB/TrEMBL:E9BJF2"
                     /translation="MAEEVNYDELADLLASDAPVVSEAAEAVVGEQESDKPRKHKKDK
                     KDKKHKRDKKRPRGEEGNARSSDDERVKSKYVLDAAESGDSDSEDELSDTDFVDDDEE
                     VEDIDYGDRPQRYLFHEGDEKKTVEEMARYYEEADRYYRMHGDHEDELLTRSDLSSRR
                     LASQFLPHEDDPKVFAVKCRPRMSRVLVTRIVNKCYAYRVGRNYERKKVDLGIISVFA
                     LDHVKEYIYVEASRKRFVENVLNGLDGVFRFNIAVVDPKELLQTMETRPSTQKVRVGD
                     YVRLRQRFYRGDLAQVTALHPDGVHITCKVVPREDFVQKPFNKATKRLEPRFFTPRQA
                     VGAREMENSYVWGDLHFDREGYLLKTVSTRMVVSGAQMEQPSTEELARFYNDQREKVE
                     RALKAAEAAAQVPNISIGDSVRVTTGQLRNTIGVVENVFTNTNTAVLTCTMPGRVQPI
                     KVQVELSACTKHFSEGAHVVVERGEHAGESGTVVKSWGSIVLLFPDRAAVGAELKVEA
                     NDCHQSKLGSVSVHSKGVWQVFDLVSITEPNCVGCIVRLNRNDVDVLTENNDVRTLSY
                     AQVNAVGRDTRQTTDCLENTLSRGAEVHIQKHPWTPIGLEGQTGRIEHIFHRTIFVRC
                     HASPLHANIVALKAECVLLIGGRKTTRRAAPTQEAATGTSAGQYAAAAVRLSAGQSGD
                     SELWDESSMMDINASAVV"
     gene            complement(<909398..>909946)
                     /locus_tag="LDBPK_272230"
                     /db_xref="GeneID:13386809"
     mRNA            complement(<909398..>909946)
                     /locus_tag="LDBPK_272230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862026.1"
                     /db_xref="GeneID:13386809"
     CDS             complement(909398..909946)
                     /locus_tag="LDBPK_272230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862074.1"
                     /db_xref="GeneID:13386809"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9BJF3"
                     /translation="MPPKRKEDQGEVLTDTFRYPDGSFYEGKYGIKHDANAEAVSAVS
                     ATSSLSTAAKKHGPAGGAAAAATVASSSAPATLNAYMHGYGILADSSSARYEGEWRNG
                     LMEGMGVLSLPSGGRYTGEFARNEFHGTGRYMWADGSYYEGEWCRNQMHGLGVYVDCT
                     GKRWHGTFTNGNAAQLVAKVEL"
     gene            complement(<910529..>911272)
                     /locus_tag="LDBPK_272240"
                     /db_xref="GeneID:13386810"
     mRNA            complement(<910529..>911272)
                     /locus_tag="LDBPK_272240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862027.1"
                     /db_xref="GeneID:13386810"
     CDS             complement(910529..911272)
                     /locus_tag="LDBPK_272240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862075.1"
                     /db_xref="GeneID:13386810"
                     /db_xref="UniProtKB/TrEMBL:E9BJF4"
                     /translation="MDQGVVSEWNVVGTFRKRPVPQGPIVDFTSDVSHCNSLDNTDTP
                     ILLYEVKGGENQQQSRVPRYMARKIAIPPPSLRKMKVVSFAPPRPADAGARCDEDLFF
                     VDCPEPPSVPSHHRDRVHRQQPLVIGTILPLPLQLAFLMPSAVFLADIALLVVSLATH
                     TPEKALIAACCVLVLMPDIGALILLFKRGIYSVTIAVHLLLWPNVVLLFLQPFVSLLL
                     MVHFLLTTVMVLYCLRVRASTYMTFCRLR"
     gene            complement(<912142..>913086)
                     /locus_tag="LDBPK_272250"
                     /db_xref="GeneID:13386811"
     mRNA            complement(<912142..>913086)
                     /locus_tag="LDBPK_272250"
                     /product="protein phosphatase-like protein"
                     /transcript_id="XM_003862028.1"
                     /db_xref="GeneID:13386811"
     CDS             complement(912142..913086)
                     /locus_tag="LDBPK_272250"
                     /codon_start=1
                     /product="protein phosphatase-like protein"
                     /protein_id="XP_003862076.1"
                     /db_xref="GeneID:13386811"
                     /db_xref="GOA:E9BJF5"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BJF5"
                     /translation="MPLKGLSALKGNTQTILISPVRDKYSILMEDDKIRAGASSMQGW
                     RSTMEDAHAVYLSLPNMPGNIRDEDCAIAAVFDGHCGSKFAQSCAANIRDWLTSTDAF
                     KKGNFEKALKDAYCTGDVALHKAMPNELSGCTGNCVLIIQNHLYCANTGDSRAVLCRN
                     GEAIALSEDHKPTNPAERERIMKAGGFVQAGRVNGILSLSRAFGDYAFKDMSLKPEQM
                     AITVTPDVFHTELTPHDEFVIVACDGIWDMMTNEKAVEFVRNEVADHGDISLACERLM
                     NACLASTPTSYGTDNMTIIILQFKSLFLKKVESKFSAE"
     gene            complement(<913664..>914842)
                     /locus_tag="LDBPK_272260"
                     /db_xref="GeneID:13386812"
     mRNA            complement(<913664..>914842)
                     /locus_tag="LDBPK_272260"
                     /product="GTP binding protein, putative"
                     /transcript_id="XM_003862029.1"
                     /db_xref="GeneID:13386812"
     CDS             complement(913664..914842)
                     /locus_tag="LDBPK_272260"
                     /codon_start=1
                     /product="GTP binding protein, putative"
                     /protein_id="XP_003862077.1"
                     /db_xref="GeneID:13386812"
                     /db_xref="GOA:E9BJF6"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BJF6"
                     /translation="MPPKKQEKVESKTVLLGRPGSNLKVGIVGLPNVGKSTLFNILSK
                     KGVPAENRPFCTIDPNTADINIPDDRFDKLVRIHKPASIVPAQVHICDIAGLVRGASN
                     GEGLGNNFLSHISSCDGIIHMVRVFEEMEITHVEGDLDPIRDLEIIFSELVMKDLQCV
                     NGLIDKLTPIVNRGLDKSKKGDLDTLHKVKGVLEEGKQVRCCQWNGKEIDFLNTIQLL
                     TAKPAMFLVNMSEDDYMRQRNKWLKKLKDWIDEHTGEPMIPFSAELETTFVAMSPDEV
                     DKYCEEKKTRSQIHKIVKTAYSIINLIHYFTAGADEVKCWTIQRGTKAPQAAGKIHTD
                     MEKGFICADVIEWADFDRLESEAACRDEGKQHQQGRNYEVQDGDIIFFKFNAAKGGKK
                     "
     gene            complement(<915222..>915704)
                     /locus_tag="LDBPK_272270"
                     /db_xref="GeneID:13386813"
     mRNA            complement(<915222..>915704)
                     /locus_tag="LDBPK_272270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862030.1"
                     /db_xref="GeneID:13386813"
     CDS             complement(915222..915704)
                     /locus_tag="LDBPK_272270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862078.1"
                     /db_xref="GeneID:13386813"
                     /db_xref="UniProtKB/TrEMBL:E9BJF7"
                     /translation="MSQSNDDWGDMVLPGVYMIQRSTGSGMTSGTVPPDKAVNLELIH
                     LEIEETEEYIELLQRSNNEIAAYLKEQRESRFAEEEGGVGTSMIELSDGGLEEEDDDA
                     VFREALEENALVIARKKKELEQLRALISEQRCGCSCAHTQHHNPQPIAAPRNETRIIL
                     "
     gene            complement(<916017..>917267)
                     /locus_tag="LDBPK_272280"
                     /db_xref="GeneID:13386814"
     mRNA            complement(<916017..>917267)
                     /locus_tag="LDBPK_272280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003862031.1"
                     /db_xref="GeneID:13386814"
     CDS             complement(916017..917267)
                     /locus_tag="LDBPK_272280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003862079.1"
                     /db_xref="GeneID:13386814"
                     /db_xref="UniProtKB/TrEMBL:E9BJF8"
                     /translation="MDTDLLLTLSSFCRVRMQARPVFSTESRTFVDDVDTFIKHWQRS
                     RSEQTATLLAFLKAVAYASVEAETRREQLIGSWLLCSLLMERKADVGKLYWQCERARR
                     ILPLSLRVNRFGVDERDSSVLGSLSLTPEAARSHNKGMAPTSFSSNSVKGFRKEIRAV
                     EAAGAYNATLQAERDSQTSELDFVLPECAESKDVVIFCAQMIEKRKCFRSCCVRRLDD
                     CCHAKHLEACLTESGVQVVFVQQSINKQLKEAFRRQKVLFLERLGRRTVDASEKTLRW
                     TIFENFSDWFFFIRAKPSQTSWRCWATTTQHQCGLTLKLRIRHRPKNSRESTGSIQRS
                     SYGAVKKPVLREVNSKVLGTEGFGTGGDVEAFLLRSSFLAALLCGCADGEGNGGGENA
                     VLVMNYEISLRILDAVCQLCRVLM"
     gap             923153..934275
                     /estimated_length=11123
     gene            <935165..>936634
                     /locus_tag="LDBPK_272290"
                     /db_xref="GeneID:13386815"
     mRNA            <935165..>936634
                     /locus_tag="LDBPK_272290"
                     /product="sucrose hydrolase-like protein"
                     /transcript_id="XM_003862032.1"
                     /db_xref="GeneID:13386815"
     CDS             935165..936634
                     /locus_tag="LDBPK_272290"
                     /codon_start=1
                     /product="sucrose hydrolase-like protein"
                     /protein_id="XP_003862080.1"
                     /db_xref="GeneID:13386815"
                     /db_xref="GOA:E9BJF9"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR006232"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:E9BJF9"
                     /translation="MSHEQRIEEANNAVLAIRKSVDKEFYPHYHIAPYARSMSAPCGM
                     IYFKGLYHVFYQHQPFAEESGPMHWGHSTSENMIHWRHHPIALAPGEDWDRDGCFCGS
                     SVAYDDRLYVFYTGHHWLTDIADDSQIYQVQCLAISENGFNFEKRGIVVKPPAGFSHF
                     RDPYVWFQDGRWWMVCGGRDSKDQGQLLLYSTDDLEDWDDSTFMVLSKSEDRNVYMWE
                     HPCFFPLQRHQMLMFSPQGMQHEDYMFRNRYQTGLLMGLWRPNATFSVTSAFKKLDLG
                     HDFYGAQTFLTRDGRRVFIGWLDMWDTNMPTKQHHWTGMLSLPRVLLVDEATGRIRTP
                     PIKELESIRGNHQYLPRQTVRDNSQVRLLFDCTSYEVRVLFDMEKSTAEKYGLWLGRG
                     LEIYVDEQSKRLVVNRHYPNYGISGYRSYALPAQALLLVHAYFDMSSVEVFVNEGEAV
                     LSTRIYPARKDRTLSLFAANGTAHITRGDIWALNQSVMQ"
     gene            <937443..>938105
                     /locus_tag="LDBPK_272300"
                     /db_xref="GeneID:13386816"
     mRNA            <937443..>938105
                     /locus_tag="LDBPK_272300"
                     /product="vesicle-associated membrane protein (vamp),
                     putative"
                     /transcript_id="XM_003862033.1"
                     /db_xref="GeneID:13386816"
     CDS             937443..938105
                     /locus_tag="LDBPK_272300"
                     /codon_start=1
                     /product="vesicle-associated membrane protein (vamp),
                     putative"
                     /protein_id="XP_003862081.1"
                     /db_xref="GeneID:13386816"
                     /db_xref="GOA:E9BJG0"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:E9BJG0"
                     /translation="MPISSSLVAFERVIIAEESVSPSLAPALQKMLGLLPRHDAKVSY
                     QLEQDVFHFFIENDIVYACTTSGHYENRIVFGFLLHIKDAFKTSFAGRADRYPHHADL
                     TPENCHGFSSTLASSRKTFNESPQEDKVCRIKEQLNATREVMLQNLDSIIERGDRIDT
                     LCDRAELLRDEAQCFHSNARSLKHAVLMHKINIIIGVVIFLAILALIITFSVCGIDFK
                     KC"
     gene            <938516..>939670
                     /locus_tag="LDBPK_272310"
                     /db_xref="GeneID:13386817"
     mRNA            <938516..>939670
                     /locus_tag="LDBPK_272310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862034.1"
                     /db_xref="GeneID:13386817"
     CDS             938516..939670
                     /locus_tag="LDBPK_272310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862082.1"
                     /db_xref="GeneID:13386817"
                     /db_xref="UniProtKB/TrEMBL:E9BJG1"
                     /translation="MPSAATLSIDAHKWTETIEAAGTDCLCSAVSAKNVTHVLSTATV
                     RAPQKHLCAAVSNFVPAMLENLHGVSILTALVRYGTTATVEQIASKLSAADEGVWSFM
                     AAPKKELTKCLSHLLERMVYREDCTGESYNALLGRLKAVKKQSLMTSSFTLPAAARLA
                     LVDDAFATGLLSSSEAQKALGKSCQHAATAAAAEEFCRILFERPKDNAAGDFVWKALA
                     ASMKADAKAHPREAILALLAAHGPVPLVNKMADAMAQWSTVRELCTRDSYAHIVARLL
                     ERCDDERAGNRLVAAVIMQEADVTERVGARKAAQHHLLAVLAAKSSYAQTLEKRLGTS
                     QTKRLAAAKVRFANATQSKATTTQQAILEKLKKLHSTTTSSVAGTKRARE"
     gene            <940136..>940597
                     /locus_tag="LDBPK_272320"
                     /db_xref="GeneID:13386818"
     mRNA            <940136..>940597
                     /locus_tag="LDBPK_272320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862035.1"
                     /db_xref="GeneID:13386818"
     CDS             940136..940597
                     /locus_tag="LDBPK_272320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862083.1"
                     /db_xref="GeneID:13386818"
                     /db_xref="UniProtKB/TrEMBL:E9BJG2"
                     /translation="MKRLQPVCPAAVVPGCGAAMQYSRRWNLLEHRTKGSPYMKHLDL
                     YARRDPQLAPYLLREVDIEYKRKCRKVSFLVWVVVFTVAVAWQTRMQGETLHYMRLYA
                     SYVRAEQDARDEDNIKRRKAFVGVMNVVKDAFDRDQRWTAADEAKALKELR"
     gene            <940820..>941272
                     /locus_tag="LDBPK_272330"
                     /pseudo
                     /db_xref="GeneID:13386819"
     mRNA            <940820..>941272
                     /locus_tag="LDBPK_272330"
                     /product="hypothetical protein, unknown function"
                     /note="contains an internal stop codon"
                     /pseudo
                     /db_xref="GeneID:13386819"
     misc_feature    <940820..>941272
                     /locus_tag="LDBPK_272330"
                     /note="contains an internal stop codon; hypothetical
                     protein, unknown function"
                     /pseudo
                     /db_xref="GeneID:13386819"
                     /db_xref="UniProtKB/TrEMBL:E9BJG3"
     gene            <941867..>943336
                     /locus_tag="LDBPK_272340"
                     /db_xref="GeneID:13386820"
     mRNA            <941867..>943336
                     /locus_tag="LDBPK_272340"
                     /product="TPR-repeat protein, putative"
                     /transcript_id="XM_003862037.1"
                     /db_xref="GeneID:13386820"
     CDS             941867..943336
                     /locus_tag="LDBPK_272340"
                     /codon_start=1
                     /product="TPR-repeat protein, putative"
                     /protein_id="XP_003862085.1"
                     /db_xref="GeneID:13386820"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR025986"
                     /db_xref="UniProtKB/TrEMBL:E9BJG4"
                     /translation="MDRSVAEAIRQQSDDLRDELKELEQWEDAMQAREMAKTQRKVPW
                     PTSAAAAEPPIRGTVPSLKEAIRQQQQQARAAGASGDAAAEAMADPIQRAKDKGNALF
                     QSGHLQEAVAAYTVGIDLDPASATTHVLYANRAMCYLKLGQWTAAEKDATTCVHMNTG
                     YAKAYYRRAVARKQLGKLREARADLEAVLALAPKDVSAQQEMESVTKALQAKRAAASQ
                     ATTTTAATTKKKRIVIEEVDSEGDEAAAEAPAMSASQLPTEEDLHQACIEEDMRRLAA
                     ARKANEEQVRQESQREAAAQAKRQRRHERVEIIEEEEHSPTEEKKTAPSPATSAPAVE
                     QTPPLPTSSPPASSSSSSTSAATRPRARPPIAKESLTTPKSFSEFERRFRELVQQPEL
                     RDHYVRLLDPTTMAKLFGSNMSPEMLLGILQAIKTFNATTALQYAKGLCQVSRVEDVA
                     LFFDAQEKAVVQDVLDLLRSAPGTPAKDIQQIERKLKPL"
     gene            <944316..>945506
                     /locus_tag="LDBPK_272350"
                     /db_xref="GeneID:13386821"
     mRNA            <944316..>945506
                     /locus_tag="LDBPK_272350"
                     /product="heat shock protein DNAJ, putative"
                     /transcript_id="XM_003862038.1"
                     /db_xref="GeneID:13386821"
     CDS             944316..945506
                     /locus_tag="LDBPK_272350"
                     /codon_start=1
                     /product="heat shock protein DNAJ, putative"
                     /protein_id="XP_003862086.1"
                     /db_xref="GeneID:13386821"
                     /db_xref="GOA:E9BJG5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BJG5"
                     /translation="MVKETGYYNALGVSPDASEDEIKRAYRKLALKYHPDKNTEPGAQ
                     EKFKEVSVAYECLSDPEKRKRYDQFGKDAVEMQGGGVDPSDIFASFFGGGSRPRGEPK
                     PKDIVHELPVPLEAFYCGKTIKLAITRDRLCTQCSGTGSKVAGVSATCKDCGGRGVRM
                     MTRQLQPGFIQQIQTACPVCKGKGTNLREEDKCVSCRGQQIIKDKKVFEVMVEKGMHR
                     GDSVTFSGEGDQIPGVKLSGDIIIILDQKPHQAFIRKGDHLFLEQTISLAEALTGFSL
                     NITQLDGRELAISSTAGTIIDPANMYSVSREGMPVAHTGGMERGDLIIRFKVVFPKTL
                     RQGCVPELRKMLGYPQQPPFKDGAEQYTLQESHIDLEKEARRNAYDDDGDQPRVQTAG
                     CAQQ"
     gene            <947590..>948708
                     /locus_tag="LDBPK_272360"
                     /db_xref="GeneID:13386822"
     mRNA            <947590..>948708
                     /locus_tag="LDBPK_272360"
                     /product="aldo-keto reductase-like protein"
                     /transcript_id="XM_003862039.1"
                     /db_xref="GeneID:13386822"
     CDS             947590..948708
                     /locus_tag="LDBPK_272360"
                     /codon_start=1
                     /product="aldo-keto reductase-like protein"
                     /protein_id="XP_003862087.1"
                     /db_xref="GeneID:13386822"
                     /db_xref="GOA:E9BJG6"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:E9BJG6"
                     /translation="MSANVLAYRPLAGPVIAITHRIAMRDSHTIPQLGFGTYRLPASK
                     ATDAVAFALSCGYRHVDCAKAYGNEAAVGAALAQALRTRCTRREDLFVTSKLWPTDQH
                     PDHVEAACRATLAALQLDYLDLYLIHWPVCMRHTPHWTSDEDRYPRHRDGTPAIDTSV
                     TLLDTWTAMNRLVDCGLVKSIGLANCTTAHVNDLVKAVAEAKLAHLPVLNQVEHHPGI
                     VDGDLIGCLGSHDMLMAAYCPLGMPTRDTPPGFQSLLDDPVLRSLSAFSGFSPARLLL
                     NWNVDRHNVVIVKSANQEHIKSNAKAARFALDDRTRLVLNNYHLLVRNFRVMNPTHFS
                     ADGATPFFAAEDARLQREIDAYRSTRTGTTTTPPSPRS"
     gene            <949193..>950035
                     /locus_tag="LDBPK_272370"
                     /db_xref="GeneID:13386823"
     mRNA            <949193..>950035
                     /locus_tag="LDBPK_272370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862040.1"
                     /db_xref="GeneID:13386823"
     CDS             949193..950035
                     /locus_tag="LDBPK_272370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862088.1"
                     /db_xref="GeneID:13386823"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:E9BJG7"
                     /translation="MKTCKTGIKKVRDVSEATTLVLDWFERHNKPATPQSLADALGSR
                     VAKPLLQKILEQLHAEEKLHVKDMKKMRFYYLRVLPLSDANGATTTEQHSELEDDAAA
                     TTGERGDAVGAPEVCGGAETCAESPADTHAALLHAVAISAVQLSERSRRLTRWRGWPS
                     STERAAKYADLAREVCELRNSLERLQSRHAGESAEAHSGGSWTSRVRRAVCRYRRARR
                     HWVQRKDWAMCLLEATAGDAHTPVQAAALLGCTTDAEAGVSFEDTAVALPAPLLRELS
                     LSQR"
     gene            <950656..>952368
                     /locus_tag="LDBPK_272380"
                     /db_xref="GeneID:13386824"
     mRNA            <950656..>952368
                     /locus_tag="LDBPK_272380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862041.1"
                     /db_xref="GeneID:13386824"
     CDS             950656..952368
                     /locus_tag="LDBPK_272380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862089.1"
                     /db_xref="GeneID:13386824"
                     /db_xref="UniProtKB/TrEMBL:E9BJG8"
                     /translation="MASEASMYVDSEEAMPLPERFQQLRHSLHGHWGTTAEADLLRAM
                     QQLHTRLVARSAQTHRRVEELSQRVTAAQVSLANALNALKLLSQHQFVQHRIATEDLQ
                     QRQRAVAGSSSEEADGGSSDGTVSPNRALTTSLPTHTTKEAAVRRRMHDYVEMCKESL
                     AEEGVRVPLCPGDVAELAAESPYAHRRLCGLIGTTAFLYDADIGCRRGADMMNAAAVK
                     QRQSPQPQPACLPAAAPPAVVTGVLSASAKPLFPPSAAAKASVPPPHATATGAVAPPA
                     KAPRAQSSVVPPPTAAKSAPAKKERQQALFSSSSSSASSSAASPSAAVTPAAKSSPPL
                     TKRGAAALARPPKSAPAKKGARNLFGSSSSSVRSNSVSSACAEAAKRAAYSPTSSDLS
                     SSDDSRPPPAAARKANNPSPPPLAATTTSPPRAASASSHSSQGSSALSGTPASLLPKS
                     TPASPATGTPAPPATPPPAPPPPSSAAPAAYAPPPASPSPPPPPPPAAASAPAAVLPP
                     PPPVFLFDTVSAMGAPAPLPQVAAVQVSVPQSATPPSRTAAGPQPPRRGGKVLSTSSD
                     DDAE"
     gap             952514..952612
                     /estimated_length=99
     gene            <952891..>953616
                     /locus_tag="LDBPK_272390"
                     /db_xref="GeneID:13386825"
     mRNA            <952891..>953616
                     /locus_tag="LDBPK_272390"
                     /product="3-oxoacyl-(acyl-carrier protein) reductase-like
                     protein"
                     /transcript_id="XM_003862042.1"
                     /db_xref="GeneID:13386825"
     CDS             952891..953616
                     /locus_tag="LDBPK_272390"
                     /codon_start=1
                     /product="3-oxoacyl-(acyl-carrier protein) reductase-like
                     protein"
                     /protein_id="XP_003862090.1"
                     /db_xref="GeneID:13386825"
                     /db_xref="GOA:E9BJG9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BJG9"
                     /translation="MVWNVRGKVGVITGASCALGREIMERLASQHQMKLACVSRKPLA
                     TPLPAGCAAFVADVSRGDDCDALMKSVQRELGAVSLLINCAGVTLSKVHVMCTDDDYA
                     AVMNTNLKGALQVTRAALRHGGLLKLQDGAVLHIGSVAGVVGNEGQVLYSASKAALSG
                     AVKSWALEYGPRNIRFNVVAPGLIDGEGMATTLTEGQKQRWRDDCPLKRLATASEVAD
                     MAVAVALCRYMNGQTIAVDGGLS"
     gene            <954151..>955494
                     /locus_tag="LDBPK_272400"
                     /db_xref="GeneID:13386826"
     mRNA            <954151..>955494
                     /locus_tag="LDBPK_272400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862043.1"
                     /db_xref="GeneID:13386826"
     CDS             954151..955494
                     /locus_tag="LDBPK_272400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862091.1"
                     /db_xref="GeneID:13386826"
                     /db_xref="UniProtKB/TrEMBL:E9BJH0"
                     /translation="MQALPQVLDDRRQRLQVHENTIVQDATQKMNVTVQQLYACSADI
                     RQCSDVIEGSVLVLGVHTAHTLLTQLSRSLKSIEAVMDAWRTTATVYQEHFTQCRQFM
                     ASMDQAYAGMKERRKTAETELRALRAERDRKEQAYDAAVLYVQRVLAEHTQWQEAHSY
                     NTQRWPMTDACEEALAVLHAVRAGSSAGNSDRRSRKDGDIGREEVPLSLKDDTSGSVG
                     EVSRSCCASFVSPSPLPALCEWAPVVSSSTANSSEASGDVARRWCTAMAGRLGATQPS
                     LHFAYVPPAEEVQLLREVLAMGTGSSSLMKDIQSAQARLDERRTQVRRVCARSLDSLH
                     AMRQEMRILRTHLQHLLDSQTPFMSMGEELLSRVRTHMEVEVARRVAAITASTATTFT
                     TAPSPAGDSQSGIGSMPRLSSYSVSYVAIPSSGLSEVAESGGDTASEGWTWMADA"
     gene            <956234..>957133
                     /locus_tag="LDBPK_272410"
                     /db_xref="GeneID:13386827"
     mRNA            <956234..>957133
                     /locus_tag="LDBPK_272410"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862044.1"
                     /db_xref="GeneID:13386827"
     CDS             956234..957133
                     /locus_tag="LDBPK_272410"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862092.1"
                     /db_xref="GeneID:13386827"
                     /db_xref="GOA:E9BJH1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BJH1"
                     /translation="MSLDADYEVESYAFVAGCRVKVYRCTHRSTGAKRAVKVYHTAAM
                     DSRRAAMAVEEGTLAKSLPAAPQLVRVFDVYVEVERVSIVMEYMEHGSLYQRITTCGP
                     LAETEARDVARHILTGLALLHANNVMHRDIKPENVLVRTTTGSSTGLGGAAAKTASAA
                     TTVVAIGDFGFATRRIPHDEFVGSPQYSAPELALVALQQRYGHAGAALPITTRPLYSE
                     KCDIWSAGVVVFVALTGLLPFDGATPEDVFTAVIRNAVPFNRVPPGRMGPSARAFVDA
                     LLTPNPSKRPSAKEALRHAWLTG"
     gene            <957822..>959504
                     /locus_tag="LDBPK_272420"
                     /db_xref="GeneID:13386828"
     mRNA            <957822..>959504
                     /locus_tag="LDBPK_272420"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862045.1"
                     /db_xref="GeneID:13386828"
     CDS             957822..959504
                     /locus_tag="LDBPK_272420"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862093.1"
                     /db_xref="GeneID:13386828"
                     /db_xref="GOA:E9BJH2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BJH2"
                     /translation="MGLTAEAIAPSEGHFRHHYSLGDEIGKGAYAVVFRCNHRETKAV
                     YAVKIVDKRKAGPKDIDDITHEIDVMGRIGYHPNVVQMIEYFSTERRFYIILDLLSGG
                     MLFDRIIELKHYSESNASVLVRNVLSGLAHIHSRGVIHRDLKPENLLLRYAASPSTSP
                     NSNLTDVCLADFGLAGYVPSTTCCGSPSYIAPEVISVGYYRTRKEPYDAKCDIWSIGV
                     ITYILLSGKMPFHGNSFKETFELIVSNRWSFNSDTWASVTPTAKDFIQACLTYDPVER
                     PTALELLQHPWLANEQPHVHLGRSLESLRDLTKKKVKAAVQVFCWTQSLLGPLDWTPP
                     FMRFLRHTDKFSTVLTHQSQTDPKQVHTVDFSKALDHKKPGWRIQDCCTCPSEQVCRH
                     IQNVHEYLFVGKRSMEVYPFIDELRMMHEEAEDSLTADPRDAEARKRLDQVNYLIEAA
                     CVFSDELAKVPAGELKPNLMLDGSRNTLFRALGGSRSVTKTWHGSDKEDVAHRVVEKM
                     RAQKLASPATGKTTKAAAMPPSSTPTPKPSSKPSSSKRITTTPNAGTPSRRS"
     gene            <961199..>962740
                     /locus_tag="LDBPK_272430"
                     /db_xref="GeneID:13386829"
     mRNA            <961199..>962740
                     /locus_tag="LDBPK_272430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862046.1"
                     /db_xref="GeneID:13386829"
     CDS             961199..962740
                     /locus_tag="LDBPK_272430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862094.1"
                     /db_xref="GeneID:13386829"
                     /db_xref="GOA:E9BJH3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BJH3"
                     /translation="MLRCNISQRVPTHPVVSVKSGLVFERSLVEKYVDEHGRCPVTGD
                     PLRKEDLITAQGAAPDASIASSGSLGAASVPTLLERLQVEWEGVALEQFSLRQQVTQL
                     QLELAHALQQYDAACRVIARLSKELDSLRGGKAVAAEETDKGPAVVVVPAPVLRRMDA
                     VEAAERQARKQRKAAAGSATATPSQLMEEAEWVATSSSSASASSARSAVRVAAAADAS
                     SSGVFVSAVTGDHAIVRYSPDGFSEEARGVGHTAAVHTLASQPGDILLSAAEDLTVRV
                     WSTKGAALTVMHTLRYASGVVAMSQRTVGGAYMLCGAADGVLTLSDLESGAHVVATAP
                     LTLDTTSGALTCVELHPYASLAAVAFQPTELQLWDAREMRADTFISHVRGTAARTHIC
                     SASFSADCVSLAAGLTDGSVNVWDLRQVLAPVAVLPPSADAVPATVRYAPDGRSLVVG
                     GHGVALYDCARLSASSTAVEAVATAGLKASAVCDVCWTTSGTDVLCGSVDGVVRLYST
                     AAGAT"
     gene            <963340..>964770
                     /locus_tag="LDBPK_272440"
                     /db_xref="GeneID:13386830"
     mRNA            <963340..>964770
                     /locus_tag="LDBPK_272440"
                     /product="tubulin-tyrosine ligase-like protein"
                     /transcript_id="XM_003862047.1"
                     /db_xref="GeneID:13386830"
     CDS             963340..964770
                     /locus_tag="LDBPK_272440"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase-like protein"
                     /protein_id="XP_003862095.1"
                     /db_xref="GeneID:13386830"
                     /db_xref="GOA:E9BJH4"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="UniProtKB/TrEMBL:E9BJH4"
                     /translation="MRPFTSTAVTPTAAAAAPASSMSSPAPLRKAQESATGSAGSYFL
                     GSSTFSVYEEMARQLREEGWRRKTETAIATADFILGDRFHIPYTLLRVERMALSSWFG
                     GTRWVNYFEGSHRLTLKAAMVQLMKEVDTHWAKWLPESYAIGGDQLKKADERRALLDA
                     LAAAGDDDAVWIVKPSSGAKGRHILLLRASAVPEWLERLPECSRSMYVVQRYVDRPLL
                     LSNGRKFDIRVWALLVSPYSIYAYTQVSCRTASEPYDLSDITNTHAHLTNHCLQKDAA
                     HFGEYEEENEMWLPQLQSYLTSIGKPADLLETRVLPAIKELLVRTLLAMMPEIAVPAT
                     EAYKCFQLFGYDMILTEEAEVRLLEINGSPGIAERFLTPLVRSMRELLGAGPKDGTGS
                     KTAACNSDDTSHEGFSENGSSSSSGCASPASTSNSCPGRRRTSRAFSAATPATGVTRN
                     WRLEDEGFVLLWRRGDAVPPGLVGVC"
     gap             965361..965744
                     /estimated_length=384
     gene            <965782..>966180
                     /locus_tag="LDBPK_272450"
                     /db_xref="GeneID:13386831"
     mRNA            <965782..>966180
                     /locus_tag="LDBPK_272450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862048.1"
                     /db_xref="GeneID:13386831"
     CDS             965782..966180
                     /locus_tag="LDBPK_272450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862096.1"
                     /db_xref="GeneID:13386831"
                     /db_xref="UniProtKB/TrEMBL:E9BJH5"
                     /translation="MPTKRPAEAPLHRSDADAPSSTHHTPGTAVASAGATPTAAAAEA
                     AAPKVIMSKAQRRKLKKPPVVVTAEMKERAREETRELRKHLRILKSNGARRKVAKLRE
                     KRPREHNINEEAVNAFDTDFRPHKKGRRLE"
     gene            <967217..>980233
                     /locus_tag="LDBPK_272460"
                     /db_xref="GeneID:13386832"
     mRNA            <967217..>980233
                     /locus_tag="LDBPK_272460"
                     /product="dynein heavy chain (pseudogene), putative"
                     /transcript_id="XM_003862049.1"
                     /db_xref="GeneID:13386832"
     CDS             967217..980233
                     /locus_tag="LDBPK_272460"
                     /codon_start=1
                     /product="dynein heavy chain (pseudogene), putative"
                     /protein_id="XP_003862097.1"
                     /db_xref="GeneID:13386832"
                     /translation="MSVSPNPPHGNGRTAVLSPLPSTTAAAAAADYVSAVSVQSDAHR
                     GFVTSQRLRDIEAPLMEHLAQKRYGHSSAGAEATMVKLQRVAGHTAVPAPLSGVQQRR
                     ADPAAPLRKVRVPRAIRQLLDMHTSLALSSAVSPLATQQHEILPHPPAATIVSATPDC
                     AVHERVGLLYHPLAAARTAYAEAEVRPSCVGAGAATAADATTVVPFAMAATAAENKTY
                     FALADFDAVDEDPRTPAEWLAMGDNDEGGTPATSRFFKTTGPGGGTVVWRKCRVREYD
                     EARQLFYVQWADGTGRWTRRLNIRFDAEDVERWEARVRRADDYRSDTEAAMREALYID
                     SIPNACVTAMEEAQMERVLRNVATRFPVAQLHVIQQRTEEAEATYYRAMKLAVHTYTM
                     RGAAEQERLQIANLPRAGVAAQPSLRDLRGTLGTPSPNFLVARAYLAENCFQVHALIQ
                     DTLHSLHTVWFRYTSQLLCVSHYEAPALPLRLPFFVSTQEEHGIAVGERLKGEWTSTV
                     QSTVQNNLDAYFNFYDDNMARYEASRMCRFMRLVNCMMRSQLRELAMTSLESYTAYLE
                     KYAVVCTNAADFDDAAAAAMVEVLPEDVAERAYWAGRIAQLEARQAAEKERRAAEQKA
                     APKKRHSDTAAAGAPKDEAEEAPPEHLLWCLGTPPLTEPLTQRVVQLIQRVNGLRPLF
                     YTKLVVASPLPSKTPTQRSSRDSGADEGDAAECAIALDPPVDEIERCVLRVFARCLEH
                     SNEVAAMGDQLFPLLEMAPAYLRPLGADEAEVVAVQERVLAVLRGNRAAPLQLVQMYR
                     EFEYLATANVEEAVQATLEHVEALEEVDLLLERLSRDRRRLAERTPNTVTFELYAVDC
                     CELKAALTARAVQLQEALLEAVATRLAEECAGVLSAYEAINAELTVEPTTPEELQTMR
                     AALAAVAAREAAIQVIFQHVTEGNELLLRYGYLVPHDEFVHYWEAYECPKRLAQLVED
                     RNFRAKEYRAVFIQQLRENSEQQAYAIMQLAASVEDFTHLCDDARAEEYYERARAIEE
                     SIQSSKASVALYGRHEELFGMTVTTYPQLTEIQQLFEPYFALWEVVYHFNAETERWMS
                     TKIATLNPRDVDQKVSDWTKRVAALSRKIKEPEAIEVARQLRANIEQFKPLVPLLYAL
                     RSHLQAGHWRAIYQQCGIPREQQGFGPGGVDNNDQRTLSDFVQLGMMDHLTSIESVAS
                     VAQKTYELESELMNMVTEWKRLVFEMEPYQDTFKLKANDAMQLTLDEHILKTQSMLGK
                     PTVRQTPALQARVSQWSDQLNNTQSTMDEWFRCQSTWSYLEPIFVSADISRSLPAEKK
                     MFVEIDETWHAVMARTRATPQIITRCQDDSLYKTLSSANTNLEEILRKLQQFLETKRM
                     AFPRFYFISNEELLQILSDSRDPYLVQPYLCKCFEGIKTLTFADHHDMVGMESAEGER
                     VLFVRTVNPSDHHNQVELWLQAVENVMKATIRDQLQQAIGDYTQRKRTDFIRAWPGQV
                     VIAVCCFFWTMEATQAMAADGTVGLTTYYEKCARQLDDLILLVRDSGLGNVARCTLEA
                     LVVIEVHAKDILRMLGEKGVESPSSFDWLAQLRYYWEGEEDNQQLTVQQINASLRYGY
                     EYLGNTGRLVITPLTDRCYRTLIGALHLNYGGAPEGPAGTGKTETTKDLAKALGKYCV
                     VYNCSDQISAKDMAKLFKGLTQAGAWGCFDEFNRIEIQVLSVIAQQIATIQEAIIQKR
                     PEFIFEGAQIRLDSGCAVFVTMNPGYAGRAELPDNLKALFRPVAMMVPNYAMIGEIQL
                     YSYGFLHGKVLSEKIVATYRLCSEQLSSQDHYDYGMRAVKAVLTAAGRLKRAYPMEDE
                     MVLMLRSIQDVNLPKFLSQDVELFRGIVSDLFPGVQLPVPDYDDMHNALVTVATQDNL
                     QLTTYFEEKICQTYEMICVRHGMMLVGYSYGGKTKGLRSLAAALEVMEQTNKSEHRAR
                     MVIINPKSVTMAQLYGKVELSGEWTDGILSSRFRELAQDTSEDRVWLVLDGPVDAVWI
                     ENMNTVLDDNKKLCLQNGDIIPMPKRMNLIFEVQDLAHASPATVSRCGMVYVEPQSLG
                     WACLLESFFNTLPPFMTETPQLADTLRSLIDAIMADMLEVTRKRARSIVPQSANTLVA
                     GCVRLLSCFIHGFDEEAAIAQAGGDERVHMRNMVMRVEGWFLFSLVWSVGGCLEHKDR
                     EIFSAALHKLLAALPERDGCRHTFTLALPEATTSFYEVRFEDGAEVRLMSWADMMPEL
                     TIQAESEYQDIIVPTTETVKYSFLMGLMLRHMHPALLVGDTGTGKTIMMKALLRGLPK
                     DGYSVNLIQFSAQTSAGHLQRLIDSNCEKRRKGFYGPPINKKMIIFIDDANLPQLEEY
                     GAQPPIELLRQYLDHGGWYQHSKDGVEFRHLVDALLLCAMGPAGGGRNDITQRFSRHF
                     NVFSVPSFNESTLKTLFGRLSEWIFSRNFPSALRGMSAPLVAATVELYTILVDNLKPS
                     PERSHYTFNLRDVSKVFQGMDMTYAPGIKDEMCLAQLWMHEVSRAFADRFIDDADTHW
                     FHEQASRTCLKHLKLNVRPTMEDGSPLLFSSLANDDGRYEQLTDIAHARSTLERKQEL
                     YKAATRSGELNLVIFNYVLEHVARISRVLHQPGGHLLLVGVGGSGRRSCARLGAFIQE
                     CDYRTTTPTKDYDHSDFLDDIRQLLLQTGQKGYSTAFVLADSQIISEAFLEDICSLLN
                     TGEIPGLWDTKQDREVYDNAVASLRDVGRALGRPDTTEALQELFAERCRKHLHVVLCF
                     SPLGSMLRERLRKFPSLVNCTTIDWFRDWPEDGLRSVAARFLDDVDLTEEERTSIRQI
                     FVQYQQQVRELSVKYRAEARQQTYVTPTSYLDLLSTFGRMLARKRHDLTSQRDRYVNG
                     LRQLKKTEDQVEVMQQELALLKPELATKQAETSELIRRVEEESKAAEEQKAIVAVDEA
                     AANAQAAAAKKIKDASQEKVDEAQPLVEQAQRAVLDLDPKALQEVKALKTPPKGVKYV
                     IEVLCTLLGGVYKPKPIRDALTGKTSVPYWEHAKVTLLTADFKNTLLNAYSDIVDNAP
                     DAQIEEVKKKMTDEMFKMENIRKTSVALVGVATYIKAVVEYYKQNKVIKPLLAQAAAA
                     QAEYDEAMIGLHAKKEELRIITEKLQALTDHLDGVNRSKQELENRIRDTDTKLTRAKK
                     LIEGLGGEKARFAHESKRYEEELLYVVGNVVVSAGIVAYMGPFLHNYRMQIIAKWRDM
                     CEAQQLRVSADYTFEKFCGNSIHIQEWKLQQLPSDPFSVDNAVILSNSNRWPLMVDPQ
                     QQANRWIRSRERDNGLVVVRLFEKDYLRTIRQAIMAGSPVLLENVEETLDPMLENLLL
                     KRITKEGSMWVMHLGEAVEWNQKFRFYITTKLPRPHYLPEVSAKVTLINFRITEQGLQ
                     DQLLQRVMLSERREVEEKKQALTLEAAANQAGLKATEDRILAILSTEGNILESEAAIE
                     ELDRSKEQSDRIEKRQEEIDAMERISDRTRNLFVPVAHLGAILFFCVTELANIDPMYQ
                     HSLQSYMVIFQEALASSARSSEVEERTDAINTTFKRSLYQRICRALFARDQLLFSFIM
                     SLKMFAVDAVLLRWLLTGGTEEDERATAVANPFTWMPELSWRLLQRASTQLAGFENLI
                     EDVRQHEMFFVDYYESSSPLELKLPGELQSMPSIAKMVLVRCLRMDKVVPAIRAYVCE
                     TLGEFFVEPPLYALETVVEELAYDPSVPIILVLSPGADPNAELDRVAELRGMFPNRLF
                     KLSLGQGQNVPACALIEAGTKSGHWVLLQNCHLYADFMPQLSRMIEDYSDVAAKERLH
                     RDYRLWLTSLPSEVFPIVILQNGVKLVQEPPKGLKSNLMQSYLSDPVADAEFFGAART
                     PEAWHKLLFGLCFFHAVVQERRQYGPLGWSRPYEFNDTDRRISVRQLQMLLDENELVP
                     YEALLYLIGECNYGGRVTDDWDRRCLLATLEVYLTPSILEDNYVFFDDAQEYFAPPFG
                     EYSTYLAYIQSLPAQQPPTVFGLHENADITKDERDARFLLDATLSTQPRDAAPAADSG
                     SGGGNKADPKTIVKTLAADVLHRLPPLFDIEAIQARYPIDYAQSMNTVLLQEAIRYNR
                     LLAVVRASLADVQDAISGKVVMSSELEQVFMSMYDGKVPEVWKRRSYPSLKPFGAYVS
                     DLIARLQFLRTWYEAGPPPLYWLSGFFFTQSFLTGVTQNYARKHKIEIDKLIWEFTVM
                     PAPAETFTETPEDGCYVHGLFLEGADWSYDDGVLAESKPKELYVPFPVLRLSPALPEK
                     VAQCPIYHCPCYKTTDRRGVLSTTGHSTNFILTVNLPRDAHESENHWVLRGTALFTQL
                     EY"
     gap             982272..982370
                     /estimated_length=99
     gene            <983617..>984900
                     /locus_tag="LDBPK_020730"
                     /old_locus_tag="LDBPK_272470"
                     /db_xref="GeneID:13386833"
     mRNA            <983617..>984900
                     /locus_tag="LDBPK_020730"
                     /old_locus_tag="LDBPK_272470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862050.1"
                     /db_xref="GeneID:13386833"
     CDS             983617..>984900
                     /locus_tag="LDBPK_020730"
                     /old_locus_tag="LDBPK_272470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862098.1"
                     /db_xref="GeneID:13386833"
                     /db_xref="UniProtKB/TrEMBL:E9BJH7"
                     /translation="MPFFCVGDAATCPSEVCEDLAAKPITAHHQLIISTVTHQLGPLA
                     GAICRTLIQSGPMSLKDISDAVHRDEEVRAVAAAAANRASATGEKTTAVPPTHQVGSS
                     FHVNLGDIASVNDVIHEVAVKELVTRLVVHRLIHADTATHLYEIRYGSAILLRVLFPL
                     LLHCARQQYGEAAKCVLLVVYQLGVVPPRAAVQVALSRTPSITRDAIEYAVVRMAEDG
                     WLVPVLNSPTAAPGATTAANAARLADLAPSHPGGNADMWNTTTPYSVGLEAALHYLFN
                     DAIEQAVAERYADGRLALTLVRALRRRIAPNSGYTEAVASFQELAAELPTTAGVRRDR
                     SGEPRMGTDNVPSSSVEAVQRCLQRLCQPIVFYSCDTAAPMTSAAGISPSFTTMPSTR
                     ALLVKPHSQSNFYAIDHVTAVHLLQEAVCERVVYSR"
     mRNA            <983617..>984897
                     /locus_tag="LDBPK_020730"
                     /old_locus_tag="LDBPK_272470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862051.1"
                     /db_xref="GeneID:13386833"
     CDS             983617..>984897
                     /locus_tag="LDBPK_020730"
                     /old_locus_tag="LDBPK_272470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862099.1"
                     /db_xref="GeneID:13386833"
                     /db_xref="UniProtKB/TrEMBL:E9BJH8"
                     /translation="MPFFCVGDAATCPSEVCEDLAAKPITAHHQLIISTVTHQLGPLA
                     GAICRTLIQSGPMSLKDISDAVHRDEEVRAVAAAAANRASATGEKTTAVPPTHQVGSS
                     FHVNLGDIASVNDVIHEVAVKELVTRLVVHRLIHADTATHLYEIRYGSAILLRVLFPL
                     LLHCARQQYGEAAKCVLLVVYQLGVVPPRAAVQVALSRTPSITRDAIEYAVVRMAEDG
                     WLVPVLNSPTAAPGATTAANAARLADLAPSHPGGNADMWNTTTPYSVGLEAALHYLFN
                     DAIEQAVAERYADGRLALTLVRALRRRIAPNSGYTEAVASFQELAAELPTTAGVRRDR
                     SGEPRMGTDNVPSSSVEAVQRCLQRLCQPIVFYSCDTAAPMTSAAGISPSFTTMPSTR
                     ALLVKPHSQSNFYAIDHVTAVHLLQEAVCERVVYS"
     gap             984902..1003122
                     /estimated_length=18221
     gene            complement(<1003133..>1004104)
                     /locus_tag="LDBPK_072480"
                     /db_xref="GeneID:13389118"
     mRNA            complement(<1003133..>1004104)
                     /locus_tag="LDBPK_072480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003862052.1"
                     /db_xref="GeneID:13389118"
     CDS             complement(1003133..1004104)
                     /locus_tag="LDBPK_072480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003862100.1"
                     /db_xref="GeneID:13389118"
                     /db_xref="GOA:E9BJH9"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:E9BJH9"
                     /translation="MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRA
                     LRGKAEFIMGKKTLQAKIVEKRAQAKDASPEAKRFNDQCEEYNLLSGNTGLIFTNNAV
                     QEITSVLDAHRVKAPARVGAISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE
                     IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMV
                     EKMLMEGLSNVAAMALGAGIPTSSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELRE
                     AAINGLLAGSGSAAAEPAAAAPAAPSAAAKEEPEESDEDDFGMGGLF"
     gap             1005769..1007010
                     /estimated_length=1242
     gap             1007374..1011497
                     /estimated_length=4124
     gene            <1011630..>1013207
                     /locus_tag="LDBPK_072500"
                     /db_xref="GeneID:13389119"
     mRNA            <1011630..>1013207
                     /locus_tag="LDBPK_072500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003862053.1"
                     /db_xref="GeneID:13389119"
     CDS             1011630..1013207
                     /locus_tag="LDBPK_072500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003862101.1"
                     /db_xref="GeneID:13389119"
                     /db_xref="GOA:E9BJI0"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/TrEMBL:E9BJI0"
                     /translation="MAPIIHRNLTAPELVQWALKLEKDTKLSARGALCVLSYAKTGRS
                     PSDKRVADTDDVRENVDWGSVNVKLSEESFAKVKKRAMDFLNSRDHLFIVDCFAGHDE
                     RYRLKVRVITTRPYHALFMYNMLIRPTRQELENFGEPEYTIYNAGEHLADPSVPGITS
                     TTSVSLNFKTGEEVILGTEYAGEMKKGILTVMFELMPRQGHLCMHASANVGKKGDVTV
                     FFGLSGTGKTTLSADPNRMLIGDDEHVWTDRGVFNIEGGCYAKAIGLNPKTEEEIYNA
                     VKFGAVAENCTLDKATHEIDFNDESICKNTRVAYPLEHIPGALTHAVAGHPNNVIFLT
                     NDAFGVMPPVARLTPEQAMFWFIMGYTANVPGVEAGNAPVAKPIFSSCFAGPFLVRHA
                     TYYGEQLARKMTEHNARVWLLNTGYAGGRADRGAKRMPLKVTRAVIDAIHDGSLDKEQ
                     YCVYPGWGLQIPRRCARVPAQLLDPRKAWKDVKAFNETTKELVAMFQASFQKRFAAKA
                     SEALKSAVPKYVETAHL"
     gap             1013277..1013375
                     /estimated_length=99
     gene            complement(<1016848..>1017060)
                     /locus_tag="LDBPK_27rRNA3"
                     /db_xref="GeneID:13389120"
     rRNA            complement(<1016848..>1017060)
                     /locus_tag="LDBPK_27rRNA3"
                     /product="28S ribosomal RNA (LSU-gamma, M1)"
                     /transcript_id="XR_002966727.1"
                     /db_xref="GeneID:13389120"
     gene            complement(<1017148..>1018929)
                     /locus_tag="LDBPK_27rRNA4"
                     /db_xref="GeneID:13386836"
     rRNA            complement(<1017148..>1018929)
                     /locus_tag="LDBPK_27rRNA4"
                     /product="28S ribosomal RNA (LSU-alpha)"
                     /transcript_id="XR_002966728.1"
                     /db_xref="GeneID:13386836"
     gene            complement(1019543..1019804)
                     /locus_tag="LDBPK_27rRNA5"
                     /db_xref="GeneID:13386837"
     rRNA            complement(1019543..1019804)
                     /locus_tag="LDBPK_27rRNA5"
                     /product="5.8S ribosomal RNA (M3) RNA"
                     /transcript_id="XR_002966729.1"
                     /db_xref="GeneID:13386837"
     gene            complement(1019947..1021495)
                     /locus_tag="LDBPK_27rRNA6"
                     /db_xref="GeneID:13386838"
     rRNA            complement(1019947..1021495)
                     /locus_tag="LDBPK_27rRNA6"
                     /product="18S ribosomal RNA (SSU) RNA"
                     /transcript_id="XR_002966730.1"
                     /db_xref="GeneID:13386838"
     gap             1023381..1023479
                     /estimated_length=99
CONTIG      join(FR799614.1:1..1024085)
//
DBGET integrated database retrieval system