GenomeNet

Database: RefSeq
Entry: NC_018257
LinkDB: NC_018257
Original site: NC_018257 
LOCUS       NC_018257            1374157 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 30.
ACCESSION   NC_018257
VERSION     NC_018257.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 1374157)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1374157)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799617.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1374157
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="30"
     gene            complement(<6394..>7671)
                     /locus_tag="LDBPK_300010"
                     /db_xref="GeneID:13385807"
     mRNA            complement(<6394..>7671)
                     /locus_tag="LDBPK_300010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862669.1"
                     /db_xref="GeneID:13385807"
     CDS             complement(6394..7671)
                     /locus_tag="LDBPK_300010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862717.1"
                     /db_xref="GeneID:13385807"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BL96"
                     /translation="MTGGLSASGAAEPLPCRVPFLPKLKFLCLHVFCALFVDLVLRLT
                     RFFSRAQLRTEATATHGSLQAKSFFKLDRLDKVPYADPPYSGHVSTILCAFRPHRSIP
                     YQRVVHPGADGNPMYLDWLLTDSRHAKGVFLIIPGLASWSGTNYIEHFVWFAFTHHFH
                     CGVFNSRGMGNTPIETPRLMSGKWTDDLRAVLRDGPFSRAAIEKHCGAGIPIIAVGFS
                     LGGVILSKYVGEECLAARELVMDAVMVVNSPLDCLDSNAVMNRRISKLLYQPSMAGGL
                     TAYARRHAKVLKDLPGLSPDVRAAFASGRLEKVLAQVKTVRDFDRFITAPTLGFATPE
                     DYYHHISPIEWLPHFSVPVLCISAADDPVTGEPPMASLANTMQSNPNVALLVIPHGGH
                     LGYIRSVWDEWLGTETVMEKIIYEVAAAITPRR"
     gene            complement(<8437..>9174)
                     /locus_tag="LDBPK_300020"
                     /db_xref="GeneID:13385424"
     mRNA            complement(<8437..>9174)
                     /locus_tag="LDBPK_300020"
                     /product="cyclophilin, putative"
                     /transcript_id="XM_003862670.1"
                     /db_xref="GeneID:13385424"
     CDS             complement(8437..9174)
                     /locus_tag="LDBPK_300020"
                     /codon_start=1
                     /product="cyclophilin, putative"
                     /protein_id="XP_003862718.1"
                     /db_xref="GeneID:13385424"
                     /db_xref="GOA:E9BL97"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9BL97"
                     /translation="MPFRVLKPRRDAPQALLTPPSREQVYNNIEERRLKEWENYQKAH
                     RFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPETAARFHRLVTGEGGIHDPTGVK
                     LDYLYTPLELIDRQHGYARFGDLLAYGVRLEPLRQETFKVRHTSRGLLTMTSYGPNLC
                     NTSFAITLAAAPSLDFKQVAFGKVVDGLHLLEKLESLPLDQVGRPLTPVMIAICGTLT
                     GERPPGKWASPQDRTGCDEDLAYEAIQ"
     gene            complement(<9975..>10691)
                     /locus_tag="LDBPK_300030"
                     /db_xref="GeneID:13385425"
     mRNA            complement(<9975..>10691)
                     /locus_tag="LDBPK_300030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862671.1"
                     /db_xref="GeneID:13385425"
     CDS             complement(9975..10691)
                     /locus_tag="LDBPK_300030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862719.1"
                     /db_xref="GeneID:13385425"
                     /db_xref="UniProtKB/TrEMBL:E9BL98"
                     /translation="MRRLQRRILSARTPVRLFDSDERFGKELGFGHKMRDIPVLTGNP
                     RPVAREESWRCAYKLSDRMEFVVRDILTKNKWSPLEVDRELAHIFERKEVGSRSSLNT
                     WSTVEEFQRTPWYRRYKPTDDTAAKFISYEAMKLLESALIPPSLRTDPYAHLRKRHME
                     DNWINDKFSEDTARYITRERLAQHTKGMPQYGQMSRRKYMEFERKFRNMHGSNMHVNE
                     IYSAWLNSLDAKDGEKRQDE"
     gene            complement(<11731..>12156)
                     /locus_tag="LDBPK_300040"
                     /db_xref="GeneID:13385426"
     mRNA            complement(<11731..>12156)
                     /locus_tag="LDBPK_300040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862672.1"
                     /db_xref="GeneID:13385426"
     CDS             complement(11731..12156)
                     /locus_tag="LDBPK_300040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862720.1"
                     /db_xref="GeneID:13385426"
                     /db_xref="InterPro:IPR007919"
                     /db_xref="UniProtKB/TrEMBL:E9BL99"
                     /translation="MNLRNPHLPPIVAGVLYGLSLILFIDGIVLAQQEANKANRFSFL
                     HCVPAIFSTVGLLLLHLVSPSEVKEGDGRGRVLLFMSWLAMIGSSVGALVILFFCYTG
                     KQTRTRAMPGVSLVLYTCTAPIITSVLWWGRRVVDSDEW"
     gene            complement(<13227..>15515)
                     /locus_tag="LDBPK_300050"
                     /db_xref="GeneID:13385427"
     mRNA            complement(<13227..>15515)
                     /locus_tag="LDBPK_300050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862673.1"
                     /db_xref="GeneID:13385427"
     CDS             complement(13227..15515)
                     /locus_tag="LDBPK_300050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862721.1"
                     /db_xref="GeneID:13385427"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="UniProtKB/TrEMBL:E9BLA0"
                     /translation="MHRLSSLSEGDLCFYQSTLYQLIQDAPIEAKPGREMMRTLRKEL
                     VRSMEQEECPEYCAALADLYKTVTDTLISAAHRSAPHELINRTTSDCRIVTDEDEYQF
                     HQEEGFFDDEDEDEMDSNSDIKSTAKDAEQKQRKREETKRKRREEEDMLMKERKVTDE
                     KGKQYHTLGPFPPPRLTVRAPTNTFPSRKALQQRTIIETPSSTSSSSDDDEAINQLIS
                     SRSTEGGEAVNHLTDFLQPLSIDSLKKVGESAKAKLRPSSTHDEFVSQIVKTAVRLGC
                     EKACVLMEKQKIIEDMTSHVQTGPLPTAASIDFLNTLPDHLKQSLGSVLGLPEEKPPV
                     EDMWERMVAMGFLSVLTNLRLKPLKKIANELSIVLPDTNSTEKFCEFIVFAAFPRERI
                     RAKFSRAKQKKVKFTVPPDSMSIKGDMGFVTFHVNNISMLTKESERHYSPEFHFANLK
                     WSLLCMTNKESLALYLCQTGSVHCKFLITVVNKANPDDSICNEGTQSFSAMSQENDWG
                     FNNVIKFAELLNPDQGFVTADDDSITIEVGIVLVEPLKTPTAREKAPVAKEKKNEPRV
                     DEAAMLQLLADEKVEQTRKKLKQEISKTIREEEKTRKDITQRASKAYHDLCDRLRQET
                     KRTQKEVADRERKEEQERQRELDKIKQAQEQTAELKSRLQSLKKENAELIQSKQDATQ
                     AAKEAKKNSERIAQELKFVLDRVQSTQQKLHTQEKKLAAAKSRYESILAEEPDTPSPS
                     DDENDLMSEDLTRFINLMTDDM"
     gene            complement(<16745..>17467)
                     /locus_tag="LDBPK_300060"
                     /db_xref="GeneID:13385428"
     mRNA            complement(<16745..>17467)
                     /locus_tag="LDBPK_300060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862674.1"
                     /db_xref="GeneID:13385428"
     CDS             complement(16745..17467)
                     /locus_tag="LDBPK_300060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862722.1"
                     /db_xref="GeneID:13385428"
                     /db_xref="UniProtKB/TrEMBL:E9BLA1"
                     /translation="MQRCLARLFQAGVHTPHGSRYNAARMKNWPVQEVPQNFSFTNEQ
                     RFKAKAVPRDTGKIPRDFLLSVLYRNQPCEVASLWEHCLNDPQIVLDSKRHLREVLQQ
                     ARAEGFVSFEKDAVTDRWVCHLTRERFEEVRALVGARAEAQDLYSGLRGASATETSAY
                     SESFREMNEDTKREHLRLLSEQVADTTTHLRKFQRMEMDYLPYTDLNGKVNFMWWYEM
                     SDTRDATALPEAAAEGSPKLSE"
     gene            complement(<18485..>19042)
                     /locus_tag="LDBPK_300070"
                     /db_xref="GeneID:13385429"
     mRNA            complement(<18485..>19042)
                     /locus_tag="LDBPK_300070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862675.1"
                     /db_xref="GeneID:13385429"
     CDS             complement(18485..19042)
                     /locus_tag="LDBPK_300070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862723.1"
                     /db_xref="GeneID:13385429"
                     /db_xref="UniProtKB/TrEMBL:E9BLA2"
                     /translation="MGGQDSMNPNAQITTRDAAGNMARARYRCHIESSGGMKLEMLVR
                     VQMGWISPRVVFSQIPYVIHLGKGIDVSIPFVLHFTMVSLLDEHGDNTGSFLYFSGTP
                     MLGFSSGFSRIKGGKMVLNPTKVVDPYVEVFDFIGHVHYRQMGFVLFKCLGYLLCFLA
                     CIPATQRMLQCVLPDPFHRHSEKPL"
     gene            complement(<20047..>21309)
                     /locus_tag="LDBPK_300080"
                     /db_xref="GeneID:13385430"
     mRNA            complement(<20047..>21309)
                     /locus_tag="LDBPK_300080"
                     /product="mitotic cyclin, putative"
                     /transcript_id="XM_003862676.1"
                     /db_xref="GeneID:13385430"
     CDS             complement(20047..21309)
                     /locus_tag="LDBPK_300080"
                     /codon_start=1
                     /product="mitotic cyclin, putative"
                     /protein_id="XP_003862724.1"
                     /db_xref="GeneID:13385430"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:E9BLA3"
                     /translation="MSTDLAIVTTVSSDSVSRLFGPAGAMDFRSNPGMKDEYEDPKTI
                     FNKMKQKDVKPLPDISVLKGTIYNYKNRRIITRWLRDVCGAFNLRSTTLCLAVQLADS
                     YIVGNLHQLELQKCQLAAVTALWIAAKFEEMDADLPNLRKIVDVCDGAYSKEHVLAME
                     EAILSFYKWYLPHTTVVNHVYLQLHLINDPALIDSQPEENVPPVVSVEVLVLDANEGR
                     TWVSLVLESHVSLQDCLDQLFSASNLLYSTSTSVFQLFGSCFLLAERLPLTAVVGNLP
                     LDGKGCRRLFLCSSSSQITSTFAERGSYVILRSINSGFLDLCDILTQEVVTHVEFLRL
                     YSYVTAFGVMGLALCLVSPDKDENRRLLQHVHKKLEISATQGLAVADLLTSKYKEALP
                     TIREGKSLPRPPETFRDTLCYCFDRRLS"
     gene            complement(<26363..>27046)
                     /locus_tag="LDBPK_300090"
                     /db_xref="GeneID:13385431"
     mRNA            complement(<26363..>27046)
                     /locus_tag="LDBPK_300090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862677.1"
                     /db_xref="GeneID:13385431"
     CDS             complement(26363..27046)
                     /locus_tag="LDBPK_300090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862725.1"
                     /db_xref="GeneID:13385431"
                     /db_xref="UniProtKB/TrEMBL:E9BLA4"
                     /translation="MPRDDFDRRRLRALYERNRRRVSALADARDRRRGGEDDYAAPRR
                     YVVSERRTRIEGFGRGGAQVSRVVRRARGGRDEPRSRRFSDRGIFRRNVRDRFRRVED
                     FEGEERRERFREVRARRGDGRRVEGRRFGEARRLRLRMRGTRAGRVDHRRAEVDGRRQ
                     REERVSDGRRRQESGRRNNNNQGNRGGNKQGSLSRNNQPQRNNKPQRSREPQITREEL
                     DRQLESYRS"
     gene            complement(<30956..>35653)
                     /locus_tag="LDBPK_300100"
                     /db_xref="GeneID:13385432"
     mRNA            complement(<30956..>35653)
                     /locus_tag="LDBPK_300100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862678.1"
                     /db_xref="GeneID:13385432"
     CDS             complement(30956..35653)
                     /locus_tag="LDBPK_300100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862726.1"
                     /db_xref="GeneID:13385432"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BLA5"
                     /translation="MNAAHDLYMECCQRHGVKPNSDIEAQVMASDLLHMRLIDASHTF
                     LGRLGVLAVLSLVRQHRCIEEVRLPQNSVDETCMSLLADIITDAHPSLRSVDVAGNLL
                     STPAIRRVWAAARQNTRFTHLVLEGCGVTDEWVTRLQTTLRANEDMELHGYEPYGIPR
                     SPHSWHTVFLLTLGAREAVQEYCEKCLPAVNKYMAAARVRVAALTLSEGDSAEQVESK
                     LARCQDAFNHQLTWCVALLGAEPFSKPQLSALAQVLCQKPPSQLPLRDKMGKLRPRVY
                     RASRSFFCYTPMSWEVSGGVNDVVPASQWLRSAGCAGAACYESLTATVTVPAAVMTPR
                     NRVVRWQSDLFTSLQMTFREPAVDGSTPAVVHADEVQGLEASQLFYTNADEIDMVRGF
                     VLCGRFHPKKTALVLGYVSGPYRDSSSPFILYGAGCIGKSSILCNVASLLWEGRPSVG
                     GEVPARVVCHVVDVDHCSVAVFLYRLLHLFAPGSTLWFTSVDALAEGVRDAIRTYAGP
                     TVALLLGRIDLLDTCGCHCSILAAWLPHILPQAVRIVVSLDTESPVLPLLRKRMPQPF
                     ECLCPPMADINSLQLFKTYLKERNVVLPGMDMSELKSRGALGMSEKSYLQKEEALTVL
                     YPRLASSYAHHLLNTGSDVESEYEAHLLIEGALPPTVAELVQSLHDKAVMLHPQITVE
                     TLLVLVSLAPLPASELVYICEELGSCPRHTTLSALLMLSDMGLFLWYKDATAHVAHPI
                     LKTLFLDICREHVPRLSVLLESHLYRLVVTYSAEVPHAFWHLAPLMMENGNMRQAVQL
                     LCNPLLVDAMLRRGPVHRLHVLDAFLHLLQARTLLREVASLVGPPVPQVMAEGPLMCC
                     LREVANYSSDLYQTALLRRSFSPYASAEAATKCITPQLFLRPLNDGQENTATVSARVS
                     EACSWCHCRGGCVVAATNESVFVFTSDLGKPIAELHMPFERQKRITGVLHAAGTRVLV
                     ASETQVLVWDYESNLNFLFADISIEARATNLDTFGSLLVATSTATNQLCLIDVLKKRI
                     VRELPDMEEGVRQRGFFCGNRLLLLSRCCLCLYDEEMKEYVAFTHDSLVTTVSCNRDG
                     RVLVSYAGTYLHVWTSAGELLHRIDVGPDPLVRLRMSATGAHYVTQQGTILQVWRTLA
                     GAACSTLRSPFSVDSDIEYVTFTEDSAKVVARSGPYIVVWDPDKGSLIGAESAPVGLI
                     QHVAVHDSNVFATTTTGDVHSWSLERGLSSIDQVKEGQRTTNILRNAKVSTQSVRSVS
                     TNRAGTLLVTVDAAHYLRLYSLITGAPIEHTVGRVRSAVAVGPDMVVFMPQEASHLGF
                     YYLGGKTQLDKRALPKTALPEADYALYVSPDELCVGVTVHQCHHSRTLIYEVERGETT
                     LCQLLGHAGRIIEVSFFGSFAFTVGEKDACVRLWSLSRKAERTSYTHPCPLVAAAGNG
                     SGMLFCVDAEGAVVRLHVDNIVSVKHAALVVTSLKLHAAVPLVQASAILQLSVYKNYL
                     ILVRATGELLLLDTLCDDVGHRVAFLDCQRVCVCTIKDAPVLLTGHGQGKVILNSLLH
                     AGVREKSRRSSGR"
     gene            complement(<36659..>37942)
                     /locus_tag="LDBPK_300110"
                     /db_xref="GeneID:13385433"
     mRNA            complement(<36659..>37942)
                     /locus_tag="LDBPK_300110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862679.1"
                     /db_xref="GeneID:13385433"
     CDS             complement(36659..37942)
                     /locus_tag="LDBPK_300110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862727.1"
                     /db_xref="GeneID:13385433"
                     /db_xref="UniProtKB/TrEMBL:E9BLA6"
                     /translation="MDTQGICAISEYVARGHDSGVVWAWCAASPAAFAAVISSPSRTR
                     QAAHERSVHYLPSYEQKSGCVCTVRVDRMGITLNDFHHRVPPWLVTWHTQLLFRLFGP
                     AGVAVHVTDLDSLVLDSLLSAWEGTPVQVTALTSRHRLSTCVSAHRRSTGRVFSALSG
                     LQDLVLLPSPSVHGSLAVAKYAPLLRRVTASKCCVECLKPLSQLQHLQEVQLSQTLIR
                     DAELRILAQLPLLTTLDVSSCPHLSSLEPLACAASLRILRASSCERLMLVAQLGTLAT
                     LRIVDLSGNVFLPTEFATFITQPTLHLQTGYFAHMRWPRDDPPPTQVLGSVKHLHLSY
                     GTVPNIRWLCGAHSLEQLCLDHTNVTAVEMAVLVQHTPLLSVLSLSYCEHLHTNLDFT
                     RSLRFLATLTITRSSLPYPFPELVELQQSLSLTLS"
     gene            complement(<40353..>42218)
                     /locus_tag="LDBPK_300120"
                     /db_xref="GeneID:13385434"
     mRNA            complement(<40353..>42218)
                     /locus_tag="LDBPK_300120"
                     /product="alkyldihydroxyacetonephosphate synthase"
                     /transcript_id="XM_003862680.1"
                     /db_xref="GeneID:13385434"
     CDS             complement(40353..42218)
                     /locus_tag="LDBPK_300120"
                     /codon_start=1
                     /product="alkyldihydroxyacetonephosphate synthase"
                     /protein_id="XP_003862728.1"
                     /db_xref="GeneID:13385434"
                     /db_xref="GOA:E9BLA7"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="InterPro:IPR025650"
                     /db_xref="UniProtKB/TrEMBL:E9BLA7"
                     /translation="MPADEAQAPIQAEVYDRLKWNGWGVEGVQMQIDSENPLWVRHVD
                     GKPIKNLLEFLYQEVSGGVGPKEIPPLSPSIPLEQALARLNKPNINEAFMKDISAVLE
                     KSQIRPDGKSRLCHIVGKNYRDLWRVRKGMVEHTPDCILLPNSHKDCAEIMGLAHKHN
                     VVVIPFGGGTNVTGGVEADPFERARMIVSVDMRRMNRMISIDRESRLATFETGVLGPD
                     LDEQLFRHGFMLGHDPDSYMYSTLGGWIGARGSGAMSNQYGDIEDMVVAVKVATPTGI
                     IETPTTSRTCGVDLNGLFIGSEGAFGIITEATIKLETIPEKKLYEGYLFPTFEAGFSA
                     FYTCTAKGIHPCTMRLYDEDDFRMSMAMSTTKHSFLQRLVSTGVKSFLERYRGWSLRR
                     ISLVIVGFEGTPDRVKFQRSETAAVFKQYGGVGIGRGAGDTWQDKKYDLPYIRDFALS
                     LSHWADVFETSVLYSQAIPCWRAVKAAVRQVWKEHGHRGWIGCHTAHQYKYGCCLYFT
                     FASAQKDDMDMKIFLAIKKRATEAMLAHTGNLTHHHGIGYEHVPWMSRYMGPNAIDLL
                     FAVKKKVDPKNICNPGKLLPSPPRENESAAALKARQQRELMFDKMGVPGAVASHL"
     gene            complement(<43041..>44651)
                     /locus_tag="LDBPK_300130"
                     /db_xref="GeneID:13385435"
     mRNA            complement(<43041..>44651)
                     /locus_tag="LDBPK_300130"
                     /product="lysyl-tRNA synthetase, putative"
                     /transcript_id="XM_003862681.1"
                     /db_xref="GeneID:13385435"
     CDS             complement(43041..44651)
                     /locus_tag="LDBPK_300130"
                     /codon_start=1
                     /product="lysyl-tRNA synthetase, putative"
                     /protein_id="XP_003862729.1"
                     /db_xref="GeneID:13385435"
                     /db_xref="GOA:E9BLA8"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:E9BLA8"
                     /translation="MGGILFITIRSGEAQLQVLRQVNESFTKADLRAFASTLHTGDIL
                     GATGVPGRTAKGELSLYATEASILAPYVCTDQALCPDLKGFVPLTDTGIKYRYRFVDM
                     MSSPSVVQHFRKRHAITRALRDFLDARSFVEVETPVLHSVASGANAKPFVTHHNANDA
                     DLFLRVAPELHLKQCVVGGMERVYEIGRVFRNEDADRSHNPEFTTCEFYAAYHTYKDL
                     MTMTEEILRHLALAANGTTKITVTSCVEKKPVEIDLAQPFRRVNAYDAVQEAAGVELP
                     PPTELSTPRGLAYMSAIMLRYNIPLPSVRTAAKMFDKLIDYFITDRVVEPTFVTDHPL
                     FMSPLAMEQRTRPGLSARFELFINGTEYCNAYSELNDPQEQYYRFQQQLLDRQTGDDE
                     AMALDETFLKALQVGLPPTAGWGMGIDRVAMLLNGSSTIREDILFPLLRHDATSHDAK
                     RRCKTASFFGFNHNMTLFCLNALEEEMLKRAAPTESLEKIRQLRQCLSTMQQRDMVTY
                     APEDGAPRGWRYEATMAVLRLFCYRGKY"
     gene            complement(<46391..>47431)
                     /locus_tag="LDBPK_300140"
                     /db_xref="GeneID:13385436"
     mRNA            complement(<46391..>47431)
                     /locus_tag="LDBPK_300140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862682.1"
                     /db_xref="GeneID:13385436"
     CDS             complement(46391..47431)
                     /locus_tag="LDBPK_300140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862730.1"
                     /db_xref="GeneID:13385436"
                     /db_xref="GOA:E9BLA9"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:E9BLA9"
                     /translation="MANPYESGISADPFREQPYASTGAAVPPAGSAPSAALSNTGDHP
                     HGYGSATYTEVSKQLSDGNAGVPPMQLYAGDGSGTPPLTTMAPLPPTGPAAAGADAAA
                     ASQTTATSKFWTLPFYQQFFDINTRQLLLRLSNTLIPINPPDFLMDRNWHLNESVGVD
                     GTGGIAEDTTLEEAGVVLSRKPDLYGPFWICTTLWMTLAVVSNIMSRIAYTKNNNTTQ
                     PWRYDFSVASVAYAVIYLYCFVFGAVVWGIMQWKNLPATLTDTVCLYGYSMFIFELVA
                     ILCMIPSSTAQWAFVMFGGAWSTAYLLINMWHMWKTTLERNWFIGLVVFVAAFHMGLT
                     LSFKFYFFNYKL"
     gene            complement(<48621..>49271)
                     /locus_tag="LDBPK_300150"
                     /db_xref="GeneID:13385437"
     mRNA            complement(<48621..>49271)
                     /locus_tag="LDBPK_300150"
                     /product="leucine-rich repeat protein, putative"
                     /transcript_id="XM_003862683.1"
                     /db_xref="GeneID:13385437"
     CDS             complement(48621..49271)
                     /locus_tag="LDBPK_300150"
                     /codon_start=1
                     /product="leucine-rich repeat protein, putative"
                     /protein_id="XP_003862731.1"
                     /db_xref="GeneID:13385437"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BLB0"
                     /translation="MACRTLRELSLAFNLLGDEGGRIAAEILGSHPSLRTLDLSDNHI
                     GDLGAVAIAEAFILSSASRIESLNLSVNHMGDVGFAAIAEALTKTNNKHFTALDLACN
                     DAVTDVGREALMRAVPHMRYVYSLDLTSCDLSDDNAKALTEAIRSSHTSVGTVEWYNN
                     PRIKLLTEKALYEAIEAKAAARLSLKGDGSVVLYAGVALTAAMVVVSIIMRQRQNS"
     gene            complement(<50960..>52804)
                     /locus_tag="LDBPK_300160"
                     /db_xref="GeneID:13385438"
     mRNA            complement(<50960..>52804)
                     /locus_tag="LDBPK_300160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862684.1"
                     /db_xref="GeneID:13385438"
     CDS             complement(50960..52804)
                     /locus_tag="LDBPK_300160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862732.1"
                     /db_xref="GeneID:13385438"
                     /db_xref="InterPro:IPR015353"
                     /db_xref="UniProtKB/TrEMBL:E9BLB1"
                     /translation="MSASAPLTTAVQWFAAQLNNSDNAEVKRRYLRWHAEDTGVPYSD
                     EDPLFVQAVLASRTGWTLPELLWRARLVALDGRTLWECLDARMIAGRVRDVVDPWNEQ
                     LSVKLAWHFMEEQQRGELPPASSLNALRAALDEYATATIKPQGSLSVTESSAARSALR
                     DADHGRCATLTDAWSDKVAFIPMEAGNDYSEGSLRCAAPVPSRGTLLQVPRSEMFFID
                     SLLQYCALGRAIAAEPSLRGLLANEEAMLVLCLVYERFVEGVERSHWRRLLTHCPGRY
                     PTIPIAWELRDLAELDGLDMVDDVLAKRSQMQAFVDQLQNSLLPLFHRALSKLYGASA
                     AAPSLADMSAAFVWEHLVWAQSTFDSRAFNLNVDGAVVMALVPLADMVNHANHTDVLV
                     RKVEPNGGPFTMQVGAALTAADVGRELWMSYGPLQNWELLQHYGFLLGPDNVHDKLPF
                     PLAVPAGPNEPQGESDATDTSAPLSREGGTESSWDARRLALMRRYALCLPGRCWIPHD
                     GVPPAALLALLRVQLAQADEFDMMEGRRYGPFEPLSPVTEAAVVSVVKSTVQCVMESF
                     PTTLAEDEETLAEVHGDEPTKNHMLCLQLRVGLKRIASRCLEWCARHS"
     gene            complement(<54945..>55844)
                     /locus_tag="LDBPK_300170"
                     /db_xref="GeneID:13385439"
     mRNA            complement(<54945..>55844)
                     /locus_tag="LDBPK_300170"
                     /product="2-hydroxy-3-oxopropionate reductase, putative"
                     /transcript_id="XM_003862685.1"
                     /db_xref="GeneID:13385439"
     CDS             complement(54945..55844)
                     /locus_tag="LDBPK_300170"
                     /codon_start=1
                     /product="2-hydroxy-3-oxopropionate reductase, putative"
                     /protein_id="XP_003862733.1"
                     /db_xref="GeneID:13385439"
                     /db_xref="GOA:E9BLB2"
                     /db_xref="InterPro:IPR002204"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR015815"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029154"
                     /db_xref="UniProtKB/TrEMBL:E9BLB2"
                     /translation="MRVGYIGLGLMGKPMAVNILKAGFPVSVWNRTASKCDDLVAAGA
                     TACATPAELAAASDVVFTNLSDSPDVMEIVFGPNGVAAGIREGAIFVDNSTIKPSVAQ
                     EIARRLWKEKKVRALDAPVSGGDIGARNGTLTVMVGGDAAALETVLPVLLAVGKKVTR
                     IGDCGAGQVCKAANQIMVAAQMVALGEILVFSEKCGVSGPTVIEAIKSGSAQCWTLDV
                     KPDRLFAGNREPGFKAALQSKDMGIVMDSAKEFGVPLPSTAVNTQLFQAMIQNGDGDQ
                     DNSAVVSVLERMANVHISEVKKE"
     gene            complement(57211..57300)
                     /locus_tag="LDBPK_300180"
                     /pseudo
                     /db_xref="GeneID:13385440"
     misc_feature    complement(57211..57300)
                     /locus_tag="LDBPK_300180"
                     /pseudo
                     /db_xref="GeneID:13385440"
                     /db_xref="PSEUDO:CBZ36041.1"
     gene            complement(<57803..>59281)
                     /locus_tag="LDBPK_300190"
                     /db_xref="GeneID:13385441"
     mRNA            complement(<57803..>59281)
                     /locus_tag="LDBPK_300190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862686.1"
                     /db_xref="GeneID:13385441"
     CDS             complement(57803..59281)
                     /locus_tag="LDBPK_300190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862734.1"
                     /db_xref="GeneID:13385441"
                     /db_xref="UniProtKB/TrEMBL:E9BLB4"
                     /translation="MTTVLDVSREASPNAPPHTQSIYLLTSTSISDVEFKDPAAQSQV
                     LVGLPQVQSIDAVHRFCDAYAATLSRVHHVLLPGGVSPLQSSLIKQLLEHIPQARLVC
                     NGFGHALLTNATFHDGVQRAVLENAPNAPLELLRFAELPEDRVSAMADGDTVAVDVAK
                     SEAEAPAPAAARALRVVAVKSKGQQQRRREHSQTHHPAHFTNEALFYYDDVFNALFVG
                     HTLHRLPWLPTVLTEASRELFLPMPPPLAMQHQLSRPSPLLDTWRVLESCEDVVEALR
                     RTPELERVLAGSYGELCGNVEDCIAGLESSSDALERLRSRLARRLSTDTSRDVHRWST
                     ALLKRIVHEVVCTQKASEPTSSEVQEAFLCWARTDGEWGRLSTCLAHAAMVLPPSTES
                     GEADGASSSATDSFAAHDSVPAAGESSAPEALQGTHGVELLVAVFNRKGLKGLIRTVQ
                     RETIDVQVFLAMSEEDLKKVFKATFGITKRLMLLQDELRKNL"
     gene            complement(<60254..>60613)
                     /locus_tag="LDBPK_300200"
                     /db_xref="GeneID:13385442"
     mRNA            complement(<60254..>60613)
                     /locus_tag="LDBPK_300200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862687.1"
                     /db_xref="GeneID:13385442"
     CDS             complement(60254..60613)
                     /locus_tag="LDBPK_300200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862735.1"
                     /db_xref="GeneID:13385442"
                     /db_xref="UniProtKB/TrEMBL:E9BLB5"
                     /translation="MLRYPSRTLPHLLPVRSSSGAVRHPVLLTPSRRFTDKVLIGSCS
                     SFFTCSTTTGLFHLLVTPISPSVALATLATAAASGALCVVDGGSLNGTTFGAVVGIFV
                     GAMGGFYAKSQKEPWRK"
     gene            complement(<61384..>62508)
                     /locus_tag="LDBPK_300210"
                     /db_xref="GeneID:13385443"
     mRNA            complement(<61384..>62508)
                     /locus_tag="LDBPK_300210"
                     /product="ribosomal RNA adenine dimethylase family
                     protein, putative"
                     /transcript_id="XM_003862688.1"
                     /db_xref="GeneID:13385443"
     CDS             complement(61384..62508)
                     /locus_tag="LDBPK_300210"
                     /codon_start=1
                     /product="ribosomal RNA adenine dimethylase family
                     protein, putative"
                     /protein_id="XP_003862736.1"
                     /db_xref="GeneID:13385443"
                     /db_xref="GOA:E9BLB6"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BLB6"
                     /translation="MPKEPRAVPMGIISAEPIHAASRKIKFGTKTITLGKSTPQGHRR
                     GTAAEGLKKKRASSGVKTGGSQSGIVFNKGFGQHILKNPLVIAAIVEKAAIKPTDIVI
                     EIGPGTGNLTEKLLQTAKKVIAFEIDPRMVAELNKRFQNTPLASKLQIIRGNCLEQDF
                     PYFDKCVANVPYAISSALVFKLLKTPTFKCAVLMFQREFALRVCAQPGSEAYCRLSVN
                     SQLLARCSHLMKISKNSFNPPPKVESSVIRLDPKHPRPDVDFEEWDGLVKMLFSRKNK
                     KSSSIFRTKAAVQALYDKYVSYRKMEGGQPVGTATSGAKPLTSSSSADVGSSVSLEQF
                     RVLLDSVIADPMFEKRSRMLDEEALMTMLAHFIKHGIHFI"
     gene            complement(<64944..>66104)
                     /locus_tag="LDBPK_300220"
                     /db_xref="GeneID:13385444"
     mRNA            complement(<64944..>66104)
                     /locus_tag="LDBPK_300220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862689.1"
                     /db_xref="GeneID:13385444"
     CDS             complement(64944..66104)
                     /locus_tag="LDBPK_300220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862737.1"
                     /db_xref="GeneID:13385444"
                     /db_xref="GOA:E9BLB7"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:E9BLB7"
                     /translation="MNYLRTVVADVKLKYRASRVVAECVLRREQPEFPQFLTECVTIA
                     DGHPELILSTIRLYLEYNQPERAHGGLLLLEQLVSLCNYAFHLALARDYDIQDRIIHL
                     AMKRGEGEAHQKTQRLARLTLLEYSRLFVDDRDLLRLSALVSSFEHRTHKSLMRCLNV
                     QNRRVRFRDVEKSDIIPISPKECVGFTSSSAGRPVKPLQLSSAPEVWPCRVCAYLNAP
                     SAMRCAACETLHTTDMATHRSSPHTTPKMSPASSTSVATANGTNVGRRSPIVPPLPMA
                     VEGEMETGDSQASSGANMEDMDATFPISDWDNTSGGHLHPCHVPPTAVYADPAHLPHI
                     ATSTAVSTSTSDISAHISPSTASEPGDVASEAYYDRIEGSIANGVAPHELEK"
     gene            complement(<67968..>69023)
                     /locus_tag="LDBPK_300230"
                     /db_xref="GeneID:13385445"
     mRNA            complement(<67968..>69023)
                     /locus_tag="LDBPK_300230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862690.1"
                     /db_xref="GeneID:13385445"
     CDS             complement(67968..69023)
                     /locus_tag="LDBPK_300230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862738.1"
                     /db_xref="GeneID:13385445"
                     /db_xref="GOA:E9BLB8"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BLB8"
                     /translation="MSFDSSRGYRSTFGYRTDTPYQQPIAHRQGYTETQLTMRQHGAV
                     IVGCSTACAFLTVPIEKLDRFYFLSDVPGESSRIYMSDKRAQFFRVVFHTRWWRGRSF
                     VWLAAHYGFLLSTFAVLRHGLETASWDNCRRGFAAGAMTGVLYATATHPYDVLRATAE
                     APTGPRRFSGAADVLMTALRERPQVLLGVYRGFTVALLGRSLQFALQFGLYNWLRYDG
                     VYRHFMVLFLYCHLATFLGMAAQYPVQSLRQQLHIINSTTCGRPQNYRSLFLDLRRRH
                     GITKLYDGFFRGKPILSAVPMALLIAAYDVSTRHYTEYLHPEATAKPTHTQSLTSVAA
                     PAYLTHPPPYEFARKAP"
     gene            complement(<70013..>71803)
                     /locus_tag="LDBPK_300240"
                     /db_xref="GeneID:13385446"
     mRNA            complement(<70013..>71803)
                     /locus_tag="LDBPK_300240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862691.1"
                     /db_xref="GeneID:13385446"
     CDS             complement(70013..71803)
                     /locus_tag="LDBPK_300240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862739.1"
                     /db_xref="GeneID:13385446"
                     /db_xref="UniProtKB/TrEMBL:E9BLB9"
                     /translation="MKRELAPTPPGAPRCEDGFESPSGIRVTCTKDWVKQHPVEGDGL
                     CVHLYQYLHKNVKGREHSMSAVLLPDTVVFDHNFPRAWYAYDRKNSEIVKRPGSMLDA
                     QTMYAHFSESVKGCDIVAQFFHTSVDVEEDWKEVLTPQQLRAHQYANQQLTYVEFFTA
                     DALRCFLFDQKRKPDGVLQKFVIPKGEGSSRRNFQLQVIWTPYITTVYRRTNRSRLTD
                     HVVPLANRAATFDGAPYLSDETLVADETKRQVTQLCESIADHFYATEKKRLSRLILYV
                     KADDQSRMWVLWSSCIRVAPDAMNPTLLRVPVCLSMRTEVLNDGGSTLTRLQTRRHRQ
                     RQLLALDAELFEMTRDFEFALTLNASHKRQAKELGLRGRGHGTGPQVRPTRWRGDQKA
                     PVERENPLYASFLALEVGSGGTAPVSVVPFVGRDSGSMQPDRCTAVSQLDDEGVAGGE
                     DELVSDPVAQVQEELVALAMDAWYATYSTILADDPHMMPTARAELAAPLVGTLTQEEL
                     QGLVEVLGLLPAPSDPAAADASRSATDVAAATSTSHYVVAPYLVTSGRRLDRPSAEVE
                     LDVVSYLAEVFRRRGDEISRSCMEKFSHFL"
     gene            complement(<72687..>76085)
                     /locus_tag="LDBPK_300250"
                     /db_xref="GeneID:13385447"
     mRNA            complement(<72687..>76085)
                     /locus_tag="LDBPK_300250"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003862692.1"
                     /db_xref="GeneID:13385447"
     CDS             complement(72687..76085)
                     /locus_tag="LDBPK_300250"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003862740.1"
                     /db_xref="GeneID:13385447"
                     /db_xref="GOA:E9BLC0"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="UniProtKB/TrEMBL:E9BLC0"
                     /translation="MSLSSQGSTPWKFRGDAAASVGAITAVEFDPDVELLWVCDAFGT
                     LMSFSLQSQGQGEAPAWVNYSSFSVSSRPATNIFFLNMGGERMVTVADREVIRGYKRG
                     GVLMMCLPQPTAVQNYIDLFQANSNTGAMFYTGNAGLTRLILNHQETDQLTVPMEATV
                     VALKQCDRWVATGSASGAVYVRSASDLSVVGQATPSRNRVMALEVFDNTVMAAYSERS
                     ATSFVKVFDVRKMPEAVSTIQDIPSGNVTQMRRYQDGFGLSSDRAFLLSPAGFHIIQL
                     DQEKPVFSSSPLSEGSCTAVAVSPSNMCAAIGNDKGTFYALAHPATRDDYVMSTFVQP
                     VRPKHPVYHHSWEEPNIADGFDDSVDLGTLASNWPEEDYMILTVPQKLRCVNYESHSI
                     VPNEWGLMRADSCLPDPKDKLSSILPNPYPFNTQLGDDPACAQEALLELRKDMKRKHK
                     SSRGGGGEYSPMEDSLQVCYSVQHKLDWRSYNEIAQRVIGIDNSFPECWITPLLQSLY
                     LCQPPEFPIRKVILRHICKREFCMTCEIAFIFANMLTTSASVMGMKGEALPPIVPVAH
                     FIRTLRQIRAFANTDVFQRPKNRDDAVAKMHLAQRLVLETLHKDLQDQKAYPFMNYEA
                     PPEYEGAIAALFGTEFTSNGRVHIEPRFYWEVPGSALKVDEGLQHLLKQLEGYKDQVQ
                     IKRLPPIIVLLLNPEHSNLKPPTSLKISRAGKEDYNYVLNSNIVHLADDVEDTGNFVS
                     QQRIKDDSFSLVNDYRVTAPMKMQELERLVPALRSYSAVVTFYALDNLTTPPYARLDD
                     SRTPNLWHLLGPLLTNDVLSRPLLRDPAKQAFRSPLSSYTEIRAGDLIAIDAEYVVLK
                     WASRDEGNEMFYVSQRKPHMGLARVSCILSSKDGDERTIVDDYVHIPEEIEDYVTQYS
                     GIHPGDLDPLESSKSLTSLKSTYLKLRALVDGGVVFVGHGLAQDFRVCNIVVPRKQII
                     DTLEIFHKPGSRYLSLRFLAYHVLGESVQEDEHDSIEDARTSLRLYRKYQQLKSEGTF
                     EGVLDHLMAKGAETSWYVPDTKSLFRDTPQTPPVSVMGSPVLEKMAKAVPENDERDVN
                     TFDMAAAAAAVAATTEGDEDDEDGDDDAPTASEVLEAVRKSMER"
     gene            complement(<77723..>79648)
                     /locus_tag="LDBPK_300260"
                     /db_xref="GeneID:13385448"
     mRNA            complement(<77723..>79648)
                     /locus_tag="LDBPK_300260"
                     /product="Zn finger protein, putative"
                     /transcript_id="XM_003862693.1"
                     /db_xref="GeneID:13385448"
     CDS             complement(77723..79648)
                     /locus_tag="LDBPK_300260"
                     /codon_start=1
                     /product="Zn finger protein, putative"
                     /protein_id="XP_003862741.1"
                     /db_xref="GeneID:13385448"
                     /db_xref="GOA:E9BLC1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9BLC1"
                     /translation="MSHSALAYAACPMCTRVVHMGQMLHHILSTHKEQDPAYWMRLCN
                     ARLALYERVTGAPLEGTETMHGACLVQATAGVADAADSEAMMPDGLSLSTPLSAQDAL
                     RPFLPTVSETGAYTCNWCTLRSVAFSSRDAFLLHVAKDHPKLDFDVVESLVPQPHTVL
                     SRAARNEGTDTPAPRAPAAESDVAMSDSWTRQQRGGAGCVGAASNLHAAEGFLDVAYP
                     VRRMPGVRTVKDTNVVTVKPEVHQLGTTVGRVGGKTFDPAPISTGGRRSRAAVLASST
                     ASATAVASDLHFDKDCFPCELCFRVFVSELNLLQHLESKHANPTAFASASDADVERGA
                     PPGTAFASSTAAASPSSVEVFVVCDRCTDRKKVFRSSSALFSHIRFRHPAEDAAYETE
                     RMIEEQKQSRVFQCRQCSYRYPDANRLDAHMRDAHGVVGCADESTIRGGRVVAGTAQA
                     HGSGELKTAQPSLFSALPPVTVRTRFWCNVCEKGFANASALYAHTESKHTTIASLYPC
                     PACKREFRDVPSLELHVRLCHKNLSLKDMGLQSSVECPDCLRHFLNYESLHDHAVRHH
                     GKSAIAPVRSFLTPASASTAGDGVGVAAVAAAVPVPGMSADASGSTTPPLAVSAPPKP
                     RKVTRRKKEPSKAATES"
     gene            complement(<81454..>82638)
                     /locus_tag="LDBPK_300270"
                     /db_xref="GeneID:13385449"
     mRNA            complement(<81454..>82638)
                     /locus_tag="LDBPK_300270"
                     /product="AUT2/APG4/ATG4 cysteine peptidase, putative"
                     /transcript_id="XM_003862694.1"
                     /db_xref="GeneID:13385449"
     CDS             complement(81454..82638)
                     /locus_tag="LDBPK_300270"
                     /codon_start=1
                     /product="AUT2/APG4/ATG4 cysteine peptidase, putative"
                     /protein_id="XP_003862742.1"
                     /db_xref="GeneID:13385449"
                     /db_xref="GOA:E9BLC2"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="UniProtKB/TrEMBL:E9BLC2"
                     /translation="MLRYVQDLWSAFFPTEAVFPLQVVGRSGAAVESREELEKALTDT
                     FLIFTYRDGFEAIPAVTRLIETDQGWGCLLRTSQMLLAHFLWVHGRPADRRLSLFFDH
                     SAETAPFSIHNMIRSLWNRRAFKAEYWSPSQGCEAIKRTVQGAVKTEQLQTRVMVVTS
                     ANGCIYADEVQHTFKQGADVVLVLASVRVSAAAQLTQESYLQIEKLMEQPQCLGVVGG
                     VPGRSYYFFAHNQTQLFYLDPHQRTAAALLSEGPSAAVSVTPSVADVRCVHWSRVDTS
                     LFLAFAVTTRDEWAALEVHLSNRFMHVESQRTQRDCDQLSRARPGHADGTFLSPLQTG
                     DNCGMGGTSISEVAPLAHRRTLRVPRKRFKEGEVGTATAAKAERNDGEDEVDTDSWEY
                     LD"
     gene            complement(<83919..>84572)
                     /locus_tag="LDBPK_300280"
                     /db_xref="GeneID:13385450"
     mRNA            complement(<83919..>84572)
                     /locus_tag="LDBPK_300280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862695.1"
                     /db_xref="GeneID:13385450"
     CDS             complement(83919..84572)
                     /locus_tag="LDBPK_300280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862743.1"
                     /db_xref="GeneID:13385450"
                     /db_xref="GOA:E9BLC3"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="UniProtKB/TrEMBL:E9BLC3"
                     /translation="MFSYQRIPSPANKMNHMRQFGLPRSSAAITVMAASTAALAVPCR
                     AMHGKPASGHKVRTQHSRRWWMQSKAHHLTAVPHEEARSRPHFPAYTEDVDQPMVVPD
                     GACCFNCDKPIDGDDINSYVWVPSGNARVPTAQGYFFHVKCFKCWNCKYRIIHNQFYS
                     KDRRAWCLSCALGRDIRVPTRRWHTSYVNTHRTGSRLTGQFFPRHRHQMEFLFSPKE"
     gene            complement(<86770..>91341)
                     /locus_tag="LDBPK_300290"
                     /db_xref="GeneID:13385451"
     mRNA            complement(<86770..>91341)
                     /locus_tag="LDBPK_300290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862696.1"
                     /db_xref="GeneID:13385451"
     CDS             complement(86770..91341)
                     /locus_tag="LDBPK_300290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862744.1"
                     /db_xref="GeneID:13385451"
                     /db_xref="InterPro:IPR000372"
                     /db_xref="UniProtKB/TrEMBL:E9BLC4"
                     /translation="MQLSEAVLAPAWSAGGFAYIVKGETTESPAGPSGPVCAHTRTSA
                     GGITAPFTFSMFDAQFSPVYLVSPSAVESTGDAASLTAHVAGRLDLQQGCYTTLTTPT
                     SLGTCAGVLRSSPAQCVLGELDALHENWTAHSLAATANATRDDESLTLSAKGLCAAEL
                     LTVFVSDYLPQRAWLRTVVPRVVDALAHAEQAARAYSAAPLSLSDAAEAADMQRAVAE
                     QWGSYLWSTYVPHLQRKWTLFYHLAVATLTPSQVAPSLDDTATESVTGEPGPAPKVSC
                     PIVDAWPQLRYSLTSSNRGLRTFARLVAYMEDALDSLEELLSSGGGADTLSEKQTDAL
                     VLQLLQRTYCVTTTYFFSVTALFDAPFLDASSSVWVEPATHMQAWAMQTMREASVADA
                     MANATAFQVATTARVTRLTESLPRSEKAFMACLAAFLDATTPLTSAAVTSPSDCAQAL
                     LKARAEASGATVRDSLVLLWDMGQMRAVKPTSDTVPGTTRYESTVSLPTRSTDARASA
                     PSEPIYWTMFQQASASFTSQTSLYTPSVVASVPKEPCAAGSAARRALGTASNRAATKE
                     ARHGVLVGSQAAATCAAGTYANPDTAACEACPSACSALLTAATPVYCPGDGLMHGCPA
                     LPAGAVLAGSPSTGLDNAKAACRYACINIYQAPLHNGCVSTPGLFYNTTAVISDKRSG
                     GWYDACVGPASLLPSSFPAQSHDARVFAFVGSGTTDEPMSCRFVLMHRVVSSAVSAEA
                     LQTVGLLLQPLSVSAASATATSSAGLPPHRDGVAWEAAMQLNATLLWEMHTSLLRSQQ
                     RASGTGTGAANTSIAHVLVAVREGGEGVASQSRLSWSLVSSYQRPEGGETATTTSATG
                     AAPPPSVTFTLRLLLNVSILSAPQSTDAFAASGDRTRTPCTTPAPSSLTVLSAPWQWR
                     VTSMTLNQLAKTTYRVVLSRSTSTVVFYKDAAAVGNPVTVDWPLWRQSQMMSPPLGKT
                     TMYLSVAGWVAGYVEREQWVLKSPPLPASGSSKLAALPLHYDYVPGMVTRLSSTASPV
                     SPLHEALSRAETAWRSQAETFVEQQGRDVEALTDVHSLGLYVASFPAVTAKVSAALSA
                     LSVRQSTGLDGVCRSGYGYGVAAGGTSATPVCATCTSGSYSVLSATPERNTCACVPQR
                     ALGGVTSLAGQPVRACLRRPAGPAAPSSYLRSPGRLFVDSNVVIGYGIPLGGYGRGTG
                     AAGTGLPATTSLEGSVTCMYGLTVPRLLTTAPTGSLNLSATLQYTTGLGAEECGVMAA
                     ARGGATAVTTQPTYSALSSYGLRLRASRLPTHTITLTNNSRLFANQTVLTVGVRDYAL
                     LPHYAMDSLLHMRGISEYHAAFLTYMLRCATVSAVLRCGSPLRDAGNFTWAGSSSLDS
                     PVLRVNLTGMITEECQVSFTVRSATAAASEASVPYTSWPYTYLATEANASLFFEASPT
                     LHYTLLPSVEAFETTKLRYEPLAESSSLIISFVMLAFSLPLISIILISVHPPSFQPLS
                     WRPYERARARRHCQHRQLHSGACSERGAS"
     gene            complement(<93131..>93577)
                     /locus_tag="LDBPK_300300"
                     /db_xref="GeneID:13385452"
     mRNA            complement(<93131..>93577)
                     /locus_tag="LDBPK_300300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862697.1"
                     /db_xref="GeneID:13385452"
     CDS             complement(93131..93577)
                     /locus_tag="LDBPK_300300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862745.1"
                     /db_xref="GeneID:13385452"
                     /db_xref="UniProtKB/TrEMBL:E9BLC5"
                     /translation="MALSGLLCRVSCYVAPSLSGTRFYRGVMSRASSTALALPISASL
                     TSSSVVPLSYAGSLREGRRGYAQERNPHDSNTEDISNTFFDVQDVDADRLTHFYWDSN
                     DDADTPYDTVSLDSLFGEGEADEWSGESLAFVDERDQLLLGEEYLK"
     gene            complement(<94803..>98990)
                     /locus_tag="LDBPK_300310"
                     /db_xref="GeneID:13385453"
     mRNA            complement(<94803..>98990)
                     /locus_tag="LDBPK_300310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862698.1"
                     /db_xref="GeneID:13385453"
     CDS             complement(94803..98990)
                     /locus_tag="LDBPK_300310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862746.1"
                     /db_xref="GeneID:13385453"
                     /db_xref="UniProtKB/TrEMBL:E9BLC6"
                     /translation="MKQETVCAFPVELFSVSDTGASSSKGACVCAVVALPSRPPKYSL
                     VCYSAQQVTFCVARMSYVDGYNTSLRLLTHASSGHISFSDDADQRWSVFFADAAQQTR
                     FLACCGVSFYALFGAPGASVFSYDVSFPSSSLRLEVGDRAHVSFTSYELTVKDNMYAV
                     GALGEQRGDAAGGTTTSQQQQPFYVFQPSTSAAQLAQGSFGFEGSVVGMREEDVRVFV
                     VPAGFTTRVSDSLANVSAQGLVFVVRLAQVEHVDEEPASARQAADNGQRAPPSVYAAT
                     EDGDARQASAPSEQALMVVAAAPTAAGVAPATSSAASAVPAFLSTNGIPAEHMSVLRK
                     IELGVNTAVATARDVHGVTAIFSQDWHRYIERPKPSLLSNRALLEQVQRVVEEEETAQ
                     KHLDACDSALQALEARNKELQQRIDRAVSDSQRLLEEKSRGATKAMEARLERERQLVK
                     LKDEIRVKEQTQEDLQRRVAALRSYIDTSSEELRQLQGRFDVHEIQSKGLAERISTIQ
                     ESLSEERRRSATLASKSSSTEEAICKAQAQHRLADGQLTAARGLAERERLRYLQVMED
                     ERSHRATDADILRKDIVDALDARERQYQVDRCRLAEEQFMRGLRDGKAEGRRVAETDL
                     LGHQDELRLNLQRAKTEVEIRKEEVRRSIESAMALRRTLGRKVTELEAQLASATRKQT
                     NLHYKLSQWQTWCRTARDTVSQHWRALLSYATHPCTQDELLKMMEAVRTAEQSSYASD
                     DGDEGSDGTGGPVRVDLQFQLDHWRQTRIRCIAQRQQWLWDDMLDLYTKGAFVHFDRE
                     WLHPLIEAHDATLEAVAQLYAQQHGGRALFDCCAEEAQERWSVQQQWWSTIHEIEEWL
                     AAQRTAQENLKDEEAAAREALWKEYMDGGEAVVQLCASQLRAQVMLLHEEMQARDELV
                     SEEQRRRRLLPDEAQQQWAASCSSALRLFEEEEEAARAGLEAEAYMSYSGLEFQCAYA
                     LRAAQQLSAQHVEQQRLLAEETAARQAVMQEASDAVERCRLAAAAVVSSAEAAAAPPI
                     ETPQEGGSPANLFSPSPMETMHSAPLPPPLAEETSASPLPSPCSSSHARSPPSPTHPV
                     EGRTPTADESATTPQVAGVPAPSHGASDAEPPVGPAVALQHVDSSPAPPPPPAAELGF
                     GFADPPRVAWGDHSSGSGGSNRLRDGGLAMTTDTFFSSEPPPLPPPDEADSLAQAVAA
                     PSEQRSASTFHAVATVVAPPPPRCSSHAEFSAAPTLAITAESDDTLPPSSEVAEVDRQ
                     HMSDQRSGSSGGESTSSSLRTSSTSAVQRAGDAAALFTALPLQHDSAGREEGAAVDRD
                     SPSSTQRRPLRAFGADSSNIGEDLSGDMSRGQGSQKSPTSVPRRARGPTTKQPAAGSA
                     TQKPKLFDSSSDSEHGE"
     gene            complement(<99971..>101731)
                     /locus_tag="LDBPK_300320"
                     /db_xref="GeneID:13385454"
     mRNA            complement(<99971..>101731)
                     /locus_tag="LDBPK_300320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862699.1"
                     /db_xref="GeneID:13385454"
     CDS             complement(99971..101731)
                     /locus_tag="LDBPK_300320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862747.1"
                     /db_xref="GeneID:13385454"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:E9BLC7"
                     /translation="MRPQERLTVLCTLLLLYVLFSAPVELLTVFWHRTTSAAVGISSP
                     SPLKRLSTGSAPGLSTNYASLYLGAAVVSMEPSSCHGGVALISESVDKYVLCPCDAPR
                     KQFVVQLIRDVQVRSVMVRNAEHFSSGVRNFTLLGSLQYPTSTWLVLGHFEAEQRRGR
                     QYFDVAPRSRVRFIKLQWATSYGPEPWCTITSFQVYGIDVLETLTRYDGGDDLVAGED
                     AAGASGGLRGTPDMHRFHLPALPPTPGEVAAPPLAGSSAVPSRNGATSANDAPAPAVF
                     IDELAAGMWAGAAATVGASRGADADDLLLAPVDVGASAETGPLSQADADAKRSSPTNS
                     IALAATAPALQSVNCSAAQPIGRNASVKCTITDLTALWGPCAVATSGASDFTAVTTPT
                     SAPALSVSTPSSKGLSASGSIYQSAAGSLLTNLLRQQRSTHHELTLLMQRERHLAQEL
                     NRTRILLSDFYARYKATEREADEYRDRLHGLQSKLQLLQERFLREHSSCCGEGGGAGR
                     SGGSIMRSDTAMAVASFALLALAVILMLMYSSSSSRSVVGPPSGWGRYYNIGRGSGGV
                     ASGGGNRPPLWPRPQRGRAR"
     gap             102959..103057
                     /estimated_length=99
     gap             106429..106527
                     /estimated_length=99
     gap             106896..107853
                     /estimated_length=958
     gene            complement(<108123..>110519)
                     /locus_tag="LDBPK_300340"
                     /db_xref="GeneID:13385455"
     mRNA            complement(<108123..>110519)
                     /locus_tag="LDBPK_300340"
                     /product="KU80 protein, putative"
                     /transcript_id="XM_003862700.1"
                     /db_xref="GeneID:13385455"
     CDS             complement(108123..110519)
                     /locus_tag="LDBPK_300340"
                     /codon_start=1
                     /product="KU80 protein, putative"
                     /protein_id="XP_003862748.1"
                     /db_xref="GeneID:13385455"
                     /db_xref="GOA:E9BLC8"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR014893"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:E9BLC8"
                     /translation="MSKGAAVLVLDITLPRAAALAEACDLCDRILADKMIYAPSDEVA
                     VILAGTEKSRSALYERSEQARYNHITVAADLGPATTLTLAPIAATRAGVAVLPDGATV
                     RRSIAEAYDFIDALQVAVAVLQVRTSQKRYNRCIYFLTDARHEVRHKEDLLSLIGALQ
                     RDQVALVVIGFDFQALPAPTDSQGKFNEFTAGEASAWAALDRKAQNEIILAALCTELG
                     SPSTLVSPAEALASLSLPRCRRIRQQPVLKVALRIGDVRLATQLFTLTQEERLPSLRR
                     STQEGVDVVQTIEYVAVGGVEEQPCALAKEERVEAFFLGADRISCSEADRETMRVKGP
                     RALEAIGFVGEAEVEPYLLMGGTRALLPLAGDHAGQRGFNALVDAMASSRKAMLVRLV
                     RTADAAPSLCVCFARTAGSSAEQRHLVLAPLPFAEDVRALRFSEYPELQFSAAEEQLM
                     DELIDGLSVDDSVLAPHDTFNPVLQQYYATLRSKLSAMNVSAEKGNAKATSSEAAVPQ
                     LLPTLRGTSTDFFAEGSAVYEAVSAHRAALASCANAFPYEDEVDALLPGSRDAGWKGK
                     PWYQDVATTSSLIDPQAVSPPSASQGSGGAPSTIAAAIARGVRCGGEADEASAGSHAT
                     SDANSISTAPHDTISGGLSFAITSVDPVGSFSMIVHHPAVTEAQLNKAKDDLSDVIWE
                     LLRSSIKDAIYRKCMACIMALRQFCVKQDDAAYYNDFLLKLEVVARQCGRDTDFWAPY
                     VVERKDSANVWPITAQECKSAALPDDTAAKAFLQKDRFDPAIAFDDTTDDDDWLAEIQ
                     "
     gene            complement(<113723..>115555)
                     /locus_tag="LDBPK_300350"
                     /db_xref="GeneID:13385456"
     mRNA            complement(<113723..>115555)
                     /locus_tag="LDBPK_300350"
                     /product="kinesin, putative"
                     /transcript_id="XM_003862701.1"
                     /db_xref="GeneID:13385456"
     CDS             complement(113723..115555)
                     /locus_tag="LDBPK_300350"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003862749.1"
                     /db_xref="GeneID:13385456"
                     /db_xref="GOA:E9BLC9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BLC9"
                     /translation="MSRTQTSSKSAPKTIAVYCRVRPPVPNEKGHTFQNISYDDRDAR
                     AITVNRKSGAKSFEKKYLFNRVFRPNVTQKDVYENFARNAVDAAFDGQHGVLFVYGQT
                     GSGKTFTISNDDPNNEGVLQQSMREIWNKIASDTANDYSCSVSYVQLYNEILTDLLDD
                     KKSKVRIQMGSEGRGDVVMVSDSTGLAVEREVKDYKSTMAYFKAGLARKEMASTSMNN
                     TSSRSHTIFTLNIVKAKKVGAVTVGAETEGPTVALEGRLVLCDLAGSERVSKTHAEGK
                     TLDEATHINRSLLTLGKVVTALTDNAQHAPFRESKLTRILQYSLMGNGNTSIIVNISP
                     SDENTEESLSAILFGQRASQIKQDAKRHEVLDYKALYLQLMADLDNKNDKTLEEALEE
                     ERGVYEERISALDEEMKLLSDENAMLRNENKQLRQYVPADRLKLIDETPSSGVPGANG
                     EVASGGWAKANQDLRELVKQRDDKLKVISDERVRLALVVAEEKRKCFQLAQKMRSFAM
                     RYKMEREQSTQRQEELCAELAALKGTDYLSAVGNFDATASPGSPGSPHYPREGEEFND
                     AESAQAQIRALRAERTELMVYQAKAANAIRMLVKERDAAQRKVA"
     gene            complement(<117141..>119069)
                     /locus_tag="LDBPK_300360"
                     /db_xref="GeneID:13385457"
     mRNA            complement(<117141..>119069)
                     /locus_tag="LDBPK_300360"
                     /product="endosomal integral membrane protein, putative"
                     /transcript_id="XM_003862702.1"
                     /db_xref="GeneID:13385457"
     CDS             complement(117141..119069)
                     /locus_tag="LDBPK_300360"
                     /codon_start=1
                     /product="endosomal integral membrane protein, putative"
                     /protein_id="XP_003862750.1"
                     /db_xref="GeneID:13385457"
                     /db_xref="GOA:E9BLD0"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:E9BLD0"
                     /translation="MGRREVPTRLPAAPATLRAALCVVVVVLCWASSITYGFSFSFMH
                     DLGLAYSQGETVHVLAKSVTSRSKIVPLRWSSVFPCAASLSQSTLPPSRRSIGQVLMG
                     ETLEDSGIRLKVLTDMKCVLICSARFNTAEREQYEKRILGRYRAHLVLDGLPALEAPS
                     VDGEHRRIRTGFPLGNFSRAVATGIIEAYNHLHLIVSYYPITSADSLTVRIVQFEVQP
                     RSVYHTGELGGDGTCTFPAVLKPQITPMESIRFSYSVEWVVSTTPWKTRWDNYVDDNS
                     HESKARWHSIVNVLSLVLLQSVLLWYILVRSVRRDILSYNEEDLLGDREDSGWKLVHG
                     DVFRPPRGAVFLSVLVGNGMQIMCMVIASLLFAVAGMLSHDSRGTLASLLVMLFVLFS
                     SVNGLVTASLIKLLRRRSWQAIFLTSIALPGFLFVVYLTLNFIHLGSHAASTLPFTSL
                     LYLLALWLCVSVPLCFGGAVAGFSSNISIPAKINAIPRTIPPQPWYMKGVFSYVALGI
                     VPLAASYVELQSIFSSVWLGVAYRMLSFLLAAFVLVLVIVAQVSIFSTYNQLSLLNYH
                     WWWRSFFVSASYGAWLMLYCVLYYWFISVVKGFLGMILFFGYMGLACVTVALMFGAVG
                     FLASLVFVRILFASVKAD"
     gene            complement(<120649..>121881)
                     /locus_tag="LDBPK_300370"
                     /db_xref="GeneID:13385458"
     mRNA            complement(<120649..>121881)
                     /locus_tag="LDBPK_300370"
                     /product="mitogen-activated protein kinase, putative"
                     /transcript_id="XM_003862703.1"
                     /db_xref="GeneID:13385458"
     CDS             complement(120649..121881)
                     /locus_tag="LDBPK_300370"
                     /codon_start=1
                     /product="mitogen-activated protein kinase, putative"
                     /protein_id="XP_003862751.1"
                     /db_xref="GeneID:13385458"
                     /db_xref="GOA:E9BLD1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BLD1"
                     /translation="MILTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYG
                     FVCSAVDAVTNEPVAIKKVTHLFDDAVDAKRVLREVKLLAYLKHPNILSLKDLFKSPD
                     PVDTYSELYVVTDLMESDMDAILRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRD
                     LKPGNLLTDSECNLKLGDFGLARGIGHDDTMTQYVFTRWYRPPELLLVCKHCNYSADM
                     WAVGCLAAEMFTGKPLFPGKDYINQINLIVELLGIPDLARDLPPSTSTEAIHYLSSLP
                     PSKGKKLEEYAPELRRRFDETTFYDSFDTELEEAIAAEGATIARPQPRPPEEYYAEFV
                     DFIFGLLRYNPEKRRTAKESIAHAWLSDVRGPQETIGGCEAERIYRWDADGTAFTIPQ
                     LRHLFIDEIGKFASTRGS"
     gene            complement(<125046..>126200)
                     /locus_tag="LDBPK_300380"
                     /db_xref="GeneID:13385459"
     mRNA            complement(<125046..>126200)
                     /locus_tag="LDBPK_300380"
                     /product="phosphatase 2C, putative"
                     /transcript_id="XM_003862704.1"
                     /db_xref="GeneID:13385459"
     CDS             complement(125046..126200)
                     /locus_tag="LDBPK_300380"
                     /codon_start=1
                     /product="phosphatase 2C, putative"
                     /protein_id="XP_003862752.1"
                     /db_xref="GeneID:13385459"
                     /db_xref="GOA:E9BLD2"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BLD2"
                     /translation="MGLMLPKPILSKVVDRAGNSFVNAACASQNGFRNSMEDAHMLVA
                     TDDADVAYFGIFDGHSNAECSAYVARELPQRLKKLPETITAEMLEKVCIEVDEAYMKA
                     NTEGGTTGTFCVIRKDLTVTIANVGDSRILVCRGGKLIFATEDHKPYIPGETERIVAC
                     GGSVVSNRVDGDLAVSRAFGDASFKVKGTKDYRMQKVIAVPDVSVLQCEPNDFVILAC
                     DGVFEGNFSNEDVCQFVWEQQQNCWDDLAVVACRVCDEAIRCGSKDNISCLVVQLAEG
                     ASKVKLFGATSFVPGPPFPRNQQPCRAAYAQMAELGHTTTAAALQTRYQLLQAFSKNK
                     LNSQPPVMRTAFEMSDEVDVETEWSFFGKGPAPGNEKSFFEALANTGNSS"
     gene            complement(<131851..>132603)
                     /locus_tag="LDBPK_300390"
                     /db_xref="GeneID:13385460"
     mRNA            complement(<131851..>132603)
                     /locus_tag="LDBPK_300390"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862705.1"
                     /db_xref="GeneID:13385460"
     CDS             complement(131851..132603)
                     /locus_tag="LDBPK_300390"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862753.1"
                     /db_xref="GeneID:13385460"
                     /db_xref="UniProtKB/TrEMBL:E9BLD3"
                     /translation="MLSLSPGTLSRLLHMKLALRHVCILLQAAALVALVAVSGSSSSM
                     AVSSTPSSHHYSGSLGSDSDTSIDSGHQPSPSPPSNKPLLDDDEWANVTLKFFIIFVS
                     VCAGAGVVAFIVILCAYCREYKLLETSDDSDTESVCSRTTSQSSSSGESESSSAEAPA
                     YATPRQRHMPPPPAANEITAPVAYEEENDNADLPEPVMQADTQSNESSEFLFVPPETT
                     PSFSDGAATAIQRTGSRLSLACSRRGLYRKER"
     gene            complement(<134671..>136161)
                     /locus_tag="LDBPK_300400"
                     /db_xref="GeneID:13385461"
     mRNA            complement(<134671..>136161)
                     /locus_tag="LDBPK_300400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862706.1"
                     /db_xref="GeneID:13385461"
     CDS             complement(134671..136161)
                     /locus_tag="LDBPK_300400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862754.1"
                     /db_xref="GeneID:13385461"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:E9BLD4"
                     /translation="MISARDAILQLTSGPSLMDSMCNFIIRPPRSTYEVDDLGPNVFR
                     IGDDGTERFVRHDFELENMRGLRFQCSWFKTYPARRVPCVVYCHANCGGRYDGLEALF
                     LLREGFSLFCFDFCGSGMSEGEYISLGFYERQDLVAVVEFLTLKSDEVDGVALWGRSM
                     GAVAAIMYASKDPWIRCIVCDSPFASLRLLIDDLVERHGGRTARVLPKILVHGIVERI
                     RKRIMKRAAFDIDDLDAVKYAKACGVPALLFHGADDDFVSPTHCEMIRDAFPIPCLQQ
                     FTPGGHNCDRQEDIHVLIRAFLRLYLIDKPQGAREIQAARELQLANTASPAAVAAAAA
                     NKGAISRLSAPAALAPKQLVPPASYGMRCAETALISSSSTSATASSSTTSPSTSASSS
                     TSFDSSLPLPAALSVPLSPENRLVYDCSNSRDSTPPPKAAATLASSLPPSLTPFRSSS
                     GTRAHVSASTATVAGEGHATSGATVPPPSSPAADSTDGLQNCTASP"
     gene            complement(<137083..>137901)
                     /locus_tag="LDBPK_300410"
                     /db_xref="GeneID:13385462"
     mRNA            complement(<137083..>137901)
                     /locus_tag="LDBPK_300410"
                     /product="PAP2 family protein, putative"
                     /transcript_id="XM_003862707.1"
                     /db_xref="GeneID:13385462"
     CDS             complement(137083..137901)
                     /locus_tag="LDBPK_300410"
                     /codon_start=1
                     /product="PAP2 family protein, putative"
                     /protein_id="XP_003862755.1"
                     /db_xref="GeneID:13385462"
                     /db_xref="GOA:E9BLD5"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:E9BLD5"
                     /translation="MSLLETARLVWDYTHLSAVEMRRGEALAYEHRQHAAALATTAET
                     SATPSEPPHWRSWAMTEVVYRQHDLLSKLFGISSIVPVAMMMLLAGLTSAPCRERRIP
                     AMNLILYLILSVCLNVVLKATVRSPRPAHPAAGMSYTTVYGMPSDHAQFMAGFSVYLL
                     RRWTRARRNRTERRKYSHLQQRKAASASAALARTSSPYALVALLLFATLFIGVGRVYN
                     GYHTVGQALVGWMVGIALAFACTTAHVQRGFTWVSEKVLVPVMLVCTFWTEAIC"
     gene            complement(<138369..>139832)
                     /locus_tag="LDBPK_300420"
                     /db_xref="GeneID:13385463"
     mRNA            complement(<138369..>139832)
                     /locus_tag="LDBPK_300420"
                     /product="WD-40 repeat protein"
                     /transcript_id="XM_003862708.1"
                     /db_xref="GeneID:13385463"
     CDS             complement(138369..139832)
                     /locus_tag="LDBPK_300420"
                     /codon_start=1
                     /product="WD-40 repeat protein"
                     /protein_id="XP_003862756.1"
                     /db_xref="GeneID:13385463"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BLD6"
                     /translation="MDRGYPRRREGGASFGGGGFGGVGGFSGGFGGPPAGGPGDPPVG
                     GPGGPRRRFRSDFDPEEYAPRRKLHGQRPVDFYSPAIRHVLTRLVPRSTPYSYHVAPH
                     EYYTKDLVTASVTNYNASTALCTQWVNTSYHPDSKGGRIRTPLYALQWSPSGRRLLCS
                     TGRGEFLLFNGQSFGVEVKTVAHEDNRPCRAIAWGRRHDLILSGDDAGKLKMWMSNFV
                     FMSEVDTSHRAVREISWAPLELKFCTAGQDGSAKVWDTNTVGAHTATAGASDGNQAVL
                     EEVKLEGHGGDVTTAHWHPYRALIATGSQDTQCRLWDPRTASRGSIAALHGHSQALTC
                     VRWHPDGRTLLSASKDGTVKLWDIRKTQPEVKRFTGHTDAVDKVDWHPTVSDLFASTG
                     ADGSVMYWMVAEGDGTMTHGVEEVVHDAAMIEAAHEKFRDKPNPVHCVAWSPLGNILA
                     SSGHEVKYWTRNKPGALEEKERGVESDILDEQGQVMV"
     gene            complement(<140803..>141903)
                     /locus_tag="LDBPK_300430"
                     /db_xref="GeneID:13385464"
     mRNA            complement(<140803..>141903)
                     /locus_tag="LDBPK_300430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862709.1"
                     /db_xref="GeneID:13385464"
     CDS             complement(140803..141903)
                     /locus_tag="LDBPK_300430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862757.1"
                     /db_xref="GeneID:13385464"
                     /db_xref="GOA:E9BLD7"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:E9BLD7"
                     /translation="MPFLKRCVLVVNNRSGSRHAAQTFASILKGYLDRAGIVHHDVHI
                     PNDDVAEQLQRALPQAEALVLCGGDGTVNSALNLIAAMPSSGAGPNTAVPLPSVLESM
                     PLLLVPAGLHNSIATSLGVTSVERAVSSLVVGRAVRVPLWAVHLHHPHAPYGAFPIRY
                     MCSYVATGTYAASVRRHGNWKKVQEEYVSMPAALGCFTAIALFTTIEHAPPESTVVLT
                     HINNETASSSVGPLRLLVASQMPQLQPGYSLTPAATYHRRQLTVTTATAEATRMRMWH
                     LLHREAREGYILAEDGVAMQEQVRGLRIDFPAASQLPVLATRSTQPPENDGGEGRLGS
                     ALLVVDGESVQVPTGSSVTVMPTELSVQLIVS"
     gene            complement(<142693..>144375)
                     /locus_tag="LDBPK_300440"
                     /db_xref="GeneID:13385465"
     mRNA            complement(<142693..>144375)
                     /locus_tag="LDBPK_300440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862710.1"
                     /db_xref="GeneID:13385465"
     CDS             complement(142693..144375)
                     /locus_tag="LDBPK_300440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862758.1"
                     /db_xref="GeneID:13385465"
                     /db_xref="GOA:E9BLD8"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:E9BLD8"
                     /translation="MTRLHRLAVAVLCLCALAVFYCPGVAARFSESRSLFRDAFEVVD
                     INSTSLRELHESAHMCPWILVTYLDSCGHCRHSAPLVARIAEETLEDSGDVLNEVTVA
                     ALNCETSMHDCHELRVVGVPSFYFLFPSDMPVNATTLEPVVANKNLLDKGNVEAKPIN
                     MTRALIGQGANPNAHFNTARKMWMSASTNLWRATNKELCLHMRTYLRNSKESDAAEAG
                     AGGVLPTASTSNFVEETTFHVVDVANAFFETLFHEVALKGLESAARRRALFRFLRLVQ
                     QRLPGLGADVLLYSMTVNRRVDGAQSSVADFASSVGDWQKLVLSAGIPYQGTPRHLSW
                     RTCKGSSWRYRGFPCGMWLLYHSLTVNAARVDADELTAGVADDNNTEVLFIILDYARH
                     FFACDACLTHFLRFQPGDKDPVLQLWRFHNEVNRRLASLGEGGDPLVPKRIFPTVEQC
                     PACIRDDVTGKEEDRFVEAEVSKYLRSRYKWNPEALHEGTVRVTESTTKRSINDHGGA
                     INVYHNLLSMDTFLTIVLVIVAAVLCMVYVLRRHHSSAAKRRRPILPLRARD"
     gene            complement(145296..145579)
                     /locus_tag="LDBPK_30snoRNA1"
                     /db_xref="GeneID:13385466"
     ncRNA           complement(145296..145579)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_30snoRNA1"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966731.1"
                     /db_xref="GeneID:13385466"
     gene            complement(146055..146105)
                     /locus_tag="LDBPK_30snoRNA2"
                     /db_xref="GeneID:13385801"
     ncRNA           complement(146055..146105)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_30snoRNA2"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966732.1"
                     /db_xref="GeneID:13385801"
     gene            complement(146287..146348)
                     /locus_tag="LDBPK_30snoRNA3"
                     /db_xref="GeneID:13385802"
     ncRNA           complement(146287..146348)
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_30snoRNA3"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966733.1"
                     /db_xref="GeneID:13385802"
     gene            complement(<146965..>147600)
                     /locus_tag="LDBPK_300450"
                     /db_xref="GeneID:13385803"
     mRNA            complement(<146965..>147600)
                     /locus_tag="LDBPK_300450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862711.1"
                     /db_xref="GeneID:13385803"
     CDS             complement(146965..147600)
                     /locus_tag="LDBPK_300450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862759.1"
                     /db_xref="GeneID:13385803"
                     /db_xref="GOA:E9BLD9"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:E9BLD9"
                     /translation="MGKTKDQRESREQLAQEAQVMVSEDFPEELEAIYAKTSEKANIS
                     AMKVLNMAKCLELLEVEVAGGHTVLLVKVAQVVKTSTTTIEITPNSASFGNTILQRVS
                     RFDSALQVSKEGTKIRVVIPPITTARRDKTVAEVNNLISTFRQRVKQSRTKAVKVLQD
                     AGLADGVQQELTALVDSTANAFVEEKAAELELLSEEVMTMGIDESDVAAGR"
     gene            complement(<149388..>150314)
                     /locus_tag="LDBPK_300460"
                     /db_xref="GeneID:13385467"
     mRNA            complement(<149388..>150314)
                     /locus_tag="LDBPK_300460"
                     /product="eukaryotic translation initiation factor 4e,
                     putative"
                     /transcript_id="XM_003862712.1"
                     /db_xref="GeneID:13385467"
     CDS             complement(149388..150314)
                     /locus_tag="LDBPK_300460"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 4e,
                     putative"
                     /protein_id="XP_003862760.1"
                     /db_xref="GeneID:13385467"
                     /db_xref="GOA:E9BLE0"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:E9BLE0"
                     /translation="MNPNATEFMPGRRNGPDGGLEALPTSTADMELAKTPAGAAAAAV
                     HAPSLPGAARRSLQNSPIIQPSRLSAKSASEIEAISKNSALNAAAAAYVPQRTLARVV
                     LTQPSPLALAPSEDPAKDNIEMMLDDLWCLFYLPTTLGENIKEEDYNPTLVFRVDSIL
                     TFWRVVNNIAAPSELQLSTLYLFRDGIDPKWEDPANRDGGIVKVKATAAQVDEAWELL
                     LCRTIGDSWSPSVRETVNGVVLKVRERAYWLELWVTKNSSALQKDLAELWHPILGASF
                     ATTYLTHAMMQERSHAAAALAAEKQKKNRRRY"
     gene            complement(<152069..>153721)
                     /locus_tag="LDBPK_300470"
                     /db_xref="GeneID:13385468"
     mRNA            complement(<152069..>153721)
                     /locus_tag="LDBPK_300470"
                     /product="aspartyl-tRNA synthetase, putative"
                     /transcript_id="XM_003862713.1"
                     /db_xref="GeneID:13385468"
     CDS             complement(152069..153721)
                     /locus_tag="LDBPK_300470"
                     /codon_start=1
                     /product="aspartyl-tRNA synthetase, putative"
                     /protein_id="XP_003862761.1"
                     /db_xref="GeneID:13385468"
                     /db_xref="GOA:E9BLE1"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:E9BLE1"
                     /translation="MNSNHADAGAPAMEKKMSDKEARKAARLAEEKARAEEKAALVEK
                     YKDVFGAAPMVQSTTYKSRTHIPVAKLSQPELVSKTVLIRARVSTTRKKGKMAFMVLR
                     DGSDSVQAMAAVEGNVPKEMIDFMGQIATESIVDVEATVCKVEQPITSTSHSDIELKV
                     KKIHTVTESLRTLPFTLEDASRKESDEGAKVNLDTRLNSRWMDLRTPASGAIFRLQSR
                     VCQYFRQFLIDNDFCEIHSPKIINAPSEGGANVFKLEYFNRFAYLAQSPQLYKQMVLQ
                     GDVPRVFEVGPVFRSENSNTHRHLTEFVGLDVEMRIDEHYYEVLDVAESLFNYIFEHL
                     ATHTKELKNVCQQYPFEPLVWKLTPEKMKELGVGVISENVVPTDKFQARVHNMDSRML
                     RINYMHCIELLNTVLDEKMAPTDDINTTNEKLLGKLVKERYGTDFFISDRFPSSVRPF
                     YTMECKDDVRFTNSYDMFIRGEEISSGAQRIHDPDLLLARAKMLNVDLTPIKEYVDSF
                     RLGAWPHGGFGVGLERVVMLYLGLSNVRLASLFPRDPQRTTP"
     gene            complement(<154700..>156346)
                     /locus_tag="LDBPK_300480"
                     /db_xref="GeneID:13385469"
     mRNA            complement(<154700..>156346)
                     /locus_tag="LDBPK_300480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862714.1"
                     /db_xref="GeneID:13385469"
     CDS             complement(154700..156346)
                     /locus_tag="LDBPK_300480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862762.1"
                     /db_xref="GeneID:13385469"
                     /db_xref="UniProtKB/TrEMBL:E9BLE2"
                     /translation="MLSPQEVANTFVLYVPTYYVSFQCVASLLPDAIREEITGRGRLV
                     NFFKKFPFIFDVLVVDSGRINVRLHPDLIHPQRGVADDKYMMSDVGQTTSYVVKPEFI
                     VCAENIESNGMQRVLLTPPAPPPAMRVRLEERVPVLDRLRSLVPAEFTAIDALEESIS
                     EDILFHPYFNCQGGLFSIAGKMPEEFQVVDGRIRRRPPHLAPLALDEFTLDTSPLPEV
                     AALIKRHVCDSDIPHWVSITPLYEQLTRAQKQEIKRRYRSFAGFLRAHGRSLAVSTDM
                     LQVSMWIFVSSPSPPTSASANAASAGADDQAVTARDSSAATPSAASSSSQQGAPSEPP
                     VSPAAAAGPSGATSAPPTPVVYTREQILNAWYDRFPPYKTLNLRDAMQLLPVEMRASG
                     LPTKIAPWLATHPHYFSVDFAEEEDPTKVLIRRASERQPLDLVAALYAKIPDKDTPCP
                     SAEVLHKLDPLVRRVIEGIGLAQLGRVLPQWLLIEKCRGGGGAVVGGPPQQEAFTIRR
                     LQDMEALEKAQRRDSKIVRKREVVEVDADVAGLEESVTKT"
     gene            complement(<157414..>158823)
                     /locus_tag="LDBPK_300490"
                     /db_xref="GeneID:13385470"
     mRNA            complement(<157414..>158823)
                     /locus_tag="LDBPK_300490"
                     /product="bystin, putative"
                     /transcript_id="XM_003862715.1"
                     /db_xref="GeneID:13385470"
     CDS             complement(157414..158823)
                     /locus_tag="LDBPK_300490"
                     /codon_start=1
                     /product="bystin, putative"
                     /protein_id="XP_003862763.1"
                     /db_xref="GeneID:13385470"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="UniProtKB/TrEMBL:E9BLE3"
                     /translation="MPGKEKAKKELHRSNPLGDDIHAERFASAKSASRRAADENDADQ
                     AGYLIPNHTTKRILRTAKKQLEAIQGEVTAEENATAVCGEDYRDNGLQDLIDNEEMTT
                     EGREHRYEVEAAADDEDVVLEYDDNESIASEMPVDVPDVSPEMYGIDEEEARLLNAFQ
                     PASRVQSRNLADMIMEKIREKEQGARRGATPSPSDNARVVDGDSEDKIDNRVARVYTA
                     IGTVLKRYTSGKIPKAFKILPNVKNWEQLLMLTRPDQWSPHATYQATRIFAANLNESM
                     LQRFYAAVLLPIVHERLLEEKKLHPALYMAVRKALFKPVAFFKGFLLPLAMDEECTLR
                     EALVVASVLQRCHLPPVPTAVTIYKIAQQPFSGRCSVFLRVLIDKKMALPYQAIDELV
                     KYFHRFLETHTKEEALPVLWHQTLLSFIQHYKADLAEAQLGLLSNVCNVHFHYMITPE
                     IRREIGAALRMKQGAAPVS"
     gene            complement(<159753..>161903)
                     /locus_tag="LDBPK_300500"
                     /db_xref="GeneID:13385471"
     mRNA            complement(<159753..>161903)
                     /locus_tag="LDBPK_300500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862716.1"
                     /db_xref="GeneID:13385471"
     CDS             complement(159753..161903)
                     /locus_tag="LDBPK_300500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862764.1"
                     /db_xref="GeneID:13385471"
                     /db_xref="UniProtKB/TrEMBL:E9BLE4"
                     /translation="MSGSTQRAEQQRRIQQLHERLELYNIADSHTDPTGNSAGGVGFA
                     GAGGPQTGSGDKAPATKPSRAAPMLSSPNPNPTPAPASNAFFFASPLPRRAADAGAPS
                     STFGLQRDNSSGSGATAAPSATEIAEVSRASPAPQQQPQAQMPAPVPAPQLARNLAQE
                     FFVSAASPTHASPTRAAFRSSAMTSGAAASPVAPERPSVTAAYPESATEATAAATAAN
                     AGSPRLAPNAFDYYEDSKSDGSEGDEYEVEEVEEYMEDEEDCDDDGEDADEHARGKAS
                     LTLEDVLRRLHRACSGSVDHAAVSSPLEQAMAAAPASSPLARDPSLASATPAAAAATR
                     ATLTAAATCPVGTTYPFLQQAAEVYRQRHLYQATQEQQQHHSPFNTGHAWSTDEETSV
                     TDTSTSEPTEGLGDASESRSASGSSCPSAASKGHLTAANATAAVQNSGLSAAALQSLA
                     DTAIATRTASEGASAEKLLPSSALCFDQLETAYRRLLILQEGAKYVSELAGPECFPRP
                     LPRQEDARALAEQRDMVVKRDTEMRAAPPAGTSLEDLRQRESAAIERTLGLLREKFDG
                     AMKSLKPVADREAVVEGKRRTLKQRELDIEKQREARLIVEREVAAAEKRLMERSEQLR
                     KREEDYSARLQQHDHQQKAAQEQIGEVEQLSKQVSSWLAILEERDRRLARKEKRLQRV
                     QADLLKRTEDIIVWKRATQRIKQIPPPPSPPRIS"
     gene            complement(<162533..>162808)
                     /locus_tag="LDBPK_300510"
                     /db_xref="GeneID:13385472"
     mRNA            complement(<162533..>162808)
                     /locus_tag="LDBPK_300510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003862717.1"
                     /db_xref="GeneID:13385472"
     CDS             complement(162533..162808)
                     /locus_tag="LDBPK_300510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003862765.1"
                     /db_xref="GeneID:13385472"
                     /db_xref="UniProtKB/TrEMBL:E9BLE5"
                     /translation="MLTENWAEKRLHSRVYPTSALPLPPQNAGVTDQGARAVCAVLRP
                     RHRCCHTRKRAPDSLAHSCAAARAAQRQQRRRERVDDGQLLGGRCYI"
     gene            complement(<164361..>165815)
                     /locus_tag="LDBPK_300520"
                     /db_xref="GeneID:13385473"
     mRNA            complement(<164361..>165815)
                     /locus_tag="LDBPK_300520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862718.1"
                     /db_xref="GeneID:13385473"
     CDS             complement(164361..165815)
                     /locus_tag="LDBPK_300520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862766.1"
                     /db_xref="GeneID:13385473"
                     /db_xref="UniProtKB/TrEMBL:E9BLE6"
                     /translation="MSFLRPTMSSLRRAVNGGKDEQHLHGGPSATAGVAQPLPAQPIF
                     HNAATGDYSHVSSRVDTGLRSRVRTSSLTRRPAAIAMSRSPSLREFSDKCDSVIQRAQ
                     EMLERTREQELKVTKALEERKSQSPARQATPPPPREMTPQRTPANMPAGLASPSSSPA
                     TLNAPYTTPVTPPRASSILTTTSPSLPPLPAPPPTPAGLPHSPPPTQPATDKSPSDPV
                     GRFSPPSLFQRLRQSWQRGSGLAWEAHATSPTPSSPDGALSVGIARMSPRKSVRFASP
                     DKLETVTPTKVVALSSDDDDDDEEDEETSEDEEEEQEQLPPTKKTRAESSGCRHTPHR
                     DSVVVPPAPPPSAVKSGSRSRSGSSTSLPSSRSPPPSRGTASPPSSHREGTRSPSSTH
                     TTSPRQCSGISGDGSRSGRSSTSSSRPPMDHDEVKEYVIHHTIRRSLSRISRANMEDY
                     LREEGVALPAEGHWLKRQLLAHIRALIKQELAPH"
     gene            complement(<167352..>170798)
                     /locus_tag="LDBPK_300530"
                     /db_xref="GeneID:13385474"
     mRNA            complement(<167352..>170798)
                     /locus_tag="LDBPK_300530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862719.1"
                     /db_xref="GeneID:13385474"
     CDS             complement(167352..170798)
                     /locus_tag="LDBPK_300530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862767.1"
                     /db_xref="GeneID:13385474"
                     /db_xref="UniProtKB/TrEMBL:E9BLE7"
                     /translation="MCASPSATVHVPTVYDLMHEQSRSIGAFASTELENVYSLSAHMS
                     AARHATSPSSATRSLADFLDDIFFSYTGVPSWSTFLHIQQEGAALRRQLGAGATFAHE
                     AVHPSLSPALKQWAQALRSQRAARARAIGAGDSPRSTIVVSAAAPRGATSAGKPPFRS
                     ESSASATAADPAATLNHNATKSVALMTAGASEDLDSSSSLMERELAAENARAHLPAEE
                     DGVLPLWRDLKLTKRCGPLALQGLRAAVGAYYLALLRLVDITESLADHWGLLSPKELK
                     GLHRAMAAEKAAHVPPSFLFSVFTELNASGERLSNAVADLRKCTRLETVRLTGNAALT
                     ELNVLPPHCRVVTACGCSLGCFLEEARSTPPSPPSAAPRGVYALVTTLGLAYNRLRHL
                     HFVQQLPSLRVLNMSFNYVSDLEAAVRDVAAHGSLTEVTLQGNPISLLDAYRTVLVRG
                     CVHLDRLDGVAVTGEERALSCPAVDDGDAAQEDSPGRPLLDSALAGAARKPSCTALPN
                     ICGRLRLNVAASPAPPSPQHNPSTRGCVTFGAPPISKSKLVVSMVGSQPPVSDEVLRT
                     TVAAGLDLVMVRGLASLQPVPQTCLADSLLPSSGFLLELAGVVTSAKASVPSGGCASP
                     IQASSLVTSPLASPRTSSVQAGSRKGRHHGGAAGDSGGRGASANGSSTNGKRVVPPLY
                     EVSSRVTVEGCWGGSSVSSGDAPLGSGDGVCVSVEVCLEPPAPLSTYSAGRHAGAPGA
                     PPPRVPSAAQSRQRRAGGTAAATNEETPPLPIPDPYIPARFTAGAGGGGGASCVVSLP
                     VTDTLVCALQQPLVLRVVVQDTFRFAEGEAALRSQLDTSTSSAARGSPVGRSGAGARS
                     ATGELPSNLVLPSAFSLGEAPPWATSCQRGSEDAEEEEAVLLLRRELGVITLDPRDLF
                     LVAGDNPATCTGAPCAPTPLPRCRVLYVHDAALERDSHTLKSAEREVRQCQRRLREAL
                     ATYSDMHHHYKEASRKGLENLDSISPAPSAALGKDSVATGTPSPQPNRRRTSVAVNFS
                     TAVLPLPSASSSKQSARSRPASVLTPPAHTSQLQGLYASLKAEQLRVAQRALRVLALR
                     TRLDELRGASLSVGVRFCVGRGAVPPPSTAADAELEALRHPTGSPKGRKGRQQAAKGT
                     RR"
     gene            complement(<171594..>174284)
                     /locus_tag="LDBPK_300540"
                     /db_xref="GeneID:13385475"
     mRNA            complement(<171594..>174284)
                     /locus_tag="LDBPK_300540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862720.1"
                     /db_xref="GeneID:13385475"
     CDS             complement(171594..174284)
                     /locus_tag="LDBPK_300540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862768.1"
                     /db_xref="GeneID:13385475"
                     /db_xref="InterPro:IPR019183"
                     /db_xref="UniProtKB/TrEMBL:E9BLE8"
                     /translation="MDAERAAVRIFDLIDARQIGQAEGALETALQKFPDDDSLRAAEA
                     LIVMRNGNYRLAKAKAVALSERNITKPKAVNALVHVLQNCCCWDALAATYERLKPLQN
                     ERQISENLVQTYTRMGAYAKVQQAAMQLYRQYSDPKYQVWMVQAMLAQVPADSSDHIL
                     LKLSTKLLDAAVLTEKGHIVPSTVQTYVDVLAQQGQYATAVDFLLSGRAAKIGLLATR
                     LEALARMLQKAGRVSAANAVARYLWSQESDNWASFTIYKDTLVPAADIDAGEGGGEAS
                     ALELRGPAPEMRTTVDCTMAHHSLEEAVQLARELQEQEESKHPNKHRRGPYLAELDLL
                     HSLQSTDMQARVIAYVERFYRKPSCYLDISTFLTPAIAASVYEWSRSCACAASRDEVD
                     VHTRRILGLRCLVGSWEETPAAGEPRALFCECVEAYQSSRHLSESLAWSEEGLCDGYV
                     TVALNIALRCYAADKTSPDYSYLVEGLDLMSVVDRRMNNPTWLIYAVCFANLLGLTER
                     AALHQLAFKNVQRDTMAHVGYWPLLTGLALEDVANWDCWAEDYYSLQERDCSLLRAKV
                     FNYTSWPAMQDVQRFEAAQTNSLYRWQCPANEFTSALLECQTQKDVKESLKVRVEGLW
                     AAWERLSVAGAADTLIDNTDWIVAKSVVLGNIHSATVQQLTDSLVVVPSRDWQVRRSR
                     QLLSSIFLVHDLAAVSSHREAAVQASKSRKGKSARADSDSAAAPVLYSSRLGTPSASV
                     EYLPAVQPLAGVLRAYVDSLGEVAPEAASATAELRTYLKSLVADSEHSAGAFEVFLYP
                     QAYILSALLKMAPAAKLPVKQWVADVRETLETAQRRYESRSWSALATTVGRTPVPSAR
                     AVESINLAPDSFTAKLEAEKVHRIVGYVSSLKVEMGAYAR"
     gene            complement(<175184..>176497)
                     /locus_tag="LDBPK_300550"
                     /db_xref="GeneID:13385476"
     mRNA            complement(<175184..>176497)
                     /locus_tag="LDBPK_300550"
                     /product="glycosyltransferase family 28 protein, putative"
                     /transcript_id="XM_003862721.1"
                     /db_xref="GeneID:13385476"
     CDS             complement(175184..176497)
                     /locus_tag="LDBPK_300550"
                     /codon_start=1
                     /product="glycosyltransferase family 28 protein, putative"
                     /protein_id="XP_003862769.1"
                     /db_xref="GeneID:13385476"
                     /db_xref="GOA:E9BLE9"
                     /db_xref="InterPro:IPR007235"
                     /db_xref="InterPro:IPR013969"
                     /db_xref="UniProtKB/TrEMBL:E9BLE9"
                     /translation="MWFLAALLLGSAFLASLWHSVVRYVPLAMRSPHRGAMKVGVVLG
                     SGGHTSEMLRAITELPLSYWLDTRPFYVVSATDPHSASLASQLEQQRFERRVVVHTIP
                     RAREVGQSYLTSIITTIRATLACFRLVCAEKPDVLLTNGPGVCVPVIVAAVCVASCAP
                     WWYGRPAIVYMESFTCVSHLSLTGCLLAPWLADVFTVHWRALERAVTRRRRRGTLVHV
                     VSETARVTDGAPHRLRSLAAEQEAYALVTVGSTKFSSLVQAVLQPGVCAALHQRFGIK
                     RLYVQHGTAEVVAPPEATLLPALPTAAGADASHPTQQWSCGGLLVEAFPYRPCLEAVI
                     RGATLVITHAGAGTILEGLQAQRPLVVVPNRQLMSDHQLDLAEALANGGFLFCVQVGE
                     LAERLPLLDLTTLRPHGGMDAAQLQEALRLVLTGHSASGERAKAE"
     gene            complement(<177213..>177779)
                     /locus_tag="LDBPK_300560"
                     /db_xref="GeneID:13385477"
     mRNA            complement(<177213..>177779)
                     /locus_tag="LDBPK_300560"
                     /product="nuclear cap binding protein, putative"
                     /transcript_id="XM_003862722.1"
                     /db_xref="GeneID:13385477"
     CDS             complement(177213..177779)
                     /locus_tag="LDBPK_300560"
                     /codon_start=1
                     /product="nuclear cap binding protein, putative"
                     /protein_id="XP_003862770.1"
                     /db_xref="GeneID:13385477"
                     /db_xref="GOA:E9BLF0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR027157"
                     /db_xref="UniProtKB/TrEMBL:E9BLF0"
                     /translation="MSSDLVDTVPRMEYVDRHELLRSLLTTEEFRERRQEQLNYSATV
                     YVGNLSFYTTEEQVYNHFSPCGHIRDIVMGLNEATRCPCGFCFVVFESQAAAVLAVHG
                     LDGSLLDDRVVSVSWDVGCDGSRRWGRGAHGGQVVDGVRQNLDEGRGGLGALRRDALG
                     VPASTAEDELVAYDWVEAPPKRRGAHTK"
     gene            complement(<178910..>180739)
                     /locus_tag="LDBPK_300570"
                     /db_xref="GeneID:13385478"
     mRNA            complement(<178910..>180739)
                     /locus_tag="LDBPK_300570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862723.1"
                     /db_xref="GeneID:13385478"
     CDS             complement(178910..180739)
                     /locus_tag="LDBPK_300570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862771.1"
                     /db_xref="GeneID:13385478"
                     /db_xref="GOA:E9BLF1"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="UniProtKB/TrEMBL:E9BLF1"
                     /translation="MSGGYIAVTVIFFVLALGVCLLTYHYYTKVSIKQIPLACAVWHV
                     IALYMCMLPFPLLVVDIDASLAAQSDASQKQDWMRPIWITIFAVTYFCAWVSLPLAQM
                     YTEVGEFTVKGRLLHSIKLNLILYAVIIVIVLAALGYFVVITNSYRSVAKVMKVVISL
                     ANAWGLLILTLFMPAGLVGVPRMLWRYADAKRLLRRQLYEATDIQEDLDLAAMDLASI
                     KAELISIDPQVSEEDRPHLAFMLEIISAADREIPMYHIAALRVKTVPSTERNDVSLLH
                     LETLNQRLKKAIKIANRANYRWNSTVRKCDSLDQIVRGVKGTNNRLKRMWFPIRQYVY
                     YTGCFVCSVLTIFILWSELTMPLRDWAGKPLGVIELVMKSSIHFIGSVVLLFYMAYCA
                     YWAAFQFKVHDVYVVYPSIADNASLCFNETFLVRLLMPLCFNFLLISGLSSTASETRV
                     DVAYGHVYRSNMDIGLLFGSYVNKLLPLMIPFIAATVFFQLTQQVLSVVGIEVHNPND
                     VENPAVRQRIIDGRKLVEAELGYQLTSPFLSEEGVTETKSPSPSPRAARPGRDGVEES
                     DTKRGQRYRDYLQKKRGSAAGAADGGSEMMNFRIAGTSREGEP"
     gene            complement(<182867..>183844)
                     /locus_tag="LDBPK_300580"
                     /db_xref="GeneID:13385479"
     mRNA            complement(<182867..>183844)
                     /locus_tag="LDBPK_300580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862724.1"
                     /db_xref="GeneID:13385479"
     CDS             complement(182867..183844)
                     /locus_tag="LDBPK_300580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862772.1"
                     /db_xref="GeneID:13385479"
                     /db_xref="UniProtKB/TrEMBL:E9BLF2"
                     /translation="MSGNKDIYTFQYGELKKGQTYALAMARVADNFVHSSFHDSPNYE
                     KLLLSIFEHISKDPSMDDKMLQALENALMARQNAVLKEARDNDKDRKKFVFEKRTTGR
                     DPNEDSGSDAEEVTEEELAARKAAQEAEEKRKEQEWIKAQERYAALQLQKRENEERLR
                     AQARKVDIDAFQRQLQSRGAVLVDSGLPTKKKGGKGAAKAGQLSAEDAEKMKEEVALI
                     VKEKERLDTALHTSDEELPAALEEARRSLAEYKQRAAAIGEPAAPTKEMSKSEVTQLQ
                     QKLAKQTMDKNRRALQLKAMEPNPLRDELVSVLEQRDVLAVTVERAENA"
     gene            complement(<184432..>185856)
                     /locus_tag="LDBPK_300590"
                     /db_xref="GeneID:13385480"
     mRNA            complement(<184432..>185856)
                     /locus_tag="LDBPK_300590"
                     /product="spliceosome-associated protein, putative"
                     /transcript_id="XM_003862725.1"
                     /db_xref="GeneID:13385480"
     CDS             complement(184432..185856)
                     /locus_tag="LDBPK_300590"
                     /codon_start=1
                     /product="spliceosome-associated protein, putative"
                     /protein_id="XP_003862773.1"
                     /db_xref="GeneID:13385480"
                     /db_xref="GOA:E9BLF3"
                     /db_xref="InterPro:IPR006568"
                     /db_xref="InterPro:IPR007180"
                     /db_xref="UniProtKB/TrEMBL:E9BLF3"
                     /translation="MAKSKKEKKAARREREAHLKKISQRIQEKILLAEVATAEGEVEE
                     IVYTLPPTPAELRAAEEEQERQQAAIAAEAEERAAAAAAAKAAQAAAAASAEKDEEDR
                     VVLPSLDGGEGGAKGCRHSSSALSGRKHHRMTWEELKLRAAEMYGLEATELVDQHDGN
                     AVDPLFTVRMKMEPHTVPVPHHWHLQRTFLSRQADREEAVGIVPAEVAALGIEKIRAT
                     KDKMATPNQVAFISCFMTGTPLQRKTYNVELSRCGDVFYEGKWRPKAHHTPGVLSKRL
                     RQALGIGPTAPPPWLYSMQTMRRLPPAYPDLRIPGLNAPIPAGGQWGLGQDQWGEPPR
                     AEDNSFLFPGVMDEAAAAGSTQAELRWGTVPPLVTSHEEVPSAAGASSPGAASPAPAT
                     AAQALPRPTPAAGRPVITPVPFQPQAYVPQQAVPAARVTPQEYVQVKDNTTNSTVAVG
                     YMMMPKDGVQSQPPPSRYPPAQGS"
     gene            complement(<187270..>188709)
                     /locus_tag="LDBPK_300600"
                     /db_xref="GeneID:13385481"
     mRNA            complement(<187270..>188709)
                     /locus_tag="LDBPK_300600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862726.1"
                     /db_xref="GeneID:13385481"
     CDS             complement(187270..188709)
                     /locus_tag="LDBPK_300600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862774.1"
                     /db_xref="GeneID:13385481"
                     /db_xref="GOA:E9BLF4"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="UniProtKB/TrEMBL:E9BLF4"
                     /translation="MPAYSEVKGTCGTPVLDQLIGYYVNIQSRKMYYKDFLRIEHQAV
                     RWAFADIRKNSEALAHGLLQTGVRPGDRVLAIQPCNCETFVLQLACAKIGALLCIVPQ
                     DTISADKLRFYLNEFQPRHLVAREWINVPEMKQGELVERNMHFWDTIYNVIPELGLSY
                     PGQKFQWVHSQEFYYLKKIIITDHNMNLLGVTPMRKMLVWGPFSYYEQRLRRLSALLH
                     PDDPVLALEDPNPAMEDKLHITYSHRNCVNAGFLFSQLMQLKAETRFGVMPNHHTDPI
                     GAIIAPYAALTSGAVLVHIHSDMFTDDHAINGIEKLCVEEVETLVGRKADFDLILKHA
                     GNFDADQFEHLRSVVIFENGIEAPVSEEYLNKLSKSLNLDDVYVFRGPIEASYMLTWR
                     TLKKGSQGMVPHVEAKVVGDRGTSDAKVLAAGTRGNLRLKGPHVTAGYYNNAGLMTEL
                     IDEHGFASTSREAMIDGKDNITLMSAQTY"
     gene            complement(<189992..>192487)
                     /locus_tag="LDBPK_300610"
                     /db_xref="GeneID:13385482"
     mRNA            complement(<189992..>192487)
                     /locus_tag="LDBPK_300610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862727.1"
                     /db_xref="GeneID:13385482"
     CDS             complement(189992..192487)
                     /locus_tag="LDBPK_300610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862775.1"
                     /db_xref="GeneID:13385482"
                     /db_xref="GOA:E9BLF5"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR016616"
                     /db_xref="InterPro:IPR029333"
                     /db_xref="InterPro:IPR029429"
                     /db_xref="InterPro:IPR029430"
                     /db_xref="UniProtKB/TrEMBL:E9BLF5"
                     /translation="MATAKDASNHIRLDTAFELNIGAPILPDRVAAGRFLRSAAAREA
                     SASAQTLAVRPPPSAVSLAFGSSGQRILLHNNNTSTAKAKRSAKRGEAQASVGVTFRL
                     EDDESVIQTLNFGKAPTALAAGQLYDTWSTDIAATYDVLLFGAATSLLAYDAEQNKQV
                     FYKDVEDGVQAVVCGTVMKPSSTSGEAPPLAVVGGNCSIFGFDRFGAERYWTVTGDQV
                     TAMALMPWTSVPDSGSAPLSLLVASDDFEVRVYDGEEAIATVHEVDRVQKLVPLWQPS
                     RIPDTEAAAADSAGRYAYLLANGTVGMYERGERVWRVRGKSVPVSAAFCDVDGDGVAE
                     LVIGWSNGRVEVRTDRGGGLEKGGSVLFRDTYSSAVAAVLSEDYRQDGMPLPVICTVD
                     GTVRGLALLETRKDEAAEVRQLQVLEALVQEKQQLAAQLTSLEEQLARRAAGAQDTTM
                     PESGVEVRCCCSANLATKHVEVRVEVTGPAAKRGDIVVHSCLLQCEVWATAAQQDTVA
                     FANAEPSATLVCSFAHPDDLPLNVSASVAVGPAFGDSYQIHEVTVRVPRFMMYQLPYK
                     IPPEQQRQRQGETVAYRQPNGCVLLQWRELLHLDVIERWLRHSFCVPEDVALLDANAP
                     TDQVLHLELIHVRDGSSFGIEVRNAAASGAAFNTITLWSDHLAPCGAVINAFVEDLKG
                     GWADGKADPVAVRCEMPLELERLRAIFARVDEFNEVRMKLTTDMADAATVVKTLLGRA
                     EDARLLGDMASMKKSYAALYDVDQELLCENAKRINNYEELKLALKEVNTCIQQAGMVR
                     IGPARAQLIASCRNALKENQVNSLLEIIRTGSE"
     gene            complement(<199815..>202601)
                     /locus_tag="LDBPK_300620"
                     /db_xref="GeneID:13385483"
     mRNA            complement(<199815..>202601)
                     /locus_tag="LDBPK_300620"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862728.1"
                     /db_xref="GeneID:13385483"
     CDS             complement(199815..202601)
                     /locus_tag="LDBPK_300620"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862776.1"
                     /db_xref="GeneID:13385483"
                     /db_xref="GOA:E9BLF6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BLF6"
                     /translation="MHSRENVGYARPGGVDIDLPTEGSIPISRGCTASRRIVRSLKNP
                     LACVMQLVPLDSGENSRPPHLLSRFNTASIPSEASVSEVRSELCSVAMEEQTEDSTSS
                     FFDHRRLRHGGKVSSSMSRSRASRVGHEIRARMRRSFPSGSSREVEESFLSYSDDPSF
                     YACDSDASSNSAETEGSSHSMSYTAISESVPSCSLTGLTENKYAVTGWASRFRKPNVP
                     PPHRESNSFGSIFGSGGIDPYNGASVNAHHQARDSAAADVAVGIAAEPRIAAAVPQRD
                     PPVVVISPSASSARVNTARTSHVAASTAAQSAPSASVARLCDGGLQFTADNSSAVQGT
                     DRGSPLSNSIDQRPRVQSVKLLERVGRGTFGDVYRAQDLDSGNIIAVKEIIVPHDFTK
                     DVEKQLAALESEIRVMRRLHHPHVVTYLGAVRENNSLRIFMEFVGGGTVGSKLESVGG
                     LSEEKTRDYTAQLLEGLEYLHVSHILHRDLKGDNLFLTEDDQLKLGDFGQSKELADTL
                     ITRSVQGTPSFMSPEMIACSGYSFEADVWSVGCCVIQMLTGKPPFANLDNQMAVMFAI
                     ISSKIEDQIPACASEGAKDFIRMCTKTNIKDRWNASQLRRHPWLLGQGAPAAATASAA
                     VTKAAGERREGAGHKPIAAHPPLKTKEPAHPNPHPGKPPRSILLDTAALAKAKGGDDM
                     TKDPSSSSPGGYQYSLEDETGDHEAGGTTSSNLSSSKSETPSSKNAAATRHAGVPFSG
                     SSPLSEGASMESRHRSPMALPEALPSGGRLDRTHESAHRATPGQGDSLVMVGQEGSGG
                     SGARGRRKSPPEPAQRPQRPAHLHKERSPRHRALMTGGAAAVESSSKRRSNPSPVSRA
                     LNTPVHNRANLSTSPSKQRADLRPAGSSIYRVSGVANQPSRTTPNKTSSPGKKRQTTA
                     VRATGHALKNDHKA"
     gene            complement(<207271..>208884)
                     /locus_tag="LDBPK_300630"
                     /db_xref="GeneID:13385484"
     mRNA            complement(<207271..>208884)
                     /locus_tag="LDBPK_300630"
                     /product="nitrate reductase, putative"
                     /transcript_id="XM_003862729.1"
                     /db_xref="GeneID:13385484"
     CDS             complement(207271..208884)
                     /locus_tag="LDBPK_300630"
                     /codon_start=1
                     /product="nitrate reductase, putative"
                     /protein_id="XP_003862777.1"
                     /db_xref="GeneID:13385484"
                     /db_xref="GOA:E9BLF7"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:E9BLF7"
                     /translation="MGSKHPRSTTSAPAREEERQAHVDTEHHTEPPFFNTAAPEAAEM
                     QVTVTPTTPPTSMEQEAMMVSGEEPSKLAVPQQQHLPRTFFTMAEVQQLISVNPGRTL
                     VIIRDKVYDVTTFLASHPGGKSALRRNNGKDVTDAFFSMHSATAMRKLPDFLIGELAS
                     SESTPAAAEETPTAALVPVRLRMADITKALSEDPNRIILILFSDAYDVTPMRDKHPGG
                     LSVLANNNGRECGDTFMRIHGLLAKKMVKQFYLGPVEGPARRRSPLRPAVAAEAESAA
                     IPPAGPKTQSTRILEMERVNSTATIRYFTFSCPKPLHMIPGGHIKLYSNLHKEESRFY
                     TPFKTGATSFTICMKHYPNGRTSGYFFDLKEGDEVFFDGPLPPSWHLNTDAAVQRAAP
                     EERHVVLIAGGTGIVPLYSISSDALETQLSSVTFVCSVRTPDDLILATELRRLANRYS
                     TALPIQKHTLRIVLLFSRASPQDISVEATSFASHVLCGGRLTAESFKGTEIRPAQAVV
                     VCGPPTFNDAVAAAVLEAGICTATQVHRL"
     gene            complement(<209968..>210618)
                     /locus_tag="LDBPK_300640"
                     /db_xref="GeneID:13385485"
     mRNA            complement(<209968..>210618)
                     /locus_tag="LDBPK_300640"
                     /product="ribosome biogenesis regulatory protein (RRS1),
                     putative"
                     /transcript_id="XM_003862730.1"
                     /db_xref="GeneID:13385485"
     CDS             complement(209968..210618)
                     /locus_tag="LDBPK_300640"
                     /codon_start=1
                     /product="ribosome biogenesis regulatory protein (RRS1),
                     putative"
                     /protein_id="XP_003862778.1"
                     /db_xref="GeneID:13385485"
                     /db_xref="GOA:E9BLF8"
                     /db_xref="InterPro:IPR007023"
                     /db_xref="UniProtKB/TrEMBL:E9BLF8"
                     /translation="MSEYQLDVGLLTVTDVSTVSGPMRREEDLMSSCTNALKALLGEF
                     VDLPTEVKKTKYESATTLVQLPQPVMQLPREKAPPKTKPLTAWQKFALKKGIDIHRKK
                     ANRVFDEDRQVWKDKWGKRAREDRDKYDWLREVKPGYMPAEDGGDPFLDDRRAKQARL
                     EKQKKKEEHNKRRSEHLMQAQEEVKHLSAAARNLATASNGKFEKTKKFKKNTKRLA"
     gene            complement(<211390..>212811)
                     /locus_tag="LDBPK_300650"
                     /db_xref="GeneID:13385486"
     mRNA            complement(<211390..>212811)
                     /locus_tag="LDBPK_300650"
                     /product="histidyl-tRNA synthetase, putative"
                     /transcript_id="XM_003862731.1"
                     /db_xref="GeneID:13385486"
     CDS             complement(211390..212811)
                     /locus_tag="LDBPK_300650"
                     /codon_start=1
                     /product="histidyl-tRNA synthetase, putative"
                     /protein_id="XP_003862779.1"
                     /db_xref="GeneID:13385486"
                     /db_xref="GOA:E9BLF9"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:E9BLF9"
                     /translation="MSSTASPNAALLAEINDLKVKLAEKEALLQPEGVVSKKSKKKSQ
                     ANMIEKEPVQGCRDFPPEDMRVRRHLFGVFHDTARRFGFEEYDAPVLESEELYIRKAG
                     EEITEQMFNFVTKGGHRVTLRPEMTPSLVRLQLAKGRSLLLPAKWYSIPQCWRYEAIS
                     RGRRREHYQWNMDIVGVKSVAAEVELVCAACAAMESLGLTAQDVGVKVNSRKLLQCAL
                     AGAGVPDSLFAPVCVIVDKMEKLPEEQIRAELKDLALDGQQADDIIKTLSLRSVDDFD
                     KDLFDKNGALSELAEFFSQMQMYGYGDWIQFDASVVRGLAYYTGIVFEAFDRSGEFRA
                     ICGGGRYDNLFTLYGSPQPVSCVGFGFGDCVIVELLKKKKLINSLPHKVDDVVIPFNE
                     SQRGTALKVLKQLRDKGRSADIIMDSKKVAQTFSYADRIGADRAVLIAPDETEKGMAR
                     VKMLREGQRGEDDRGDPVPFEDL"
     gene            complement(<214522..>215118)
                     /locus_tag="LDBPK_300660"
                     /db_xref="GeneID:13385487"
     mRNA            complement(<214522..>215118)
                     /locus_tag="LDBPK_300660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862732.1"
                     /db_xref="GeneID:13385487"
     CDS             complement(214522..215118)
                     /locus_tag="LDBPK_300660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862780.1"
                     /db_xref="GeneID:13385487"
                     /db_xref="UniProtKB/TrEMBL:E9BLG0"
                     /translation="MLRVCSVWCSNALHNSTPFVDGALQLMKLHLAHRNATADKNKVA
                     CHAIEQEFFREVEVFRPCFTMSASLEVAQQYSRRLYAALKYFRMDDDPLIRQLDLLLG
                     RRAMQDGRHEGQRGFFKGARTSNTSAFGKGGEITHETLAEHAETTLPTELPHAPKVDL
                     TAPRRPGALRINQRYRGHWVLQEPDIAITRSERREDPW"
     gene            complement(<215941..>217134)
                     /locus_tag="LDBPK_300670"
                     /db_xref="GeneID:13385488"
     mRNA            complement(<215941..>217134)
                     /locus_tag="LDBPK_300670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862733.1"
                     /db_xref="GeneID:13385488"
     CDS             complement(215941..217134)
                     /locus_tag="LDBPK_300670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862781.1"
                     /db_xref="GeneID:13385488"
                     /db_xref="UniProtKB/TrEMBL:E9BLG1"
                     /translation="MLHRTARRLLGYTPINPDTSPMLMYSQCHWHYNLPQGMERPSSV
                     NRSLPAPYQPHHSSVNKYRGVWISTEMHPAFLVGLEPQLKKLPHGRLVPQTPVAEVID
                     EFEKLSPLIDDAAARDGWLAKIFQHCAFQRSGAEAMALWNKHCAPRFMRDDSASAPPL
                     PLVQAILFCCSKSDSAEWRPIFTKCLKDGWNYTPSFDTPQWSYLLKSLGRQGDEEGVR
                     LVLEEMADVQADLDRVEARSLVYALNAVHDKAIYNYVKKYLFYLGERKVKFLRITYAD
                     LRGHGAEKLRVPLKENDSMFYHVCWHASIRQPRQFSPRQLYFDYTPSQLATSGHSPNA
                     KVDGIVKDKIDKWKAEGLLPEDYVYEDRVYDRTAAFKSVARQEKWKKVPWIVKSKRFG
                     YSGEP"
     gene            complement(<219168..>221360)
                     /locus_tag="LDBPK_300680"
                     /db_xref="GeneID:13385489"
     mRNA            complement(<219168..>221360)
                     /locus_tag="LDBPK_300680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862734.1"
                     /db_xref="GeneID:13385489"
     CDS             complement(219168..221360)
                     /locus_tag="LDBPK_300680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862782.1"
                     /db_xref="GeneID:13385489"
                     /db_xref="GOA:E9BLG2"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR015359"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:E9BLG2"
                     /translation="MGCLNSKSTAEKTTSGPKRFGYHPKSNNKHHNEEKGVVSKYSAV
                     KGWAGSSDNDERTEEVGPDANKATKASAERFLRSILEGAELFFSGLPDSQAVKQLIAL
                     TFTNSCAEVTRTKFRLKLDLITVLLTSLARQLKLPLIEASVPQVEERAMDDGFSRILL
                     AWFSNNPSFGKTIPVTSGQAVLNTLYIRYVVSKSVSFEDILAYQFRWVSANDAATEVF
                     NKFTDGKESMTSEQLGKFLRDVQRSEVTDRQIVEKFKYCFGGGIHKYNFISYNGSVLT
                     NNAIDPARTSDVWQDMTQSFTHYMVSCARIETEEDLKRAAADGTRALVLNINKASNGK
                     LMVGSCELQTILEGVKKNGFATNTYPIVLCLSPGTPMPTPVQDEVAKMINDILESAVA
                     EGLMFEGAMINDPKFSPGALRNKVLVMSHQSRLKPFIGFLVADMNKDGLGVRVTDVME
                     GTPASKGGVLKDDWLTHINGIPIQNKQHLRETLARLKVGDEFTVRRENLHDVKVVVGG
                     AIDPQDTTASASLSSITFFKYSDSNDPKPWDTERVPASSLATTKLTRKDLLTHFAFCT
                     VNSAEVSTELPDAEGKAASLGIQFVDVDNSERCLPWTRGRFSDNGRCGYILKTDIDSA
                     KSPELSFSVIGGPRLLNCSPLTSMNVTIHGAGAARVNGSQVSFTDCNQATIAVVQMTF
                     EANGAERTFTSAFCPGLLRPGYRALPSVPFGEERASKKQIHGIYCFIK"
     gene            complement(<222005..>222205)
                     /locus_tag="LDBPK_300690"
                     /old_locus_tag="LDBPK_300710"
                     /db_xref="GeneID:13385490"
     mRNA            complement(<222005..>222205)
                     /locus_tag="LDBPK_300690"
                     /old_locus_tag="LDBPK_300710"
                     /product="40S ribosomal protein S30, putative"
                     /transcript_id="XM_024473480.1"
                     /db_xref="GeneID:13385490"
     mRNA            complement(<222005..>222205)
                     /locus_tag="LDBPK_300690"
                     /old_locus_tag="LDBPK_300710"
                     /product="40S ribosomal protein S30, putative"
                     /transcript_id="XM_003862735.1"
                     /db_xref="GeneID:13385490"
     CDS             complement(222005..222205)
                     /locus_tag="LDBPK_300690"
                     /old_locus_tag="LDBPK_300710"
                     /codon_start=1
                     /product="40S ribosomal protein S30, putative"
                     /protein_id="XP_024329251.1"
                     /db_xref="GeneID:13385490"
                     /db_xref="GOA:E9BLG3"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:E9BLG3"
                     /translation="MGKIHGSLARAGKVKNQTPKVAKQEKPKQPRGRALKRLKYTRRF
                     LSKTVKPGEKVHMNKQPPGKAG"
     CDS             complement(222005..222205)
                     /locus_tag="LDBPK_300690"
                     /old_locus_tag="LDBPK_300710"
                     /codon_start=1
                     /product="40S ribosomal protein S30, putative"
                     /protein_id="XP_003862783.1"
                     /db_xref="GeneID:13385490"
                     /db_xref="GOA:E9BLG3"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:E9BLG3"
                     /translation="MGKIHGSLARAGKVKNQTPKVAKQEKPKQPRGRALKRLKYTRRF
                     LSKTVKPGEKVHMNKQPPGKAG"
     gene            complement(<222524..>223009)
                     /locus_tag="LDBPK_300720"
                     /db_xref="GeneID:13385491"
     mRNA            complement(<222524..>223009)
                     /locus_tag="LDBPK_300720"
                     /product="nuclear movement protein, putative"
                     /transcript_id="XM_003862737.1"
                     /db_xref="GeneID:13385491"
     CDS             complement(222524..223009)
                     /locus_tag="LDBPK_300720"
                     /codon_start=1
                     /product="nuclear movement protein, putative"
                     /protein_id="XP_003862785.1"
                     /db_xref="GeneID:13385491"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:E9BLG5"
                     /translation="MSLVASQEGLTDLIPCNDQCGGDYTLYTFGQSEKEVTVTVPLAP
                     GTRGKSLRVDIKVRHLQIEVPGKGTILAGELYKPINVDDSTWCIQDGKELVVVLTKTN
                     IQYEEWWPHVVIGERQIDLKTLKPPSIRFSDLDGGAQATVAKMMHEQHQKRTDPAFTN
                     A"
     gene            complement(<223448..>224245)
                     /locus_tag="LDBPK_300730"
                     /db_xref="GeneID:13385493"
     mRNA            complement(<223448..>224245)
                     /locus_tag="LDBPK_300730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862738.1"
                     /db_xref="GeneID:13385493"
     CDS             complement(223448..224245)
                     /locus_tag="LDBPK_300730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862786.1"
                     /db_xref="GeneID:13385493"
                     /db_xref="GOA:E9BLG6"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:E9BLG6"
                     /translation="MRHSLRFLSATRAHLADYIDYLRQVDKELPSLHDIFPKSNAVED
                     VVKFHASLCAAMEENAYPLIGFKVLPPEHEAITTLRGTQPVCFPIFSNLFQRKSVSVK
                     QDRLQYIETAICLEVKHLEDCSTVDEASLNTGAFSPSLEVSGSRFPFYAPTLTAMACD
                     LDGCVSITKGCNISMDSIKRESLTTTRFVLTHNQEPIQTGSAKLCMGTPFTAVVTAAA
                     YAKAIKAPTKKSLFIFCGGVSPRTPIQVGTYAFEWGRFGRLTYSVLP"
     gene            complement(<225709..>227349)
                     /locus_tag="LDBPK_300740"
                     /db_xref="GeneID:13385494"
     mRNA            complement(<225709..>227349)
                     /locus_tag="LDBPK_300740"
                     /product="CDC16, putative"
                     /transcript_id="XM_003862739.1"
                     /db_xref="GeneID:13385494"
     CDS             complement(225709..227349)
                     /locus_tag="LDBPK_300740"
                     /codon_start=1
                     /product="CDC16, putative"
                     /protein_id="XP_003862787.1"
                     /db_xref="GeneID:13385494"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BLG7"
                     /translation="MEAIGVLKENALRLVSAGQPISALHLVEVLCELQPNSDENRSLK
                     IRCLYELREFDSVLKLAKQMTFACDQNSEVFLLAVKAAFELGDLKTCVQYAMTLINAD
                     SSKVVAMCFVAKAAELSGDPAKAVRFYKMALEADPFCGEAFSALTERHLLDRWEMLKL
                     IDSLCIPAEVEVYRSTLKARIGSDYLTPGISGVPRTLVLLAGAKKEYESNNLRQALSL
                     TTEILEVEPYHRQTLCLHLCILVDSKATPLLFEKAHFLSKNKCYTELAVYAIGCFYYS
                     LSNYERAGRYFSRASELDCYFAEAWIAYGHCYAKLEEGEQALNVYRRAMNFFPGLNAC
                     CTYVGMQYSRVNQRSVARCFFEESLRKNSMDPLVLNELGVLALAEDNPKQALELFQRA
                     YDSLPNRENPSEHSDCILFNLATMYRKLRRYEAAIDYYNQYVRSRPNASHGHCALGFT
                     YHLSGNTKAAISCYHTAESIKPDSFCRDLLRRALELDFGARGRLSWDSERPHLSFSPG
                     EVSFSTVSRRFRSESTAADSVAASPPPRVGRSLDFQHQ"
     gene            <232193..>233026
                     /locus_tag="LDBPK_300750"
                     /db_xref="GeneID:13385495"
     mRNA            <232193..>233026
                     /locus_tag="LDBPK_300750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862740.1"
                     /db_xref="GeneID:13385495"
     CDS             232193..233026
                     /locus_tag="LDBPK_300750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862788.1"
                     /db_xref="GeneID:13385495"
                     /db_xref="UniProtKB/TrEMBL:E9BLG8"
                     /translation="MRRLITSPCFRLLRHVVVGPSTTIPSARSTPRFGRRRQRLQRNP
                     SPPTFDVANDEDAKSICFERYGFVQKPLFLKTWQEFLRELQRVELTWSLMPSAGGILQ
                     LKIHDHLEPGDGLLCELKGAANRSAPLAEFFEACGSVSQGTMSKAEVEFFDGESCSVL
                     LIESKKRLGEIPFKDDPPILPLLCQFNCRGTSVSLSVLDKKTLVRTPLFSDISIQTLN
                     YAFMTSLPLFLKRTDLGIRNADFVTKDQMRHFRYAWCFLRKESWMTPVEMGELDALLP
                     P"
     gene            <233403..>234062
                     /locus_tag="LDBPK_300760"
                     /db_xref="GeneID:13385496"
     mRNA            <233403..>234062
                     /locus_tag="LDBPK_300760"
                     /product="co-chaperone GrpE, putative"
                     /transcript_id="XM_003862741.1"
                     /db_xref="GeneID:13385496"
     CDS             233403..234062
                     /locus_tag="LDBPK_300760"
                     /codon_start=1
                     /product="co-chaperone GrpE, putative"
                     /protein_id="XP_003862789.1"
                     /db_xref="GeneID:13385496"
                     /db_xref="GOA:E9BLG9"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:E9BLG9"
                     /translation="MRALSLRTGLVARASAVAYTSQRWCSADAKSEKRAEEEKEAPST
                     GTEEVVSAAAVKQLEKELDASKAKIEELKKEILYRAADAENARRIGREDVEKAKLYGI
                     SSFGKDMLEVADTLEKGVEAFSAFSEAELNENKILCSIFTGVKLSHKVLLKNLSKHGI
                     EKMGVTVGTKFDPNLHDALVSTSATETAPADTISNVLKDGYTLKSRVLRAAQVSVSQH
                     P"
     gene            <234878..>235495
                     /locus_tag="LDBPK_300770"
                     /db_xref="GeneID:13385497"
     mRNA            <234878..>235495
                     /locus_tag="LDBPK_300770"
                     /product="co-chaperone, GrpE, putative"
                     /transcript_id="XM_003862742.1"
                     /db_xref="GeneID:13385497"
     CDS             234878..235495
                     /locus_tag="LDBPK_300770"
                     /codon_start=1
                     /product="co-chaperone, GrpE, putative"
                     /protein_id="XP_003862790.1"
                     /db_xref="GeneID:13385497"
                     /db_xref="GOA:E9BLH0"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:E9BLH0"
                     /translation="MYRRVGANVAPLLCSHCVAQRKCCTEENTAGLSVAELKGKYEVL
                     RAELCDSKRQIQKLRSENLYAAASCENIRKTTQEQSKQAHNDAVRSFARDMLDVCDAL
                     QVVTKKAVKYTQRNSSIPKSEAAVLAGVMLTEEVALKVLKRYGVTQMHTEVGATFDEE
                     KEEKLFTVPSTPSLKEGSVAEIVKNGYDMNGSVLRRAQVGLSEDP"
     gene            <235800..>236315
                     /locus_tag="LDBPK_300780"
                     /db_xref="GeneID:13385498"
     mRNA            <235800..>236315
                     /locus_tag="LDBPK_300780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862743.1"
                     /db_xref="GeneID:13385498"
     CDS             235800..236315
                     /locus_tag="LDBPK_300780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862791.1"
                     /db_xref="GeneID:13385498"
                     /db_xref="UniProtKB/TrEMBL:E9BLH1"
                     /translation="MLRRCASAVAPAGHIPCPAAAVSGVQKRFLKIAKSTFGFYLARR
                     GQRKFPFHRRPHIKNTQAMNLNAPYFWSYMTAKSQSFFLPEENYITGDWTGKFFVSKR
                     QVYTLQHATSGGKVRVKSFPSVFELNSPSRWNVGKEMNTLTKPRMDLIDDQMLTKKQR
                     LDYVKAGLLPK"
     gene            <236614..>237453
                     /locus_tag="LDBPK_300790"
                     /db_xref="GeneID:13385499"
     mRNA            <236614..>237453
                     /locus_tag="LDBPK_300790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862744.1"
                     /db_xref="GeneID:13385499"
     CDS             236614..237453
                     /locus_tag="LDBPK_300790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862792.1"
                     /db_xref="GeneID:13385499"
                     /db_xref="UniProtKB/TrEMBL:E9BLH2"
                     /translation="MLLRRVLKCSSQARWVRWDGIKAPSVLNHAADHSDLLNAVFDEI
                     ENCDTSVHAEKRESPKMVESSGTPTSPSNTAPSVSDTKVRLEEAKHKRLRRQLRDATE
                     ELDALLNESSRTTAAVSSAKYVPARAAKTFLSSAELVQEKSPQEFVALENSKAELDRL
                     PVLRHSGCSAVVTLVGVVTEPPTSVSVALPGVSEATNCVEFAVRYDVPFFQMQTSMGI
                     VIRTVGASLSAFAKESVDVGDVVHLLGHLVPLTEPNGKGHLCCVYVLPAGGNMSVLLK
                     ATS"
     gene            <237803..>238393
                     /locus_tag="LDBPK_300800"
                     /db_xref="GeneID:13385500"
     mRNA            <237803..>238393
                     /locus_tag="LDBPK_300800"
                     /product="4-methyl-5(beta-hydroxyethyl)-thiazole
                     monophosphate synthesis protein, putative"
                     /transcript_id="XM_003862745.1"
                     /db_xref="GeneID:13385500"
     CDS             237803..238393
                     /locus_tag="LDBPK_300800"
                     /codon_start=1
                     /product="4-methyl-5(beta-hydroxyethyl)-thiazole
                     monophosphate synthesis protein, putative"
                     /protein_id="XP_003862793.1"
                     /db_xref="GeneID:13385500"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR006287"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:E9BLH3"
                     /translation="MNVLVVAADHSEDIELISIIDVLSRAGIKVTLASVMESKSITLA
                     HGVNVMCDALIGEVSAVEYDAVLLPGGMPGAVHLGNNEALKKILQNARVGKKLYGGIC
                     AAPAVALAPMGLLEGVDTVTCYPGFEDKLPSSVKYSTNAVVKSENCLTSRGPGTAIYF
                     ALAVVSILKSPDLAERLAKAMLVDHSNEMNDVRAIK"
     gene            <239494..>242670
                     /locus_tag="LDBPK_300810"
                     /db_xref="GeneID:13385501"
     mRNA            <239494..>242670
                     /locus_tag="LDBPK_300810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862746.1"
                     /db_xref="GeneID:13385501"
     CDS             239494..242670
                     /locus_tag="LDBPK_300810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862794.1"
                     /db_xref="GeneID:13385501"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BLH4"
                     /translation="MVENVVRIARQHANWPDFSRWVCALIHHYCTDDFTVSLFSEFEV
                     PKVAVDALRNNPHDRRGVLAAATLLSHFNLYDIGDGITQLTNTLQNHCSDATIVRIVT
                     RTLAEFTSYYKELPDRFPRVSQEFVDAKGITVLEGVLHEHINNEEITTYVARIAANVT
                     SSGAANMVDADSPVMMYLADTLARYQQSEMLCGHVLRVFSNLPRSRYIDWDCVSSLFN
                     NTKSELVVFECIHFLCSVAINVKEMKAKIYNTGCVPRVLEMMRVYQGNAAIQEEVCSL
                     LSYLSFDSETITASITESGGLLLVLNAMRKFPDNEDLLMSACAALSGLTFNNQTGQQV
                     IVDNGGVALILDSMRRGKKARLQENGCLAIGTMCWNSDLKADVVRLGGVQVIMKALEE
                     HYTSSGLVKNACRALAQVAFNSERYRDEMSAKGVIPFIIRGMAQHPNYDRAQMHGCVA
                     LSYLSWTNEDNAAQITANHGYKVVVDAMRNHPNNHEVQEHACRALANISNVSLTDSLA
                     ALEQIVAAMRRHENISEVQEEACRAIVTLSLVSPSNKDRLYQLFGADAVIAAMKRFPQ
                     IQLVQQEACNALAHLAYEHTDLNRAVTRLGGVSLLLAAMRTHKSSPKVQLNACGGLSA
                     LAFDNTVAQQQIFELGGVQCVIHAMDNFERLRMLELGCSVLGTLAWNTEIKERVAVDA
                     IPEILKAMRAHSNNALLQKSTCRAISQFAFNSESNRQLLADSGAIPLIVNAMRAHLTT
                     EKLIVHALKALTYLCWENTQVAETIINERVEEVLQRIIEHYEQTHRVYNEAVHLSKIL
                     FRKTTGSPSPNLRIVSPPIVSPMPIQQTPWLRYENPAPPSPPPQENPEDHFYSAPLDR
                     PQEKPYQDHAHRRDAPADDDRGGPRSGRGGGRGRGGSRRRGGPPTRGGGGERVGERGS
                     DRGGRRGGSGGDAVAGAGGNEGRGRGCGEHHEDAMEKMLDARFGRRPNYRGRDDGRSA
                     PRDATDLWDDPDPDSFHGNRHLGQMNWQQAELTASLNADIGIYDTLEPARRGGAMDQN
                     FQRGGRGGLRRYGGYRGRGRGRGAPASQ"
     gene            <243703..>244077
                     /locus_tag="LDBPK_300820"
                     /db_xref="GeneID:13385502"
     mRNA            <243703..>244077
                     /locus_tag="LDBPK_300820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862747.1"
                     /db_xref="GeneID:13385502"
     CDS             243703..244077
                     /locus_tag="LDBPK_300820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862795.1"
                     /db_xref="GeneID:13385502"
                     /db_xref="UniProtKB/TrEMBL:E9BLH5"
                     /translation="MNVPEWTKDAQSIQAARDYVRQSRVVDFYEMICRNILFHHPADL
                     TEFCLRIVKDIMNGTEITSAADFQPKRIDDNKYMRDMAVCNFLDGWILELLRERPGSD
                     LERMEFHKRYLEGLQSEPNTGK"
     gene            <244835..>246868
                     /locus_tag="LDBPK_300830"
                     /db_xref="GeneID:13385503"
     mRNA            <244835..>246868
                     /locus_tag="LDBPK_300830"
                     /product="mitochondrial oligo_U binding protein TBRGG1,
                     putative"
                     /transcript_id="XM_003862748.1"
                     /db_xref="GeneID:13385503"
     CDS             244835..246868
                     /locus_tag="LDBPK_300830"
                     /codon_start=1
                     /product="mitochondrial oligo_U binding protein TBRGG1,
                     putative"
                     /protein_id="XP_003862796.1"
                     /db_xref="GeneID:13385503"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BLH6"
                     /translation="MLQRCATLTGAPLRARAYSTVLGACAVLHQRGGYQGRGGGPRLG
                     YGGGGPPPRQQHYQQQGGGYGNRDDFSRHRGGSDRGYENRNQGYENHQQRYIDRPQRR
                     DNDQQGYGNSRENYDDRSQGYDDRRKGFNNRQQSFGNRQHDGDDRQSAPRRGKEQYLT
                     QDADRLLRMKHDYKKAKDTKERFGIVKEARRLLRRTRIDPSTQDERSVAIVINCAATF
                     SVPAKIEAVEQAFQWMRRNIGGISPQNVALFANALGLISPPEAKQVMVSEVMPAVQSV
                     MREMAPVEVVMVLQALQRLGVEENEKLQDDLLSHLEPCVSSMPVQQLSTLASVLHHHS
                     MQTRDNAKWKQIAHETLARALAGVDGIHSREAIVLLCAAPFLDASQKQIGQLLARVTE
                     TVQFHTDDQVGELMSAILHIRQQVSEPSVELTAAVEELHTALMTRLEKVSAFVGPKSA
                     TRIWNYAHASNVELPSAIQETMCASLIQLMTFRTIRFRALARLMASLSTQKLPSAEIL
                     TVVANCSVGVRPPRSAKAILPQESDMPGDGEDHESIRAAAFEALYSRHFGTLTELRIS
                     LENAFAKNDVPPNDALAKTLPEHLLKHAAEASPRQMLTAVVAIALAPADCPCRNKTHD
                     AAVRAAVLKALEDNPDKFKSDLSPELVDWFVSSIPADSESAEIVAAVQKAAAP"
     gene            <248062..>249339
                     /locus_tag="LDBPK_300840"
                     /db_xref="GeneID:13385504"
     mRNA            <248062..>249339
                     /locus_tag="LDBPK_300840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862749.1"
                     /db_xref="GeneID:13385504"
     CDS             248062..249339
                     /locus_tag="LDBPK_300840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862797.1"
                     /db_xref="GeneID:13385504"
                     /db_xref="UniProtKB/TrEMBL:E9BLH7"
                     /translation="MSGFWSFRECDSGSAAAANSASGLQQLDLAVTQVLPVGVEFKRA
                     TLSTAQEGSHTRFGRKVAPHVEAVEWTGGTDCGPAKKLARQADLSSSQSISVEAYDVA
                     VDEGGINAYLLDREEVVDAVQRSWWEALDADVRPGLSLPSASIAPAKVDTPDAETLEL
                     VREFLYHASDNVPERETARSRDNAFLSYEVRLSERKEQRTYLDRSPASEVQMKSRKNA
                     KHADSRSFRSTVPRGPSLHTERLARLRGRRASTAALQLSEGEMSKSKAGSCYNQDHGG
                     IAKDTTVVSHVSSRPEGQCSCELETNSGACTVAPLETQSEVFSPSAALQDVLRTHTRR
                     VNLSSTAATRMEVIRRREELLLLRRYFALWLAAAEQRHIKQCAASYHCFLMWCINDTI
                     EHTTSQVKEEESICAYRHCASDFRLTKRQGKRA"
     gene            <251317..>252849
                     /locus_tag="LDBPK_300850"
                     /db_xref="GeneID:13385505"
     mRNA            <251317..>252849
                     /locus_tag="LDBPK_300850"
                     /product="rac serine-threonine kinase, putative"
                     /transcript_id="XM_003862750.1"
                     /db_xref="GeneID:13385505"
     CDS             251317..252849
                     /locus_tag="LDBPK_300850"
                     /codon_start=1
                     /product="rac serine-threonine kinase, putative"
                     /protein_id="XP_003862798.1"
                     /db_xref="GeneID:13385505"
                     /db_xref="GOA:E9BLH8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BLH8"
                     /translation="MSGYLKVLSPDGRWETRYIEIDDAKLRIWRTKGDKESSAAVVKE
                     LDLKCATLREVSEPNTWAVQPEKAEATYFQADGEERKTEWMDTLRHYNSSSSASEKVT
                     LRDFEKKFVLGKGSYGKVFMVVKKDTDKWYAMKEMSAEKMRQAEIKAPFAERIILEEI
                     DHPFIVHLHYSFQEQGNLYMILDLLAGGELFTYIEQHAPLDEEVVKFYAAEVALALGY
                     LHSRNIIYRDLKPENVVFDRDGHACLTDFGLAKANVHEPNAVTYCGTNEYLAPELLKG
                     VPHGKAVDWWSLGLMMCEMLFNDLPFYDENPMQMQMKILTEDVAFPPHIQITEETKDL
                     IRCLLNKNPERRLQTLEAFKAHKCFSNLDFGLLEARKLKAPITPDPNPAHNFAKEFTS
                     EVIVQNESPSQAVVTLAGYTYDRDLSEQEKSPSHSPTIAEELRQRRASMKKSTNGSDA
                     ASPPVTGENRTSNSSPAGAPTKQAAAGPVKKVEHHIPAKVAPQAARKKLTGNKSFDKP
                     TK"
     gene            <256735..>257331
                     /locus_tag="LDBPK_300860"
                     /db_xref="GeneID:13385506"
     mRNA            <256735..>257331
                     /locus_tag="LDBPK_300860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862751.1"
                     /db_xref="GeneID:13385506"
     CDS             256735..257331
                     /locus_tag="LDBPK_300860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862799.1"
                     /db_xref="GeneID:13385506"
                     /db_xref="UniProtKB/TrEMBL:E9BLH9"
                     /translation="MKLFSYQSSVCGTLVLALCLLYCVLAASSTPAPTDLITVAGRVH
                     VRNEVVQYVVVRVVDDKTGVVVRSAPLDATRSVSFANIASSAVSLEATVELPDHLFEL
                     DASSSVLKSAISTSSSTTPVQLTISTISKAEGAARKAPTPTAGSSGASAVLALMALVA
                     GWYSRHKIVSVLDMPSLRMPKPRKVMGSFASSKRASMR"
     gene            <257929..>258678
                     /locus_tag="LDBPK_300870"
                     /db_xref="GeneID:13385507"
     mRNA            <257929..>258678
                     /locus_tag="LDBPK_300870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862752.1"
                     /db_xref="GeneID:13385507"
     CDS             257929..258678
                     /locus_tag="LDBPK_300870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862800.1"
                     /db_xref="GeneID:13385507"
                     /db_xref="UniProtKB/TrEMBL:E9BLI0"
                     /translation="MNSHNRNIAIVSSAAYGAVLCCGMLFFLLDTREKHFYMHPSKSV
                     AVFSVLWFSFAPSILFTGATIPWLCAAYGSEVAALVFAIVPGCIFVLLGVVWLVVYLF
                     HERNSYFVGVQHSALWGGNIANLEAAIGGSAARRYVYTAADPAMVGGAKAFSVADSAL
                     PRPHGALTASFSASGFEDVDAVITPASQWRGYTASRENNIPRGAGGWAADRASSASWY
                     RGPLVLPTHSVDQLEPPYVVQERSLGTHYVA"
     gene            <259933..>260685
                     /locus_tag="LDBPK_300880"
                     /db_xref="GeneID:13385508"
     mRNA            <259933..>260685
                     /locus_tag="LDBPK_300880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862753.1"
                     /db_xref="GeneID:13385508"
     CDS             259933..260685
                     /locus_tag="LDBPK_300880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862801.1"
                     /db_xref="GeneID:13385508"
                     /db_xref="GOA:E9BLI1"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BLI1"
                     /translation="MPSKEASSRNLPISGRDTNGKTYRSTDEMWKAELTGDLYDPEKG
                     WYGKALEYWRTVPATVSGVLGGMDHIHDVDIEGSRSFIESLPGHGTSRALDCGAGIGR
                     IAKNLLTKLYAATDLLEPVEHMLEEAKRELAGMPVGKFILASMETTTLPPNTYDLIVI
                     QWTAIYLTDDDFVKFFKHCQQALTPNGYIFFKENCSTGDRFLVDKEDSSLTRSDIHYK
                     RLFNESGVRVVKEAFQEKWPTDLFPVKMYALK"
     gene            <261661..>263976
                     /locus_tag="LDBPK_300890"
                     /db_xref="GeneID:13385509"
     mRNA            <261661..>263976
                     /locus_tag="LDBPK_300890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862754.1"
                     /db_xref="GeneID:13385509"
     CDS             261661..263976
                     /locus_tag="LDBPK_300890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862802.1"
                     /db_xref="GeneID:13385509"
                     /db_xref="UniProtKB/TrEMBL:E9BLI2"
                     /translation="MSAVSARPSPYRDCLGSVVVDENSNAEGQLCSMVDAIIATSTHA
                     LQKASSDVNSTDAAFLKAASLFQANGIRISHGELGENTSSAASPAAVESDLRTQLENC
                     RNLLRTVDCERRRLRSQCIYLQKEHELRRAEIQSMHRYSTESHQRSLTLERQIAEERQ
                     HRRRLQNEVDAQTQEVMRLRRVLRALPDNVLRSLSPRHPADGAAADLVLTLAPDRRFE
                     EAFRDKMNSIAYKRRYHQASAMHQAAREQVEMMMMEQQDPLQIAARWPCVVEGVSTVG
                     ATSTEPVVKREWQGCGSGASSLFKFPPQGIDELRQADAINATEAATLANSALMHSALE
                     FPFQLPFTTATPKDAYIKFLMYHSAYAEPLTQLREHVLRLSSRLKTAQDAGLRALYTT
                     FTQVLHLLGSAPARAPWRSLYEREIEKMQRAHRDLLYAVIEQANMAATQIPELERAGG
                     AATALRELAGGAPQRRDVGCSAHELTTMEKYRASQLKEQLDHLKLHSLEAEAAAQKEK
                     EEIAKQCSTARQGTLQALQSLKALAKCVVGSVRAHGAADGAVYDPFAQLFDPLTEEVL
                     DDPRLATKTAEATDLTLSYVRLLGRSGGGGGRGKSAQRHHADLGAAPLSSSPTSGTDG
                     VREGALASVIGISRTACGATAPSCSSKAHSSRRQSAPPAVPALRHRTRSSSLGYSSRR
                     LSSPQLPPMKSIPALSRGATGFRKRRSSGAASSTHSPREGDLSSTKALAAPSLQNTVN
                     SPKACAKESGPKPQPTVAVIELGFREGDAQR"
     gap             265696..267104
                     /estimated_length=1409
     gene            <268750..>269190
                     /locus_tag="LDBPK_300900"
                     /db_xref="GeneID:13385510"
     mRNA            <268750..>269190
                     /locus_tag="LDBPK_300900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862755.1"
                     /db_xref="GeneID:13385510"
     CDS             268750..269190
                     /locus_tag="LDBPK_300900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862803.1"
                     /db_xref="GeneID:13385510"
                     /db_xref="GOA:E9BLI3"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:E9BLI3"
                     /translation="MSNSSSVSVAAQAELMEKEKTVAEHQQRLASLRDTVKTMATRQV
                     TLKRTERRCQITVGELTKLKPDHVVYQGLGRAFMRAPVNKLIDLNNEEIERCEAEENR
                     LSTEKQRTSELVIKEEGELRRAVEEFRAALMVVQAAQSRSQQSA"
     gene            <270334..>273090
                     /locus_tag="LDBPK_300910"
                     /db_xref="GeneID:13385511"
     mRNA            <270334..>273090
                     /locus_tag="LDBPK_300910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862756.1"
                     /db_xref="GeneID:13385511"
     CDS             270334..273090
                     /locus_tag="LDBPK_300910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862804.1"
                     /db_xref="GeneID:13385511"
                     /db_xref="GOA:E9BLI4"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLI4"
                     /translation="MPPSAAKAALADAQQQPSWGGGPAAAARANHCFGAPLLRSLDGP
                     TTTGGVHDDASTALAGAAASVALLAAPYGEDAGVPRAALPSSSPSSAGVSRLQAATPI
                     ATVPFGKSLQLNVEEVDTYPSSEPVPLQLQGLKRRSRKAVADSILLPRHINRLFHKIM
                     GWSEELVDLEAEKDSLSQEQTGASEPRGARPSALRKKAENLTDKMKYGVLLDAYEKDR
                     FAIEHQLEIAGEKMERKMLGWEGMHVLDQDAAAEMAHVLENKTSIVMEAPSSFHVPVP
                     GRDCCPGCGALLQNLSEDAFGYVRPGEIEKYVAQRNEKAQLRHEYAARMAELQAHWAK
                     HGRHVGEEWLDFMTQEEFDAFYRDTPRPFTCHRCHALENLGVEGRRKVWSAPDFTDQL
                     RALKEKKCVVVLVVDITDFPGSMVYDLPGLISMNNSVIIAVNKMDCIRNRSFNYASKD
                     RSVAACLVSESYVRRWVMDIAVQFGLPQHQIKKVVPLSAKRGWGITHLISAIEDAANL
                     NLRRPHKPLPTYFVGVANVGKSSVINAMAHALYVPQPPHPESRKVYYTKTDAQGKNAV
                     FWRWYTPPNVNQAEMLDIRGRHDKKASKLMTVSSLPGTTVAVNAVRLSLGPTAHTAKQ
                     ERQRLSEGATAPGKADDVAGTQTYIYDTPGLLPHWHQRSLLTLLQMRRTLIRKFRNPQ
                     CFLLLPGHTLFLGGLAAVDVVRGPPRGLLFLVYTSQKVRNAIVNTVQSDAFWREQLGK
                     ALDPPGSYEQLLPLDDLSTAAGPPRLSETRSYLFECYGRHRRRPKADLYVCGLGWTSF
                     CVSEPADVVLRVRTLPGVVHGVREPLRFKDLRARRAWPRLKRRFTAKGIEDMESDVDR
                     DSINTVVRLISAPVAPAPAASADEPPEASVRTVERVAHPRHHSASSAPFAALKEDLHA
                     VGKL"
     gap             273662..273760
                     /estimated_length=99
     gene            <274323..>274919
                     /locus_tag="LDBPK_300920"
                     /db_xref="GeneID:13385512"
     mRNA            <274323..>274919
                     /locus_tag="LDBPK_300920"
                     /product="surface protein amastin, putative"
                     /transcript_id="XM_003862757.1"
                     /db_xref="GeneID:13385512"
     CDS             274323..274919
                     /locus_tag="LDBPK_300920"
                     /codon_start=1
                     /product="surface protein amastin, putative"
                     /protein_id="XP_003862805.1"
                     /db_xref="GeneID:13385512"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BLI5"
                     /translation="MGFEALRGRMDVALSMLCSCIVFMFLVTSAPISQFRGRGINASA
                     TGGASKLSCVTVWGLKNDCNANNYDYRPTSIGCARSKQLFQVSEAFYILAVIVSFLSC
                     LMSGLYFMGIKAKVLLVLLAVLEVVFALIPWVCMTAVWYGNYCGGSTVKINTSSGKAD
                     GVPHGSVLRESFKVSAGYGLTVAAWCTQVIGLVLLIAM"
     gap             275054..275152
                     /estimated_length=99
     gene            <278357..>279025
                     /locus_tag="LDBPK_300930"
                     /db_xref="GeneID:13385513"
     mRNA            <278357..>279025
                     /locus_tag="LDBPK_300930"
                     /product="amastin-like surface protein-like protein"
                     /transcript_id="XM_003862758.1"
                     /db_xref="GeneID:13385513"
     CDS             278357..279025
                     /locus_tag="LDBPK_300930"
                     /codon_start=1
                     /product="amastin-like surface protein-like protein"
                     /protein_id="XP_003862806.1"
                     /db_xref="GeneID:13385513"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BLI6"
                     /translation="MANKKSFYNQEYSKHVGAVILFIVSFVTATFTVCGTPLGMLMIR
                     SWGEDLSGSSAELELNPCFTLWGLHSDCSKPDYSLRITDSPIVNCSDMHVRFEAAEAF
                     SILAIFSLVGLFGASWYMICGSKIKKAVMLLAVFAIGSTTVPWAIVTAFYYTPFCGLD
                     FLTNTHTRFGAGYALLVTSFVLQIVGLILFVIFEPDTSKKRPEENEKRAASEVWSSTA
                     SALR"
     gene            <282222..>283259
                     /locus_tag="LDBPK_300940"
                     /db_xref="GeneID:13385514"
     mRNA            <282222..>283259
                     /locus_tag="LDBPK_300940"
                     /product="adenosine kinase, putative"
                     /transcript_id="XM_003862759.1"
                     /db_xref="GeneID:13385514"
     CDS             282222..283259
                     /locus_tag="LDBPK_300940"
                     /codon_start=1
                     /product="adenosine kinase, putative"
                     /protein_id="XP_003862807.1"
                     /db_xref="GeneID:13385514"
                     /db_xref="GOA:E9BLI7"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9BLI7"
                     /translation="MSALPQLYIQCNPLLDVSAPVDDAFLEKYKVQKTSACLMEEIHK
                     GIFEELEQHPNVTYVPGGSGLNTARVAQWIAQAPKSSFVNYVGCASDDKYGKILKEAA
                     EKDGVNMHLEYTTKAPTGSCAVCISGKDRSLVANLSAANLLSADHMHSSDVVETLKGC
                     QLYYLTGFTLTIDVNYVLQVAEAARASGGQFMMNLSAPFVLQYFTESFNKAAPYLDVI
                     FGNEVEAKALADAMKWNPASTHELAKKAAMELPYSGTRDRLVVFTQGSQPTVYATRSG
                     KTGSVTVQPIAQDSIVDLNGAGDAFVGGFLAAYAMSCSIERCCEVGNYAAGVIIQHNG
                     CTYPEKPSISP"
     gene            <286192..>286836
                     /locus_tag="LDBPK_300950"
                     /db_xref="GeneID:13385515"
     mRNA            <286192..>286836
                     /locus_tag="LDBPK_300950"
                     /product="adenosine kinase-like protein"
                     /transcript_id="XM_003862760.1"
                     /db_xref="GeneID:13385515"
     CDS             286192..286836
                     /locus_tag="LDBPK_300950"
                     /codon_start=1
                     /product="adenosine kinase-like protein"
                     /protein_id="XP_003862808.1"
                     /db_xref="GeneID:13385515"
                     /db_xref="GOA:E9BLI8"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9BLI8"
                     /translation="MYVGSVGKDKHGDQICSAAEADGFTMKLEVSSGKRSGLCAVCRD
                     GNSRTLAVHPSSASSLSDDFVNSAAVQEGQRSAKTIYTTAYANVFRVRQTLQLMTSSR
                     CHTLPDGSKQLAAMGLSNKRVLDDFGEDLVDVLGKLDIITGNQEEIHDLAMMLQWVPS
                     EMSDMELAKKIATETMPDQHGVRRVIMTHGVEPIIYATSAGESGEVPVVATCAH"
     gap             289450..289548
                     /estimated_length=99
     gene            <291821..>293893
                     /locus_tag="LDBPK_300960"
                     /db_xref="GeneID:13385516"
     mRNA            <291821..>293893
                     /locus_tag="LDBPK_300960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862761.1"
                     /db_xref="GeneID:13385516"
     CDS             291821..293893
                     /locus_tag="LDBPK_300960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862809.1"
                     /db_xref="GeneID:13385516"
                     /db_xref="UniProtKB/TrEMBL:E9BLI9"
                     /translation="MEDSPPPQPREVHIDLCGIEGDAPQPPAPHFETPNGTAAEPPRE
                     KSEESCDAVKATQHSSPAAAPSLTASHNGGNSTNDSPQQSIARTRLLTACGDANGAPP
                     GDSRPSLEVIAASSAIPVRGHDSIRPSYLLKSPHHGATNGNAAAAANGEQATAECDVG
                     GATRSRSEMALHRSASQARRRQVSTPVLARSSTSNSQFPFKTALPVSPEPPEEAGTLA
                     TSTQEDVKRYVHAVMEHHTAMLAAWDKRVYVAEVYRDKPLRTGGRPAPVRPQDRGFLE
                     RVEQNLDSYLRQLEFAKSLLAQSHEAVPPTKSGQKSDVKAWQGYCSRLYFTLSDLTVE
                     ENLIRLRMSRVLRVGHQGFKESMSSRTASPWGSRARGMRSYSRESTSARASSRPASRG
                     SSKPATPRQKPRAASVSRRGRSAQSAGSTHSAAAAGAEVSCPSTPIGTNGSPSSHSRH
                     AAPSSVVRRGNGVIRPGHSSAPSPAQASAVSVDQPRHPGRYGGHSAYHTAKSHTALSS
                     APALTLARQRRLLIALHPDTVLPQPSCTGNTYDSQTPYGRLSPQRRTVSPAFAHSFDR
                     SVALLPELNDDDAESHSAAPSCRSLERSSAHRPAGAPPQLRTYSSPRGTNVARAATSS
                     ALALHPLRHRQLLEKIERYEKNAAALQPSDLQLARACFYELYGEPMGLHQYCQWIDDV
                     AIKILRGA"
     gene            <296496..>300701
                     /locus_tag="LDBPK_300970"
                     /db_xref="GeneID:13385517"
     mRNA            <296496..>300701
                     /locus_tag="LDBPK_300970"
                     /product="ubiquitin-protein ligase, putative"
                     /transcript_id="XM_003862762.1"
                     /db_xref="GeneID:13385517"
     CDS             296496..300701
                     /locus_tag="LDBPK_300970"
                     /codon_start=1
                     /product="ubiquitin-protein ligase, putative"
                     /protein_id="XP_003862810.1"
                     /db_xref="GeneID:13385517"
                     /db_xref="GOA:E9BLJ0"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ0"
                     /translation="MSQFVFNGSSRMRNMKLARDHHKTRNSIIEDAQRLRLQREEEAR
                     RMRAVRRLQRAIRQWLACQAMVRLALSDLDSLSSDVKRILLSTSSAGFSSAVHTTAAP
                     SQTEQLTARLHTACWCLSYVRRHQSHIPLRLDAPFRAAAKNDCSTETVLGDAGSGIPG
                     TTGLGATAAAHQRVTLSSPHTSSVSSLGELRAYRQRVFWHYSECLYTALSESINRGAE
                     GEDTADEDTIAFHADAATEAAAVNRPADPLSLSWPSFLASLPTKDVVLLLCVLLQQLS
                     RVAPSMPGSHASPSSSASLVKRLARYLVAVIVTHNAAFARTLNEEPTPRRSHEGLEMS
                     ATAVTSPSLAAAASFDRWPAVHALTVTLSFLGQETVAHPVSVRSQCRELLQPLVAAFP
                     PLSQAEAGGYSPLSPPTGSFAQVCWQCMCAPYAGEESQRLTSNSLAVLLGAADTAAEG
                     PARGGCDVVDTCFTMLVAECYRRTAMNTELTACDGVSGLRGGELRARVLGRLVRLLPR
                     IHQLVEATSCAAAASPSPLTACTDVVKWYLLSVSCLSERLCREDFFIEGILADHYAYN
                     TGRRQQRRTMDGKDDAEGVDESSHSQYRLLTSYLFSAEGGLQLLQLLTVQDERCEKLR
                     LMSLQKPTVEAPTDTGAPPTVDDGGNEEGDLAAAASLANTTSFMDAGAAAQWPSSASM
                     QQSPLEILCNVFAWPIFTFSKPRYSRYQQETLALYAKLVRTPQLLRRLWSLYWQSCEG
                     LRAVLPPGEALQRLCQPPAWGAQEQEEQPALAGEERSRRRRVPAAAHPGPALISLPRL
                     PTWETHPRYPLAFYDPHASLSIFFFTLLAYYVNVCDFADELRRGGEAAVLSTEESWAL
                     VLALKEIVHRSHMYGVVPDSNGEAVAHAACLLLSRLHTVDEADPFVPAAATGLWMSVS
                     AVAAEAAVGLLFRTWDAASAAVVDEEDAAEAGEAELDGASVATGERSVVGGVMSSTTA
                     GVATTSVAHVRLPGDDVAFHGSAQWKQATRYAKMLVHTPFLFPFAARALLLSALLVET
                     DHHWTPPSERRVVVQRGRTFIDAFDLFHDKPLSNDMLNIRFIADDGTLEAGYGRGVYR
                     ECIVSLCKEGFAAEYGLFRQTPDGYVYPNSFSAVATSDPQHLLKIRFLGAMVGRALRD
                     GVLQDVPFALHFRNSILGRRNTLSNLKSFDAELYHQLMSLTQLSEEELEAVGLTFVYT
                     VNALGITREVELVPDGAKMHVTPRNCLFYVHLVADFKLNREAAEQTRAFCTGLHSVID
                     TNRLRLFDSNEVGKLFGGDETGQIDLEDWKANTVYDKPEDVNAPQVRLFWDVVESLTR
                     AQQRQLLKFVTSMTRPPLLGFRFLAPPFKVQLLAMNASGPDHLPSAATCFSTLKLPPY
                     RDYATARAKIVAAIEETGTFEFS"
     gene            <302150..>304963
                     /locus_tag="LDBPK_300980"
                     /db_xref="GeneID:13385518"
     mRNA            <302150..>304963
                     /locus_tag="LDBPK_300980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862763.1"
                     /db_xref="GeneID:13385518"
     CDS             302150..304963
                     /locus_tag="LDBPK_300980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862811.1"
                     /db_xref="GeneID:13385518"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ1"
                     /translation="MFRRSLAAYGSYLLNQRLIADWWQAGHREEVHQAAKARLSAALE
                     EVEQRSSSAAQSSTACVDDESDPSFSPSGSCEYADAPHRSPPLSLYEANALVATFVSS
                     HNTQDLSATLQYIREQLGEELTAYHFHSLLRTFNYHHDAANALQVLEVMVHSGTTTLE
                     TYARMVDCAHCLCPPDVEARLLQLVALAQEAFGTHVMEDEAGTEGGTVAAYSFSGEGL
                     QARQAAADLTGAGSSHPSGETATPQPARPPRSAPVLSSLLYHCSTTSHRSTVASCVVM
                     ALWIRAFGVELTDWDVMSVLSSVLTHPDEFPQFCAMFGCFDAYKRGTVSVQAVVERLA
                     LLGEVERCGPPTANELVDEHVESDDTGSFDGDKEKARDSRVPAGPSATSTLTSLVGAM
                     QASLRAAGIDAASRVVSLPFVNAQTNSMEELVAATLLPLAQTGVGPHHYNAGHLFHAL
                     SLVQSSVGDDTGAIQLLQRAACEQQRCTVAQEALDMTANSRASKGQPGEELASSAESS
                     SSLAVTSASAPASREPYCVSVHHLLDVGTLLSRVSATTLRDVQRPFHGALRQMVEELS
                     EKPTEKPSPTSASPPSTWPTMLASCTPPVPCARDLVTVSSYETQFIRTVSEARAVLRR
                     AIDAGNATASNGRVPRSTQFMFMQLAQWCCRHPPCNPKLTPEGLEERTKWGRYLDARD
                     TSLALFGSARQSRDSMKHLFYNNNQLPELRSEAVIAKDFADVHELFFGSASPSSSLSQ
                     AELQLSMRQARTTLPHTGSSAAIVPRYLWDSAVYNPYPAAQLAINTCEFSKSPCGEGT
                     QSPFALAEVHQTDATLGNDAEEDVGDAEFFVELWHALLDKTTSVGSNEAWYLQNTDMF
                     LLLVRCLLHRLDWEAAAHLTRKMTQHTNYTYLMDHELTTIFREIGDPAGCLAFKVATK
                     LFDGRITKDGQTKRERFHQEQFS"
     gene            <306453..>307460
                     /locus_tag="LDBPK_300990"
                     /db_xref="GeneID:13385519"
     mRNA            <306453..>307460
                     /locus_tag="LDBPK_300990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862764.1"
                     /db_xref="GeneID:13385519"
     CDS             306453..>307460
                     /locus_tag="LDBPK_300990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862812.1"
                     /db_xref="GeneID:13385519"
                     /db_xref="InterPro:IPR011935"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ2"
                     /translation="MSRVTLAPKLEAVTVYGDRAQLTFSAPVVLKPSARVVAVVENIE
                     QWGDVDWATLQVRIGEATDPAVAAAVLLQNISPVRETVRQDVRADVQRQKDVIKRIEE
                     EQCACEEGIAALEESCQHLERIKCFVSSAGRGDCAVPPESAGHLQAYMQDPVKWGAMA
                     SFFATRRATAQRGLAELRTKLADVEERLEEAQQRLSDLGGDSGVRLHTKSALEATLVV
                     GAGVVSGTKLMVELSCVVSGAGWSPLYDLRVNYAESKLEVLYSANVHQCTSLDWEKVR
                     LRLSTATPHAGASPPPLWPRWTIWTRPPAPAMGALRGGPLARRRMGANSIFFTAPNTK
                     EN"
     gap             307463..307561
                     /estimated_length=99
     gap             309473..309571
                     /estimated_length=99
     gene            <311108..>313393
                     /locus_tag="LDBPK_301000"
                     /db_xref="GeneID:13385520"
     mRNA            <311108..>313393
                     /locus_tag="LDBPK_301000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862765.1"
                     /db_xref="GeneID:13385520"
     CDS             311108..313393
                     /locus_tag="LDBPK_301000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862813.1"
                     /db_xref="GeneID:13385520"
                     /db_xref="GOA:E9BLJ3"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ3"
                     /translation="MEEVKCSLLSFNSALLSQTLDAPSSAADARAADSNADSAAGASA
                     EPLRRYCEALPFHPTEQQLLQRALPLGRSYHTLLRATQEAAVGRVEGLYPAAIANGVK
                     KVLFNYAEAVKAAETPSALAALPATYALTFTLLEAIVKQQQRTEVCLPLLDSFLHNQE
                     VPAAFRRLLGESVWLALLYTTAHYIAHGVVLHARPDYFIAVRAKSTETAAATAAVRSA
                     STGFGGGAGEEHILYTDRLPLGVSPELGLLILAAGKERRVLLRDMDVQGGSDYLEQLA
                     LGSQDEAANAVFHSIFNAQLCHGGVLVAEELAARVEAAKTLWSKALWMKVGDLPSLKV
                     NLAALRSMFLCHRGDVWYAFVERVLPVLADVLPSLSPAAALEVAEGANAEGEKQVNAA
                     DAPARESHVAAPRSAYLQRIASEAFLFALSVSNLRDTVAYEAFTMRVKSCSVQQADAA
                     FAADGPTRVARHTRGGGGAAGSTEDVARHLLLIVEALYLQYIPPQGLLLIVSHKAMQY
                     YQRLFLFHLALRFSLEALAVTRSLLSEALVTNTRPSADLRRAFSLFQFIHFMESSLGY
                     YMQVDVISVFTAKLEEQLASAACTSVDQAKRFHDQFIWHVLEATFLTEGSEPLLRACQ
                     SLNTCATTLYILCMRYRIPYWAVDGVNETPAEVRATLIALEARVQQEVVAVFTGHLGL
                     GGRPWERALWSRLDFNGYFSRRRGRPAVPVPLRSASASANTFRQPHHTRVHSTGGPSR
                     SSSVAAKPHRHHITSRRTSAG"
     gene            <314415..>316361
                     /locus_tag="LDBPK_301010"
                     /db_xref="GeneID:13385521"
     mRNA            <314415..>316361
                     /locus_tag="LDBPK_301010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862766.1"
                     /db_xref="GeneID:13385521"
     CDS             314415..316361
                     /locus_tag="LDBPK_301010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862814.1"
                     /db_xref="GeneID:13385521"
                     /db_xref="GOA:E9BLJ4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ4"
                     /translation="MHHSNESVNDAADASFFPQPSPTRPSREALPSAAPPTGRVTRTQ
                     ALARLRRGEGSSTDTKPVRAPGNDVNELRVLETRKECVVGEVRADAQQKKSEGTSSHA
                     AAPPAVSATITPDDGDDIGAAFQETGDASRRHRRHGHDAEGTSGDAVRDDASDGGAAN
                     VCDDYSSDDGSESTCSARRGGAGSAPTEAFSVHPTHAGARGRAVSTRQAANALPRMLA
                     LQRSFETEAKHLYEYCGTHVVEWPTLAVEWIPDRAFVDPERDYTLQYLAIGTQAHPLS
                     GAANTVKVMEVAVPVTTAKDVMYGLYGDDDIAGAEAVDPALEGGIDPGKRFANVKGHF
                     HCEQTLTMDSAVLKIRAMPAETNIIAVKTASGLIGVYNLVQDLTQNEAGRTVPDALLR
                     GHRRGGFGLSWNTLKPGFIASAADDGYVNYYDVSHRLTIDLREASAVDPSLTGPETQP
                     LERLVGHRDIVTDCCWHSSQGHLLASSSMDGDARLWDIRMSAGSSTIPSAHASGATAA
                     QFHPIGAFQLATAGAEGSISLWDIRRTADPVRELNYHGRLIAGLQWSPFCETVMLSYG
                     ADGRVVLWDLAKMTLPLGYSEDQLAPPEVSFVHIGHVGRVTDASWNSSKTEEWLLASA
                     DTTNGVHVYRPLLNVVQDYRAYQQ"
     gap             319004..319102
                     /estimated_length=99
     gap             320197..320295
                     /estimated_length=99
     gene            <321641..>322996
                     /locus_tag="LDBPK_301020"
                     /db_xref="GeneID:13385522"
     mRNA            <321641..>322996
                     /locus_tag="LDBPK_301020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862767.1"
                     /db_xref="GeneID:13385522"
     CDS             321641..322996
                     /locus_tag="LDBPK_301020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862815.1"
                     /db_xref="GeneID:13385522"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ5"
                     /translation="MTDPAPSPQEPMTVPLAASATVLPRANLAVSAPPGATRAGHSKR
                     LPEELAESPHTQPPRMETINERKQLFRTRLYTTPLRVPATEGAEQRGETPGASLTATG
                     ATPNDSVAGAPLLRAPPPAILSAAGGPASLSIVKTVPFSEEEHLAWLCAPASPTEIRA
                     SAAVPPGAAAASSRGLACTERIPRAQSEGELKHEPDRRTVGATATQQPHLSSGASDVL
                     GNDAPACLQGLAAAPTATAPNTATPLAPQHGEISYKSSFSVLTSWDALMVAPPLLRTT
                     PRMPSLLTQDADSIGTAVVHSSRSTSVTHACVSNDTARIPSTGSRGELLIGTSPATEK
                     GEARQGEEARADAALQQPLFPSSCCTRTPTTVPSRLKCDGREWSPEDLVHQFEEDSAR
                     TFVKHFTNGLVFVDPPWFICPVLLDNCEHPYYMTWMDELEVGSVEEAVAEAKAKLLTD
                     A"
     gene            <324079..>324693
                     /locus_tag="LDBPK_301030"
                     /db_xref="GeneID:13385523"
     mRNA            <324079..>324693
                     /locus_tag="LDBPK_301030"
                     /product="p22 protein precursor, putative"
                     /transcript_id="XM_003862768.1"
                     /db_xref="GeneID:13385523"
     CDS             324079..324693
                     /locus_tag="LDBPK_301030"
                     /codon_start=1
                     /product="p22 protein precursor, putative"
                     /protein_id="XP_003862816.1"
                     /db_xref="GeneID:13385523"
                     /db_xref="GOA:E9BLJ6"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ6"
                     /translation="MSGFDRVPSTSAPTALTVPRRSASDAALADATRRELEEEMGRSD
                     KPEQPTPPAGWQVVRKPGTCTFDLTKSFEGEELVVRYSTNQDSDKANSHDIFVYITQT
                     NGQTMQADLSIEEGELVLNNIRFYDEAALAKDTSAEAEAKRNELYTGPLVHELDYDLL
                     NCVMTYLEKRGVDEKLGEFVVLYSFWAEQQDYEAWLTTMNKFAS"
     gene            <326395..>327777
                     /locus_tag="LDBPK_301040"
                     /db_xref="GeneID:13385524"
     mRNA            <326395..>327777
                     /locus_tag="LDBPK_301040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862769.1"
                     /db_xref="GeneID:13385524"
     CDS             326395..327777
                     /locus_tag="LDBPK_301040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862817.1"
                     /db_xref="GeneID:13385524"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ7"
                     /translation="MLLAIVRDLLQLFRPYAAALHPETTQVWFSVRDTPLSWLYPAGA
                     VKDYVNECVREERAAHLSASSTSSPSSSAAAALLQSHLCSILSEPLELSFHIHSLTKG
                     SSLARTVPLYINYDRLEEHIRMEVKQAHKAAYTVLYGNYTIYQREAESALQAAVGLAL
                     YRPFDAAAQEQLQQQRYRDPGLSGSGGAGVGNGGYSSSSSPGGGYSAPFAFTSPYLLA
                     EYQQLLRGLLTPRPHVAYLIRIGFPFAYRGAAGRSESGYLQYDAHRVSAAPALALSVT
                     ATEAAAAPTIEPEQLPLGLLLWRLFRAPVLRWKAQQPQEHPRDSTSPSTSAHASAVVL
                     SEVERTYQQLLRTLAPYYADPPRCATDELEKQEPLLTSTPPEPPAWAAWEHAMVQAFM
                     RDYEERPEKCGLGLEFAEAAAPSATSPNAGRRVRFMVQGIQPPLSTPGSFLEAHLSSS
                     DRAIFVTVQV"
     gene            <329333..>331051
                     /locus_tag="LDBPK_301050"
                     /db_xref="GeneID:13385525"
     mRNA            <329333..>331051
                     /locus_tag="LDBPK_301050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862770.1"
                     /db_xref="GeneID:13385525"
     CDS             329333..331051
                     /locus_tag="LDBPK_301050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862818.1"
                     /db_xref="GeneID:13385525"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ8"
                     /translation="MMTPAVLPAASPTTSSAQDLPSSTSCAPRPMPVVELSPLILRVL
                     LWWAGRPQLPSRRSGHAAKVERQNTYSNRINRYDVDVGSTSELPADSREPSHASSSDN
                     GGSGNLPSQQQDDAMGAQQLRLRIADIFALLCRRDGGVAVSDALLYGRCHDASELAAQ
                     RCHLVFSGFSDARWRAATALAPNSPKTFATALELALIEPSASPDSKDGGASARSGTYD
                     VSQVLCALVDLHTSAASATRRSQPRPSPHLRTDANVDSDVVATGVLLRALLRCPPLHK
                     RLMRLFSGDARAAEPRRQRRGASAVVVTPQAAASLKSSEEVEPGSSSTVVLKAADTRR
                     QLDIFLPALTHASPIVSADSWQTLTMLLFPSSTATVSSATRRLLLFAPACPVQRLLAA
                     ALALPGDDNDDTCASRPSTPQPVLPPSSHPMARNNALRLLHVLCSSSDLPPGLQSLFQ
                     QCPALLWRVLRLAAAVCKGVAVAHVALVRRVLVDYIMLCASQSSCSESGGVDLHNNSS
                     VSTQVLLRENKDAVARFLASTHAAWGGGGRAPEDTGGDLAGAAAPASSENGYDEGHLM
                     TVLNAL"
     gene            <331653..>333488
                     /locus_tag="LDBPK_301060"
                     /db_xref="GeneID:13385526"
     mRNA            <331653..>333488
                     /locus_tag="LDBPK_301060"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862771.1"
                     /db_xref="GeneID:13385526"
     CDS             331653..333488
                     /locus_tag="LDBPK_301060"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862819.1"
                     /db_xref="GeneID:13385526"
                     /db_xref="GOA:E9BLJ9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BLJ9"
                     /translation="MNSQASSSPLPPAASCVQFRPEQLQLGSGIPLGSGAISQVVQCR
                     LRCAAAPLLPVVVKVVSKIQVLQQGKVQSVMNEKATLQRLAPFPYVVRLYGTAQSEDE
                     LYFVLEWLPHGDLLQHIRYVAQERVRQYNEEEAAAGSTASMPSPGAVAGGTAGSVPDG
                     APVAEASASTGPSKRATAIPASSTALRCLDFHDIQLITAQLVLALEHTADRGVVLRDL
                     KPENVAFDEKYRACLLDFDTADLEGAVNMPETNGGVACPPPVDAAAVDEAESSDGGGG
                     HAAAENGGASSSSRRRRLTVSQIHRMRRKTASFCGTAHYVSPEMVGECKWSFSSDLWA
                     LGALVYELVYGEHLFSGMTPFEVLQKVVHGSYVERHELFPHIHFADDADGEAEQCCGE
                     RRFAAVKDFIQQLLLTDPQKRLGVHPDTHRFDATALRRHALFDGFQWEPVEAQLRTFR
                     MRRFDLGSSKATSAASGDASCDAREASNDASGASSAALKSLAAACVDPSASLASCYHI
                     LPFNDPAYAEYVYRATADANPFEQFFTQEDTEPAPTAAAASHEAAGSAGGSAPGAVPT
                     PAVNSRPEAASVVDDDEVDDVIDDVGMHYTGRPADKYFQDYRDTP"
     gene            <334660..>337728
                     /locus_tag="LDBPK_301070"
                     /db_xref="GeneID:13385527"
     mRNA            <334660..>337728
                     /locus_tag="LDBPK_301070"
                     /product="ubiquitin fusion degradation protein 2,
                     putative"
                     /transcript_id="XM_003862772.1"
                     /db_xref="GeneID:13385527"
     CDS             334660..337728
                     /locus_tag="LDBPK_301070"
                     /codon_start=1
                     /product="ubiquitin fusion degradation protein 2,
                     putative"
                     /protein_id="XP_003862820.1"
                     /db_xref="GeneID:13385527"
                     /db_xref="GOA:E9BLK0"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:E9BLK0"
                     /translation="MLEITSLGQLLLHVQRSDVVTVIDFYADWCGPCQQIKPQFEQMA
                     RYYDPSKVIFAKCNVDRNRDCASRYGVSTIPTFIVFYANERVATVTGGDLGMVQRSID
                     LAVAQIPETAAPSSAGQTAARRDSVQETQDAFAEQMLRIVEAKSTKNQILEKDSCDAA
                     YALLKAKTPYGLLLLPYLASDAFSAVAIDALFSNIASRAGAERHEEGYLINQVLSHLM
                     QLSTHLSWGDMSVVKQLHRVLLSLLACPRMQTALMTSPFFTNMFITTGTQLEHTTLLG
                     VLFGLGPKPMAAARAPHGDWLAMLEVFSPQKQDEHQQTVYTIQQEMSTLAKMNVRLVQ
                     SLLHVKTARDATLRYLGRALQLNEDYLKTMHHDSPISSRYFMIQLQSVLIELALPIFQ
                     ARANKEDTSSSGGYDYRQIPAHYLLDRLYGPNGVVVSFGSDVERVAHFGDDNPLPRAP
                     SSRDPYKPFIHLFFLAARAVTLCAAVFIDEHDRDERQATHPQASRQQRDFFTAEKLLL
                     EGLLGSTELSASRLEFLNHLAHWLLMVMQVDDQGVLPAQPPAEWGYLPQCLVDCVIRA
                     TSMAPLDGLYSDGMISLMLVLMGNTKYFPKPHTHALFPAYLLRLQENYATRKVLEQHP
                     WFSTHIVRACMECYIAVEKSTYERVEVRYELSYAIKTFLKSNLLCEPVREEMESQANN
                     TMLERFSHMAVAEVNEAVDQVIDTLTRMNEMVKAGADLSENAVASDSPQNAAGGSNGE
                     QQQRQTRRQRSNASRNEDVDAGEDGGEGDDEENADGSQTYHERGMSLRSHLMLFTASM
                     DMFIELSLQFPKGVSQNMVAGQISEMLARSLMAFAGPNSRSLKIQNADLYNFRPREVL
                     MRLVDCFTHFRRSKNFLRCLCHCSIPLSDIRSVMRTIVDRQLVSEDLIWKVSEMAAAV
                     TSVSKEVDNEEAVWDDAPDYALDALLSTPLLQPVALPADVKDLNDLVYVNQETLHHLL
                     LSESKHPFTNEPLTEDKVAAFNKRPDVAAAVEGRRAAIQKWLEDVKAAQV"
     gap             338460..338732
                     /estimated_length=273
     gene            <339484..>341100
                     /locus_tag="LDBPK_301080"
                     /db_xref="GeneID:13385528"
     mRNA            <339484..>341100
                     /locus_tag="LDBPK_301080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862773.1"
                     /db_xref="GeneID:13385528"
     CDS             339484..341100
                     /locus_tag="LDBPK_301080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862821.1"
                     /db_xref="GeneID:13385528"
                     /db_xref="UniProtKB/TrEMBL:E9BLK1"
                     /translation="MLRFTSFDLGRWSSRDFLRGRSKRAGAVHTRHTHGRQGRYKRLS
                     SITSSIRDGRRHASNHMQGGLGLKLGGGLFGLRIPRQHQLSHMSKEEFELEVHGHPNI
                     TNPYREHLDEHPDLKSVMMNATVALRLVVLLPKAARRPVQREGGDVQVPEQWSSVVRE
                     LKAALGALAASARQALGVVEVHLATLESSVCCRCAPSDAASTPTAVDGKRVEVGPDLE
                     TGVARLYRAHCLLRSRLKPTAEATRRHRRPAAFMGAALRASSPTSSSTPPGMFPWSVP
                     STSFTSSVLASLTKDTAAPSQRVLHRPCREGTLTDACLPSSATTLSAPVTADAAGASK
                     GKGMMELVRECSATEQPLLRLCLRPGAPASKWTHLAVRKDRSDTTAVAGHAAVATRKV
                     LKEDIDLNSEVGVWRLARSSLPELLRWHYCARDPRAHNHDALPHHRRSLPVLLVVDYS
                     TIAEDVGRARAQSTASSRPAATLMPRHLSLELESAGFKLLAESSLLDVAKSLEAWVPA
                     RQWVDYVQSCAHAQPRGACRAAPTAQAATS"
     gene            <342178..>343116
                     /locus_tag="LDBPK_301090"
                     /db_xref="GeneID:13385529"
     mRNA            <342178..>343116
                     /locus_tag="LDBPK_301090"
                     /product="DNAj-like protein"
                     /transcript_id="XM_003862774.1"
                     /db_xref="GeneID:13385529"
     CDS             342178..343116
                     /locus_tag="LDBPK_301090"
                     /codon_start=1
                     /product="DNAj-like protein"
                     /protein_id="XP_003862822.1"
                     /db_xref="GeneID:13385529"
                     /db_xref="UniProtKB/TrEMBL:E9BLK2"
                     /translation="MLFRRVSEAYEVLSDPVRRRAHDAELGIQTRRKQQPSAANAKAG
                     TRTGSPAGGARPSSASAGRRKHTTSTASSTSSTTFQQPQQRRYRKPFVRGDANRVFAD
                     AFDGKTLDEILFDVQRRRRQEKTGRAAAAQRRERGGGTGHAAPNDTAKSSSSPPPAMG
                     ENTPLDRDARLRHVMETAAELFAQRAQRQYGHGILRHIRGVAGPLPEGPAAPPEVYMP
                     FRPFVGMPVPPGVRTPPEPKLGKVLYSQEATIDSSSSTPDSRGAAWYEIPKQFHTHTY
                     ADGTPQSRSASLAKATKYIHGMPHNMGQLYSYHRPY"
     gene            <344059..>344811
                     /locus_tag="LDBPK_301100"
                     /db_xref="GeneID:13385530"
     mRNA            <344059..>344811
                     /locus_tag="LDBPK_301100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862775.1"
                     /db_xref="GeneID:13385530"
     CDS             344059..344811
                     /locus_tag="LDBPK_301100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862823.1"
                     /db_xref="GeneID:13385530"
                     /db_xref="UniProtKB/TrEMBL:E9BLK3"
                     /translation="MRRLACLASATALSGLSVAATAANPAASTTVPARFIYTTWGSVP
                     CEGWACNESWLKRITSQSEYRSFDFWHVPQTDVPAGLKLNAVERYLLSSLENDAARLL
                     HVSWCEDFDSYWRDRVNSLEMLYKTIYTDDHLFYRYIFGNCTHKTAEKEHMLRKLNYL
                     KNILFWACRTERCYTSIAKARYYVQRCVWNALERERYLCACVEAVDSFGKKVPEELRH
                     KAMPELEVALVSMRHWVWDCPNGKRTFTRRLA"
     gene            <346766..>347782
                     /locus_tag="LDBPK_301110"
                     /db_xref="GeneID:13385531"
     mRNA            <346766..>347782
                     /locus_tag="LDBPK_301110"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_003862776.1"
                     /db_xref="GeneID:13385531"
     CDS             346766..347782
                     /locus_tag="LDBPK_301110"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_003862824.1"
                     /db_xref="GeneID:13385531"
                     /db_xref="GOA:E9BLK4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BLK4"
                     /translation="MSTVDMYIDGAVASMCATIISNPFDVMRTRMQLQGELCKRGEYK
                     VVYDNLGQGMIRVAREEGLRALQKGLVSSVMWQVMQNGIRVGLYPAARAEVSYVCGSD
                     AVYISVIAGALCGLVGSYLSSPFQLVKTRLQSQRNTIVTMRGDVLSKATTGEQYDYAG
                     VKDAFHKIYKTGGLRALWKGSHIAAQRTLVGSAAQLTAYDVAKPIICQRMGWPASDIR
                     VHICAAIFSASCVMCVMNPLDVVMTRSFNHRIGEPMAYSTNLAVATWKIYRIEGVRGL
                     YKGSMALFSRSAPHNIATFVMLEYLRKMRERYTNRAYTSGSSVDKSIGFNRVIDRKSG
                     KNAA"
     gene            <348902..>349510
                     /locus_tag="LDBPK_301120"
                     /db_xref="GeneID:13385532"
     mRNA            <348902..>349510
                     /locus_tag="LDBPK_301120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862777.1"
                     /db_xref="GeneID:13385532"
     CDS             348902..349510
                     /locus_tag="LDBPK_301120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862825.1"
                     /db_xref="GeneID:13385532"
                     /db_xref="GOA:E9BLK5"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:E9BLK5"
                     /translation="MSVRLLLGAGLAYARRLPLAPSPILSCCAPHLHTGVLWSLTEGA
                     RAAHTGSKEAGYYRLQNPKHINIDPCVYEIRTMRGSGPGGQGTNSSSNKVELRADMEL
                     LSEFFDDELLAALRRHEAGGALTSDGTTIVVSCHEHRSALQNKEGCLRKLQTLLHKAS
                     WVPPAEAGLVERPSFIVTEQKARRRKKSNMNRMTRSARSGSW"
     gene            <350132..>351037
                     /locus_tag="LDBPK_301130"
                     /db_xref="GeneID:13385533"
     mRNA            <350132..>351037
                     /locus_tag="LDBPK_301130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862778.1"
                     /db_xref="GeneID:13385533"
     CDS             350132..351037
                     /locus_tag="LDBPK_301130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862826.1"
                     /db_xref="GeneID:13385533"
                     /db_xref="GOA:E9BLK6"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:E9BLK6"
                     /translation="MALLAAPFFSNLFPLPDLSSLSLQLLRFLFAFLTRGRFSLETSL
                     PRQPLANLPSHLLVIASSTLRREMLPRLALSHGAAAAAAAVPLAVTISTASATSVSQR
                     WCSSMTSDKPDATGANPFTSAIAKTLREKVFSQDFTAVKAATPKETELLKRWRTGDGT
                     PEQSPRQPAAPGTADSSDVEPQIAEGAQNVAVSHGKTFRDSRPADPEESVECKRRRLI
                     YQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDVLLKQLDSELFRWLVMGVDAPEG
                     VAKLRCFDELRRFIKEERTELLGSN"
     gene            <355437..>362987
                     /locus_tag="LDBPK_301140"
                     /db_xref="GeneID:13385534"
     mRNA            <355437..>362987
                     /locus_tag="LDBPK_301140"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862779.1"
                     /db_xref="GeneID:13385534"
     CDS             355437..362987
                     /locus_tag="LDBPK_301140"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862827.1"
                     /db_xref="GeneID:13385534"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BLK7"
                     /translation="MTCSRDNDTAIKRALAHNTTAEPLTNARTASWTAHSAAQRESAD
                     VEARMKAITAAMTSSPLPLLTHVLTSVPSAIACVSSATPVTSAACASVGTDTAASRVP
                     RTSPSSPPVASSDDATPWSMTLHTDATRGSAAEAYWAPYDVYLALSAPLLRERALQDF
                     VATLCCPMTPSAEGQPQLVKIDSVFFFLLHGNAVAPLIASAPAVVAPVSTFQSPMQSS
                     SSLHWSEHGSRNSKAELIAFPLFCVLGAKLCTVSRRTRSICSIHTPEAPIAARLATHP
                     NQRGGYGSHSRHGSDRADLTYPAVQQDLAAKPCSGTEASLPRHDGGRDHVLLLFAEQL
                     ISGLPGFPVALLYTTSPTGAVVSAPPAEASAFWDSWHKTPRAVRRSVAYEHIWSVVTL
                     PRLVAMLQRWGVAPAVAMRRLCVGLHCSSTSPLEPPGKPHPLHATMNIAHGQGEEATA
                     AAAAVPDTAGALRRPQLPLAEPDSCLVESPPPIPTAAPAQPARASVVGPPQHIVDSSS
                     SDGAAWESLSSDAGVVPHRGMSTPAMRGAEVAVRAPATPLERRGRVTAGEFGTCGVTT
                     PRSQDELLSSGEKGDAGDPVHPYNALGAPGSVNTGPEDNRGLYGQAHLYYTSSSPPPP
                     AASSVKTTAGSVLFVRSAVSGRPLTESSTPLFNTRRFRYPDVLHPPLRLRLHTSSFLE
                     RANGPVRVTRGAAMLPTPRCSGAPKRVTAVPTDARYSDSGALAHPYEVPASDTTRQSG
                     NRHRRRHSGTGSRLIHQDDHRRGTNVRDAPAELVHASGDVEQLGDVRQVSARRSSVDG
                     LTDRGRVSSHAAAPALTPTPPTRNGSGCCLGARQRTEHVNRYMQVLMSAAALRRASPS
                     PTATDDFPQQQQNTAHRYSTGDHLAAAAGATPLCVASSSSGTGSNTKGSLNRSRESGD
                     RGEAMPRRAPVPPPPLQQHQLHLHRSPHANILLCHQSSMSTQSSFTSSSLTGGAVSVA
                     LSDHAASVTAEHENKQLGDDGNTDRRAGAVAAPSTFAGDSKIPSMTTSSEGSLASVAD
                     AAGTLPTAQVSLHPEAASLWSVKNARTHNAARNGIEDSLSKRLTRSPLRSIFTGLRAL
                     LQLATPPSSMQARGFPHRDAKPAGPQLSPCSPEDRAVRPCVHAPPELSSPLLTYSSHP
                     TLYAAADVAASPPPSDVLSPPGQHSLTLRASCERSASCLVTASSEENLSPPLRHNRGS
                     VVNHFAVAGASARPWALPTSGFSAINGCTAKVRPLSANESDHGAECRLVSEPAISVDL
                     QLHAAAREHAANAQAVTAPGAVRHDGATAVAASTAAPPVSPGCQPCAASLHLSRRLAD
                     ALVDSTLHEGGGWPSFLPLSLLGPTLAVATQFPGDTGGFRAAVPTLANSESGLLSWWI
                     DTAALLMNLLACVVQAVGRGYVARRDLRRLFRRPSSSPTERAAVSMTIAAAAPAVTRS
                     PHHTLVTRDLSLSSSPTASASASPVPPIVHHHGVATLAATAAFSADHFPGSHRPSAST
                     QMASSSRVLAMQPPQGCPPPPQTAFSTSLTFSINATVAEASTTPSDVHVSARDVSLVA
                     TTTPKSSLQRHNAASQTSPKSNKIPTFSSFATDATHSSPKNLSSFSGVRLKQPTRSLD
                     TASQKKVPAPPLRHLFAMCGLQSSSTSEDSGTWAPAPSVEAAGDAAASSDEDDAAAAA
                     ANASACPSIDAATLLLAISKYTISTTPDVVPQGRSSDASRGHELPSPSTHGDNNAGGE
                     PSGGAAAPACLVAGEPLGLLAQPSLLRLATSLKLQSSTEDADTTAFRESTAEWMGMMQ
                     QQLAVTPSCTVPFLDQAVAKGPPASTLGSSNSQGPISPDGARSSSCRLSSSADEYAAP
                     MVAESLLQLQRIGRGCLIRRRCELSYRERQEKALDLLHKRACQHTPVLSTCATSMEED
                     GIADGFGGGSTAGGAAAALSGITGLRLASSSYQTSDRTRLTGSLPQSTPSLPGASRPL
                     VTLMAGQRRLSPVNGRHFTDLAHPASLLSQAEPNLSGSEGVVGIVGDSAQLADDRSTA
                     VTFRGKTNTMAVPSDSGKYIASPAFVSSKRRPSVLFTDAPPHMPSSGSLSEPRGAAAG
                     GTEDGTAAASGSVQEAGATQAHRGSLPSSAPPPAAVKAADTDRGDDDAAVESPLVPSP
                     TVVLPSSSAAVPVETNDSARKAQPPTGRAPSPPRPSLLSPPSLRVPFSRDSYLSSANP
                     VTMKTPVSAAAAVVPVTSAVGTSISATMSDSSSRQASRSEGAYSMRSPYRSPSSPFTV
                     QGSPHTDMVGAAVDSNDASCCPLPRRRFLIAVPRAELSPMEGSIVATSGRSARSLNSI
                     NSLPFNCSTTANTTSVTAQIFSTSLPEGMTPELWVLDGVEEAAMSSSVSDGSDDDDAD
                     DNEGDAFKADLIHVEGGAEPACFVAAAQVLGREAAPPLMSKALLLLQRIGRGYLCRRH
                     QHFLFMVSISWTEIALMRRVALGFLARRRTGLDFFVHREANRQMAYWELRHRSAVLMQ
                     SVVRGFNARQRVKRLQRRVCTRIELRTALEQQNTDE"
     gene            <365765..>368755
                     /locus_tag="LDBPK_301150"
                     /db_xref="GeneID:13385535"
     mRNA            <365765..>368755
                     /locus_tag="LDBPK_301150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862780.1"
                     /db_xref="GeneID:13385535"
     CDS             365765..368755
                     /locus_tag="LDBPK_301150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862828.1"
                     /db_xref="GeneID:13385535"
                     /db_xref="GOA:E9BLK8"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="UniProtKB/TrEMBL:E9BLK8"
                     /translation="MSSSMLRSGLQLVAIDYSNPQPQYPGGPVLDAAAFSYDPLSEES
                     AALHQCVSAVNSPPVTYGVDDLLGRITNVEFIAAGGSPEEAAAGAPMHYRLASSLEPM
                     LNATLNPAITAVVDHCLSSIVLVYGATQEMKQMGLIGTPEECGLLPHGIRTLMERLLD
                     RKEHQLSKAASLNCTAKPTGDRAAAASDSVGSDASPSAPPRAAGSVSPPFGGGDDAVS
                     DSDHTEAVHSRSATSHTHSFVFPSIGSRHHRFVRMEATFIAFDSTSVVDLLDLSNKHA
                     ELVLKLAPPPTPSAFEEMTCDVSAAASTSPTTDSFVLNAQAMPVENANDALSALDIGL
                     DNLTRALELPLLQSESGSSLLFSLTAFTDTCRCATMHMLCLAEDPAAQAWLVSTVQAR
                     SQAIPLGEEQSWASIQNTPMPPPLHHHAATMLVPALCFGNMFTSVLICVYNSITALSR
                     LNRDLTLAVTGYRMRTIPRVTLASSRRGLKKLPPSWEEHFTNDGRRYFIDTSTQTTTW
                     KDPRFTYPHCSSRSGGLTGNNPSGSGTGADSGRSSRSGSPHHRPSRISLGPGDKDFLM
                     SRLQQEMHGGSPSATGSTGTTQQPAACAGRLPALGAPASGADSLDIGIIVVDTMCRPR
                     VLIHSRNPQFALQYDEQEEVLRAKRRELEEARVELQRKAKAAAVLGEAAGEAQDAGPA
                     SVPDTAKPREAVQPIVDRAAPTQAVDLAHSSPTPAKGVVGLDDVDDEEISALCHRNSV
                     KIEDFMFEDDSDEGGEDDEASDTEQISTPESAFKAGGVAISQSCTASSAEARFYANVL
                     QEQAAGVGEVSASSTVSSTETSVAVSPVIKSAAAPGSSSNIAAAASDEQSSSVISDAP
                     HGGTTMAAAPPEVQDLESLVDEFTAFYRRAFELQQRVAELEAELKRPKSTARSSSPLS
                     LPVAAEASDAGVHELVHQMLKAVELSPSAEVRAALTPMLTNAASTAPATATASVVLQA
                     FHEALRIAAQTNRAGGRANAAPKQ"
     gene            <370681..>371604
                     /locus_tag="LDBPK_301160"
                     /db_xref="GeneID:13385536"
     mRNA            <370681..>371604
                     /locus_tag="LDBPK_301160"
                     /product="DREV methyltransferase, putative"
                     /transcript_id="XM_003862781.1"
                     /db_xref="GeneID:13385536"
     CDS             370681..371604
                     /locus_tag="LDBPK_301160"
                     /codon_start=1
                     /product="DREV methyltransferase, putative"
                     /protein_id="XP_003862829.1"
                     /db_xref="GeneID:13385536"
                     /db_xref="GOA:E9BLK9"
                     /db_xref="InterPro:IPR007884"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BLK9"
                     /translation="MQGLSKDLQLYISGHRGRPALIYEPRTSLVEPSLLQLFEACNCD
                     AETTAFLIRSRNMSVWKLMLADFLSVFLSRTTAQGMAGRGMMFVYSTEQIRRLLRPPQ
                     APLVSPLPPDFQFDSLLDIGAGDGGVTANIAPLFKKVYVTEFSASMRWRLRRRGYEVL
                     PHDDPFHMNTAERLLDRRYFDVIACNNVLDRADMPETLLREMRDSLKPNGLLVLAVVL
                     PWCPFVEDGPRQKRPSEILPMQGGECCRGASFEQSMSKLVENVLVPMGFEVVRWTRLP
                     YLCEGNLRIEYAVLNDAVFILRKRGDVESRA"
     gap             371875..371973
                     /estimated_length=99
     gap             374793..374891
                     /estimated_length=99
     gap             375521..375619
                     /estimated_length=99
     gene            <375805..>377664
                     /locus_tag="LDBPK_301170"
                     /db_xref="GeneID:13385537"
     mRNA            <375805..>377664
                     /locus_tag="LDBPK_301170"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_003862782.1"
                     /db_xref="GeneID:13385537"
     CDS             375805..377664
                     /locus_tag="LDBPK_301170"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_003862830.1"
                     /db_xref="GeneID:13385537"
                     /db_xref="GOA:E9BLL0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BLL0"
                     /translation="MRDPTNTVWVGSYDPAFHSRSMLCRAFWPFGRVMEISIHDGKSY
                     AFVHLRRTEEAKAAVDALIESRELGAAIFNYSKMHEYTEEEMNLPHDPNVVEEPPVTD
                     PAPAPAPGARRQREYDGSRDPRDERGAREAEHGRDAPLPPPRRARHEREAKEPSNVLW
                     VGNLVPYITNEKLTEVFEVFGPISSVSRLGRSNMAFLHYETVEQCTMAIETMKGRPIE
                     GVMLSLNYGHDAQHASDAAGGSGAGAEGPAGMTGHSYGNVALTADGIPVNETPTNIIY
                     LGHLPADADAKDVEDLFAPYDGFIFSKFVASNGIGFGHFDTIESSRVARAGLSNAMIK
                     GTPIRVSFGKHNHTYTMADRRRIGEPALDNGGGEFNLDAMMRGPGAQLDGTTGALVAG
                     GYGGGAGAGGALVLPAMGGGAAGGGIGGADTNVYARKREAPEMNMDNRLQSLLGSTYN
                     NCGARGLEISPSQIQAVCQLVDNCASESACETLRQALMLYSPLRSVHVFNVVAKRMKE
                     FPDDPHKRLFVLYAVTHVLLGVSTEYVPFTEAVLNAYLMVLLVASEGQTSSGMDRLTF
                     IIESFQQHPFIEKKSNAGKEYEEQFRAQLDEITNRAKAEQDLRLLATRRRRRN"
     gene            <382352..>383971
                     /locus_tag="LDBPK_301180"
                     /db_xref="GeneID:13385538"
     mRNA            <382352..>383971
                     /locus_tag="LDBPK_301180"
                     /product="importin alpha, putative"
                     /transcript_id="XM_003862783.1"
                     /db_xref="GeneID:13385538"
     CDS             382352..383971
                     /locus_tag="LDBPK_301180"
                     /codon_start=1
                     /product="importin alpha, putative"
                     /protein_id="XP_003862831.1"
                     /db_xref="GeneID:13385538"
                     /db_xref="GOA:E9BLL1"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:E9BLL1"
                     /translation="MFNNQEKKGAKHAVSTKAGAERRQRQLMSVRHRVHGEVMKLLRA
                     EGQDDSDMLGGNGSVAQASNPEDVWSYDARSTPASVPLQLLPTLVNMCMNGPTDREVF
                     QGTLLIRKILSVEKDPPYDVVTSSGVVPHLVNLLQREDYPELQFESAWALTNIAAGTS
                     ENTMMLVACGAIPRFVALLGSPNADCRDQSAWAIGNLSGEGAACRDEALSHGAMVALL
                     NVLSVKEQPIHVLRNATWAVSNLCRCKPLPPLERVAIALPTLVDLLNSSDDQLIVDAA
                     WGISYISDGPAERVQAVLEAGAVPRIVQLLSVPSTNVKLPAIRIIGNIAAGTDEQTQV
                     IINSGALPAMAELLRHPKRALRKETCWTISNIAAGQPYQIEALVNSNVCIPILECLSA
                     PELDVRKEAVWTIANITFCGSVAQVKYLVNIGVIPPLCETLRTYDPKIVTVALEAVQC
                     FLQVGEDEKTSGGTEENIVAKQVMDCGGVDSIEQLQTHADKNVYSIALQILETFFTTE
                     DEAGPMGDSMGADMVDFAQGNPNAGSGQFNF"
     gene            <386630..>386914
                     /locus_tag="LDBPK_301190"
                     /db_xref="GeneID:13385539"
     mRNA            <386630..>386914
                     /locus_tag="LDBPK_301190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862784.1"
                     /db_xref="GeneID:13385539"
     CDS             386630..386914
                     /locus_tag="LDBPK_301190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862832.1"
                     /db_xref="GeneID:13385539"
                     /db_xref="UniProtKB/TrEMBL:E9BLL2"
                     /translation="MAHGILRIVRQMRTFSFTASCRSHPFAWYAGLCCTLFSWANYAQ
                     YKRLAPMFPKYERYLTEEGGRMMEAKRQELAEVSRYNNMVDTMRRDLAGK"
     gene            <387893..>388444
                     /locus_tag="LDBPK_301200"
                     /db_xref="GeneID:13385540"
     mRNA            <387893..>388444
                     /locus_tag="LDBPK_301200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862785.1"
                     /db_xref="GeneID:13385540"
     CDS             387893..388444
                     /locus_tag="LDBPK_301200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862833.1"
                     /db_xref="GeneID:13385540"
                     /db_xref="UniProtKB/TrEMBL:E9BLL3"
                     /translation="MQLSSLRELVVLFDTQLQQLTLFYLADGFFALHTVAVSIASLVV
                     CASLAVATSSGSGGSAAPLTSTPLLFTSFTSFASLSVLTLMTLTLLYRAIGGGFVYSP
                     RETAYVVDWILDTVSRPAVEDTVHLLLAPNKRRERGMFFMSLCLIGEAGKFLSFWSIC
                     TLASMAWCGWSVRRAWRTHRCAG"
     gene            <389610..>392192
                     /locus_tag="LDBPK_301210"
                     /db_xref="GeneID:13385541"
     mRNA            <389610..>392192
                     /locus_tag="LDBPK_301210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862786.1"
                     /db_xref="GeneID:13385541"
     CDS             389610..392192
                     /locus_tag="LDBPK_301210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862834.1"
                     /db_xref="GeneID:13385541"
                     /db_xref="GOA:E9BLL4"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="UniProtKB/TrEMBL:E9BLL4"
                     /translation="MRLHSSFSDRHDSHKQQQRQNGRYGHHRGGASPSLAALDADPVA
                     DRQRDRKARRRQERQDKKQLRITQHEQWTQERQQARQQARDSRVAEQLQRQRKRQRAE
                     RAVTSEAEKNGKRHKDEKALKDKSEKCVRATANGCTEKTRVAGLKADTVMPITGAAAA
                     GTAAPATSSLADPTPVPAEVAEKVRRLVNKLTAANVVDLTKDLSDYMATPGVSRVSVV
                     KGLVQQIERLCRLEAGPLSTTGTLPFAGLLRGLQLLHGNQVGSELVERVSFSLHAQLA
                     AAEEAAAGNTLMVLAQLYLLYGVDVVFVMSLLRTLLHQGTRLLDYVGGDGATASDASS
                     SSSPTSASAVAVQAVCACACGLALMRACGEKLLKESPTELEASLQEARRSSAKMRNIT
                     GTARFAALVEVMGDIAAGRTRKARRAITEEAAPVETMLEDLCSLLPGQEKAASTQRRT
                     MKRLVLTTNIMSGLTWAQVTSPEKPPRWYIPGVMMTSAPSAREDGDKSAAATAGKHSG
                     TAAASKENGRSRHILPSHPSLTADGESEEMEEVDEAELKRERIARMRAEEKALSGQRL
                     NTEHKREIFRCIATAADDLECFTMLMHRDPGYTRFHDVCAVLLQCAYQERRYNPYYVQ
                     VLMRFCSAKPACAKTLQFAVWDRFKSIRIENTDIVGYFNFACGIADLMQHGVYNLSLL
                     RGLDLENTNKTIGLFTRMLLLRLILQLPASRLTQLFFGGDGSSAHDLQVDTSVLRRLL
                     TKFMSLYFIDENASKRWLPDFYEVVAAGTDFDVSAAAEPRALPGLRDSAAPAADEGSG
                     AAEERVLRRSADRPPSTLLDSAPASPRAALSRSKSAASAEAMLGQFMKRVQVVYKALK
                     HGIL"
     gene            <393174..>398534
                     /locus_tag="LDBPK_301220"
                     /db_xref="GeneID:13385542"
     mRNA            <393174..>398534
                     /locus_tag="LDBPK_301220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862787.1"
                     /db_xref="GeneID:13385542"
     CDS             393174..398534
                     /locus_tag="LDBPK_301220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862835.1"
                     /db_xref="GeneID:13385542"
                     /db_xref="UniProtKB/TrEMBL:E9BLL5"
                     /translation="MRLSNDLDKRRHRSRGEKATALMHRLGETEVNSVDAGSSPCSHI
                     HLFSSSGTGLFEDMVEDEEEGGGGDGLVLHFDSSPPSSSSPPFAPRVEAAVDDVAPPD
                     LVKGANNATATAATPNALRLPAHDGTTAAPRIPGAAPESSTQTPLRAAATESAEASLS
                     GAPRRLLLLRPGTEGEPCSLSTASSTAVPPAAPLSSALSSARGSRVLRISTAAAAKSD
                     TLLAEPAQEAPHTPLPACAATTTTAATEATRSTLKVPAPTRSTIPISASETAGTPEPR
                     EWQPFLLSFAYPVCSTDATTTAQKPPPLLSAPVAMKGRRTVAVHLEFIAVAVGETTSH
                     PDAASIAAHCSRGSVASCGWSSQCLSTNVLSPDVDAHDTMHRASHGYSVIIGDASLAS
                     RCFMCPLVAAVLPGDSGRCYDATCKLPTNGGTGEVRAGPLLDVWVRAVSGRQPSAQQR
                     GHRNAREFLSSTEVVLKDQPRPQQGAAKLEGATQDEGTCRVPAKPSSSSESSQPLFTT
                     VFTASWLSQLCCVFTPCPLATSPYRHPHTGDVRRPRPARRSLWPSSRSPSLVWVATQV
                     TQDCIVTRPRCLTGSTSSPPLRASEPKGKVRYYWLRSDPRQSDALHRYLCRVFACWAS
                     ATSASLSASSPHLCASQCTASDVVAASTLLDIVVTKANPPTLSLRGGAVGTASAVLVA
                     YETLHTAELELEAEDAAEAPSAASATPLVAGAERRRLSPSALRARVAITAAVLQHLMW
                     GAVERSDTSCKGEASKDAAVERKAVSDPERTPSTPSPPGEQHVVHLEEVTSRLVRAAR
                     ALAVHWVCGSPSLLRNAPASLMDFLTEELLLLSSILSVGRLLGDMFARAAKGFEACSP
                     VRAPSTTGLDMLRHFATEYASASLAALAWLSQHAADTQLLREEGLVSLRLHEAERALL
                     CSASASPASSRHGGLVRHRLSSGKGPAFRLCSYTKESHQRFSRDDGTTVVGKSVLQAP
                     LRGKVNVRVEHAAVMNAFMVHLEWTTTMSAAACDAPPPALFPDVHAAVELPFLLLVFV
                     VAEDVGGTAHDSADSSWTSDDRSLRGPRGVGGCAVRLYQVTPFTWRLSAAACTSNGFV
                     ARTTQLLMHALDLVARQPDVFEGFHLQAVTGLGSGATTTAAASARPRTTLKRTRGRRC
                     GTGCADGAAEGGASATAVSSKNGALGADTAAVRRNRAQPRAGKRRRTGVDDNDDGRSE
                     GSETSRVDEDGTVDSEADDDDASTLMLHVGSSRGFRAAAAAASPPDSGPARRRRPGSG
                     FHKSSSNTSLSVFDTARVMPVVVFRQDAAAPLLEVEVSQASQLAAQLAAFGSRATRSA
                     GRNANEQDEAQEEASRVLCTLLDHWIGFSSLHAAAPHYVANLQARQRHGALTLTTQLG
                     SLSSHTGALTERCVLYAYADLLRSLWRELAHLSESSPHSTETSPSASSPLTRFVSVAA
                     LRAHVLDPVRVAAAIEAAIAEYARQDIECRKRLLAAKRYAAAQWASEEAEENEKEGGA
                     GNTGGARRSKPKKQTQQQQRQRLEEEVSTEAAARATWASLAMQTKALVRTFYAEVLGA
                     FPLASPPLPADNQPRTIHAEVKSGSFCGASGGNALPWGVPNSWDLAASEKRAAFLSCL
                     RGFLQSVEVEEEGPPPPRRGDTTAPTFSPAFRLQLAGASADKVFSLQTLPSSLKSRQW
                     RATGAGAAADLDVTVAQLAETCVAQLSCTPSHSCLRLADATSANAQRGKKRVDKVVRW
                     PVAGDDAAAQRAAQLLLVSDALLLPCGKRASAASAHRQATAAKLALPLAQLMMNAEAV
                     LH"
     gene            <399840..>401888
                     /locus_tag="LDBPK_301230"
                     /db_xref="GeneID:13385543"
     mRNA            <399840..>401888
                     /locus_tag="LDBPK_301230"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862788.1"
                     /db_xref="GeneID:13385543"
     CDS             399840..401888
                     /locus_tag="LDBPK_301230"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862836.1"
                     /db_xref="GeneID:13385543"
                     /db_xref="GOA:E9BLL6"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:E9BLL6"
                     /translation="MSQSPNAECLYSPVDGEGMKRLSTATSVHRNTRATSQRPAPPVN
                     PNGSAASPHRSPLTLVGAPRPGESKPAAATSETHPQCAAASLGESAYDMDAGDELPAF
                     GYRGGTSTGLRKKCQGNAAREYPVEGTGDGVLNPLRCEGGSDSGSNGASGKVRDGAAI
                     GGAIAADDGQATSLSATESVKENGKSLFSLSNIPVPTTAEEYYARVAEIDHVRCGLGQ
                     ELEGDAKDIYGPTWPFSRRMIASRVFGTKECPAPNCDKKTNIQAVTGPRAWALLFIYG
                     ILIVYPVFTTVAYAGESGWQCIIVLWLLSGLTIVFVTLCAFTNPGIVPRRRLRNVTDR
                     GDILIVRVPAPNAQAVLDKLQELPERMGQPPAVKCGNGGSGEAADASAYTAEALRSAV
                     ADGDLPASVFNHKRSTMYSMERYFETDTGRIVLYNPRLSESDLAVPTLEFPILFCRTC
                     QIAKGPRTHHCKVCDNCVDEMDHHCPWTNCCIGRNNYPYFFGSLFFLHFMVLYAILYN
                     FAQGIRLSYLHPAWDVRRFLRYVYGMPIIVYISFFVLGLFFFPLMLGHLYMTCRGLTT
                     AEMLKQKWKRSEYFGGINPWSQKHWYQNIYARLLQRWPAAQEDPLRWLNSRYYYGVTV
                     AAAVEDQKVDWLLALPPEERKKVEENDAAAREAGAKIREEQEAEIVRAAMEKRGFHVA
                     "
     gene            <404222..>404722
                     /locus_tag="LDBPK_301240"
                     /db_xref="GeneID:13385544"
     mRNA            <404222..>404722
                     /locus_tag="LDBPK_301240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862789.1"
                     /db_xref="GeneID:13385544"
     CDS             404222..404722
                     /locus_tag="LDBPK_301240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862837.1"
                     /db_xref="GeneID:13385544"
                     /db_xref="InterPro:IPR029248"
                     /db_xref="UniProtKB/TrEMBL:E9BLL7"
                     /translation="MPIILHEVHAFRRCTAPYLPLIFRNWNRLVLVPYRLAMWCVHFS
                     TLICVTRGSDRMIRVSSLARGCAEADYVFLRQVTNLCLATSFLCLFFNLWGVLTTRTL
                     RFGVDNWFQGSCHCAAAVLLIVSWQATVHVARIWQVFYIFSIIPTGIEAITLAHSYWR
                     GMEFFW"
     gene            <405643..>407499
                     /locus_tag="LDBPK_301250"
                     /db_xref="GeneID:13385545"
     mRNA            <405643..>407499
                     /locus_tag="LDBPK_301250"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862790.1"
                     /db_xref="GeneID:13385545"
     CDS             405643..407499
                     /locus_tag="LDBPK_301250"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862838.1"
                     /db_xref="GeneID:13385545"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:E9BLL8"
                     /translation="MPSSSPSLGPVFEAITPRLWVRYLQRYLDVAELLTLSETCWTFF
                     VRCNEEPLWRELCLRPPYIDVQRKLGLFTFRGSWKYTVCAYRAERAGADRQSRRPSTV
                     VLAQSRSIADASLRFNALLPRIVSYLQASGEMSSDDGGVWMSQLRSPCAAGTGAASEV
                     SVGLDSGRDEGAVESAVGAEMSVKAWQESVLGKPYAPTLAVKYLGLSAGAINYFMHDG
                     TFLRPPLQALRQSQHRLVRPHTEFTDYNWYGTCLLDLVPLPKWCTNAQFFVTLRWKTS
                     CRTRRLQCCGHATAALDDTGGARGPLHLPDELRGVPGVVDRRYRLSVDAFQREYEAPN
                     TPVVLTGCIEDWPARDTWQDIHFFRRFASEALRANGRTADGRRFRMSAADYLAYEVAT
                     NAEKPMYVFDKVVLRKSTALRADYAIPPYFTEDFFSYMTEEDRPDYRWLLVGPDGSGS
                     PFHTDPHGTSAWNAVLSGCKRVTLYPPHVVPPGVEEEWIHSDYYASEPCLRWYRTRGE
                     SMPSGSAVCGTFSKEHVGEAYHGSARELLPVEALVFPGDLLFIPSGWWHQVLNIGHTV
                     AVTHNVCSSLTFPRVVADMNAYADRTVRKRFQCALRRAGRDELAVQLRVPGA"
     gap             408796..408894
                     /estimated_length=99
     gap             409866..409964
                     /estimated_length=99
     gene            <410544..>410570
                     /locus_tag="LDBPK_301260"
                     /db_xref="GeneID:13385546"
     mRNA            <410544..>410570
                     /locus_tag="LDBPK_301260"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003862791.1"
                     /db_xref="GeneID:13385546"
     CDS             410544..>410570
                     /locus_tag="LDBPK_301260"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003862839.1"
                     /db_xref="GeneID:13385546"
                     /db_xref="GOA:E9BLL9"
                     /db_xref="UniProtKB/TrEMBL:E9BLL9"
                     /translation="MPCYCIEEV"
     gene            <415056..>415316
                     /locus_tag="LDBPK_301270"
                     /db_xref="GeneID:13385547"
     mRNA            <415056..>415316
                     /locus_tag="LDBPK_301270"
                     /product="small nuclear ribonucleoprotein polypeptide e,
                     putative"
                     /transcript_id="XM_003862792.1"
                     /db_xref="GeneID:13385547"
     CDS             415056..415316
                     /locus_tag="LDBPK_301270"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein polypeptide e,
                     putative"
                     /protein_id="XP_003862840.1"
                     /db_xref="GeneID:13385547"
                     /db_xref="GOA:E9BLM0"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:E9BLM0"
                     /translation="MSAHTRQMENPTGVVHRFMQDHQRVCVWLVHDPQMRLEGNLLGY
                     DEFMNVVLGDTTETNLRNNKSYRLGKILLRSDNVGVIYPIGA"
     gene            <416263..>419055
                     /locus_tag="LDBPK_301280"
                     /db_xref="GeneID:13385548"
     mRNA            <416263..>419055
                     /locus_tag="LDBPK_301280"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862793.1"
                     /db_xref="GeneID:13385548"
     CDS             416263..419055
                     /locus_tag="LDBPK_301280"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862841.1"
                     /db_xref="GeneID:13385548"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLM1"
                     /translation="MGVGLSTVRHAGTAILVPTASAASAAVLPLSSEERVAALPVTTT
                     RPAAADAAAAAPAPPTAEHTSNPRQRLTDTQAAHAAVSLRHAAPKPDRRFPPYPEETS
                     ALATPPPAAVLTAAPVVAEAAVKRHRKESGATKPLHPAQASLLTRAEEGQRDATGDAI
                     IAVDRLRRRCCPDAGVGANRNMNCNEDATLLVRSPDEGRRSGTSLQTEGGLYGEKGQR
                     QFAASAKSSPSPASPEAEEVATTACASVKAAAHADAPGGPAAPLLSSTFTAYRPVARS
                     ASPGPALGQYEGLPLTSVQQVLESKHKVYRICLTGGPCAGKSTMLSAIQAKIPQRTGF
                     RVMCVPEAATLLVTGGMQWDGDLTVPQQLGLLRTQLALEDQFYALAVASNVPTVIVSD
                     RGTMDGRAFCTDEQFQEILRGVGSTIDVLRDRYDAVIHMVTAADGAEEFYNLDNPARY
                     EDLDGARASDLRLQRMYVGHPMFRLLDNSTTFEDKIERGLQVVSQVVHKEQCAPALPT
                     YYLVRRCPVELPVASATYTTHTTVLSNSQISDIRLLVKREMADGSTMHFFKSVRDAPS
                     TVLSSRAPPRATSHASSGASFRSSVNAPTVSTASPTQQRIESAQRISSREYASLCKHR
                     DSTRAEVVMRATHFIFEGANYELTTMIAPSWAAGRQTLTVESCTVSTAKQEQVHPHGS
                     RQAAPPAAALRLPPFLEVDREVPVESLTTTFLISHKETGPLYTSLAFAPVFSRAVLTA
                     LGAHADTENILSSTVSTPRGTPALRTEKGTLHIPPALAETREDSGLPAKAPVLGEGNQ
                     RVENAENSVFMAAPPPLPLPARRGLAPLDVNALAISAPAMKSATSKAEGTHHVELASS
                     PLHLDESTSVRKQHNVDTPSSFSLAGEEGGTAKVTTAAPAGERLQPERLMARDPESVL
                     PPIGTKKSTPVACLRS"
     gene            <421164..>423335
                     /locus_tag="LDBPK_301290"
                     /db_xref="GeneID:13385549"
     mRNA            <421164..>423335
                     /locus_tag="LDBPK_301290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862794.1"
                     /db_xref="GeneID:13385549"
     CDS             421164..423335
                     /locus_tag="LDBPK_301290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862842.1"
                     /db_xref="GeneID:13385549"
                     /db_xref="GOA:E9BLM2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9BLM2"
                     /translation="MSEGGNRNQGGGGSSGNRSAAGAFSPYSEEVPVECLICADPCRA
                     LCVFPCGHYTCYSCGLRIHSLNRGSCPVCRKEATQMPIITQQVSREEEQFSAKEMESM
                     RRVVTTNRHLRCVIDSPQLAYEVAKLYEYTCPIESCWCQGYQDPFLEMNMLKDHLWVD
                     HELVYCDVCLQHRPAFLCEQVAYSITALQYHMEGRCRHDRSSFTGHPPCRFCKRANRF
                     YDGESLLKHMQQQHYTCDVCNRGQFTFTFYASRQKLDQHFQTCHKICDHPDCASHDLM
                     MRVFGNEIDLMVHKQRVHGVKAKVTFSPAMFGEASGSSVGNGPTGSVPATASNANVIQ
                     ITFDHVFRVETVEMMPTKENNHRGGRRGGGGGDRGVDRVHAPEENGIPLYYLGSGAFP
                     VLTRSVASDAGAASSSARAGGARSSNRSSAPSSSAFAVAEDMSNYNVKNKLPADKKQL
                     EQRLNDMLSKHVKSPVTYAHFRSYTRDFIESAMLTSEYYDVLAKECFPDPQVFHEVFP
                     LIVATVPVAAKQAALQEVYKMRMAPETQRLARAREEDARKEAEAKAAAARAEEMQSCK
                     AGKSTGSNNGANNSTPAGAPSPFARKNAKGKGAKQNAWLTTDTRSKFGCSSSAPAQHQ
                     DPSASAPATAPTSSAPPAAASLKPQSNNRPRGWGPVATASSGTFVTTPAAVSAPVSSP
                     PHVGPGLVINEETFPSLPNNGIRREPIGKAQRPKANAWFKR"
     gene            <424523..>424822
                     /locus_tag="LDBPK_301300"
                     /db_xref="GeneID:13385550"
     mRNA            <424523..>424822
                     /locus_tag="LDBPK_301300"
                     /product="calcium-binding protein, putative"
                     /transcript_id="XM_003862795.1"
                     /db_xref="GeneID:13385550"
     CDS             424523..424822
                     /locus_tag="LDBPK_301300"
                     /codon_start=1
                     /product="calcium-binding protein, putative"
                     /protein_id="XP_003862843.1"
                     /db_xref="GeneID:13385550"
                     /db_xref="UniProtKB/TrEMBL:E9BLM3"
                     /translation="MRAKSKSVSEKKNEKRRRCLLLRFRSVRSHCCCCCRFHFAYLQP
                     RSLSRLFSMFPFLLCRKHRLSFFVCSLYLRFLFEEVACPDTHTHTHTHTHTRTQS"
     gene            <427789..>428697
                     /locus_tag="LDBPK_301310"
                     /db_xref="GeneID:13385551"
     mRNA            <427789..>428697
                     /locus_tag="LDBPK_301310"
                     /product="Pyridoxal kinase, putative"
                     /transcript_id="XM_003862796.1"
                     /db_xref="GeneID:13385551"
     CDS             427789..428697
                     /locus_tag="LDBPK_301310"
                     /codon_start=1
                     /product="Pyridoxal kinase, putative"
                     /protein_id="XP_003862844.1"
                     /db_xref="GeneID:13385551"
                     /db_xref="GOA:E9BLM4"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9BLM4"
                     /translation="MTDDKHVLSIQSHVTHGYVGNKAATFPLQLHGFDVDAINTVSLS
                     NHSGYPVIKGHRMDLEEFTTIMEGLRANDFLSDYAYVLTGYINNRDIVRQVAATVAEI
                     REARQKQGKKDAVFFCDPVMGDDGRLYCKEEVVEAYRELLTHADVATPNYFEASILST
                     VEVKDLASAIEAANWFHTQGTPTVVIKSFAMADDPTHLRFLLSCRDKATGSTKRYTGV
                     VPYHEGRYTGTGDVFAASLVAFAHSDPMDLAVGKAMGVLQDLIKATIERGGSGKATLS
                     SRELRVTSYPDRLQHPSSVALVTPLP"
     gene            <429612..>430667
                     /locus_tag="LDBPK_301320"
                     /db_xref="GeneID:13385552"
     mRNA            <429612..>430667
                     /locus_tag="LDBPK_301320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862797.1"
                     /db_xref="GeneID:13385552"
     CDS             429612..430667
                     /locus_tag="LDBPK_301320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862845.1"
                     /db_xref="GeneID:13385552"
                     /db_xref="GOA:E9BLM5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:E9BLM5"
                     /translation="MRDGHLAPTATASLAAQFSVYCLEKPRQDVSDDDAAVPARESAP
                     TSLPSKADLAAPLSYLDVVQQLDGDDEWSFAPYPRCSRAQLLQVHAYWVAIRSSAAPE
                     TWKPSWPKASDGASEVQKSEESASIRSAEEATTTPRCLCDRDDGCSAGSCPSADALRL
                     ACVVGIVWVRLSARTPSTYSLVNRRTPHNGQVSAGSAIADSPSVSLCRPSVEGYIQVV
                     VTHPHYRRRGLASWLLTQCLACTEAPAGVFASDRRDGVAYAIERWHLHTLAATRRAAK
                     RSRGDEETWTCQQDHPRPDQHHQDANHRRSEGEGSEAVVAATLAMYRRLGFHERRYLA
                     RYYAGKNDAVELMKMCL"
     gene            <432011..>437983
                     /locus_tag="LDBPK_301330"
                     /db_xref="GeneID:13385553"
     mRNA            <432011..>437983
                     /locus_tag="LDBPK_301330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862798.1"
                     /db_xref="GeneID:13385553"
     CDS             432011..437983
                     /locus_tag="LDBPK_301330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862846.1"
                     /db_xref="GeneID:13385553"
                     /db_xref="UniProtKB/TrEMBL:E9BLM6"
                     /translation="MPFPSAASFTQAKWLAFFAELTAKLTHHNALVVMEGAELLKRLL
                     LSRVSIAAVLQQGDLLVRLLDAWRGCVLAEHPSKFLHHRDETNFAFPAPPSPSAAVAL
                     NDELSFVLAESISQCIDLMVSLHADGDPYYSLLVLARAGPMLEVLVDVIRMAPPQIYG
                     ITASLLQQLLALPLGRDSVGGADGARGEGTQRGFDKATLAQLRKSIPLQQHVRSLVEA
                     IQGHGVLLQHAADTLAELLAGQQGPRRFAAIALFNQASKRLRKHQLRRGGASSAATSA
                     PGSDAIPGMPPQSRCDARESTVDDSDLNVTITGAAPAHRASPSPSPSPGAVTPCALDD
                     LERGLRSPAKRRHGGAAAPLGEAEEAGGAAAARGGVSLARDAARFPSPPAANPAADSD
                     KPPAPPSPSHDISDMVDAEPQRLACAVPLTVAEEALRHLASSRSHDDFFAAFDWLWCL
                     TVADAPVVGAALTPEMLRRSLGRYLTAAPRTRRDRILFTLLLLWIGHVHSVNALREET
                     HSCVLEVSASALLPMLRTELAKDGERASSGQGRDNSSKQGISSLTVSAITPTNTNIAA
                     TTSATMLSTQETVGPLGYGDIGVDPMVAGLSLDPSSFRRGEGRDNGSYPSAIGSALLP
                     YAAARKAQEAAVLLRPSIGVILLSFLLNIHAGAAVHAQRVWVSQGRVLEVAQMAVRRA
                     QGCRSALLDTPTNIDGALSDEVYLEYALRSVRTDATTVAVLGCRLVAAVLGDELRWGA
                     AARDSSTAKPAPTEKAQAEGNAAAASIQAELALSAQSLIPLLVDMAVNNPDVTAAQES
                     GAASPVHHVPLNLRCSRYTSLGECSLVALDACLQYHAQAGHLRSRGDVPMSVSGFAIE
                     DLVRVLPSLTCASQCSVHPPVRAVPYRLLLYVSQRLEEVLVVLRHMPSLASAAVSCVL
                     DYGPRAAQWEAAAAAEWLTVLVDLLIGAETAKQTAAPSCEGKPPSPSQQRRRLPTAAE
                     LLNEYFHFDDSPLSRKLLLTIASGRRSTSTGSAYAVNALLQLATHLQAYLQARRRRAP
                     HERHRKPQQPSPASLSSVTREAAAVEEAVTLPLCPAGASSLAQWVLLLQSITADNRRL
                     TRICSAFKHPIEGGHSVLRRGSGGVAKDACTRAITAAEQIALQYNFTGTLFRALQSLL
                     CDAAAGVPAALLSSWLLCDAVAAALMLPTPRDVIALLSTRFQAARAPEAGDGDAAHLP
                     PSWIPSPALVFSYQAAIQWASRVGASWLTGSYGSAAQSQVGASDGTRGHGGLPLKHGC
                     AGLVEDICAGALRAMQEMTPNVSQRTRCLAATLVSAVVDACPEEQLGVLEARGAALFA
                     ASATLRRLPCVSGLQCRLLRRVRSAAVHAATSGDGWLEESLTSLRHVVDRLQENAQLW
                     PSSAKNGGHSSHRRLSHQPHDAAQAVRELQNFQVLVSLLTSLVSCTGATRAEGAARAS
                     SPAVEDEMSSPPHRQLLLTDAQRQTLCAALCDALRVHQLQPTVVLALRIMADTHEGRR
                     CILTEIASTGDPLGRTLFGRLLALTLHMPSRWVGADSAAGTSSSSRAFSPTSTPQDRH
                     RALKSSPSQQRSPSITGAGATAASSASPPLRSPPRSEAPQPADRDIVCVAGCDVCTML
                     CGSRLQEGVGGAKPLADAGPSSAPTSTVFLSAFVKHRGVEFLARAVVESDRELRRHGR
                     DLAVPLHWLRLVAALSLHRSIAKSFVQQSDFFSVLMELAGTPASALHAPAATLALLAI
                     RNVCFSDGLKSTLCQDARVLLTLKAAGMGITAVSQLIEWRPPPSPPPNSKRPRTTARQ
                     TATGGAPPPTSRGGARLEVMLREDVIDMENKTEVDWAKQACVYARGMTRLGEEPLPNI
                     EDSASCDAAGDVVTAERKPPSAALGGASGADHVAAAPLPRRLFGDITNHSRAADVGGS
                     LLEIDATVSGGSPAKQVGDNMLPVLVAATDSEAHLRRYLAATAIASLWFDNQRGRSAI
                     ARVLAATPCWSMEDVQAAIRASVASPMGAQVS"
     gene            <439107..>441221
                     /locus_tag="LDBPK_301340"
                     /db_xref="GeneID:13385554"
     mRNA            <439107..>441221
                     /locus_tag="LDBPK_301340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862799.1"
                     /db_xref="GeneID:13385554"
     CDS             439107..441221
                     /locus_tag="LDBPK_301340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862847.1"
                     /db_xref="GeneID:13385554"
                     /db_xref="UniProtKB/TrEMBL:E9BLM7"
                     /translation="MTSQERQAAVLALVRRLLPLVQPDLPVHSPTHFTQLCDGIALFA
                     MLRLVAPNSFPSTCSESTEEGAVVSLTGPMLEEDAQQRKHNMCALLRDIRAYAQEAMH
                     TTSSTPVTQGLDPAVLAGLPGAEDDGCAAAEAAQRQQLTQLVGVAVALVVLSGVPAVL
                     SEVKSLPRQEQVVLSDWVKEIMRAYQLQPRHHATAVSEPGPSGVSAHLRQTVSPQPAS
                     SGFAAASPMIRRGATGFSPSPLSHRGASSNAAAAGEEDEGYYRNATYQLRRELTEVKA
                     QLAALQDAYKVSKEDKEMAEGKYRLLLGDQAKMSPTLAATSAAAATEGGDSEAGAGGS
                     SDILSVWQRRCAQKDEAIAALTARVEQQSTQVTALKEATAAHEMALQALRRRLKTAEE
                     GVMVKSEERREALQKLAVAEDKLAAQMKARVELETQVEELQSRLLVLELEQDRLHGLG
                     SDDAAQLNTSFASNGSVDRVLALENELDEARQQRDSLQRQVGILQRQVAAMVAPVADV
                     STANDTWRAQLRQVEREREDLRQQLTTALERVGGLQQQLTASGAAAAVVDASGVGAGQ
                     AGPASGTANADASIMSVEEGSELDMGLLDEGTDSPCGRDTGLTPCSKTREPACREQVI
                     LSSLLLQYSYRNLLLQQHQTLLHKDAMEAEAARRRQAEEHLEMMRQTPTSVLTKQRRD
                     VEQGLLETVLLGAKLRMMQVES"
     gene            <442174..>446514
                     /locus_tag="LDBPK_301350"
                     /db_xref="GeneID:13385555"
     mRNA            <442174..>446514
                     /locus_tag="LDBPK_301350"
                     /product="vacuolar assembly protein vps41, putative"
                     /transcript_id="XM_003862800.1"
                     /db_xref="GeneID:13385555"
     CDS             442174..446514
                     /locus_tag="LDBPK_301350"
                     /codon_start=1
                     /product="vacuolar assembly protein vps41, putative"
                     /protein_id="XP_003862848.1"
                     /db_xref="GeneID:13385555"
                     /db_xref="GOA:E9BLM8"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BLM8"
                     /translation="MKRHDSSGDASASLPPLSPLPAPVQEVDHAHDGSRTSSSSTPAS
                     HHTLEKREATGCGGTRHSSPGGGKKAGDDGVDGTENDSYTSYYEYDSGYDEENSSFAD
                     SDNCRGSGSVDDDRSSTAASLLPQEDLLRFLSYTLAGAALEDHRLMAMEAFRHILVLG
                     TNQGAVAVVEPSSGKLKEVYTNHHEPICDVDCTINELYIAACDKAGHVTIQSRRDVKD
                     VWMAELNGPIESVALHPLYHKMDSCPMVCGGSTKVLLLTKGVLWSNSRRVRTLQEGRG
                     RIHKVRWCHTAAIDVVAWLSDAEITLYNMKSGAVARRISLPDLTAQNALYPPTLRWEQ
                     NLSRDPTAAATSTATLLCGWGDVVQEVRLHADPHARRLSGGGLFGVDRSPRSTLLQGG
                     WRGTSSSSFPLRASSGSAALAPSPSLTTAADAAGRSPCVVELRTSKPLRPSSTLFPYR
                     VCGIAPYGPQRYVVLAGIVEGDTEGVLKDLEVRVVDRNSLTDVYRGRMPIRFIHPLQL
                     HLTYLELLPSLAAKPASAASPPQLALPADPLAPSPMTQYFILSVDTIVKAVPSDVDDH
                     VEFLLRTSQFERAYRYAAAHARQLRRHVLEHVGQQWLMHLFHNRSTEEGALLKILELL
                     PELIPRDNSAAWEQWIYRLDTCGESWRLIALLPASTGASAEYRVASTPDMQEEQDAYA
                     EHADAAARSLPRPVATLQTPIQREYYDLVLLRCLRHDPSLFFAALHKFHTLFSVPVVL
                     KATEVVYREQCAAAAWWEGDDSDEEKNDNGDQHGQTRNTTASNASPTLSTASADQSGV
                     PSVAPASPPPTTPQGTLEETSASRAVSHPSPVTTAGAGATSAPSMSRTSRWSLVASYG
                     FLLRCARRHEEALQVLLHLPASPRSDREVFGLIRDQQLFHKARELLPELLHRREDATL
                     QLLMEHVVGASGRNGVTDGGDAALAFQVVVAETDGTAPSSPSLDALQYGSAQDPLCTE
                     SVISRLEKSDRLHLLRYLNLVQKRYPEVFAQAAKQHAQLVATLYIDYDRPSLLPFLKQ
                     MSMYVERIRELHALCHKHHFLEEEIFLLFRMGREDEALRILVEKMHDLRRALKFVVSV
                     PDLEEQAALFTRLVDYTVAYNASLPTCSLDSAKGATAGSGVRMRYVMHHTKPNETYAS
                     IAEQYHVALEDVCKVNGVASTSGGAVSPPPSAAVEASKRRTSCSSPLEGQGEAQRRAS
                     CDADAANDLPTPPPQCVVPLNLFGDFLRALAEPQFMEHPALDVRLVLPRLPSREPILH
                     AGPSIAAIAHTMAEEIAFFSTVCMVGENDLMGYYGQLLKRRTAAIAMGRPRHPVESGT
                     ATMNEAATTARHAAAKSAEGSAAVHRCAACRQLLAQRVVVFACQHMYHPACVLQYLRK
                     SPTDAFTGGGGATFGGRAGGAVPVMRDGAALALPVTSTAAAWAETMEGELRKLPVYCR
                     ACRQHSGEQS"
     gene            <447203..>448069
                     /locus_tag="LDBPK_301360"
                     /db_xref="GeneID:13385556"
     mRNA            <447203..>448069
                     /locus_tag="LDBPK_301360"
                     /product="U3 small nuclear ribonucloprotein (snRNP),
                     putative"
                     /transcript_id="XM_003862801.1"
                     /db_xref="GeneID:13385556"
     CDS             447203..448069
                     /locus_tag="LDBPK_301360"
                     /codon_start=1
                     /product="U3 small nuclear ribonucloprotein (snRNP),
                     putative"
                     /protein_id="XP_003862849.1"
                     /db_xref="GeneID:13385556"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:E9BLM9"
                     /translation="MRRSVIRTRKEFLERKQHERVHEAIHARKEQFRSAVETATPLPG
                     HLKKDALALKKFTELDDAQTRNLTTTVDDEYANAGQEDPHVLVTTSRNASQKLLEFAK
                     EVRLIVPNAVRMNRGNLSVHQLMDAARKENYTDVLVLQESQGVPDSLTVSHLPLGPTV
                     TFTIHNLVARHDIEGVGTMSEQYPHLIFENFSTKLGIRIKDVLRYLFPVPKADASRVL
                     TFDNENDFISFRHHTFKKEKGKKQVELTEVGPRFELTPYRIVLGTLEMDDAETEWVLQ
                     PYMNTAKKRRLL"
     gene            <450392..>454084
                     /locus_tag="LDBPK_301370"
                     /db_xref="GeneID:13385557"
     mRNA            <450392..>454084
                     /locus_tag="LDBPK_301370"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862802.1"
                     /db_xref="GeneID:13385557"
     CDS             450392..454084
                     /locus_tag="LDBPK_301370"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862850.1"
                     /db_xref="GeneID:13385557"
                     /db_xref="GOA:E9BLN0"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLN0"
                     /translation="MTTSARQAALRRRMEAFTSAVAHQESILDDVAAACRAHLHTVGG
                     ATAVPAPCFFFAALPQISMRQWAGSHLYKQWLVRCETPRASLPSTATRPKKVGLHGAP
                     MLPSPSAPRAPATTLVLPLDVEAELRKYWKLHDEAAARARLEALRCNDAQAFAEHVSL
                     LKVSALLEIMERTEGFMHRIGLRLQSHATQAAANRGGDGACAVSTTRAAPAALAEPGI
                     ADRPGGAAGCHGSEYERFRSYVASTKNEFKLMHRVDVFVAAQPAGLDATLLPHQMDGL
                     RFLASLDANHINGILADEMGVGKTIQTLAFLLYLKNRRGETGEGSGGRVAPLRVGSRL
                     PHLVLAPLSVVREWREACEQFVPSTLHVAMYQELADPVHEAAAYDLVLLPAHAIRYVG
                     AEAARIRWHYIVVDEAHKALANLSTITAQRILGLPCLRRLVLTGTPLSSDLQELWSLL
                     HFLNPEVFTDNDAFEEVFRRPFRVYEAHEMELTEEERGLLILRLHQVLRPFLLRRTKA
                     DVDSTLRMTLHHMWCPLSAMQQRLLCMLREQRRMPTVLGMAGGYSGKSSSSSEADNEE
                     ETAGAADEAAHTSTFPAAEIGTGESSGCTQHTASAAFAAEALHGEFSPDLDTLQARNE
                     TATTRDRLAELVWRHLPALASTESSDILRCAVQQDRALGLTSAGVSESSARLLCNHAF
                     LLPFFSQVLHRHGLDEVTQEGCSDADAAAARTSESSVVGGEAAEGCGAAGLTLACSGK
                     FLVLHLLLSRLYVAQRKVVLFTHWLNCVDLLVDYLHSRGWADHAEVLTGGSSEAERLT
                     SVRRFREDPACLFFLLSIKAGGCGINLQAAHMVVLVDRDYTATNEDQALARVYRIGQR
                     HTVRAVYLATTDASEQRVAQRAAAKNKPRQAIINDGVYQVTTASEAERVGETGETVTA
                     ATFADSPSHAHNELDTSELWRSIPGATTPPSPTTATQEARRPECDGTAYGAAGPAPFS
                     LPPPEAFWAALSRLVESMDELVLTEEDQAAATVRSAKEEGRSMDCTPANSAAARLLAT
                     RPPQSTAELHLRLQGGKPEMFSGPQRERGVAPSLSGTAADDAYLGAWKHGAEAPTAGD
                     RTRPHTPSEPQAAALAATPQSTPLSAPVTDPLRNSALFWLEFSHLLRIAGRGPYLLSD
                     SLRAAVTNDARKSDPEERVRRRQRRDRRVAKRLRLASVDVPDDFREACWAKEGIDDNA
                     EVAERYLRFLDANAGKRRQRRRKDAG"
     gene            <456113..>461257
                     /locus_tag="LDBPK_301380"
                     /db_xref="GeneID:13385558"
     mRNA            <456113..>461257
                     /locus_tag="LDBPK_301380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862803.1"
                     /db_xref="GeneID:13385558"
     CDS             456113..461257
                     /locus_tag="LDBPK_301380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862851.1"
                     /db_xref="GeneID:13385558"
                     /db_xref="UniProtKB/TrEMBL:E9BLN1"
                     /translation="MVTERKVLKGGDGGGGDAARRTGFTSCGAITPAEVASHATECHS
                     HRLPQVQVPSSSARAPATVEEVAVSPVRLSDTVTPQKPPQHYAASTADSKVLFAEDED
                     EEGEDEGRQPWRPNHLRAASGDPQRPARAEEVEHVLGELSECSSITSARPQAPRRSSD
                     TSGSHDDRVPHPRCAPTESDKEVRCGPLDVKYTDNTAARGAKAVLGGEDDKARRQTCA
                     ACTTPSLKPACPDLSEGSVTPVLEGHTWGAASASATFTETLAVQDLSLLPGESGGGAT
                     LDVGGVANGGGYVYTPLLSSSTGQRTPYSAIANEGASARLRGDTLGVTAPEEVLLGEG
                     LISPPVKRTTATPQQVTHGVEVAAEDGTETRSGAGETGAGPSRAHGKALAMDGSSSST
                     TFLPTLSSATLCAVTGGGEASGFGQNMNTPPSHSSADGAVSMTDEQPPPPPPPRVPIT
                     PSSPSLPPSSLPSTLDDGLWKESAKSAQADVVDTDAVTPGRCTPNGQDASGDAPAPLA
                     PSVAVAQHETVPIDPFLSTPPQFKGESPVVEKDASGGGARVRRSPERSGCEDAGKGDH
                     SPAVFGFLTRTPPRSAKKSAMGLTSTITGADVDMRVLRVGTQVEGRWGRQWFPAVISE
                     APRNGFVQVEWEEDGSRLHLRLREVRLLPGAAAAKRAGAVPAIHEADRCAASVGGGAA
                     ATEGAHGVLTATQLVALMEEEDAQDSRYQPEPPHVRPSASHRETSPPMTTSVGKQVDR
                     SGGEGGEGAEEDVVVRPLGVSRACGRAGRGVYAVNADGDAHPDRASSAASSAGAATTR
                     SPSRSPVPTYAAPGVPPCEVHPSSLCIFLPQTVRRDLLQGEGPPPASAFSSSSFRYHA
                     APATELQRRTELQRILHFLTSAGTIVIDSVAQADNMAAQLGDSGDVKGTSFTSHLSSL
                     AAGQLHSADSSPMQGEKTTKAVAGSGGKRGTVGRASLPRRSMASAVAAASHAQRSAPR
                     YFVFLVSSATALVGGSAEASEKLDQLQDVLPVVCLAHALGVSAIHASWLWGIAPGTAR
                     VKLPTPADQVELLPSAAPETWGAWKATRAGAPSTKAAPLPLRFAPLAVKDRWLSAKNV
                     AFVARDDRMEMWLNAAGATVTAELAPSLPSHVARQSLPRGSSRPSASVAGALLGRSPG
                     SALPRCHSESPSRSLPLKQLRAEQTPDFVYVPDDVTVPLDLDRLGSVPVLQVSWLAEG
                     IEQHYRHCCNPTSSAEPVLPKPPSLTSVWRTILHAKPPKGSHTRRSNTPSQPDRAQSS
                     PSSPSPRPAVNDEEKRSVSEGARSRKAAAASTLGNERDRLSHHGSDVVHPASVPPLAN
                     DRSESGDGVAPSAFPPSAKGGDMDEGVGDTVGALRGSLNEEEDALTMRISGGDAQEPL
                     PREAEDFVSARGPEGAAAERGSAEAEKDVMLRLAGATGATAEALSDAVVSTEPSACTF
                     HPAIVIGEDYYFTLSAPQPPPPPSLSPHGPSHPHVPPPALPTATIVLGQVVDLQVVAP
                     PSPLLRQHLCTDGAASSLTFSQPQCRCRVTLQLYEPKYISMHIDPRSGEVVHQTTVYL
                     VRRWATVPGTSLLFDTPVYVITTAARSHVYFLEEVEDEVTARGVSDGAHQSRLRQQSV
                     CGAVSTPPASDLFHGAARATTDGTLSPHFHGRRSLSKVAMTSSSPVPTCPITRGCPPT
                     PPAPFSLTQSVANGRPRRDALAPSRTSEGAARDGSGGGVDERRRPD"
     gene            <462471..>463796
                     /locus_tag="LDBPK_301390"
                     /db_xref="GeneID:13385559"
     mRNA            <462471..>463796
                     /locus_tag="LDBPK_301390"
                     /product="ATP-binding cassette protein subfamily H, member
                     3, putative"
                     /transcript_id="XM_003862804.1"
                     /db_xref="GeneID:13385559"
     CDS             462471..463796
                     /locus_tag="LDBPK_301390"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily H, member
                     3, putative"
                     /protein_id="XP_003862852.1"
                     /db_xref="GeneID:13385559"
                     /db_xref="GOA:E9BLN2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLN2"
                     /translation="MIGAPWPPEAVFGNTVDRVASPAPVPERKASIADALHLRLSRFL
                     EKMSWGERRRVQILYGMLYPATLYLLDECSTDIDVAERRTVLELVRQECEAKDGCCVY
                     ATHILDGIEGWATHLLLMEGGRVVDFKAVEKLTMPLEDYALQFMSKRAHAARGFDAVA
                     APSLSQGSSAAISTTLSACPTTSSAAYPTPSTADAPVTYWPRGHADEKRSEIVINCAQ
                     LNYKDVFKNLSFQVFRGERVLLCGGNGTGKSTLLNMLGGKQFFDNRHGSLSVLGKRCY
                     DDMLLNALVSYGGDWWTAVPGGEVHVREMLQLRTSRAERLREMLAVDIDWDVRHISAG
                     EQKRVQLLLHLLDEKPVVLLDEATTDLDVYQRHSLLQFLYEESVQRGVTVVYSTHIFG
                     GLEGWANAVVLLDRTMRGVHAVWRASEGQPISLQRVVDAIVALKAREAF"
     gene            <464566..>465534
                     /locus_tag="LDBPK_301400"
                     /db_xref="GeneID:13385560"
     mRNA            <464566..>465534
                     /locus_tag="LDBPK_301400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862805.1"
                     /db_xref="GeneID:13385560"
     CDS             464566..465534
                     /locus_tag="LDBPK_301400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862853.1"
                     /db_xref="GeneID:13385560"
                     /db_xref="UniProtKB/TrEMBL:E9BLN3"
                     /translation="MPSSFAAQQQGSCNPHQNPVRSHKGGYLRCPFNISSSYAELAER
                     RVREDLTRGRSSGRSGAAVADKDGVMAFSSTGPQLDSDGIDGDFAGRPWSRAGVGANR
                     LSGKEKRTQQEQAELIYGRGTLAGDDGVVAATGAVSVTSDLSRENMFAVDVRDRAALQ
                     KVVPRAVREKVKRRKLEDFKKERLSPGNHHRHGCAPLHTDRAADEEAGEEDGVESRSE
                     DHMAVPPPECTRFSLPAAGPSRNGVPPFPHSAGSKDHSSGGSSSANARAERLPGSGPS
                     DASAQRPPLREPTPAPASAKPNCPKNRMQMLDGLRASALMGKKGRR"
     gene            <466158..>468299
                     /locus_tag="LDBPK_301410"
                     /db_xref="GeneID:13385561"
     mRNA            <466158..>468299
                     /locus_tag="LDBPK_301410"
                     /product="GTPase activating protein, putative"
                     /transcript_id="XM_003862806.1"
                     /db_xref="GeneID:13385561"
     CDS             466158..468299
                     /locus_tag="LDBPK_301410"
                     /codon_start=1
                     /product="GTPase activating protein, putative"
                     /protein_id="XP_003862854.1"
                     /db_xref="GeneID:13385561"
                     /db_xref="GOA:E9BLN4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9BLN4"
                     /translation="MHSAFLERVLGYSGADRTSASSEVGPDGGVMASTGSGGAKSSTQ
                     YKAVTRPYRCSQSNPALRSENLVGTAKDGDADGAPLNSSMKRGGGFSFSKAGRLSWMS
                     IRSSIGMGTRQSSASAAPAPQASSGALHLNKLSAPTPPGTTATVSPFGPNTPLAKTPT
                     TAAATATAAVSGEHAKRFQEALCVDSVDMALLRELSWQGCPVALRYEAWMFLTGCWTA
                     QAATRQPTVLRRRVEYAAYIHSSYGIVDWDAVCAMVDSGVDTAVHRSTLKSLEHTADT
                     PQVTPPSCTSQSRLRAAPLTTGGSTATAAKEAAAAPPLSLSQRPDGWQSASLPLEDAR
                     SRSPQNTSGSDAPQPSQLPQPQSADLPTASPSLGTLPAPSGSSFRASASVGLTDTAGA
                     GPTSHPPMSVPPLPGLATLGLPNAVPATVAPSAASGGAGGATGHQLSASTMLGSKELQ
                     TLKQIRKDIPRMSGGHCYLRHPRVQGSIERILFIWSLRHPACGYVQGMNDLVVPFMGV
                     VLGYRFCPTHSVTELHAYTEDIFDDLWSVSAVSATQWINEVEADVYWMTSYLLNTMQD
                     NYTSSHAGITSMMRHLAAVVQVADPPLYHRLVDVLQLHFEQFSFRWMNCLLMRELTET
                     QSLRLLDAYLSDEERRWSVTHVYVCAALLLRWGSQLMAFCEDYISVMKFLQEPPTEQL
                     SLRDMQDVLSEGFVLQNLYEASLKRLSTTAE"
     gene            <469235..>470695
                     /locus_tag="LDBPK_301420"
                     /db_xref="GeneID:13385562"
     mRNA            <469235..>470695
                     /locus_tag="LDBPK_301420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862807.1"
                     /db_xref="GeneID:13385562"
     CDS             469235..470695
                     /locus_tag="LDBPK_301420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862855.1"
                     /db_xref="GeneID:13385562"
                     /db_xref="GOA:E9BLN5"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:E9BLN5"
                     /translation="MVKLNVTLLRFMEDEDFRVLTALEMAMRNHDVAPTALVERIAQL
                     PHGGCRKRLNNLLKHKMIHHENTMYDGYAMKYGAYDYLALRTLSKRGTCTGVGHRIGC
                     GKESDIILVRDEAGHECVLKLQRLGRCSFRSVARNRDYKGNGRARHGESWFYLSRLAS
                     QKEYSFMKLLYDEGFPVPKPIDQNRHALLMELVPGTLLNNITELGDASKVYRRALELM
                     VKLAESGLIHGDFNEFNLMITDDQRVIMIDFPQMISINHPNASELFDRDVQNLANFFH
                     RRFKVDTTWFPSLEKDVVRKGELDKQVYASGHFTRKQQEDLERLMLEGFQRSEKSDDE
                     AGSQVLDSDASDDDGDENASQRSDIGNADVDAGVAGKFTSIPGGARGGESDEEREDSS
                     DDDASEGRLLDEAMGAARERREGEVYARNPDRNANFLPDGKINEDHVKHQIRKNIRRK
                     DNHDFNRHLHRNVQKGRQKQKIQRQLKSSNGGGFFD"
     gene            <472907..>476086
                     /locus_tag="LDBPK_301430"
                     /db_xref="GeneID:13385563"
     mRNA            <472907..>476086
                     /locus_tag="LDBPK_301430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862808.1"
                     /db_xref="GeneID:13385563"
     CDS             472907..476086
                     /locus_tag="LDBPK_301430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862856.1"
                     /db_xref="GeneID:13385563"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:E9BLN6"
                     /translation="MPPTRAGAASRSGKGSTAAAIQTAFRDVTNNYLNANKENIHPCH
                     LGRSHGSASLGGDSGNIGGGGGCSASSPNVWSGSREPLLRDNGFCGTPLQSDFARTGS
                     ESVSDAVECVTDKPSFGAALFAAPPDTLSPSGPAVEAAAAHGELTPMTPKARALSGCA
                     ATAGNPSEDSSLLGVSRTPGHNAAHHPAHSNSSAACRSTQHRQRGFSTPHSKDTSAAE
                     ATPNEARQRPFRVARATLLASPLYAPSNGLGAAANTETSGVQDDNGSGSQLPSQSSLL
                     CTPNRACRSAAVAAAATAAASGTRSRLDTPTLLDEIPLFFNNSFESGFESPTGDAAAG
                     DGYGAAHMTPYHTYDLQMAVEEVLRSCLDSFTPAKCSDASGATPHESRRRAQQRQTAA
                     AQAAPFNAYAALESLLPPSAMGAAGRDGLEVWAPAMMGAAMPGSTPARLTAPQGAFAE
                     SDDEGALTTPQSDRASCGMPSAGVRRDPLAYFSTAAVTAANSSEGRCGVTHHGEDGVA
                     SVGSLSADCGACGGAAESLPQHSSDARSGLEFNCRNGCCGGPDMLSMLAAAVQQQHPQ
                     HPHPYPHKETRPQSARSTTGSMELDSRAFSERDVAAAAEKQSTAPPPSYEVAACHQKP
                     PHHGGYAHPDLSSASSCAAATHAQPPTRRGHHLPHVKAAAGSLIAVGGRRVPVDKLHL
                     LSIGDEPSLSAPSSMAGQAVTAASSRGGPKARSQQSPSSALHHVEGPSMRRVPKANLV
                     TVTHPAAAGLAEAGASVPPGRHASAPVCERDAALPISSSYATLSEAAPARAAATGPSA
                     RRVPPAMATQQRHSSGGAVPGVVTLSSAVDREGVQQSSEADVVAVLQFPKGQTMRFLT
                     NLSNAALATAKDAIARDLDSSKRSTGGTATSMLASRPLLRCVEVGKAYLAHVYAEGSP
                     HEGVSYEDVGVCVQLITPSSSLYAALLGCVNGVLLRKVDVLVNDEDRKQHERVLLQQT
                     TAYIECERHFKFSGLPFQLESIYCTFDGSVCIVFYRLLAVADGSASSLASHRHPSTSR
                     MVRELKFHLNCRVFLKRCLHRTHTHTQKK"
     gene            <480327..>481652
                     /locus_tag="LDBPK_301440"
                     /db_xref="GeneID:13385564"
     mRNA            <480327..>481652
                     /locus_tag="LDBPK_301440"
                     /product="N-acyl-L-amino acid amidohydrolase, putative"
                     /transcript_id="XM_003862809.1"
                     /db_xref="GeneID:13385564"
     CDS             480327..481652
                     /locus_tag="LDBPK_301440"
                     /codon_start=1
                     /product="N-acyl-L-amino acid amidohydrolase, putative"
                     /protein_id="XP_003862857.1"
                     /db_xref="GeneID:13385564"
                     /db_xref="GOA:E9BLN7"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:E9BLN7"
                     /translation="MNAYADVYRARSVYPLSILLTHVPRNSPPPHIPPPYLSHKIMPV
                     PFQQLMCEVRATADETIKWRRYIHQYPELSFKEFRTAAFVAETLRSFGCPALAVTHPV
                     PTAVVANLTGGAGDGPIVALRADMDALPGDEETDLPFKSQNTGAMHACGHDAHTAMLL
                     SAAKVICAHQADIKGSVRFIFQHAEELLPGGAKDLVAAGVMEGVKSIFGMHCSPRYEA
                     GTVGLMPGINTSYTDFFKLIIRGRGGHASTPQLLVDPVPITAEIVMAIQTITARKIDP
                     RVVPVVSITTMTTGPNESHNVIPNEVKLMGTVRSRHKAVREQVPRDIERIASNIAAAH
                     GAAATLDFTFGYDCCDNDPEVTAQVRCIGERILGSANIIDPKVPLYGGEDFSAYQLEK
                     PGCFLWLGTANKSQGICEMCHSTKFRVDETALPIGVSFHVGYVYDNVMA"
     gene            <484508..>485005
                     /locus_tag="LDBPK_301450"
                     /db_xref="GeneID:13385565"
     mRNA            <484508..>485005
                     /locus_tag="LDBPK_301450"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862810.1"
                     /db_xref="GeneID:13385565"
     CDS             484508..485005
                     /locus_tag="LDBPK_301450"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862858.1"
                     /db_xref="GeneID:13385565"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:E9BLN8"
                     /translation="MHNSSKSEYSVVGQREQLDVVDVAVSETTQVVGSVTRPWHYSLC
                     VTCTEMNSCLECCFCTVCQLSRQFNMLYNNKPELHLPVCLMITGLSMSGVPSVFVLEY
                     ILRSDIRRRYGIEGNVLKDCCVSWLCEACAVQQQFLEMTSLGMCPGMSMCGVAPVAPG
                     AQVML"
     gene            <486901..>488562
                     /locus_tag="LDBPK_301460"
                     /db_xref="GeneID:13385566"
     mRNA            <486901..>488562
                     /locus_tag="LDBPK_301460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862811.1"
                     /db_xref="GeneID:13385566"
     CDS             486901..488562
                     /locus_tag="LDBPK_301460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862859.1"
                     /db_xref="GeneID:13385566"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BLN9"
                     /translation="MHSQRGSAAFGPPGGNRNNPATTNPAVTTRTRSIGRSTGAARDG
                     VAGGPRSSVGRLRASSSSHTAAVARGGRPLGRGRAPTHPTLFGTRGRSPATMSGAGAG
                     LSTAQDAIQAEMDALADEFYGSVPSRAPEDGTPSLRGASTRTVSADSPYYRADAGNGL
                     TADTLRSTTSWYEGPADPAGRTFDASDSNLLCMDVLVPRAAASGAMGRTPAARTFGAA
                     PPSASSPLCVVGSADHGLKVFDLCTMRELKTLYTKTCGHTEWVTACRFLSDRRVISGG
                     MDSKLCLWNDVTRGGPGRCVDLLGHSGSISQVEVNECRGRFMAMSSSYDRTIRVWELD
                     GIAGGREMGCLSGHKGPVTQFSWLETEVLSGDRQGTVKLWDVETAQCHLTASSKRGQI
                     GSLAHLVHPDVGHLALFGDQGGALTVVDARGPSSAKPLFQDVLHRGGMITFIRAPSPT
                     AVSAPLIVTCGADKRIIVRDARHNFAEVCAITDHDDFVYSMEVIGSLLLSGAGNGRLL
                     VHDVETGELLYELKANAAAVREMFASPSVLVAAGDDGNARVFDFM"
     gap             489650..489748
                     /estimated_length=99
     gap             490147..491279
                     /estimated_length=1133
     gene            <491457..>491984
                     /locus_tag="LDBPK_301470"
                     /db_xref="GeneID:13385567"
     mRNA            <491457..>491984
                     /locus_tag="LDBPK_301470"
                     /product="ama1 protein, putative"
                     /transcript_id="XM_003862812.1"
                     /db_xref="GeneID:13385567"
     CDS             491457..491984
                     /locus_tag="LDBPK_301470"
                     /codon_start=1
                     /product="ama1 protein, putative"
                     /protein_id="XP_003862860.1"
                     /db_xref="GeneID:13385567"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:E9BLP0"
                     /translation="MPQGQYSQKPNDGPTQPVKTRPGQNVYTGNPMNAPGSRAAVQNR
                     KEDWRFPLCVCCDDMDSCCEACCCFTCQVSRQCNMLVNNRREIHWPYCLLMTLCDVSL
                     FFFSVTCVFASETRRLARERYGISGSGIDDCCIGYWCRTCSAQQVLLEMTAMNEFPGA
                     TCYEAAPQPAANRMV"
     gap             492016..495957
                     /estimated_length=3942
     gap             497833..497931
                     /estimated_length=99
     gene            <498149..>498673
                     /locus_tag="LDBPK_301480"
                     /db_xref="GeneID:13385568"
     mRNA            <498149..>498673
                     /locus_tag="LDBPK_301480"
                     /product="ama1 protein, putative"
                     /transcript_id="XM_003862813.1"
                     /db_xref="GeneID:13385568"
     CDS             498149..498673
                     /locus_tag="LDBPK_301480"
                     /codon_start=1
                     /product="ama1 protein, putative"
                     /protein_id="XP_003862861.1"
                     /db_xref="GeneID:13385568"
                     /db_xref="InterPro:IPR006461"
                     /db_xref="UniProtKB/TrEMBL:E9BLP1"
                     /translation="MPQGQYSQKPNDGPTQPVKTRPGQNVYTGNPMNAPGSRPAVYYR
                     EGPWHYSLCVCCEDMDSCCEACCCFPCQVSRQCNMFMYNRREIHWPYCLLMIVFDLYL
                     PFSISCIFAGETRRLARERYGISGTGCEDFCIGYWCRTCSAQQVLLEMIVMNEFPGAM
                     CFEAAPQPAANRMV"
     gene            <498977..>499222
                     /locus_tag="LDBPK_301490"
                     /db_xref="GeneID:13385569"
     mRNA            <498977..>499222
                     /locus_tag="LDBPK_301490"
                     /product="ama1 protein, putative"
                     /transcript_id="XM_003862814.1"
                     /db_xref="GeneID:13385569"
     CDS             498977..>499222
                     /locus_tag="LDBPK_301490"
                     /codon_start=1
                     /product="ama1 protein, putative"
                     /protein_id="XP_003862862.1"
                     /db_xref="GeneID:13385569"
                     /db_xref="UniProtKB/TrEMBL:E9BLP2"
                     /translation="MWCPQFFCSLLLCASFTVLILFTLPSPSCCLPLPFRLIPAPPPS
                     LPDAVAALEELLLRLLSSPHCFFLFLIDRSLLWPPFPP"
     gap             499225..503776
                     /estimated_length=4552
     gap             503907..504005
                     /estimated_length=99
     gap             504451..504549
                     /estimated_length=99
     gene            <511843..>516246
                     /locus_tag="LDBPK_301500"
                     /db_xref="GeneID:13385570"
     mRNA            <511843..>516246
                     /locus_tag="LDBPK_301500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862815.1"
                     /db_xref="GeneID:13385570"
     CDS             511843..516246
                     /locus_tag="LDBPK_301500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862863.1"
                     /db_xref="GeneID:13385570"
                     /db_xref="UniProtKB/TrEMBL:E9BLP3"
                     /translation="MQRLVCVPSYYGLTASGRALMRPSHSLLAYADSGACRTRRAVRH
                     HDSACDSSTANKDHEAVHLSHTRCQQRIGSFDRRPLLPPPLTPCSIGGTPFAYLLQRI
                     IVGKAEELSHMRREALEFLCNVAVGDSTTRRHGNATEEAKTRERRMREALLKVEQPAL
                     CSSLQQKENPRLTVCLQRPEGHVCVPAVVGETYLFLRSQGVDVTAWWERYYTAFIRPS
                     TVEHPSSEGMIVTAAADARGVKRVAASPVTADCSPDAEWNGATPPPPLYWKLDRGLRH
                     TFSTYATASHRGDVFAVPLPSFEEPAPCWVAPAKTQTDASERGSDGVPASTSATAAAL
                     ASPPTRQSVWIPVWLIRHLPFFPIPFPSANAEGEPRRGRSAEMRYNDAAFASADSPLT
                     SHDPDSCMAEENERVLLQRDGEPETTEADCLLSRQDAVSRTNASDDAPLEVNGADMRA
                     CTSWHTAQTFTSTPRLPTHAQQDQLDKEWGHPFFDGLHSVSDIGNWSPRHATLTTSSG
                     NHGTVAHDIISVQALWHQRVRESSTFALDLEFSTGCPPTTATTTTGALSGAATAEWPS
                     PLFSWKLRSTHWRTLSSFWATKADPASSLAADYSFPLDAYPLLRYRSFLRARAGHTAI
                     STCKPHLHPFSEGSILNRLEKDTTSQKWIRYPFRPCGAAQQRTHWNAQPPAHSWIGEE
                     GPLDRMPPTAAAGGAPYTSKVSVAAQHASVFHVLQRKSCVERVAFFGVHYVSVDATAL
                     SCLFDSTVCVRHAVPLGVTGAVFKAGLRSTRYRQQHSCLPDGQQRMLTVEDDQSGAYA
                     ATHRFSNRRTEPRLPLFAAAMKKLEAAEAAAAAPVNPQDKAAATPGGGGELGSTAGAA
                     PWLARLRAIRNERERGKCEPQASQMERVVKMRTSHRSVFFLFQSPYWVEVAELYERWG
                     VRVAPGTVPLLICGKPYVNAEQTTDASRFSPNTCVPHLMQEVLFSKGLEACTWAGSQC
                     LLSLIAPGAAPRPRPGGACAWTYRTLCERAAAVQRVSNLWIAESVIERFKWTLRTAPA
                     PPRPDMSDSSGLGGPEGGRDEVLRAVLPLHDIESSKFQETLRDELHSEVLHRHFHERI
                     DSPQHADSCKNTATSSTPRSTSQNTPTRVAFFTPSRPPPPPCEPPVVEGVPFPSLSRR
                     TAQPHVCVVHSSCVAEQAELTFVAAFSPVVLLLRVPDLTSRDWGFDTWEAAKRRAATA
                     SRTVETRVTGSVNDGDGVGSRAGARAERPLSSYKDLDVEVGDEDDQAFDASLADDGAS
                     AAGSEALLEKRARLMYMKAMRRKRLLYAAPWRSTRLSFESRLDLSHLALRKGYSAENA
                     NRWVSLDFLRDEPRVRAARTDMVAPKVDTQGVGEPQIPRPNFASDPAVAASSAERQAK
                     TSSRSRSITGIRVDVLFYSQDEPGGSSGLSANGGYIEYDHGMCSHDNCATDDCSGVTR
                     VMKIALVNYEELEWPESVVSSSKQQWVWKNL"
     gene            <519442..>523077
                     /locus_tag="LDBPK_301510"
                     /db_xref="GeneID:13385571"
     mRNA            <519442..>523077
                     /locus_tag="LDBPK_301510"
                     /product="kinesin, putative"
                     /transcript_id="XM_003862816.1"
                     /db_xref="GeneID:13385571"
     CDS             519442..523077
                     /locus_tag="LDBPK_301510"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003862864.1"
                     /db_xref="GeneID:13385571"
                     /db_xref="GOA:E9BLP4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BLP4"
                     /translation="MSEQRITVAVRIRPPIGHERYEPVCARKADDDQTITINAEETSA
                     SVSGVSVFQFDYVFDETDDQVAVYEESVQEMVDHALSGFSATVFTYGQTGSGKTYTIL
                     GSKSADGKVTEGSGAFMRVFDDLFTYKEAVKDRTHIVIALSALELYVEDVMDLLMDKK
                     KLKLRDTPEETITVGINTVEVHTMADVERNFDVANSFRSVTATKMNDTSSRSHALFFI
                     DIFQIPVEKSPQAPKVSQLIDETGMSLSKGVAGVTKSRIALVDLAGSERVKRSGATGQ
                     AMVEAQAINKSLSTLGTVINAMYLQNPHIPFRESKLTKLLKPCFVDTTSRLLLIGQVA
                     PPSNSASESLGTLRFCDRVKGLKAGQVMGFTDPAAEQAFLQSRRVNEELLAEMHILQA
                     QYYYEAVSVRRLAAAKSVPVDQERQRIVAELQAGAADVVARKEREMLEKAERKAIAQR
                     DAAVESFVLHMNSLIEEYEQVAHTVKREKKAQKKLREEQEAEHEVRLHEAKKAKKHRL
                     KLQEAVAEARQNLEALDRELEALDRQIEVVGKENAAGVIDGVDDDAASPNKAIDRAVE
                     EATHGLVESFYNHATEQSRLYSMFVSRLAATRRERSRVRRMKLMSSTLVTDGTLLYDL
                     IAFLIDRAVDVSEGDLPLGAKWGWHDVDGLSQRLLCADEMYPPLLPSAWEPLHEEAKP
                     CLEQPHSITFLSSDESDGEHSHHAAESRRIRQIRDAAAAKVENLNALHADGEDDKQHE
                     TSSGGGSDGDGHDGKESSEDSAGTPAPHAHESDWMNGQLLGRTPPQDAALAVVNTVED
                     APPLSTKACAPRKRKDGAAAATVTSPSNGNGDASTSGAAAASATRSPEDRPGRHGKSK
                     GVPAAVTAVSEGSSSDEPGDESSGTESSASPSESDSEDESPEEAAAAKGAAHKAQKKE
                     AHEAAREGRGAEEDALPVGAPNPSYQEKDSRALMKVYDSPTLVQDLIRFLRSGTRMLK
                     HCRRGKPHERIFWVSTQRGKKELFWKEPDSRSVDYSCIQLSDVSFIQLGCFGKVFSRH
                     RIPPNDPAFFRAFTIGLKHGGRTVDIVAETLPDYEAWVVGLSHLVGVDPFWGGKIDLT
                     MEVGTDRLTYFESSVCEANYIHPLEYLELKKRVQHVAARTIQVLEESGQDTARAQAIL
                     GGIHPPAVNSNCAVYMTKGELRFLLPETFDIIRVSRLWMLFQQMNLVYDDNFAPATAF
                     GITVRES"
     gene            <526998..>527519
                     /locus_tag="LDBPK_301520"
                     /db_xref="GeneID:13385572"
     mRNA            <526998..>527519
                     /locus_tag="LDBPK_301520"
                     /product="p1/s1 nuclease"
                     /transcript_id="XM_003862817.1"
                     /db_xref="GeneID:13385572"
     CDS             526998..>527519
                     /locus_tag="LDBPK_301520"
                     /codon_start=1
                     /product="p1/s1 nuclease"
                     /protein_id="XP_003862865.1"
                     /db_xref="GeneID:13385572"
                     /db_xref="GOA:E9BLP5"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:E9BLP5"
                     /translation="MPALVGLRLPLTVLCLLVLSSALCVTEALGWGCVGHMLLAEIAR
                     RQLDDKNKEKIDAMAEVFAQSGPFPSSPDMVQAACWADDVKRWRQYAMATWHFFAAPY
                     NPENINITDAIDTVNAVTVSLDMISALKNTKAPLYMLNFAWANLVHIFGDLHQPLHTI
                     SRYSSEYPHGDNGG"
     gap             527520..527618
                     /estimated_length=99
     gap             528781..528879
                     /estimated_length=99
     gap             529956..530054
                     /estimated_length=99
     gene            <531394..>532755
                     /locus_tag="LDBPK_301530"
                     /db_xref="GeneID:13385573"
     mRNA            <531394..>532755
                     /locus_tag="LDBPK_301530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862818.1"
                     /db_xref="GeneID:13385573"
     CDS             531394..532755
                     /locus_tag="LDBPK_301530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862866.1"
                     /db_xref="GeneID:13385573"
                     /db_xref="GOA:E9BLP6"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BLP6"
                     /translation="MLVLSKPPGIRMDGDETIYGRTVESLVCEHMKARGIFDDTHEQL
                     QKEKKRKKQLKFVHQLDFGTSGVLCLAFTKDMAARLAHCFEMRTVRKYYVALLHGHLP
                     SDTAPTEDGASSDQPGSTFTSDTKARRSSFAAWANACNKAWEGLGCVRAVCSASTSGE
                     SSANSAGGDEVAGFRYLLQRPRKTAWEAVGLANSKDAEEGVPVTVVHRYHSRRSGAPS
                     LSTSAPENPASVPADVVEDLIYRTLLESTATRSVVFVDLPVGYDLTGPEHLRMAVTAE
                     QSRDAKTSLLVLKRTYLAEPPPAGGEAPQRDAIAKDSPSVTSYPVTLVLLAPHTGRRH
                     QLRVHCRAIGFPIVGDTSYCADLPWCAALPLGSSTSTWAAAGARRMYLHAWRLLLPGT
                     VTPRLDEVERVALKKKRRREILGLSGQHDASFSASRCEWTEFVASVDFTGLDLEDSED
                     REM"
     gene            <533581..>536754
                     /locus_tag="LDBPK_301540"
                     /db_xref="GeneID:13385574"
     mRNA            <533581..>536754
                     /locus_tag="LDBPK_301540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862819.1"
                     /db_xref="GeneID:13385574"
     CDS             533581..536754
                     /locus_tag="LDBPK_301540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862867.1"
                     /db_xref="GeneID:13385574"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLP7"
                     /translation="MLHEVYAPRTVADVAWSRQKIVTLSTVIQQARGRGKALSSAAPH
                     IVLLYGPPGCGKLETLKVLLCEDAALVDAPVLATHSTSHAGPGATWQLAQSHSTSFHI
                     FHTCEATVPAYAQYLNSVVSYCRGQLGGGELQLPSLTESPASCMSSGGRSSSAGSRAG
                     TMAGSAGSTELSTNHAHIIKFYGEPASHALHRCTLLFLREYEELRAMAQHEEQEQGPL
                     LSSGTRVGRRLCLMQHLRRNLIFFLHTTHDTHNDKLDLSTSFPSTLLQSPAVELFHCT
                     PITEINLRKRLQSILDVEVQRHAQKRRWAASTAAMSCFDNSLSSSSTVPPSASLTSAR
                     RTTKAKRKASTPTSAAAIATATACTASSSIDLIDPETLNAIVAGSQGDIRQALLQVQW
                     LCLMPASNSQVPAAHQSGESVEGAWSQAAQAAATIWMRLEKQRLAARQGVVAASAGVA
                     DARVLSLSGTTDVGLSIYASHSTPCVSPAKPASKASGVVHREGKDEDGEIDSERESDV
                     VEEVSSKGSGETVHIFSSAEFTSFPEPQTSRNGDDNTHAKVGGAASRKRPRQPSSPPA
                     VNMLSLLDSQMERMQAMADVDGQRRRGPKSRAGRFAHRGAAPPASATGSQQRSVLPMT
                     RDEYLGLSHAIGRLLTQKYCIDEVLGTLNVPPRKILDYLTNNQIRYFGDDQLPQYARC
                     IDAASDADALRASELSGSFAGVPNAAALRERRQLADRTTAGENLGNMGRLLESIALQL
                     FHLTYRAIQTEVRPPPGFVAQEPPPYLRLAYPRLRDISYSAMPYSMRRGEDRTEADPA
                     AYISEREWVQQALARLESVPAVGARGSSASYGSDSNRRRRFDAGAGGGSSSHATLTPR
                     IQAEEVDVLREGLPDLLYRCGSTEAVLLDYYALAPYILLTVSPPLPLQSSHAERIPAS
                     AALASLSQACEGTNTTAQSRGVHIAPDAPSLPSCSPGTSTMLTTAPRRTVFRFASSSL
                     SASAPPLPVPSAHSVNKRPCLRPCTPLQMAILQRGRNPATAQLRSDLFVLSTDGVGDR
                     TAGAATEGSAERPLIPPGDEIEDIDED"
     gene            <538128..>539099
                     /locus_tag="LDBPK_301550"
                     /db_xref="GeneID:13385575"
     mRNA            <538128..>539099
                     /locus_tag="LDBPK_301550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862820.1"
                     /db_xref="GeneID:13385575"
     CDS             538128..539099
                     /locus_tag="LDBPK_301550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862868.1"
                     /db_xref="GeneID:13385575"
                     /db_xref="GOA:E9BLP8"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:E9BLP8"
                     /translation="MASPESPQTSLPSEEKYPSVHLLLLITGSVAAIKTGLLLDQLST
                     ERCNIRIAATKAAFHFLRRAQPSKTGIPFQSIITDEQEWSEWQAMNDAVVHIELRRWA
                     DLVVIAPLNANTLAKVATGLCDNLVSSVMRAWEVKQKPVILCPAMNTAMWTHPITAKQ
                     LNQLAEWYCDPDARSCTSCTNMIKTSFPVGDSCASPSRAVVKESAETNGREAEDSATT
                     AINTSSSSAAVTAGAVAAATARGPPLPVTLRESMYQVVGPESKRLACGDIGIGGMASV
                     EEIALHIRHTMKLIRDEKRRCFQEAPVRREAEAGGTQPVAHPPQETH"
     gene            540504..540602
                     /locus_tag="LDBPK_301560"
                     /pseudo
                     /db_xref="GeneID:13385576"
     misc_feature    540504..540602
                     /locus_tag="LDBPK_301560"
                     /pseudo
                     /db_xref="GeneID:13385576"
                     /db_xref="PSEUDO:CBZ36177.1"
     gene            <542381..>543880
                     /locus_tag="LDBPK_301570"
                     /db_xref="GeneID:13385577"
     mRNA            <542381..>543880
                     /locus_tag="LDBPK_301570"
                     /product="pseudouridine synthase A-like protein, putative"
                     /transcript_id="XM_003862821.1"
                     /db_xref="GeneID:13385577"
     CDS             542381..543880
                     /locus_tag="LDBPK_301570"
                     /codon_start=1
                     /product="pseudouridine synthase A-like protein, putative"
                     /protein_id="XP_003862869.1"
                     /db_xref="GeneID:13385577"
                     /db_xref="GOA:E9BLQ0"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ0"
                     /translation="MASSSTADDHSAVAGTVASSASVCGSREAAALPPTALLKLGSTK
                     KQRTERAFLFDRYPSRKIALRLAYHGHVHDGLAKQKETDNTVEGLVCDALRRLRLIPE
                     DGPHNFGRCGRTDKGVSALGNALSLTARASCTADAEPQLPPLDYCSMLNNVLPSTIRI
                     VGCALVDDAFDARFSCVHRTYRYYFFHRGLNLEAMQEAAAFFLGTHNFRNFCKMDVVN
                     VSNFVRTVFSVGLHPSEALPELISYLEIRANSFLYHQIRCIMEVLFLVGRGLEVPSVV
                     QTLLERGDRKPTYPLADGTPLVLWDCGFDNVQWQMSHCAFHAMEQELQDISTALLIRA
                     TSAAAMRSQLFRWYTGTADMFRKDTLEKSDTSGEGRSRAVAWRDPELRRLDMWSITGC
                     DWTDPGTAGQIKARKRDLLYYLRTEANKGQPLSTTTSCEEKTSQTAETIASAPLAPVN
                     YVPLLQRETERTYEEEVRELSGKKRARYEVNEAKKAAAAAAHKEVVSED"
     gene            <545088..>550154
                     /locus_tag="LDBPK_301580"
                     /db_xref="GeneID:13385578"
     mRNA            <545088..>550154
                     /locus_tag="LDBPK_301580"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862822.1"
                     /db_xref="GeneID:13385578"
     CDS             545088..550154
                     /locus_tag="LDBPK_301580"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862870.1"
                     /db_xref="GeneID:13385578"
                     /db_xref="GOA:E9BLQ1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ1"
                     /translation="MASTETVWDGACLLLATDVAGVLHCYQYTTEKVSDGSTDNDDER
                     VAVLTHLWSHSLGDEDVPSELVAAADGGTSPTASSIAASAKAERDARAGFKCALSKRL
                     RLLEPASTMLARWAAAEGPRASGEHRDISSASPKSGFTEGHSRVNGGDADGACDTAAR
                     GTREGKIDGIPPVAAAHHFGLQAIGASCPFCKRVSFSSSSPSPAFTSPYSPCTPRFTS
                     TSAATATQKPTCATTSATTSLLCSSTAGRAAIVRRRSEVREETVGDRRVSDASGDNFF
                     RPCDFMARIPEAAYSGFNASAKARPAAAAGSITPVDLAAPTVGCASSQLAEVAWYWRC
                     PRCVVDARATPDGGGSDAKRASHRYFVSEEEAGQLSRDDTAMETGDLAEVAATAHLWM
                     PLPEAVRHWNAVCCHHHRLLLLRHMEEGYIELDLFTGASLDSIYMKADMKVAVSAEML
                     DSTSSFDISAHSIYSSVSDGSGTEVSHDSCASISDANGDGLPRAVLSLTTQRYETLIM
                     QATVSRSSAKVTKGRKTRKETMTAPIQKAAHTCLAKLAAPAIQLGLTWHAPRQRVRKD
                     LSFSDADDEAVVERQQGEAELLATSQVPAVLSFSSVSSENTLHHGSTSASDIDMDVMA
                     GRKQLPPQYHFLRAVSPAPSSSAISATSPRGIRNEPTKWSREKPARPKYAGTDRSAES
                     SAGREAVPNEIPVRCGPGGCVYRAVSATLDSFTAAGNGDSAPLQFLLLLQLPLPLVEA
                     FWVTLPSSSASGCSQNGGDAAFRRRAGERSMSAVELRRVPWLPRDACSLRVVEVAAGA
                     PISASSASKARTTLRGFVLEASEVPSARRAMSTGLPRVLRALSAYDVFSARRATVRSA
                     WLARDRRGDCGPFSASSDAGERERAAEAAAAPEHRNGTRAVHTKSFSTPFPYESKETS
                     SSITHIISSPPRHYIPAASFFDENFEPLMLLGRGVGGAVLLARHRFTGVFYAIKVLVA
                     RDYDSERDILQEVRIHAMLENRHLVRYHTCWSEVISATRAQQLAFIGVCHPYEANLGR
                     CKRLNSASSSMPMTTRQSARDGASHSPTNSDGDMLNRSQSRGAPGGWRHLILPSLSSM
                     MLVGSDSTSGAVTPEKTPMRSHPQLRGDGRRRLIVDGFADDLTDDDGDAMPVGQAEKR
                     QGAADDCLRHSGKGISPPTKIGSQPSRRPLTFSSTASPSAWGTRASLTAHRLRKQLPI
                     TSVLSPGTSSAASNSVSGTTVQGVADSEGEDLESIWDDAQGSDSDRSEGSGDSYGSSQ
                     RPEENTIIGTRVVFLQMELCQGTLAQYLASRTSIDRVENLIIAMQVVAGLRYLHHRGI
                     LHRDVKPTNVFMNYRCQYHKEVHQTNLSSTSGADDGSEDEDDTRSFWGFPGSATSHSG
                     ASAAWHGDRGNEACAPSPSSTLTLCRRHPSSCPPTLASSGCGPSVSCAPRRSSMVPPG
                     MQELFRAASSLTSDWKAETTMTSLDNLPSWDGERAALDFVMHPPHRTATEMLQERLLR
                     RPPPPAARQRASSKCKLMKEEMTAADATMPLVQSDGGRHFLRRLASWLLRRFVQVQLG
                     DLGLAKFLYQQELRVDGFVSMNAINTIGVGSPLYASPEQLKGNRCTPASDAFSVGVVL
                     AEMYLQPKTTAERLTVLREVREGVYRDKVLLAQFPELKLVRRLTEAQPECRMTLAAVH
                     KALRSFLEQALQDELYRHYE"
     gene            <551001..>552248
                     /locus_tag="LDBPK_301590"
                     /db_xref="GeneID:13385579"
     mRNA            <551001..>552248
                     /locus_tag="LDBPK_301590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862823.1"
                     /db_xref="GeneID:13385579"
     CDS             551001..552248
                     /locus_tag="LDBPK_301590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862871.1"
                     /db_xref="GeneID:13385579"
                     /db_xref="InterPro:IPR014903"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ2"
                     /translation="MWRWVSLGGWCGPSLMLSKLGLRPAEESLPFDMVRCTFDGLVEL
                     TANGFSSSVRPTPPVSPANPAASVSATPGVGRYNFSPAQEDGYFPQASRIPSAPSPSD
                     AAGTAAPPCFAPDPVNVWLLFRSQHACFTHYDLNNTDVQAEFRRRIRAWEALLAPENA
                     GAAGHERVRPVTFIRTVIAENPAEELEMLPQFHQAVRERTRGRLPFRTVLVVHDQADT
                     TRPLCAMPQESKVHGSPCIVWNLRRQRPARTSSSSSAVDSTGATSAATEAPSLLDECH
                     DGYQTILTTMSKNAKWRSLDASLPAYETYIHSRKAPFTPYTELSRVDGVPAVRGTCTG
                     FGSTFSAALGRCVHCGCTDGHAVSAERYDKHQEWEEEDVNELLLNYALHHCDEVAAVE
                     ATARRQKRGAHETWQKLRVLLSD"
     gene            <553191..>555731
                     /locus_tag="LDBPK_301600"
                     /db_xref="GeneID:13385580"
     mRNA            <553191..>555731
                     /locus_tag="LDBPK_301600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862824.1"
                     /db_xref="GeneID:13385580"
     CDS             553191..555731
                     /locus_tag="LDBPK_301600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862872.1"
                     /db_xref="GeneID:13385580"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ3"
                     /translation="MTATPAPRVFLASWLEKKMEWRFVYEHRYFILDGTRLSYRLEEH
                     GAEKKFGTIISFDPWREGLRDDTSKGYCFTVWLLEGGSWELRAATREIYDSWLHALLT
                     VLVPSDSTSAVQSESGGMPSSREASVTADVAATPGGPSSGHLESESLGCSRKAGAVGE
                     RGDTINSASPTQAEPADASRKTPGASPVAEGATLTAASIAAAMNASNTVSVSNDVLLS
                     SMVEKETAWRGRWKPRYMELLEGRHLVIRSSATSKTERQHYVIEAVDPSPLVGQEVWL
                     LFTASNGDRFWVRYGSVEECQRWYTVCRRLLHAECSWHWLPLAENDAGRSLRLRQATS
                     GDYSDLQLHYHSATVVPSFQKGTWCPSLYIFGGSDRWCKQLFNPQARAFLPHAESAHT
                     TNQLCTLELTGPHVMQLWKPAPYEEGPHALVRPLSRYGATLTCIPVEVPPSSARNDSP
                     QQTIGARVVLFGGLSGGGYQPPATELWSVWRSAVACAEDVEMQWNRHDLPPYELPMLA
                     FHDAVCVPWRCAAAKSSSDPHKRHHTDGGFLLVTGGLDVEYRCRAECYAVVWNDADLT
                     EADEQLRPTDSATKDNLEERARLAKPVAFAFGQLPEPRAFHRMAVIEDGTVVLVGGRG
                     VENAAVDHPVLTLAPEVWRRASKAWRDVATAATAPPESDVNGTEPRSENQCRRTSGED
                     EADAGATDDADASSSQWLAASFDCSTTPTLSTALRAVAALPNEMGDVAVAATEHGNRV
                     VVMGQVSQPRQDVKLYLLDLEPVVAPTSNGRRRGSRGISAGQQLPAGTRRARCQEVVL
                     FVGAVPNRVVGITLHVYNDYLFVIGGCMVDKSKSEPYKLCGPLRILLE"
     gene            557773..557864
                     /locus_tag="LDBPK_30snoRNA4"
                     /db_xref="GeneID:13385581"
     ncRNA           557773..557864
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_30snoRNA4"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966734.1"
                     /db_xref="GeneID:13385581"
     gene            557987..558051
                     /locus_tag="LDBPK_30snoRNA5"
                     /db_xref="GeneID:13385804"
     ncRNA           557987..558051
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_30snoRNA5"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966735.1"
                     /db_xref="GeneID:13385804"
     gene            <559334..>560482
                     /locus_tag="LDBPK_301610"
                     /db_xref="GeneID:13385805"
     mRNA            <559334..>560482
                     /locus_tag="LDBPK_301610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862825.1"
                     /db_xref="GeneID:13385805"
     CDS             559334..560482
                     /locus_tag="LDBPK_301610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862873.1"
                     /db_xref="GeneID:13385805"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ4"
                     /translation="MLCCSAGRAAAVAVLAAILCVSVLAAPPASAEAAVPNSAARTVP
                     PFEQFFAQSFQVSVMTQSSGVFNATLRMRASPNFPERVQGELIPIGEAKLNSQRQTLL
                     PHFQRTRSLEDDRLSALSCSMAAGFGRTNRKKKGSTDESGSGEFAVAGKEERPSLLMV
                     DLHLRHSDAMQGTASVYYLPADLMALRAQREGIKEGSAPPSATVEFEFRSEVDHMSGN
                     PLSDVQALAHVSSAVVTMGGQSGASKSSSVAGEKVDDGSAAATRQGGIIFRWITEHEF
                     SAYVTIPITDKTGATSTHMEQIWVYGYAVPSKSVFDRKQRELPLHNRYMMFGVGLLGF
                     FVQVVSGITEGKRRAQEAADLEAKAQGLEKAKLEAPLLERERNSKKKK"
     gene            <561335..>562933
                     /locus_tag="LDBPK_301620"
                     /db_xref="GeneID:13385582"
     mRNA            <561335..>562933
                     /locus_tag="LDBPK_301620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862826.1"
                     /db_xref="GeneID:13385582"
     CDS             561335..562933
                     /locus_tag="LDBPK_301620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862874.1"
                     /db_xref="GeneID:13385582"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ5"
                     /translation="MSGDPLALVVYAGQMATYVCEGGDVQPTYPILNSITEEVLRLLR
                     QEQCQTTAPDQSAPASASSAMHTSGDRTWLLKQQAQELRYHFLPLLLGRFVLLVVPLS
                     STASYREEWTRLCFDSHVRARRLVMLTDTVASAFACGMDSGVVVHASLSTVSMCRVEE
                     GCSTRYSNSHMGSLQMLCGVKLSLQLAEEWPKVANSVTTSNSTSVPALGPVKGAEVDT
                     AVEGDADKHLWSSGGGASVDLKNPAYRDTLVRAFGFKAYRDVIVRAQMEAQQHQAAMT
                     TSSKGKGKGGTRQRAPSLLDDLHQKYPRGVRRAPGQLEKLLARVVQGGPTTPASAAFL
                     EGGEPCVLAGEALAIPYVHALFDYLVKRCGDDVWAVVERERRARKRSLTASRPQHRSS
                     PSHHDHRDTMRKAESGAAHSGANGGSDEAATGTRRHNSSTSRSTSSGKDLSDEEEEGK
                     EESSFSSSSSYSSSGTSLPDRSDEDTWLRLQPTPLPAAPWWLPLLGGSIVSRLTDKDL
                     QRAVITAEEARETNGTMVHWRMLL"
     gap             564555..564653
                     /estimated_length=99
     gap             566130..566228
                     /estimated_length=99
     gene            <572069..>575023
                     /locus_tag="LDBPK_301630"
                     /db_xref="GeneID:13385583"
     mRNA            <572069..>575023
                     /locus_tag="LDBPK_301630"
                     /product="ferric reductase, putative"
                     /transcript_id="XM_003862827.1"
                     /db_xref="GeneID:13385583"
     CDS             572069..575023
                     /locus_tag="LDBPK_301630"
                     /codon_start=1
                     /product="ferric reductase, putative"
                     /protein_id="XP_003862875.1"
                     /db_xref="GeneID:13385583"
                     /db_xref="GOA:E9BLQ6"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ6"
                     /translation="MHRYASVILQAALGILYVATGVTLLVEWGGNPAQCAFIFCLGVD
                     KYPEAPRTRGEDFNVTLSVITFFVLVPAGLVLLYRVFTTVMLQRTAKVVRERDAASVA
                     AGAQASSSASGQSTGEETPSPGRGRGAIAAVATEANPMAKSERMWPFQARSRVKQVCR
                     LVGVLIGILVCAILSFWLPNDSRRFNSHRIASFARNGISRERRTTNMTVPEMPDAWLR
                     TGQIRFSDDLTLKLFPGNVFFYAYLLTTAIVVLVLRLTQRGRYWVQRRIPLCACFTYG
                     EAAFVAATALLSVMFFIYWLHDHNYKQTWTVTANESAQIEAPERWARGLGQLAILFLS
                     LLLLPVSRQSVVVSVLGVSRDGMLWFHRAVGYAMLAATVGHIVAFYVSYASFGYLMQN
                     LNTVTNRVCKKGVYDDYTVLVVTWTTWFLLISMGIFAFNLVRRRHYELFYYTHLAATY
                     MTLPAMVFHASAGWMYLLPGMTVFLSDQLVRLWQRSAVVRVVRARVIGDDTTELAFSV
                     PGRRDMRHVHPGQYVLVCVPELTALQWHPFTLINVVDEESAAVGSSKASTTGTVFYVH
                     VKSMGPKTWTGRLYDLVSRGEEITMAVEGPCGTPVDYRHYDNIVLVAGGIGATPCVSI
                     LGSLLRQCHALGHSGASPRVDFIWSTRSARHVKAVADMLQLPMRCGDVVRQPATRSAL
                     KKIDTCAAPDDITKDARLNTEIIQPADSLEQDEPLNDELSAVNEVVRIADDAAQNVFI
                     DVYVTRKTEQRHFSNGDACLGEQCPSKALLSARKGFVELDGKPLSCAGAIENAQNAVD
                     SASPWKQKAAAAMTPGLHGKADDAGEAEEMVFSNASMGSESEGFDSASADGCEDGIEG
                     ASESTAHKKERKTVVDTASATDQEGALVSNGLSKWSSSSVMKSGERLHDNSESSGSGC
                     VAVKVHLGRPDVDRLIREALKQPGSGVHKSSRLDRARTLLFVCGPNSLVRQVTSSGAQ
                     LGVAVHKEEFLF"
     gene            <578031..>580121
                     /locus_tag="LDBPK_301640"
                     /db_xref="GeneID:13385584"
     mRNA            <578031..>580121
                     /locus_tag="LDBPK_301640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862828.1"
                     /db_xref="GeneID:13385584"
     CDS             578031..580121
                     /locus_tag="LDBPK_301640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862876.1"
                     /db_xref="GeneID:13385584"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ7"
                     /translation="MRTAHPLRCLRRCHFVLARRGHGGTAQMQRELKRLALLEEFITQ
                     PAETRAQQAPATTAACTAAYLRELPQRVEQMRGIAATANGDQALPEHGVAGTSASATL
                     LTEHEESRRPSGEVSAPQVSTLSQFLSACKEHRVRYSSSADPALRKQGRDVFRSFWSR
                     HASSAVACCYESVRDLGFVADIGLADTGLHLGMRDMRGMLRVLQTNHAAASSLDTTRV
                     LGYLARELQYWESRKDSESDGSTAPAPVSLMAFRAALTDVALGRLASIFVQQRHCAES
                     FTRPRVKAAANVPASDDSVFPPAQASGADAVWGLEALSVLHARDATEGVLEDVWTGKQ
                     LCLLRQQREPAHLRSTPAFPDVPSATVPMSALATEVQHLLVSELFRVVAARRRDLRMT
                     DIVHAYALLRVHLRLLWPPYGRQPPPQPSRAARHHSRGCASVERDRSHAASTSAPATA
                     QRRPLWYEKDTLFRVTWGLAVALASKDRVFISGYHFVKIVAVLAKLPAFVLSQEPHVK
                     TELRRFELPHRGVAFRRDAAEDDAVSRFVCATIAAEVIRQEMAVEAGSKPPTAVALHP
                     SDFWRFIVAKACVFMPSLPPEQRRIVCRSLHLAITEKRAHLLPLHASATARSAPVLQS
                     ARRVRSDSIGRQFGSRTVSPDGSGAASASEILRPLVEEMEDYPEPYEACIKDHRPRSP
                     PPRVAPRRRPQWQR"
     gene            <581219..>581605
                     /locus_tag="LDBPK_301650"
                     /db_xref="GeneID:13385585"
     mRNA            <581219..>581605
                     /locus_tag="LDBPK_301650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862829.1"
                     /db_xref="GeneID:13385585"
     CDS             581219..581605
                     /locus_tag="LDBPK_301650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862877.1"
                     /db_xref="GeneID:13385585"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ8"
                     /translation="MLRCFNGSMLRPTRGAASLATATAPAAIALPARQFHSVYGIIGS
                     CLMCGACMLCFGSWANNYCNVKKYGRWRFRNSIDDVIMVSDFRGARYFGAFLGFLFWW
                     FVVGPQKYRWNSNLADIPGNTRIGPF"
     gene            <582895..>583347
                     /locus_tag="LDBPK_301660"
                     /db_xref="GeneID:13385586"
     mRNA            <582895..>583347
                     /locus_tag="LDBPK_301660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862830.1"
                     /db_xref="GeneID:13385586"
     CDS             582895..583347
                     /locus_tag="LDBPK_301660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862878.1"
                     /db_xref="GeneID:13385586"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:E9BLQ9"
                     /translation="MASAVADVNASAKQMTDKEITRHRVMARLSEIRTQPLKQLPMTV
                     FMMWMVGNEVSIFSIMFVGMAVVNPLQSILSAGKLFADFEEDTKTDRQIRSAVNQARW
                     IYIGCCLIAFLVALVKLNWMELLPVSSMDWMDNTPPTYQELSSGAFYR"
     gene            <584549..>585922
                     /locus_tag="LDBPK_301670"
                     /db_xref="GeneID:13385587"
     mRNA            <584549..>585922
                     /locus_tag="LDBPK_301670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862831.1"
                     /db_xref="GeneID:13385587"
     CDS             584549..585922
                     /locus_tag="LDBPK_301670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862879.1"
                     /db_xref="GeneID:13385587"
                     /db_xref="GOA:E9BLR0"
                     /db_xref="InterPro:IPR000397"
                     /db_xref="InterPro:IPR016153"
                     /db_xref="InterPro:IPR016154"
                     /db_xref="UniProtKB/TrEMBL:E9BLR0"
                     /translation="MHAFRTRDITLRVPSKDKLLRFSFCSARHLLAETIRRHDLLRST
                     RAHVGFLQLLGTQITFANLLASALEGEERVEARFTAEEATILTEALALGECRCYLRPE
                     YNAQLAECGLPTFPLRVNRILYRQEKPFSSVVHADLAELLQPPCGVASNSAAAATGAN
                     EASDAPFSLYLPGTERRVPLEAWKSFFSYNSSLHAYNYLRRSDGSVPAVWLQSRVDAA
                     RLMDHGFLNADGTAAAAAWKRGEACSDEDEEKKAQDIRRALLHAIPFSFGVVVTPLAA
                     GVAVDQRVNQLNRVVMESAALLSASPGGGATVTSALQPLLDRCAEKHTACQHILSLVS
                     GDHDGAYQAAVAARQYNDDPAQVAAVVDPIRRALGVQDFVVPLAAAEAARTGLDFFCR
                     CSKQNVLESLVSAPPRALESLKGSGNTVHCSFCGRRYKLAGAEWQELEMARSASTPPQ
                     RSQSLTE"
     gap             586204..586504
                     /estimated_length=301
     gene            <589144..>590034
                     /locus_tag="LDBPK_301680"
                     /db_xref="GeneID:13385588"
     mRNA            <589144..>590034
                     /locus_tag="LDBPK_301680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862832.1"
                     /db_xref="GeneID:13385588"
     CDS             589144..590034
                     /locus_tag="LDBPK_301680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862880.1"
                     /db_xref="GeneID:13385588"
                     /db_xref="GOA:E9BLR1"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BLR1"
                     /translation="MATAKVTEREAACVTALKGEYPASKADPADAGFLSDSTYLRFAR
                     ARDGNVERASELLGTTLKWRQQTKPYAITMEEVQNAMKQTTMYCGGRCNIGCPVIAMA
                     LGMQNDCTVEERTKQLVYIMEETQRKGYERITWIIDFGAMGNHRDERSKEARKETMKI
                     LQDYYPERMARILLYRTPWYIRMLLGVAKMFMDARTAAKVYNAGRTIEELEKFIDRDQ
                     VPPVCGGTMKGSALSHLEELPSLNSEEAQRPGHKQHTADADSANDGGLVTSNNTAGEE
                     PAAANGEAKRNDNIAATDAA"
     gene            <593981..>595039
                     /locus_tag="LDBPK_301690"
                     /db_xref="GeneID:13385589"
     mRNA            <593981..>595039
                     /locus_tag="LDBPK_301690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862833.1"
                     /db_xref="GeneID:13385589"
     CDS             593981..595039
                     /locus_tag="LDBPK_301690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862881.1"
                     /db_xref="GeneID:13385589"
                     /db_xref="UniProtKB/TrEMBL:E9BLR2"
                     /translation="MRPDGLCRRLVRTLFSILHFLFKERIMGKKPPSKKGSAGDVAMP
                     QPEETAAIAAASTLSPHTIRQRTWEKRVDGAVIEMRHVQQLLQKYTVEVNTVKRELEE
                     LTYTAAALWAANPDELPAQYKDRQQSSLQRANSPASAAGRSSDTTPTKRRGGPDATSP
                     SASLGGDALSGISEVALESVEQTLSQLSPAQRAKVSAALQSLFYAPPAAPSAEVMDGA
                     GVDFAADPPSTAVDGTAQQKPAPPAKSGKAAAAVADATATAATSDGKPSTPATVRRHC
                     IPPSLLLAMKELQARRINLEERLTRATNATAQQLQRFQLLQEELMVSQYGLDAARHDP
                     QKQAQPQQAPSEGVPEPS"
     gene            <596273..>598855
                     /locus_tag="LDBPK_301700"
                     /db_xref="GeneID:13385590"
     mRNA            <596273..>598855
                     /locus_tag="LDBPK_301700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862834.1"
                     /db_xref="GeneID:13385590"
     CDS             596273..598855
                     /locus_tag="LDBPK_301700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862882.1"
                     /db_xref="GeneID:13385590"
                     /db_xref="GOA:E9BLR3"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLR3"
                     /translation="MVHLCVWWRGAISAGVLGERVEQLVRLVADVQHPGEHNTASTCL
                     SSGARPSAGSHDVADVGQGSEDTPSSRRARLARFVKQRIVERSKRGSSPSAAAATAED
                     EEELSLDTFADMVGLTQQLLEQEGVLTTGTTGATETSSAQGMRTFELYDEKINNAEAL
                     KQRPILAVVMVLVLAVYASKIVARPELAARSVAHLEALEKMMVLGSSDGNRSGAATVA
                     LPRPTTSSPSTLAALWPLTGELEVALVHRQHEADAARCSSNEGEELRSTLQHMHEKRM
                     SLQQDSSAAKDATPSERWAAGASQYIGQRPIWAALRSHFLSAGVFDADKPTVLVFFGP
                     SGYGKSELAKRVASVLHGIPMPELEASGKMVYIHMPSFCTKDSIYSLVDPPAAHVGSG
                     ILLSALQKHPDAVVVLDEFEKSTAEAINNLWLSAFQKNGVLRSLKEASRSVSTVRATF
                     ILTCNIAAEGIAASERLYLNASPADQERIRALFQLQCKNVCQETMGDPFVNRVDHFFP
                     LMPYTRAERRQFVCLLLERLLTSQAEKGRTIYATPGFVDVMVERLHTFHAATLEVAVR
                     TQVVRMAHEGWTSGVLTVERRVAGGTVAVLLPATRSELMKHTTPASSCPASTTGGCTA
                     ARLSNDGSDDLADVGGRSLLVEAWESLPGGPQSLAQWAVAGGRDGRASRTADEDDTLS
                     PPKVTLAPSTDRRDTSLSSAAPSTTMLPTPTPSCAAPPAVSAPALEKEYKYECFTDKV
                     RILELQKELDTMRELLKQRDLEIDTLKDKILLLQRALALVLLSLLGCLFLMSLIIGLK
                     LTLLFALVIAGCLVFVLGVPLSFLLDAVRGLFHLLGPYKAGGLLLLLSAWLARASRSA
                     ASCS"
     gene            <599546..>600253
                     /locus_tag="LDBPK_301710"
                     /db_xref="GeneID:13385591"
     mRNA            <599546..>600253
                     /locus_tag="LDBPK_301710"
                     /product="small GTP-binding protein Rab28, putative"
                     /transcript_id="XM_003862835.1"
                     /db_xref="GeneID:13385591"
     CDS             599546..600253
                     /locus_tag="LDBPK_301710"
                     /codon_start=1
                     /product="small GTP-binding protein Rab28, putative"
                     /protein_id="XP_003862883.1"
                     /db_xref="GeneID:13385591"
                     /db_xref="GOA:E9BLR4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLR4"
                     /translation="MESGSDSSEEGAMQFKVVVLGNGAVGKTSLIRHFCDSGFTKSYK
                     QTIGVDFYSRKVQLPHSHPPVTLQLWDIGGQQIGGKMLANYIYGSHAVCLVYDITDLN
                     SFKDLGDWKECVDKVFADAPAVDKPKMVLVGNKVDLPNRQVTDENQAAFSKNFSMPHC
                     TVSAQSGERVNAMFTRIAATLAGVEMKQQDLDLADRVAANVVSRPEERQSAPRALVLQ
                     ATSNSQGKRKNGDCAVM"
     gene            <602125..>602496
                     /locus_tag="LDBPK_301720"
                     /db_xref="GeneID:13385592"
     mRNA            <602125..>602496
                     /locus_tag="LDBPK_301720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862836.1"
                     /db_xref="GeneID:13385592"
     CDS             602125..602496
                     /locus_tag="LDBPK_301720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862884.1"
                     /db_xref="GeneID:13385592"
                     /db_xref="UniProtKB/TrEMBL:E9BLR5"
                     /translation="MQAFNGDSAYEAVEVMVVDRGTQTVSTVGTQTDPLPMPYGAYYP
                     GPFAPSPYTGAGSYARWMPPSLPLPSYGVGVDEQPFRHHYHDYEQREAAEAAKLRGEL
                     EMIQNSIDMLIARYNLPPPPM"
     gene            <603077..>604252
                     /locus_tag="LDBPK_301730"
                     /db_xref="GeneID:13385593"
     mRNA            <603077..>604252
                     /locus_tag="LDBPK_301730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862837.1"
                     /db_xref="GeneID:13385593"
     CDS             603077..604252
                     /locus_tag="LDBPK_301730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862885.1"
                     /db_xref="GeneID:13385593"
                     /db_xref="UniProtKB/TrEMBL:E9BLR6"
                     /translation="MFSAKYYDDPFDDDDNDICYAEIVSDGGAAADAADARPRCTFAP
                     STVAFTSALRRTSETAKSGCGASTEIPLSTVYGSRSGSGQAENLEYEAHIEQLRAELK
                     ASNAENNRLTALQSKLESRVRSLSFGKENAERQLQQEKERNRVLADKVSALEEELELM
                     MARASSAAHHRGATPLETSSVHDSRSPEGPRPAAPRTQRRDPNTSIGQFMASGTPLEL
                     SRSLELSRSTARHAPSVDSSRSFHALEQLHHAQAAYAASRGGPHERQGGSMMTAALPP
                     TGLTSNEPQGAVPPPSSRQTLRSQRGATAVHETITAQEQTRSQQAAAVRQLEAQLLHH
                     SQQRDELTKQLERLERIRTRTVADRKKKAVVERQLEEEEKFIGQIRLELRSYSALMR"
     gap             604708..604806
                     /estimated_length=99
     gene            <605196..>606137
                     /locus_tag="LDBPK_301740"
                     /db_xref="GeneID:13385594"
     mRNA            <605196..>606137
                     /locus_tag="LDBPK_301740"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862838.1"
                     /db_xref="GeneID:13385594"
     CDS             605196..606137
                     /locus_tag="LDBPK_301740"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862886.1"
                     /db_xref="GeneID:13385594"
                     /db_xref="UniProtKB/TrEMBL:E9BLR7"
                     /translation="MNFAKGATPRKSLNSKRRNGAEKTTDVPKDAVKHSRTRVLHVSV
                     TDDTQIVSIPRDQEDPFDVWAVYSHVVYATKKEQRFLKRSLQSRIHESIVQCSNLFPL
                     TGNDQEGKQSTPTGNSSRRMNASFVSTLQAQGYGKSIAACAMCVLSVWPSLPVKNRPP
                     LSTKVQRSFEALQAGTHLYVFNEKPNSPLLCDTALRLLHSVDRDEVSVTIFNATERTV
                     IDGYIPLSFVVSLSFGLEPVERARHLNKTGTIKCSNGHQTTEETSKRAFTLHCSAPEL
                     FYVTFIAATQEDFNKWTCVIDYFVLLNSCYRAYLQSR"
     gene            <607016..>607363
                     /locus_tag="LDBPK_301750"
                     /db_xref="GeneID:13385595"
     mRNA            <607016..>607363
                     /locus_tag="LDBPK_301750"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862839.1"
                     /db_xref="GeneID:13385595"
     CDS             607016..607363
                     /locus_tag="LDBPK_301750"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862887.1"
                     /db_xref="GeneID:13385595"
                     /db_xref="UniProtKB/TrEMBL:E9BLR8"
                     /translation="MYFIILRKLYRILSRTNKRSSKPNRIKRSSASIPDSKDSVADLV
                     STPRTVDIAFLTDTAEYAPSKNQMIVGDGVIVINRNDRYVEVYERKNVAKVGSVEAEV
                     KALLKEFAARNNR"
     gene            <608105..>613960
                     /locus_tag="LDBPK_301760"
                     /db_xref="GeneID:13385596"
     mRNA            <608105..>613960
                     /locus_tag="LDBPK_301760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862840.1"
                     /db_xref="GeneID:13385596"
     CDS             608105..613960
                     /locus_tag="LDBPK_301760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862888.1"
                     /db_xref="GeneID:13385596"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="UniProtKB/TrEMBL:E9BLR9"
                     /translation="MDSKPLGGPSGACEDFSSCSVSEVLWHSHWKARKNGYERVQKDP
                     IKYKKLLFDSLKYIANEGNATVQEAAIEALVIVLSECNDSERSQLAEGTLPIVVEKGI
                     TGRPKAVQLSQQFIFALVEAGSGAAVFAALLPALAHKAPKNRLAAAQTAASLVSDYGV
                     QHFPLKEILKAMQPLFNDANAQVRKEAIALCCQCYRYIGANIRGFLTDLREVQLQELQ
                     KQFESLKVGERPPKMIKGAERSSSDGKGGKNSLAAAKPIGSLTGEDTAAVDDAGFELL
                     EESLIIPRLPKKFFRVALDKETTWQDRVEYVNVHLVPLLAAPRFRAKDNYHELASMMK
                     EYLVDPQAPLMLLGFKMVQDCARGLRSDFSPHARLFVAPLLGKMKDKKVSVQLHVMKT
                     LEDLICFNCISMDQCNDDFEQALQSKNPTQRTVLLNYLIRMVDTLGDRSRYVKLGRSI
                     AMLTRAVNDEKASIRDVAYVLLDRLIRAFGEAQYKSVLEHLDDNQRHNMAAAVARGAP
                     TVGPRSVASRQASDLSISQSGGTTGTTPFNSPAKKIPRVEDSSAATAALARPPQARTI
                     SAPCATVVARRLSAFSREDGADADAEPRGTLALEPPRTSSLLRKSAPSHASGTERPSV
                     ARSCVAATRGSGAEQSSTRTNADDSIALESLLPSKMESLMMILGMLNGDNTVLDMVRS
                     REWARRQEGMNKLFVMVQQWTPAQTTRAMDYLVVYIRAHPSFREPTFQVFTLITQVFQ
                     VALAKAVTLTMAAGYAIVSGFTSRFAEPKNKPLVREVCGLIAQKLGQRFVVRHILDTA
                     AMIKTPKLLQEVCEYVREAVQHQPDSEEAERDAVDARGALHFVKTVCSDFNNAGVRQE
                     AALLLVALRRSPQASAAAVERCVASLQPPLPVLYERELNRSEGVSTFAGPLAPTRASV
                     ALPAGAPAPGAAAPTPPSPTQKRARTVSQSSGPGTRASVLAPSSPNRPSVHRRSLSDA
                     EASPDFHHRTSSPGGTGVATRLTSGHASSLRPLPRNSCSASAAPPGGLRSILHEITSG
                     EDWRDRLNGVRRAEAFVAEAPRPLPGHCAVALLKALQGRFEEANKNIIVDVLRFIPVV
                     VNAAGPEECRAALRQLTPGVLAMLGDQKAALREEARNVAFFAMNVVGLESLLPLLQRP
                     LSSDSNVCRQNVLEMMVSGFEQLPADATLPRVGMQLLTPAVIASIMDRLLDVRLVAEQ
                     VLGWMLGVVGEDIVMHSVQQLKPAEQQAVMPAVERQIEHRRRQAQEGRPEGQQDQLPS
                     TAKAGQPFSTVENGLLDNEESRRTTPRRATPRASSPATPRVANGGFTTPRRLSAAHIP
                     YDTRSAINTRQNGNRAGTPTLELAPKTRPAHKEAVGVTAAPSAPSTAASESGEATPAP
                     ASSNGPAARASAHPSRPSAASKAAVPAKTSPPSNASRTPTTSTDISPLADGNEELYTI
                     REILVGLRSATSDVALAMCKDFCRHLRAGVDCGTPEVVQVMVERLYENTQNFDSGLAQ
                     ALTECLAAMFMTPRCAMRCHSQLLFRMMGAFFDCLLSEKFSLHEPVIKALNVATLKLL
                     EGCPANDVFTALLSRLTTYSTIYLSTAQKADLKFLQVTVKCVMRVDLTKVSADTIILC
                     CHEYLLQHPPSAFRNLDDLPIRTVKTVLQTTTKRLGASLLTTAETLVGPQNLVTHFIR
                     ACLELRNKTAKERGQNEQQAIEESRHEQRASQSPTPLPAKEKTCSPLTPPNNTMASTS
                     VTSTAATAARTATPGTTATAATASVTPSKGTVTPSRRKKRVSHHADPNATPASSLNAT
                     TVASPGASCEGSFSPSAPACSVRAPLKAHSRLQAGAAAGQSAPESSTANSSIVVTPSK
                     VTPQGVLNGPASSSQANAPTASPRDIKRDLTEIFAHIRNHVTSSSGIDELYSFLKDLP
                     PSSYEEAFRVHFNRCSEAFRLYIKRKLERKVEEDPTKPVSFKLPAVIQHLS"
     gap             614622..614675
                     /estimated_length=54
     gene            <618976..>620064
                     /locus_tag="LDBPK_301770"
                     /db_xref="GeneID:13385597"
     mRNA            <618976..>620064
                     /locus_tag="LDBPK_301770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862841.1"
                     /db_xref="GeneID:13385597"
     CDS             618976..620064
                     /locus_tag="LDBPK_301770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862889.1"
                     /db_xref="GeneID:13385597"
                     /db_xref="GOA:E9BLS0"
                     /db_xref="InterPro:IPR022088"
                     /db_xref="UniProtKB/TrEMBL:E9BLS0"
                     /translation="MENTAASAVLGGQLMVNNPNDERIEVRNAENVKTPRTSLGPSYA
                     PEADASRGGGGMGQPIENAPHDEAIPVSPSASQVATPMAMRTGQTMRPDDDDDEREDE
                     DEEDEEETEIDEGREYRAEGYAGQKPTELAEAAPVMQVGDPQLGYNPAKYARINATAS
                     REMQDLFKQIMEYEPFAAELPAKLRPFVPDYIPTVGDLDPFVKVPRPDGIPDGLGLEI
                     VDEPAIPQSNPAVVLLELNATNAHGVAADIVDSLENAANRPEVIDRWISDIKKVHYKK
                     ALPTVNYQRPMPDIETLMQVWPQQFEEVLNSDVAFPPSQINLDLDQYVRTLCAILDIP
                     TYSSLIDSLHVMFTLYEEFRSNQHFQHV"
     gene            <622035..>623915
                     /locus_tag="LDBPK_301780"
                     /db_xref="GeneID:13385598"
     mRNA            <622035..>623915
                     /locus_tag="LDBPK_301780"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862842.1"
                     /db_xref="GeneID:13385598"
     CDS             622035..623915
                     /locus_tag="LDBPK_301780"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862890.1"
                     /db_xref="GeneID:13385598"
                     /db_xref="GOA:E9BLS1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BLS1"
                     /translation="MAHLFFTGACAAAAVLPTSDREEVSPVWSIYDDYCCSASQNAEV
                     NDPQVEGGGVGNCGGTALPRLPLISGPVPSMTLKGAQLKKEAPIRRGAQGAVYSALDV
                     ATSAPAEDENAKGLFSQEACRGHEGEEQVADGGQRPARRGRRVAVKRIFIQASDFGAR
                     DISATVLREVTLHRFVSEKQAACLAAAGTSYSTASASDATARAEDDQGQALCNLIDDS
                     ARVIHLYRVVEAPHKEMCLVMELAATNLEQVVFPHGARGAQRGDGAGGYMRKPGVVSL
                     FGSSASIGVGGGLGLSSASLSTAPDAATADAGPQASPPSPPPSRMPLVRYVMRRLLRL
                     VCFLHETCRVVHRDLKLSNVLVSKDAGLRLGDFGSARFIPPLRSATKTGCENSPSVLK
                     PPAAPAGQREHLLCTPPSIRTTLHYRPPEALLGDQVCRTAADVWALGVIFAQLLLQKG
                     LFRSESELDLLGGIQKLLGMPTYSAPPSWLGAPSVPGPPRDRESAAHIPAPQASLPYK
                     FHAGVVPADGLDLLSRMLHQQPECRITAREALQHPFLNLEGLSALATHDDDERGRVLW
                     EERVATVLREQATGPIYGMGRGERRPMLISLADNEDEEDQEDDEDGAAPFCVDLGGCT
                     SY"
     gene            <627633..>629855
                     /locus_tag="LDBPK_301790"
                     /db_xref="GeneID:13385599"
     mRNA            <627633..>629855
                     /locus_tag="LDBPK_301790"
                     /product="DNAJ domain protein, putative"
                     /transcript_id="XM_003862843.1"
                     /db_xref="GeneID:13385599"
     CDS             627633..629855
                     /locus_tag="LDBPK_301790"
                     /codon_start=1
                     /product="DNAJ domain protein, putative"
                     /protein_id="XP_003862891.1"
                     /db_xref="GeneID:13385599"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BLS2"
                     /translation="MGAGAASVAPEPTGGPEASPRSVRSNTLYAVLNVSHTATLEEIT
                     AAYRKLALVYHPDRPNGLQWKFQEIQRAYEVLSQKDARAKYDILLRGKLAMQNFKRPP
                     PLESVLQPVYALLADGAFYEFEAAPSKLKCSFHYGDGIQFNSDCGSFIGLAGDGFIYW
                     TISGRGFASRLCKAGSTFALSSVRVMYRSNMGLLKMPLKRSSLRSSHTSRPAGSAGGK
                     RAVRGSTGDAGPSERASSATCARAAKTSEADRIKKALLNKERSRNLKRRMEMLKEEET
                     EERNYLQQDLWGQFSSLHTTAEAAFRCTLQGAAVPVEMALWMGYKSPEEVMLRSSDAC
                     SSPLLAEQVSLQASSLWVDPLQSDYYSDDEMLREACDGNKEDSRHCINNGGDVAARHK
                     PDSADSSPCSSQPRPTSDAAPDGDAFRGRSATAPESHSPILHRFNNGAAAVSGTSDGA
                     EVAEKQIVASPSTPPPCPISPIESSGEAAPLHPTSDSYVPPTSQPSCAANVPVAKLAA
                     QEEAPLTGLQSNRQPHSSGLYTSAESGEPASSSLGVSSRAIGKTVKAVARAKRGVVMS
                     DSAAALPSRNVGVKDERSLRAGSKAATVSSDASPQKVSVTGTPAGEFSKDRKACPPLP
                     RRKNNGGGVGDAMLPVRLGPILQEKPERSAKGNNAVLSNKNPVPKEKEQTRPRWMMAT
                     EAYARRANLPLEKSLNATTQSSSFCHEASRAYNSLTADQLFEEERAFMESFSKTKRII
                     "
     gene            <632881..>634290
                     /locus_tag="LDBPK_301800"
                     /db_xref="GeneID:13385600"
     mRNA            <632881..>634290
                     /locus_tag="LDBPK_301800"
                     /product="queuine tRNA-ribosyltransferase, putative"
                     /transcript_id="XM_003862844.1"
                     /db_xref="GeneID:13385600"
     CDS             632881..634290
                     /locus_tag="LDBPK_301800"
                     /codon_start=1
                     /product="queuine tRNA-ribosyltransferase, putative"
                     /protein_id="XP_003862892.1"
                     /db_xref="GeneID:13385600"
                     /db_xref="GOA:E9BLS3"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="UniProtKB/TrEMBL:E9BLS3"
                     /translation="MPPSSIFTFEEYRGPDGKQPVAARSGVFHLPHGPLRTPIFMPVA
                     TQGALKGVTVEQLEELDVEIILGNTYHLGLRPGEEVLRALTARKNAREAATGTRTSAD
                     GIRDNMDGIHFMENWRKNILTDSGGFQMVSLLKLAQITEEGVRFQSTHGSGTAGAVAS
                     VAKTAALSSASGATAAASAATAPTDAANGHDNEGEAENTYSLLLRPEDSIRIQNAIGG
                     DIMMQLDDVVHTLTVGPRVEEAAKRSIRWLDRCLAANQNREKQCIFGIVQGALNAELR
                     RYCVKEIIQRAECMGYAIGGLSGGEAKDDFWRMVRLCTKEGLPANKPRYCMGVGYPED
                     ILVCIALGVDMFDCVYACRTARFGSALTSSGKLQLSKKEYAADFGPLDPNCSCMTCRT
                     YTRSYLNMIAAKEGTAATLLSYHNIAYLIGLTRGARSAIEEGRFTEYVQNFFLAYYPT
                     KEYPAWVVEALASVEITLL"
     gene            <636252..>652931
                     /locus_tag="LDBPK_301810"
                     /db_xref="GeneID:13385601"
     mRNA            <636252..>652931
                     /locus_tag="LDBPK_301810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862845.1"
                     /db_xref="GeneID:13385601"
     CDS             636252..652931
                     /locus_tag="LDBPK_301810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862893.1"
                     /db_xref="GeneID:13385601"
                     /db_xref="GOA:E9BLS4"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLS4"
                     /translation="MRSSSPETNVRKAAVSTFSGPSSAPLTRLQKRFSSHAASAGREK
                     AAALPAGIAAAVVGTSASFAATGSSLRKRSASKVGLAPHRPANAKCDSVVRVPPTHRQ
                     TNKWSAGTATLDALSTRQSPHAASACSPSFPFDVYPTQIFFDLFAANRTYTATLELRN
                     HTTANTHVRVDRPSSCSGFELSAPHGAESSSKVAPGLSVIYTVVFSPTSNLKDYETQL
                     VVRAESGEAITVPVRAYASRGQLQLPAALTLREAPVKGTSCTPLFLRNTSEQSCAWRA
                     MVFDVSSVASEAMAKDTSYSPSSHFSITPSYGVVESLCGGGDGTAVTVAPVTLHFHPH
                     PSMAAASTFGAVLRFFLGPEGDVVQDVQLSAQAVELTGIALEQTVVTLADTYVTTERQ
                     TVVRLRNDSDNTVHFAWKSSYRGSRESDGDDDGSVAGDDAEFGGDGAASGGMTGSCAE
                     KRMSDLTATADSSVYNGSSGGDGRQHQLHQPFHDYSTMRDDYTGDEAFRIEPLSGVLY
                     GHGVREFTITFNPSVAVLYESIAFLDVTGLENRLPLTLRGHGLGPQCTLEYSRLEIGD
                     VYLNALHEYEVSMENISSIECQYVIMPPLPVLPASAAAATTAEPATSTSLTDFSSKFR
                     FTPSHGTLGPGEIVKLRIELQSDRIGSFSEVFRVHMQGAVEEVPLLLKGRVLGPHFQC
                     SVEELVFGNVSYNMTHQRTMQIANTSPIPMHYTLRMPDECTYADDLIISPATGVIAPM
                     ATQTVTVTLHSCTVGNYDTALLVEVADVGDVLEAIPLKATCMVPPLFTNATELSFGGV
                     FVGYPSTLNVAVLNNSALTGMFEFALVGGGALSDVVAVELPVSAEHEDGVHWISPHQT
                     MQMPVTMTALRPGKLHFSIALRVLGMDPAVAPPQTILVSAVASGTHVEMQPSTFQFGT
                     VDVLRAEVKELTLKNTSPVPAPFSLVFDRYGGLPATASSAAAASVAAEATLPFPREPV
                     FTVEPAGGVLEPHSTLTVRIRAKPDEAMVFSDTLRLCHSPASHSAAAAEETAVAVGNK
                     PTVTVKVAGKGIPIVSERPVADVKLGDVLTTALVAETITLHNYGRREQEVQWQSTHNA
                     KTKERDLPPAFSYKPERSVIPAGGALTFTLSGGSDEPGVRTETFTLKQSGTFKEILRS
                     TVSATFTVPTLSCSTRAIHFDFANTEQLQALDAPSAASLVKSLTMKNITSKTLAVSLR
                     IRHAATASSSPSPPPAGASSAAANGVPFELEGPSTITFAPGDSYVVGIRCNPLYRRDF
                     TSHTTKATVQFSFAHHARKEHVSLSATLRFPALVMNPSARLEFGSVLRNTEKRRTIVL
                     SNPSADLPARFEWALQPQPGNSATAAPKAAGEGDVKAAEAQYTGDKSALRTIKAGDEA
                     AAAAARCFDIVPYTGMLLPGESRSINVTYQGAECGTALATAVCRVHGGPTYTVVVHAT
                     SSVVQARCDRTEINFGRLPFYESATQSVMLSNSTLVPVTWDVDLRSIRHPECVHVSPV
                     SGELREKARLLITFTPTVPDAFEETLWVRIGHLDPQPIHLRGSGYMNRLMITTTSSTA
                     SAVENEVVVYRAPFSAFTEALQYVESRLASSQLRSVYASRSVTPLTTTLATAASASES
                     ASNAPAPPTWVQREWPTLEAERLAFCRAVCEAQASEHRCSVSPNGAIGPPLFLAPHAL
                     RRNSVTAVCSKDGTGAGTHKFVLARYVVDFGHLTRHDMRKVTLRLTNPSATEVVSAML
                     DSKELEHLPVSAVPMKGIKVGPLETTTLTLVMDATKPESLVRHGQNRYEFAIDVKHGP
                     AIVVECRCYVATPTLRTAEKEVRFGPVLLGKVKVLPLVLTNPEAVPCPWRVTCKEEAS
                     SDMTASTAPRGHWLRDEQSYTPAGLVAAEPRGSIRSRRAAPASQFWVKKDHGVVEASG
                     TTTIAVYFAPNCIAAEDGMGASEDRGSAPATATLRFRCGKGSAESVLTVKLIGSAFQY
                     KVSLSTTQLQLPVVRPHQVVHESVTLTNNEEHPVEVYSLDLDTQHMHEIKLLRRAIEV
                     NPDHEIFLPHLEAGSRLPDALLESIFARLHAASESLKEAPPAADLEAAEEALVGAPAA
                     ACKGAKTSRGQSVSAASRASSSNSKGGRREKGKSGHQSAAAASGGIEKGLHSELAAAD
                     DIAGQDQGAIDGCTAASMAKPSVVLLVGPPCSGKTTLAKQMVEWADAGSVIHVDVDEV
                     IRREADRDDTADGAVARFLLSQLADRQLKSVPVTADDAAATGDAVAASYIACAPKLVR
                     DALEGHLNRCIADHATHSAAGAASLVESRDFAASKPRKLLFLFDGLGCTVLQNPWRLF
                     ELLKETCDALHIPLQIVSLAVSTPMSGVRRAEALEAHHAARATAASLTLLSEAAFEAL
                     DKEAREDYTRRLKHFNDCRRDLRAAQQLKRNYMAQLPHKTVQQETEEAFTKAQMDLQQ
                     ALALESTMRSARKGKAAAGAGRGAAQAAEGAKKLRELKWSDLDAATQFREWYTRFLTK
                     YGTPPKPEGGDDSAIGAATARASAAGPPLKGAAAVAAAAAAEERANCWAAVVRVSAET
                     ETPSEVARVVELQLVQGDTETSSHTGAATTTLALPTLSPPLTTVVVATSSSAASGEGQ
                     LSVSARETDAPPAASSMAAVVESSHSPATAAAVAATSAIGEWLYLNKRRLRFWGNEAL
                     GGSRGVASVLGRPSSGEEVLAAKASTAVPTVAGVAETHTPLDAAGLPFATDAFHAGSA
                     AVTREARYVHFFSTLEREVIPAKKSCGRGKTVPAVVQQEEELTRWWLPPKSSVTLTLE
                     FCGDHVGPYTEKCLFGVVGTLQQLGLTVSTTVALSDISRDPKDIFPVIKARGMSISGG
                     VEAGQRASKVYIPSRKLFDFGPLLIPPPPVPKSRRRSIEKVGTGSSSSIGGSGRSGNA
                     GGGNYIHSSKAPFQHDGTLGEETLTFVNREASEAEVTLSFLNEKEKTFVVTPTSFVLK
                     PGASQQVSLRATPEKVGDFTNTLLACIKDNPLPWRTDVTCMGARPTLTVNGCKDLEVN
                     FGRLVLNRSVTKSFSLVNEGPLPLQWRLVPVLDGMTTRGPGGGGSGVGGAASGAAAAA
                     AAQLPTELQCSALEGVIEEGGTYTLNMTFAPTHPCFYTRSMLFTVSYPGHPHQVLYES
                     LPVIIKAEGYDVVLEWTREIHLGVLHVGEEKHDTIRILNKSPYEVGYQLKLPKRLQKS
                     VTLSSPSGTLRGMVGFKDAAVVNIDIVARLEKEGELPAKLSLIEVAFFDVDRKELLYP
                     VQSIPVTGEAWYTKYAVQPPSVSFGSCLIGQPRESTFELRNTGVFPLEYVLFNYRDAA
                     AEGSANENVADASTAGGAAVAAAPALHAPSAGAKNQIKAAKGSEMDVIVGAFKCSPCR
                     GIIPVGGAQIITVSTVPRKQSRTRETIGVRVVQSGPELERYGTPVEVSAYPALPSIAA
                     DLTSSADVETIFEEQRVVYRLDQLAKGVCAYSKEERVFSFGTTLVGQRSEERFRIANS
                     SPLPCTIVAHLEGASVTGTSGNSGSGNAARGNASVASSGNKPVTGGGGGGGASAAAGG
                     AGKVEGFDLSLDGSGASPAQTRMTTVKMVLPPYESRFLTIGFTPGSLRRFQAQIVAVA
                     ESAAISSDDMAEAGQELRFGLCGEGTLPSVEVEVPPRLSSSAVPWGSSGGRKSSGACA
                     GSMERMHRRTESGGSTSSNERKRGLRRSGGGSGGSTSPSVYGSADGYSTSSGVAEVLE
                     LPLAHVGAVASRSFTLRNIGCVTAKVHLELMTPGGDDYGTPNSALKITTRGGTGGTAV
                     KKQRGALAHHRAELFVPAGQSEVVELTYAPTQVETTTTRMRVLLRDNPFEEKEVHILA
                     YSFDSPISFDGIDPSSPDHYDIGDCWIGVDKSCTFTVRNNTDSLVRYDWQYPDAVVRM
                     VPSVGHLSAGATRTITVVVRSESQNLNQVARCTIQVQSIQLLTNALGGGLVHSSIGDG
                     GAASGGTGSGATPVSGATNAAITEWDNSMQSPKWVLREDDTAASAIAAGAHSAAATAA
                     LLSTAASMVGRRNLKQVLEPLPEPPYAVVDAVNVMQSLTLRYHCSVPAYQCQLVDAAT
                     GAVTDLKAISFEQTYLMQKRVAIVRVINTGSVGLPLTYDIATSGEEDGAPTRTASQQN
                     LKSPHARRGDSGALAAGVVSGASLFTPAVEGDAGALHESPGYTAPTADFAVVPSPTSR
                     AASTIPVGTHLDLHVEFTPRAVGLIMAELILSMRHSDPAEMRVPLQGVAECPLVHFNV
                     PPTTYSDTRSMAGISGAAYRGQGTVVVEFLARGLHTKATVKFPVMNPTATTYSYEWVE
                     EGMGRGASANGGASGGSVSPFRCLTPMGTIAAGRQAEATFEFYADTLGVRESAWSFQI
                     PGRAAIPFVLVGTAVEPNVYFHASKVIFGHVQVGTQVEQTVVLENCDDVPFSFSWDKF
                     SMEGTSSFLSVRPLRGTIAPHERLLVTVTFSPQDEVEYNVPLRCTVKRSSVPLSINVK
                     GVGVSVHDSLQVEPIEDGAEPTLMVRGQPLFLNLDRVQVNSTVERRFALRNTGAYPFQ
                     YSVEAPENSSVSVEGMEGKIAAKQTGVIVFRYHPTCEETLKQCRLLFRIEGKVAYKVG
                     IKATAYMPRLQLSFDHYDFGPRFILAYNNGSATAASGVAMTVLQLTNLESEVVSVDCS
                     VSAHNVWCRLDSTTLVVRPKESARLRLTFVPPEARQYNDNLRLCFNALHTVLVPITGE
                     GVVPRVEVVNPFAKLGIVRIGETRQMEVKLMCLSKIPTPISFAQSIDDDLLQKGFSVS
                     LPERTPAAAAAATPLAIMLKPKESATVVLSFAPTQRMGEFSREVKMLVCGVEVPFLSV
                     SGSCADAEVHLDTSALSFRDVVVGASASRRVSILNSGDISQKFSWLSSLQKLRPQGEW
                     SIFPSSGYVRAHTELSCELRYTPSLPSRGNTKAAAAPASSALMQQILTVELDSSPGIS
                     LTIESNCVTRPAATETVHFACRARETDVKMIEVYNPTEETWTTEPVLDNSLWTCPAQL
                     TLKPKAKSMLTVTYQPVRPTSTAAAAAAAKFYSNASNDLVTDVLSSKDKATLFIPLPD
                     GTGRCVALEGIAEAAGSAGPVQEYDGVVQVSLPLYFQIRNWSTTEIARFRREVEWNSV
                     TRTGDNDSGQLSERISTLIHVEGDDVGDGGRKGTSSARSGRPSNRSGTAPKAPPAQNA
                     IEVPPGASRESVLTVTPLCEGVYKGTVRFVPVDGPSDAAAADVVQFYDFVIRVRPVEV
                     SVPTTVDLHAALRELASFAIPLTNPLSKPAVFKLEVGAADGTASPTTAAASAAPETFT
                     FPPTVTVPAHTHAEALVQFFPLIPKPPATVRCTVTSTELGSTTVYDFRLLNTCDVAAP
                     ERMTRLVCPLGQHTNFVLRFKHYSKTNTEFSIRVSGETLGKGTATFTRVGAGGGGSQA
                     AVVKVNACPQPPATSTSLVSKGQDVAVEFSYEPSELGEAVETIEFVSPVAGTYTFPIV
                     ANCTLPERQGPFVARLGQNVQLPFKNVFSEPVAVTVTSDSPFFVPSRKTETIAAHKTA
                     NVIVHCKPEDGVEVIRGRVTITCVPPGKPAPNQTQQPIQWVYYVEAANSSDRSSSVKQ
                     SKAKK"
     gene            <654914..>656779
                     /locus_tag="LDBPK_301820"
                     /db_xref="GeneID:13385602"
     mRNA            <654914..>656779
                     /locus_tag="LDBPK_301820"
                     /product="splicing factor 3a, putative"
                     /transcript_id="XM_003862846.1"
                     /db_xref="GeneID:13385602"
     CDS             654914..656779
                     /locus_tag="LDBPK_301820"
                     /codon_start=1
                     /product="splicing factor 3a, putative"
                     /protein_id="XP_003862894.1"
                     /db_xref="GeneID:13385602"
                     /db_xref="GOA:E9BLS5"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:E9BLS5"
                     /translation="MQTNVLERIRALEADIERCIDSIVQQDLFAASIENERHRILLDH
                     FTLQQVGIVRSTAEKLLDVYLDEDDIVQVQNAPAESPDDIAAAVKEFEAKIADIREYH
                     HIYRDLPPVKDELAVPSPRLLDDVFTVHERYGACFDMDAHYNRYSAFMVHTKTLAEGC
                     ATASAEVKKELAPLSPSSVLKWSSMWPGRLDFFSFTKALPQLLLHEVEAHRKIVGFAL
                     YKPFVAELLAYLEGFYRRIHPLKPAALERLMADVESDAEKYWASLVEAKAEVTSVTAA
                     AAASTEDEQVDVQNVEDERAEERETGGAAASSSNGQTAAPARIAVENKVACGLAIPPS
                     LRQQVKKFSLWPLPLIEKLIEDVGQASGTSDGAAASTSKYPTSVTDVKTVCLMEAKAA
                     ALLQSLLYTTLETTNKSLLRDYSRTLEELENDREVAEQEFLDSLEEVRKNSADTMEGT
                     VAHAAEYNLKLALEDSKGSRRGRHGKASAPAPVSPAPAAPELPLEEEEEQLIGENGEP
                     IPRWLAQLHQLDKMFRCDVCGGTIYKGPKVFREHFGAERHAEGLRRLGVMHRLKSYEG
                     ITSIRQVVEMRERLTGGESGFRKRLRDNTDNEEIQDARGHVVTAKEYLRLQQRRR"
     gene            <657745..>660213
                     /locus_tag="LDBPK_301830"
                     /db_xref="GeneID:13385603"
     mRNA            <657745..>660213
                     /locus_tag="LDBPK_301830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862847.1"
                     /db_xref="GeneID:13385603"
     CDS             657745..660213
                     /locus_tag="LDBPK_301830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862895.1"
                     /db_xref="GeneID:13385603"
                     /db_xref="UniProtKB/TrEMBL:E9BLS6"
                     /translation="MSQSSLASSTASGCASTPSSTGSAAVLAAWPLSSATDMEDTTAT
                     ASATTSASASSLTDGDADASAPPVLHDDVWSLAALLSDPSTVTTTIAAAADAPYQAPE
                     ALPSLQPLPSIDTAQLRGFISNATGTVSTSCAMPLQTVLPALISPSHDDPGDMLAAPR
                     SSPPRAPSSAASSSVASDASTSQHGVASSLSTIALAPSPESPVPFVPVVAADQAHHSE
                     IPGPSPAGALSTTSASSPLSQPRTTADATRIVACDYAEPTTREERFRLGLSPSIEGAV
                     TSPAIRGAAASPRVQSATHSLSATPLTLDATLASTPEEDKVAVPLPRAGNGDHCVAGG
                     GVLLGTTEARVALDDTAIAEPALSLSSVAVKVNAGAGPQAEGGASFEAPKKTTPLLMR
                     PADAPRKLTIPTVSMNSDIGGARQDGNDDCRWLMVSVEPPVMQEPEKAPPASRKRRRA
                     ALAGPNRQPRRPAQGAGSEAKAAEEVEPARSLSAQPNSGLLHATAAAGEAICHAPTLI
                     KTYAPAAVSAAVQGSGGEEASDEKRLDVLRPPGVAHERDAGDMDVCAFTGSNTQEELP
                     GDAHQYGLRRVRADYGAQAETAEDSYQTEAPVVSCSGKEASVTSPPPSPVAAGASTAA
                     ARATATPLPGINLTTETPTPTAAVHNAKPKRGHRGAQGTAAASRKDSEPGALTKEAGA
                     PASFLPASSRPVLNLAGVNVQALLAEGTDPPPLYTRRQRRTRRRSTLAEDHPLFAEHR
                     DLWEHDTAGRILPRAPFASDADVLNSLTEWTDSPALVYAQLLWRYAPALFVNLAMHDS
                     DATPYVKVEPKVEADTRVKQEKME"
     gene            <663610..>667734
                     /locus_tag="LDBPK_301840"
                     /db_xref="GeneID:13385604"
     mRNA            <663610..>667734
                     /locus_tag="LDBPK_301840"
                     /product="phosphatidylinositol kinase, putative"
                     /transcript_id="XM_003862848.1"
                     /db_xref="GeneID:13385604"
     CDS             663610..667734
                     /locus_tag="LDBPK_301840"
                     /codon_start=1
                     /product="phosphatidylinositol kinase, putative"
                     /protein_id="XP_003862896.1"
                     /db_xref="GeneID:13385604"
                     /db_xref="GOA:E9BLS7"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9BLS7"
                     /translation="MSDAAAATAAAEAATTARTENPVAVCPATPPPTNCIGSVWLGVY
                     DRVSHTRFRIHIEDPVFLCILSNAVVPAAESDGSLPFEIQEFVEYLDAYERERLRQAY
                     AARRGPNNSGGAVGSGRCGVHGDPAAAAATAGSCGAGGAVSGSGAIYSGVSGIPSMCC
                     LNSCSPAGGPVPRKLEETLRETLSENSDFFFRVSSVAYHLDPNPQGASACTSASASAG
                     SGVMGNAGVGARSPRRGEGLASAAAGGVASLLTNTIAAASATGPPPRRNYSVHSGYSA
                     AFHLCGRLFADVYRDHCRALAQKIASGFSGLRVEDCVKFRKAVWSGFHLKALEPYRSG
                     ARSESNLELRWVSEKIKDDQHLFPSRGVAPQQQSSHVSRLVDATLSYVANARLRGRPS
                     SSVGGNANSSTGGNGAAGAGGAGAAGKGGGGAAARATVGSVAEENELNTFGLTKLLHN
                     PSWQKDDESSDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLA
                     KPGSSDEAEERLVCDTCYKEYETVSQLHYLGALFAFAGLGFSDLVLCRTVNEQWREAA
                     ELCISEYRLLLHNCDADLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLL
                     KFIATENLWVPDASYYFIWRLSSSVLNRADTVLTSLPSLSSSAASAVESKHHSFQLPV
                     VPNFSHWHLFCTAFCSKIGSSYFFVKCAELLCAAPTKVYDAYVASALERMTRVYLSTT
                     ALWKRLAEANQATAASFAARTSSPPTTAPLPLPMLSDVTEGQVVTVWLLDMLHKDALV
                     PAQRRRFQQLLEQVIPTVAGSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEV
                     GRKDPVARDRVVATLDFFHELDRFCAQSSVVSQTSVVGWIVAYCRRCTPKAPASATGA
                     PGEATTPSARRGYHHSYIDLPHPILNPFKPYIVLKSIRLSGVKVAPNAASKPTWLAFS
                     TWSAAEHLERDTTTAAKNFGGHTLPTGESHAERSGEGREKGTGAAPTYPSTKTSAPVT
                     SPVAAVNGVSPELLHDSLPQECMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEML
                     DYSVLPLSCDSGLIEKAEGRELSNLDNMDIASYVLQRGTRSCINFLASAKLFLLLNYI
                     FSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLARSTVRIDDAFLAAVEQCQQR
                     QCPCFAGPSPAAASSYARGCTSPPGSPGSGGCGSSASPTKAPEPSSAEIREAFFSSAA
                     EWFVHVRPFAAVFYELWLYAVHRHTVPYNDAEMLNMLNTLFDRHASQTSSASKFSTTM
                     KESVNVCRLKDVTHSSAEVLRTFADQVSRRVSESSVDAMKMMGSMWSSWWSRGG"
     gene            <669446..>670903
                     /locus_tag="LDBPK_301850"
                     /db_xref="GeneID:13385605"
     mRNA            <669446..>670903
                     /locus_tag="LDBPK_301850"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862849.1"
                     /db_xref="GeneID:13385605"
     CDS             669446..670903
                     /locus_tag="LDBPK_301850"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862897.1"
                     /db_xref="GeneID:13385605"
                     /db_xref="UniProtKB/TrEMBL:E9BLS8"
                     /translation="MTVRELAKGAMMRYILSLRRTAKEADAVVRRLCRSGIAVTDVYV
                     LVPSNAARSITLEDDETGNGGRTGEPPAHMIELLSNDCVVQVVQVMKETVHMRFRAGN
                     GASAKKRESSSVQAAAATEAQSTEETFNSISIAAPLAVVAVGGAACDGPTLPSGDEPI
                     KNAAAFGCASDAVSDTAQESSSTPVAARQSSKKTAHNVDSTGADSSSEEEEEKEAWQD
                     IARSIATLREREAQRIRWGPAAHKHFAANYVSSPEKIMLGRFKCGRRPPPVVQLHPTQ
                     TSSSASSQGSVSEVPSPRSSGDSRGTTETGGDRRPPRPVIAQEGSSKEHLRYQRHEAR
                     QSPQLPSKHYRCDTYSYPRSESSSIKRAHEVLTPSAATESQHLQVTAAPSVPAVEEMH
                     VATEVTTAERQQVSPSSARQDALLCSTETPVDAAARFGTPPGAPRTVAKPAVAVVARQ
                     LSFDDDGDTAPKRSPAVADYSAVTPLGGVRRVIQG"
     gene            <672271..>676089
                     /locus_tag="LDBPK_301860"
                     /db_xref="GeneID:13385606"
     mRNA            <672271..>676089
                     /locus_tag="LDBPK_301860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862850.1"
                     /db_xref="GeneID:13385606"
     CDS             672271..676089
                     /locus_tag="LDBPK_301860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862898.1"
                     /db_xref="GeneID:13385606"
                     /db_xref="UniProtKB/TrEMBL:E9BLS9"
                     /translation="MAVSRQCVRISLFQCAPLSDTSVHQARRASQADGKPEAKQPLFR
                     SRSADYRGDVLIPLASIASSSLQSVDQKTETVKLHQLRDGLEGRLSTYCVLHVPASRT
                     RSFVEEHRLSPLSVSLTPPAAGPSAPEDVQLILAADEEQSRSRCEGAPVCLPGEAQFR
                     CCASCSSSVVAEAAAISSKAPTVLGASSVPPEAASNTTSNAPWICINQLQRMMARSSD
                     ATSQTPSSSSLQSCFAPPATSLPMRSAEEWMLQQHDSTDVFLTSSEAESVGAVDAEDD
                     GAEGEVEGGACYAAFFSLTMLPAAERAKRLMLSLARSSAPAAGATTSKSPTVFTVRTH
                     HHTLRIGLPLRTSVGEADPSKTLQSPLTLREAIIDRLRLQRRVRVERLLDTKTGAAVL
                     PCESAPTLLAAQVVSLEVECRASLAARSKQEEGLTQRLAPRSPLEAQQQSSSTPTSAR
                     AGGPSTVTASDLLDHLASLRAHHHGDQYYYDDVDAYGWAERRTLISPSELASESELRL
                     TFTDSRGPSQMPRYSSTRPSTASSGAASSVVSLFADSSNSHRAQRPQDDGLCAVQTGP
                     PDGVGVTGSSAGTELPMSTENGTNLHEQYHNRGSKVSGDQCGSTVFSSMNGEEATAPL
                     SPVQGKLVGLRDSLCDMNDVFIYEDEETVVDVDAVGTGGRGDGISGNQRQERRSSLVW
                     STPVARGSGAGRMLSDTGFSATPLIYRTSARLSLSPPTSPVAVPGKAATTAMNEQPTQ
                     RMIFATSPSSTASLFRSLHSGTSVENEGVTAFGSGDDGDVTSAGEAHDGDVAEQGAGD
                     AIHKFLMSVVRASAASPASASSAMSTTDSSIASAPHSSNMSSSSLARSYHPSTPSCEA
                     TPSVRREGAAASSGEMLVAPLSLVDSASASALPSPSPHKTGHAAAPAHPDEQTTLIAP
                     CSTPPPSRRCTSEHEFRSYLHSLNPLATQNGSERASQGAPLVDAQRSTDGWNAQNGEK
                     AVCHGHDGGISSERKRARGRETMALDSTDARPMAVLRGEGEHAVTLFSSSTSAGGIED
                     DHSTNSSISTPSTTVAIRAVRMRSPIILSPGELSRMALNMAASDAIQIRPSYMKHPLA
                     RTVELDLDDASEVSEDMLSHYDYGGYIASYTAPGSDGREDLDRDDGRGHGSRHSSTCR
                     SHMARPTQHCQSMVLQPVSQSSRRQGAAPLVAATTTEEATATMDPAHHLDGTTRRRSL
                     SFPAPGLETWIRLTDDDSGGTESGADHHMLLTQRAIPAHTTRSTSSAESDGGGSASDE
                     DSNERDADHT"
     gap             676641..676739
                     /estimated_length=99
     gene            <677387..>677716
                     /locus_tag="LDBPK_301870"
                     /db_xref="GeneID:13385607"
     mRNA            <677387..>677716
                     /locus_tag="LDBPK_301870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862851.1"
                     /db_xref="GeneID:13385607"
     CDS             <677387..677716
                     /locus_tag="LDBPK_301870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862899.1"
                     /db_xref="GeneID:13385607"
                     /db_xref="UniProtKB/TrEMBL:E9BLT0"
                     /translation="RPSQLAAELLPPDQMWCTVCHQAVERRRFREHAAMLGHRLGRKK
                     MNKLKYVSLSMWERHRGASLDNESAHEGSIEQEFARYQADQRRREQVSVAAAWGPSRP
                     PSRGDLF"
     gene            <678469..>679011
                     /locus_tag="LDBPK_301880"
                     /db_xref="GeneID:13385608"
     mRNA            <678469..>679011
                     /locus_tag="LDBPK_301880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862852.1"
                     /db_xref="GeneID:13385608"
     CDS             678469..679011
                     /locus_tag="LDBPK_301880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862900.1"
                     /db_xref="GeneID:13385608"
                     /db_xref="GOA:E9BLT1"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLT1"
                     /translation="MEQPKGINILITGTPGTGKTSMAEMIAAELDGFQHVEVGKLVKE
                     NHFYTEYDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPERWFHMVVV
                     LHTSTEVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYEDDIVLVRENDTLEQM
                     AATVEEIRERVEVLKVERGL"
     gene            <680434..>683502
                     /locus_tag="LDBPK_301890"
                     /db_xref="GeneID:13385609"
     mRNA            <680434..>683502
                     /locus_tag="LDBPK_301890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862853.1"
                     /db_xref="GeneID:13385609"
     CDS             680434..683502
                     /locus_tag="LDBPK_301890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862901.1"
                     /db_xref="GeneID:13385609"
                     /db_xref="UniProtKB/TrEMBL:E9BLT2"
                     /translation="MPHAGNKLVPIGCNMNDAAYPFRGEHRLADCINHGHSGVVKRIP
                     TSIAMRISGSNLVIEEVKTPKGVELECELGVDGGIARPVSLQQASAFMVPGDGHDYNL
                     IATVKASGNPMKHYCKLTFNGSEGISVLRMRAPEGCSPDAVYIVADGRRLRPTAGWFR
                     IPIHTKECALVANLPLDGAPPPPPPPPPPPPPPFSFTATPPLPPAPSGGLAEKTLEAT
                     TGAPLTAGNVPELETRIHPPLIPNAGAVTLTEPVSAAMPSFVATAPGFSLQLTGENGS
                     SAFGVGVAALPLSHRRAQTVQIVVSDAQGRVLLRQRSHVPSLEPAAVSLALKDDGKGG
                     LALSANPGSKITVGGVPQADPSAAAVLPRVVPQRAVVEQPNADGSVSKATLDVAPTSG
                     PAPVSVAVSKQPPPPPQTLTLPEAWVKELSEALQNSNPDEQRRLVQNIYPSSIPGMTI
                     VNFVRDQLTRQPPAISFTVSSNGLEAVQCPGCSVTAAVGNDPARQIPAFGSVTLASGK
                     SALLTATSTLTHRAVSACRVQMALPSAVTFTSPTVSAYPPHAVAGPPMQAVPSADERA
                     DSDVVSRLVDCLLRHNLSAPLVAKELDSMSTAPFSAQGRRMLSLLTSCLRSATASGAA
                     AAMQAASTQAAAVAHAAPEEIFFTCGPGYVDNIYTTQPQYQLFGAVDDQAPQVVPQRG
                     RVPAQGTLEGEHKPFFIRITARDPTTGAVKVEKTVTVLGVRHEAKPTPAAVEAPPPAQ
                     VSYTAAPTAAETLPEAFAEEPLHRLGAAAAAAPAFMPEQQPPPDSAAAAIPYMDVSLQ
                     AVGQDVQARILCHPHLRIVCDVDGVGGNTGRSDFVAKMPATRFHQVNFSLIDLHGRVV
                     FQQKLGVPAMISPLWGLALQHNGLAVDPEVGALVTASIDRALERTLQGNFVSFDASAP
                     HFVHLRKYHDSIHGGAAGEVSLRLPGLTLPAELEEVTRIMRRRANGEASDPQIKTELE
                     QLRARCTAASVVELITSILDGWPATVSADARTSGRDSPSSRIFFRLTGTD"
     gene            <685286..>687103
                     /locus_tag="LDBPK_301900"
                     /db_xref="GeneID:13385610"
     mRNA            <685286..>687103
                     /locus_tag="LDBPK_301900"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862854.1"
                     /db_xref="GeneID:13385610"
     CDS             685286..687103
                     /locus_tag="LDBPK_301900"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862902.1"
                     /db_xref="GeneID:13385610"
                     /db_xref="UniProtKB/TrEMBL:E9BLT3"
                     /translation="MVSATATLHRSGSAGVFERLAGESRIGVTMLGKRVRQWAEGAGL
                     VLHPSSSAWHALLAYSTEPLRHERLWRQTCAKGRYRLSLLARAKAGDTTHFANTVQEH
                     KAAHRPSHADPRQEAMAHGQRGPARRRSLPSATPGGLSAYRRQQEYTLWCRWQLWHFF
                     EQGRRYLTSVWRVSPPLDCQRRHAVRCCGNIECRTTSPASSMSRIFDGRYVVPSAASI
                     DAAQEEHRALEKRVNVLLRLLRQENGPSAPTFAERSGNHEGAVNGAGMAACGAGAMAG
                     STVLDPDEEGAEDEERANVYHSVSQSRRISEAVAATQPYLDVRVDNTTGLMHLSLYVN
                     GDAGGNGAEFVDNSVAGCIDNHRWVILKGLWALQVLVFCFHREEELPSSTEKHADEYL
                     KRQGGYDEQTEQDASRRSQIVDGLVVKGVAFAKVKTGHTLATAQDTFACTRCGQTRRL
                     HNEVYISKKTGRIVCGMYYCVVCLARTHHVRLPPMKDIPPGLLGEREASVADVSWLHT
                     VRDVSPARCSASLSRFANTGLSDLLPSAYAHQCSMSSARAADAPQLPDEAAATAMREW
                     TRAAAAAPPPEWHPGGKVDSDELFGGTRGLDCPPPRPRM"
     gene            <689785..>690411
                     /locus_tag="LDBPK_301910"
                     /db_xref="GeneID:13385611"
     mRNA            <689785..>690411
                     /locus_tag="LDBPK_301910"
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /transcript_id="XM_003862855.1"
                     /db_xref="GeneID:13385611"
     CDS             689785..>690411
                     /locus_tag="LDBPK_301910"
                     /codon_start=1
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /protein_id="XP_003862903.1"
                     /db_xref="GeneID:13385611"
                     /db_xref="GOA:E9BLT4"
                     /db_xref="InterPro:IPR004163"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="InterPro:IPR012792"
                     /db_xref="UniProtKB/TrEMBL:E9BLT4"
                     /translation="MLRRTLFRFKPAILTAAEALQDVRDGATIALGGFGFCGFPFELL
                     EALNQRGTKQLTLIAGTTSGPENGTGPLARDRQLKKIITSYVGENSVLSDRLFHGEFE
                     IEFCPMGTLVDRLRAAGAGLPAFYTPTGYGTAVAEGRLPVRFAPGKAVRVAEYSQPRE
                     TRQFNGRWCTLEMALPADFAFVRAWKADKRGNLVFRGTTQNFNLASAKA"
     gap             690412..690698
                     /estimated_length=287
     gene            <694009..>694413
                     /locus_tag="LDBPK_301920"
                     /db_xref="GeneID:13385612"
     mRNA            <694009..>694413
                     /locus_tag="LDBPK_301920"
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /transcript_id="XM_003862856.1"
                     /db_xref="GeneID:13385612"
     CDS             694009..>694413
                     /locus_tag="LDBPK_301920"
                     /codon_start=1
                     /product="succinyl-coa:3-ketoacid-coenzyme a
                     transferase-like protein"
                     /protein_id="XP_003862904.1"
                     /db_xref="GeneID:13385612"
                     /db_xref="GOA:E9BLT5"
                     /db_xref="InterPro:IPR004163"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="UniProtKB/TrEMBL:E9BLT5"
                     /translation="MLRRTRRALRPMVMSAAESVQDIHDGATIAAGGFGFCGFPFELF
                     DAVNATKATNLTVIGATMGGVDSGFGPLARDGQLKKAITTYVGENPLFTKHLFHGEFE
                     IEFCPMGTLVDRLRAAGAGLPAFYTPTGYGTAV"
     gap             694414..694512
                     /estimated_length=99
     gap             695488..695586
                     /estimated_length=99
     gene            <698130..>701627
                     /locus_tag="LDBPK_301930"
                     /db_xref="GeneID:13385613"
     mRNA            <698130..>701627
                     /locus_tag="LDBPK_301930"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862857.1"
                     /db_xref="GeneID:13385613"
     CDS             698130..701627
                     /locus_tag="LDBPK_301930"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862905.1"
                     /db_xref="GeneID:13385613"
                     /db_xref="UniProtKB/TrEMBL:E9BLT6"
                     /translation="MHAERSLGEPKRQARFSPLPTSAPLLSFDVLEWIPSNSELLARL
                     PVGRAASEYPPDSRAPVACSEGRVHPRDCTAFESSCGSWTCFRTLSRCGDALVLEDAQ
                     LVDVGAARRHVLTWQQGPGRLPSDCVSTRYIGADIVPRDSLLANRRCEGSALPAQSRK
                     QEIPMQDIHSVRRHCFQKPVTLVFDARGHSISGRDRVDTTARDDRAKWVLAQRRHHRS
                     SGSEMGLTLQWRYELWGPVGVIFTLRGGRRIFLAFASTRHAEQIVELLTSFATGAELG
                     RRQPSYHSPHQSSTGASASFSQVPAWSVGDDIPFAASASGPQAAPLSSGALQRCASPS
                     CVSVHIASCEASLRGAPATPCSPRGDSAFSSAWAFGAHWLVPSTPAGPQTGEQRRKTG
                     SFTGENSPSPLTDTVAASQEVGGTLAASSRRGSSRVPGSGYLYCRPWGEASRYLRYYL
                     RVSTSAGRSHVVRFSRHRLRLWQRLRQVFGNEKRTVSLDMRRTSVCPSVAHENLLRVT
                     YLVESFAQYKSLQPLGGGVVSVGPMSDLAASRATPRRELELCAGHPVVFEALAKSPEE
                     RTSWLAWFRSRGATVQAPADAAQLGDYAGALRMPQKPVTFQQLGGEPLLVTSPASRPG
                     QEMLLSSTADQCASAWETPTFSAEAVASLKSLCSGSPHLPLKEQSEGRRGGFRTAAET
                     AAALRLSTPCRTYPSKAFPSLPGPLPAADEHASTQTRPQPPSAVASGMGDRQEEDEEL
                     TIVVEDDELDRTTACPEAAESHSPCYIMQSDPSVMDHTAAPLRRTSASLLLDEGARWL
                     RSGIGSAAEAPNSIAAANESSKADHKFANIRPTMAGPIAVPMYLEDTTSSEVSSHERL
                     NALPPQLPAKSKTSKIRPGANETPLDHTAAAQGAVGTPLFTMEVNNAGLHTPVSTANG
                     SATPAPLKASSTVVASASVLAEEHLDRCSSSSGVNTPSRASEPETAVFTTTALGSLVA
                     GLPQRMWQTPNRSSSPDATLDAAPPAALHSGAGKPARTSTKSSSASQAPPASSPGMMG
                     HQLRHKDARNRLAFENRKIRDTSASCSSAPSSRGRLGKGDGDTDGARISDASSSFSAL
                     DRGSVSSSSSAVDQRLSQFLEPCVNETSPGQVGGRYRGDGVSIGVPLTPFDLHLIPSR
                     EYRGNQATALRLQGEASAV"
     gene            <702848..>704449
                     /locus_tag="LDBPK_301940"
                     /db_xref="GeneID:13385614"
     mRNA            <702848..>704449
                     /locus_tag="LDBPK_301940"
                     /product="RNA pseudouridylate synthase-like protein"
                     /transcript_id="XM_003862858.1"
                     /db_xref="GeneID:13385614"
     CDS             702848..704449
                     /locus_tag="LDBPK_301940"
                     /codon_start=1
                     /product="RNA pseudouridylate synthase-like protein"
                     /protein_id="XP_003862906.1"
                     /db_xref="GeneID:13385614"
                     /db_xref="GOA:E9BLT7"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BLT7"
                     /translation="MPRELRYCRPRRDPDESLLAYLSTKFTYLAETQWRQHIAAGDIS
                     VNGETLTDGSYVLRQGDMLRFAPPRSFEPPVDSKHIEVLYEDSTLMVVTKNGNLPVAE
                     GGRYCENTLVEVLRRRGAAAFYTASTRTSFATTHEDTEKVSDTLTHAGKIAEASVRAE
                     GSTAMDACGKGAEIATSSPSRRRLEDGSHMTSAAGSAPCASVPLSETPTVQQRSPLDL
                     FTVQRLDKETSGVVVLAKNSFSARTLASRLEAQTKGCTDAVESRLRERGHAVALSSDT
                     FDELVRLKAQSVHKTYTAVLRGAAPEDHTFVVVNYMDCMAKHPTHSWEAQHTQLKKLK
                     MCCEPMKEILFSHAAASLPKPPKEQQMRWGKLAVTRIRVLASNRKLGLTCVQVELLTG
                     RSHQIRLHCAAVGYPVLGDKLYTTVTPGREGGATAVSDAVYLERVRREDDPFLPIDDD
                     VSGAGGTSRNGKMWCRRHLLHATWITFAHPDISPARLMTFMASPVPFFTADVRFECEE
                     DSSLFSQWLTRAVSRPLERAETSQS"
     gene            <705199..>706521
                     /locus_tag="LDBPK_301950"
                     /db_xref="GeneID:13385615"
     mRNA            <705199..>706521
                     /locus_tag="LDBPK_301950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862859.1"
                     /db_xref="GeneID:13385615"
     CDS             705199..706521
                     /locus_tag="LDBPK_301950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862907.1"
                     /db_xref="GeneID:13385615"
                     /db_xref="UniProtKB/TrEMBL:E9BLT8"
                     /translation="MSTMSSPRSEMSVSTALPETDESRLMFYAEVLMANVPSLIADLS
                     SAKYAFLSFSEKTRIEVKQKSALIQSIGRTFTSLQNSSKSLIAARQSLQECETKLVRA
                     APPTFVTSAEALHLSSARAHGDTTGAEQNGNASAEATAAEVRRLSAAAPDNVVILNEE
                     DIRPVREAEEAYEKESAVYTEIAKACNKMEDAFDHAHDQCRVMTEHVQDLKWKFDEVY
                     NGWKSAERERWVVRVMRDELEDRRAIMTEALLGIKAVEEECRAQEFRIIEGSIAHAQA
                     EADVIKAELQAKRSRYELELATYQIAYKEQQAEVESLREHCKLLRSHQRDLEILAKKQ
                     QLEEMDRNCLRKLMMATLTLTPSKYGKAEDRTLTSEQQMEVRNDHLLVSVLAARISIL
                     EEQRKTVGGLLASARGMGKSNDVSATVEQIRTLLEPEVQLDEDALTGD"
     gene            <708955..>710247
                     /locus_tag="LDBPK_301960"
                     /db_xref="GeneID:13385616"
     mRNA            <708955..>710247
                     /locus_tag="LDBPK_301960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862860.1"
                     /db_xref="GeneID:13385616"
     CDS             708955..710247
                     /locus_tag="LDBPK_301960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862908.1"
                     /db_xref="GeneID:13385616"
                     /db_xref="UniProtKB/TrEMBL:E9BLT9"
                     /translation="MEFPVFVASDVHGEKVNLALRYNPRTTTLDRFLSVASRCFDDVA
                     HLTRRGCLQPFSAAYIYRDVQCQWDVLEDCTQLSPFCQVYVFRQLFNEVVAAISDPLD
                     ASQLLSVHDRKADCATSCTGASFLAGSPPLNSSKSTSPIRVAANRWAVSQSRQHPETA
                     RPRFGVPSLLCKNDSPLVHATHPTKSERATHIGDEAEGFHHVRSADRAAAFRCVKSHR
                     FRMQILSPPVETQMHRQDAARNATSTSVHLAALAALGPQAAYVKPMRRHLSDSYNAPP
                     APSSSSAGEVAIPRSWYDSSRHSFPSTSPRARTPGQSPSQPLFVSACSGGTVLPFSPR
                     EGRSRALSQTDERHREMLAYSEARSGRGDSILREERARVAAHMLLGIDELRSHLREET
                     RQLKRTLSDLLHSRVSPLNRADDGTIYNASPPRMSVLW"
     gene            <710890..>711915
                     /locus_tag="LDBPK_301970"
                     /db_xref="GeneID:13385617"
     mRNA            <710890..>711915
                     /locus_tag="LDBPK_301970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862861.1"
                     /db_xref="GeneID:13385617"
     CDS             710890..711915
                     /locus_tag="LDBPK_301970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862909.1"
                     /db_xref="GeneID:13385617"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9BLU0"
                     /translation="MTEGLKESCKKILQRLQQQDVAEFGCILCSQHVRGQDALMQHLI
                     AEHQVHCLHFDNVVDLPRLLEHLSTLLHSHVTSPAQWVCPVCGEGTASDSAETLVRHM
                     RLAGHQHWNPHTIPSMAPWCVTGISAPTGPGNKALAATAMPATCAPSSPAPQGLGRGD
                     ADEEVTDSEWNDIEDEEVDEDEDWNLECVCLYCDYSGEDVLQHLRTHHNFDFRASVLR
                     RPDLHDEYDLIRVVNMVRRAVCSDRCPYGDECDVDGKQNNRAALEAHLALQKEHRLPR
                     RVSSSDADLIPVLPGDAFISMLVTSGEGFLQAEEEDPDFPMVPTVQELAAAASRAPHT
                     TKSLSST"
     gene            <712819..>713802
                     /locus_tag="LDBPK_301980"
                     /db_xref="GeneID:13385618"
     mRNA            <712819..>713802
                     /locus_tag="LDBPK_301980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862862.1"
                     /db_xref="GeneID:13385618"
     CDS             712819..713802
                     /locus_tag="LDBPK_301980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862910.1"
                     /db_xref="GeneID:13385618"
                     /db_xref="UniProtKB/TrEMBL:E9BLU1"
                     /translation="MQRGHRCTDRLLLTRRLRRLFARVHERQWLLHHHQSDASLSWFH
                     ASSRPLQALHHLRSLQTNLSKLAWAPASFAEEADGDSPQTKLEDRPRDRAPPHPAAPP
                     GDPPPFAHPAAPHLSFLMNASFLHETCLFLLLLRNPLPSSSLARLSSLSEREPLQVHS
                     HGTVAAETTHYILQNGLWCSCLPHSVEATWLRAATPAIDVQLELGSSTDPTTRHDQAP
                     DDSLDERGDAREAALARLCSHDYLEHLIWPTHAAGAVRPELAADCVWVDVSSVRSHAL
                     HSYNDAFWVPFSTSHSFAAWHRASLRATLDGQHAAASVEAWRWTGDLYICG"
     gene            <714699..>721181
                     /locus_tag="LDBPK_301990"
                     /db_xref="GeneID:13385619"
     mRNA            <714699..>721181
                     /locus_tag="LDBPK_301990"
                     /product="cyclosome subunit-like protein"
                     /transcript_id="XM_003862863.1"
                     /db_xref="GeneID:13385619"
     CDS             714699..721181
                     /locus_tag="LDBPK_301990"
                     /codon_start=1
                     /product="cyclosome subunit-like protein"
                     /protein_id="XP_003862911.1"
                     /db_xref="GeneID:13385619"
                     /db_xref="GOA:E9BLU2"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:E9BLU2"
                     /translation="MSLSPYTIDVGPCKADGRRDVFLQWHQRPCFSTTHRGITRVCLA
                     KWPARSRTDMALETNDVDESEALRAQRTEQVYQTLLEFGDPQGPPTSPQLMCSDHDAA
                     GNDNDARSPLEQYLCVFHREELADQYGRYTFVQPHTICTAYRIADSTALELVLHNITP
                     TDISAAAAGVFVRGHRQSNKGLPSSTPLEYQGIQYKPASNLWWMGAPLSLKPVYVAVP
                     LGPQVGATGGAPKGSVDKASGSHADGIAAADSDHGDKAAGDTVSRPVASPIAVGADDA
                     TAQKETGDNTSSPLLVELGGRTAQGEFEFRHSRSSSPNMCCPSQSAVLPAEGLASQVA
                     AAASSPSVPRVSLPLVSNAQARHVAVEATVLAQLELFDLTAGSCTCASSLAVVRTGDD
                     ELGLATTTPQYALDCMLWQWWPHRVRLPRLASGNAALSAVASPHAALDRYAVFVYDAH
                     QSRVFVLRTPHLRSGTGDFELLFSFPCGSLPFVLPCLRAPHPAPIAVCNYPRPNCISV
                     YDVMALLDAPAATTVAMELDLETYQANHSAFFGKVCTSSSGDDSALSGGADILSTNGS
                     STRGFMPAPPLPTGAADNAMARSVTAASWRADAINGVSHPIRNILYHYQNRLVVQYAW
                     PSGSAQPAATEGADDAGAGFASSCGSGEYEADSDQSVRSRHRRRRRCEGTVSFTVEFP
                     AITLDQDPLLAFVLEALSAALGARAVAALEYILFAELWHRKCRAAAVADAFDLCARLL
                     RKIFRCECGCSDPALACASARAELQQAAEDPEATACGSEAMTEAAAPHVFVDPSTVTL
                     QQIRRTIARLHTADAPACWRKEEEESSTTSVVKTPIPVRRGAIDAYAWTRQERGLALV
                     ALHLLFEACRAQEHLWPLLPRLASVNRDLSDALQWPSYVEYYDVMCPRLFAAPPPPSQ
                     ISPTQSFTDSLPASVLQCHFDSLERPDNAAALRACCATSVAPSAAEFASGDAPALFSA
                     LSLTAMRSSIPRSVAVPFGTWPLLKHLPDAHPIALVNRVVLLYRDIFIASAGSLTATL
                     ASSVDTSRGDVLVDSHVDATWWQRICSLVLQRHISSRVVRHTLNAAAAYPLLEALTKG
                     RECADSTWPAALLELVGRRDRCPPTSRTAQISSAGQHVVETAEENAVSRQFRVALADD
                     DGVSVRPDFRKTWRDSRLDMVQNLFNTVAPISLSGFEDRPEELTGALELLSCRTRAMP
                     LGRGMLTMCTQSFKVQDSIPIAPLNLNGRTSDGINVASKPADDLMWPLFHNGCAAGLR
                     FLPLPPAFCAGTGEAPFATQDALGDTDAKEAAALSLRNVTQSITKQWVMYQTKNIGDP
                     ASRAGLLLATGILGHLTVLQRTDIFYLLISRQEQYVWREATTMAVMLGLSCSFCGTGN
                     EAVFRCLSVHVQSLNPSAEDIEVSLDVQTAALVSMGLLCQQSPSNSFLVEVFLVELSR
                     LPTDEHCTKREGYVLGAGFGLGQLLLGVGQSHGVQRVEDRLLAIMRGEPRSAAVSTRE
                     GVEHFEETMGRGEAGHFLTRALLSQDEREATYNACASVYEGDCYNVFVSGPAAAMALG
                     MMYLRTDSAFIASRMAPPNRRAAMQKLTPLMCHLRSMMASLIGWSSIEPTRLWLYNQV
                     PSSLLELTQASLPRLATQQINYLLMNLAHCIAGHVMAVGLRFAGTMNSTARDLIFAEL
                     QGFLAGRVGSTKAATPAVQRATGAYETCLLACANALSLVMAGTGDLRALALLQQLHRR
                     TNVPYGSHMAISMSIGLLFLGSGRLTLCNNITAVAALLMAFYPVWPKDAEDNTGHLQA
                     LRHLYGLAVVPRVMEAVDAVSHQPVSVPVRIVLRKKKSAEMDADVRAQQRTSRAAASD
                     AVERAEDTEQAIHTVTPCLYPPVEMIERVEVRGTQYYPLVFYAFSKELTQSAGMLFRV
                     MAKESASSPVYSRGGGRALSTRTSIESRLLGWLHRLFRQSSTTMTEALTIIDSVKLLL
                     RVQRPLLSRTTGGGELLLSGDFGEAIAEAMERRYAFIFLHGGVPAVEGVSSDPHHPLR
                     QLILEGKSRAEVFQSIARHPQGTVAFPCDFTALSVGCASPANGGGGTTMAPMLPAERN
                     MCPVIDTGALARWMTEALHYYGIGQREIALLRRAFTAFSTSAAGSPMGTSCEGSSSVQ
                     RLTALLRLQATTLLPLATLEKIWACCVY"
     gene            <722076..>722465
                     /locus_tag="LDBPK_302000"
                     /db_xref="GeneID:13385620"
     mRNA            <722076..>722465
                     /locus_tag="LDBPK_302000"
                     /product="intraflagellar transport (IFT) protein,
                     putative"
                     /transcript_id="XM_003862864.1"
                     /db_xref="GeneID:13385620"
     CDS             722076..722465
                     /locus_tag="LDBPK_302000"
                     /codon_start=1
                     /product="intraflagellar transport (IFT) protein,
                     putative"
                     /protein_id="XP_003862912.1"
                     /db_xref="GeneID:13385620"
                     /db_xref="GOA:E9BLU3"
                     /db_xref="InterPro:IPR028172"
                     /db_xref="UniProtKB/TrEMBL:E9BLU3"
                     /translation="MDEDRLIMFDSNGAIRMYDPEKYDELVKTVEVERRYVEKMDEFR
                     ALVQRTMAIVQRLGEAIEAEKLKAIGFRNIVESESEERFRAVQEAQIRLREKQMELDR
                     YVAEYESLKLVEQEQQTFFQHLSQAKD"
     gene            <724698..>727874
                     /locus_tag="LDBPK_302010"
                     /db_xref="GeneID:13385621"
     mRNA            <724698..>727874
                     /locus_tag="LDBPK_302010"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862865.1"
                     /db_xref="GeneID:13385621"
     CDS             724698..727874
                     /locus_tag="LDBPK_302010"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862913.1"
                     /db_xref="GeneID:13385621"
                     /db_xref="UniProtKB/TrEMBL:E9BLU4"
                     /translation="MWAAAATKNSQHVCLSTLRLAFALLMCVCDRQGDLNRTTMAASG
                     LNHAAPRRRPGSCPPSTRQLHCIETLYATHRHVPSPHYCFDPDALLAKSIQQQLERLY
                     RGPNADASPRQRPSSASQPHRGRSTNSKQHGSGSQARLSLTQSTPGAKRGESSFSLSR
                     LSTPCSKRLVASLSSPQPQRPHGTTAAAISLLTSTLPEPSQPPAWCRQRGKEEIIENE
                     LEPVPNLIGLSDYFMKRPHFVYRPHSTGGGEASTSTADLYSGWHDLDGARCHSRTRVT
                     PQLSRSSSSTTPGLPNSSSIRRPTLQFGVLPSSVVRRCAAGFSGQPKPSQRIDTSAPA
                     ADHSRGVNGAPLPPGEAAIGVHASEPSSSSRHSASTFFLDSEEVFFDEDPLATQLLQG
                     PEAAKCPATMHAPASEQAAREHERADDPAASGTRAAAALEPLVVESLSSSAAQHALLP
                     RAPETPSDPVASFSSFSTDPASSAAAGQPAAPATPKPPSKSTLFLRKRSPSPWHRCRT
                     IDNLLQKLLRLRVQYERVRHQGHGPCGVCDKSFLEPPLYARSKSAATQGKCFSSLSTF
                     AGTVRSHSRRGRTQQQGRQPHARPVSRGSQRSGLCSGCGHSAPHIRSAVDVGNGDQDA
                     SLHLFRGFRRCECCEVLLPHDTVVPVPPTVPRNGASLTPRRGRRGPSSVASPAAPPRQ
                     RSTRISDPFAAARPMPSYYCPCHSETASHRRPSARRSEEGDRCREGVRDEAGARAALD
                     LDAKDHLLLKLLRRIGKDIRAGQKGSEASTAEDTASRTTSGATDRGVEALLRALREEV
                     RMDDATYAELLRELHGSSLSPVAGSSAASSAEATHTVVLFPHSMPHPPFAPPHHTTGC
                     CDAAVATMASPPSPPEVNAENNHADGRARGAPLQAYEENLPSAPAAVLEPLHAGEGAP
                     CSQRFSSISSIKLRSDSCVRGLAAPALTSHEETDASAPGPVAELHPATATIPAALGSV
                     FDDLVHKSVQHSQLRIIDELEGALRARLGKDEEDARWEVCRRGVNEEEVLRRRALALD
                     EAVKGVDLLRQCRYLRARILVAETELKE"
     gene            <729448..>730464
                     /locus_tag="LDBPK_302020"
                     /db_xref="GeneID:13385622"
     mRNA            <729448..>730464
                     /locus_tag="LDBPK_302020"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862866.1"
                     /db_xref="GeneID:13385622"
     CDS             729448..730464
                     /locus_tag="LDBPK_302020"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862914.1"
                     /db_xref="GeneID:13385622"
                     /db_xref="UniProtKB/TrEMBL:E9BLU5"
                     /translation="MTAIEPDEDGELVEGEVSQGLIALTTPAATTAAAGMVRFQEKCS
                     ADEPHSKVHPQDVPRPLPRPASTSAEMEHIEGRPSIDVHAAYGKVQGEGGQLQAPSVM
                     ESGADYALQRLPPPQLSAGNAADAEIRQPAQQPHSSVASAEDSHASPPVSAQLQQTSA
                     QTERSVSMLGEDHMTDFAESPTDSRHFMSPLVTRSEKDSPNVVNAEVNLEVEEDEGDE
                     RADYGTYGTQQLFKHVVSPPALRHCSTPAFFSSLVSTHLLEPTTEEDGKAPDVDGARD
                     DHSRVRDEDASYEPGGDRDVAEEGAPRKRVEVEKCEDATNVLLLHGVHPPHCRGGPRR
                     RRGE"
     gene            <732403..>733701
                     /locus_tag="LDBPK_302030"
                     /db_xref="GeneID:13385623"
     mRNA            <732403..>733701
                     /locus_tag="LDBPK_302030"
                     /product="mannosyltransferase, putative"
                     /transcript_id="XM_003862867.1"
                     /db_xref="GeneID:13385623"
     CDS             732403..733701
                     /locus_tag="LDBPK_302030"
                     /codon_start=1
                     /product="mannosyltransferase, putative"
                     /protein_id="XP_003862915.1"
                     /db_xref="GeneID:13385623"
                     /db_xref="GOA:E9BLU6"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="UniProtKB/TrEMBL:E9BLU6"
                     /translation="MSSKAWLDRQSIRTLLLYGGLARVVLLIYAAFHDYYFRVKYTDI
                     DYMIVVDGARELLHGGTPFDRTTYRYTPLLAVLVIPAVLVANPLGKVVFTLSDLGAAY
                     YCFHMLLRFSTERSAKWMVVILILFNPVVLNVSTRGNSDMLISFMSMGVLAKFAEGRY
                     FTAAAILGFAVHFKIYPIIYALPLVLGVWERAKQECFFGRLAHTAPVVVGCGLCFTVA
                     FAVPTYVCYLVYGQQYLDEAFIYHIHREDHRHNFSPYWLLMYLNMGRRDLGVGVDYSA
                     GLFAFLPQFAVLCYASWKLRKNIAHACCVETILFVAFNKVCTVQYFVWFLPFLAFVFC
                     EPAQPKRLMGATNVSKSERPSMLSAVAVILMWSLTIPLWVWTAYRLEFEGQNHYGRLW
                     IVSCVFYLATVGLAAWLGRLCYRSRITIAIKDHRPAFKRA"
     gene            <735871..>739935
                     /locus_tag="LDBPK_302040"
                     /db_xref="GeneID:13385624"
     mRNA            <735871..>739935
                     /locus_tag="LDBPK_302040"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003862868.1"
                     /db_xref="GeneID:13385624"
     CDS             735871..739935
                     /locus_tag="LDBPK_302040"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003862916.1"
                     /db_xref="GeneID:13385624"
                     /db_xref="GOA:E9BLU7"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="UniProtKB/TrEMBL:E9BLU7"
                     /translation="MSYYIGYSQREIYKKRCNELGCACNSAVVRLLSDVPGEVTGLTS
                     LDLSRNFLGRKGIIPLLDVIESAVQLRSLDLRDQQLSNDTVEVICARLRRHPSLLKLN
                     LSNNPITLAISSALLELANQNSVLQYIYLENTLVRPSMVTAIEVQLEKNRALARTALA
                     ESQVADGKPRRIFVIASSVAGTCAAGSKPGSPRAEQAVLSTPVGSGKSAAAMLLRNAD
                     AASTAAGSTGWRQRIPAHELQHVFRSYTHAVADFFFDVNPTKDVWAWCEERHYVFDDD
                     QFNSHNDHLHRTARHTYGIAGWRRVGELYPDATLFGWEGATRNANDTARQAAPSINGA
                     GAQDTCEDPVEDMMGAERAAAGDGRRGSDAEYLHATSVFWQLPKDVPEGFTWTFTALM
                     ASVKETQLLHALFCASATGLPDGGTRVQRGTACPGIYTMRMFVEGQWRYLLVDDFLPV
                     DKYGRLIFTKPSMDNRAFWPCIFEKMLAKLHGGYHVLDAHFDKHHAGIDSPNIRKPIA
                     RLFLSKENLQRPNDGAGGGGDTDWGTVPDDTLVCEEVAKNCGRVMSRLTRGIYDSYQL
                     HPVEQAPTTLFEGLHKVLGVPLCSADAREGYGNPPCGRRTASVKRSFLGSHSVSVDSP
                     AGAFGVSSYLTAAIAFSRDASRTFSGIHPRCGYQIVRVCHAGGVRLLELRNPWCGTEK
                     WTGDWADDSPLWKKHPEIAELLLTGAHGGRRTQRGGSNLLQLSNSASTLANTPLKRSL
                     LTALGEMGGSLAEASSMTPVCSVTRPSRRAAATRPHVQKSAFWISYTDFLQNFEWVHT
                     CRVFGDEFHRQDVHGTWTRDSAGGNAREPSWYRNPHYRLSFPYRTTVHVQLTRRDPRL
                     RRTRGAVRGQDDGVGGIGLQLLRDTHYPLHCPTISRGQAEISTAASLPMSSVEDIVAG
                     NQEDDGSIKEALGCRDLGASDRGCGCAFSSVLSSEERQSGDCLSLGILLDAGAQYWIV
                     PTTYAPRVLDEFDLSVTSTSPFILQEAQESQYWDQRTVPPELLCCASASAQEVERNEG
                     EVAIVFDSKSRVSSDANLLLQKQKQRSSRRLARNSVSHSIETESATVSSGACRIVVAA
                     TMHLAAAGVDMRNFGVDEAYEQRSVPPEDVHGTPTLQLAIVTGEVDGEGRPSRTVGEI
                     DPHAAHTYVLDRHTVLETAITPAPHNSVEHHTAICTLHPAGARVHVDYRVWCAAPLLE
                     VMSVPAWPKQEVTLCWDDEKGSGNYYEGTGHPQVELSRLRPFQRFAISLRMVDYDTIE
                     PAIMFSVICNDRQRGEPVEGQLGNRAVLSQSAYVNGTYVKASFDLDERPPESLIIISC
                     LQPTGSKGRCVMTISSDSADYRVHPLRVAAAYPL"
     gene            <741591..>741674
                     /locus_tag="LDBPK_302050"
                     /db_xref="GeneID:13385625"
     mRNA            <741591..>741674
                     /locus_tag="LDBPK_302050"
                     /product="ferric reductase transmembrane protein-like
                     protein"
                     /transcript_id="XM_003862869.1"
                     /db_xref="GeneID:13385625"
     CDS             741591..741674
                     /locus_tag="LDBPK_302050"
                     /codon_start=1
                     /product="ferric reductase transmembrane protein-like
                     protein"
                     /protein_id="XP_003862917.1"
                     /db_xref="GeneID:13385625"
                     /db_xref="GOA:E9BLU8"
                     /db_xref="UniProtKB/TrEMBL:E9BLU8"
                     /translation="MTTAIKDEANLPGIDDIPPTPRVGLKS"
     gene            <746403..>750029
                     /locus_tag="LDBPK_302060"
                     /db_xref="GeneID:13385626"
     mRNA            <746403..>750029
                     /locus_tag="LDBPK_302060"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862870.1"
                     /db_xref="GeneID:13385626"
     CDS             746403..750029
                     /locus_tag="LDBPK_302060"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862918.1"
                     /db_xref="GeneID:13385626"
                     /db_xref="GOA:E9BLU9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9BLU9"
                     /translation="MASLQEAPSPALLPCSLSEVEAELQKTQETLVDGIQEELMCAIC
                     GSVFIDPRILECQHCFCLRCLYSTVSRDRTSQIEVPCAYRCAAVTVTQGDIRTVPKNH
                     YITNTCVLLRQKLVRRSRLLERKLLLSAAADKELPTLAREMRLDSAALPLTAAAASPV
                     ATEASLSQGSPATVTSALLMKEIHAAKELHECEWCSCSSPTCEVCTYCWSRVCAECRG
                     QFSDHQYLCVELHQPGRRPPEGWLPGVSTATAADTDRGADAGQEREATRMDSASSAAQ
                     VGATAAAGAQTPDQEAPFPYFIAPFFVPVLVKECLLKQHGATLQLSEIDVTSVTAVRL
                     AVPEVEVQCQHHTTGFGFNFRVHPSFKTTEGVEVDLTVPHWADGGGRPNTTLSFLANT
                     ARLGETVLQDLRRLSTIMSKVVLELSSAAHQAYVRRNKGFHMYAVHVWSLVRAQCVIA
                     RDALLPHLERSRLLENIMGDLVVYQFQQTASHASPPQKHAIRDKCVAFMKAEVQLCRQ
                     LDQVMEGIDAVCRGIYTLLARMYTVMKELTQPKVHRGGEHRRSRQSRQQFSVRLFRVR
                     QQKHQDSCMHDSHGPAATSADGTTPLPRTRAGFIRSLSRTPPRAGAVSVEAEAPPSPL
                     PRSVADTVPDPILSDSPREPDCSFRGQVAEHGAMTRTLTELMLSILRCFMQARMWEWS
                     LSNTCIRECGLSEGDRRTLLAAEEELQLITDDLLHSMWSYSRMTHILEVEQDAAGPAS
                     SLDILMDAETLELLNSALECPVYDHSEVFESLKALSHLRAQFVASSSAVTIVARNPET
                     QQELLSMMSSVLNTTMAHQTTVWRLLVEAAASLDEHYATYLRTRQMDPTVGERPSPSE
                     DTLLAVDVLKLLQRQSGEKLADYLAVMPKTTDHHDDGSLRGAHARQGFPRAGILAMTQ
                     GSCLPDASNASAGEGAAPPPHCPFLADFSLRDTALFSCQVFGEALVRAAHGEHLQAGS
                     APEGQHQEQRSEEQANDAEVAASAAAEVPSPPPVAPERFTMSMERIVSAPTEEAAPRT
                     SRSSTTSLRTVDVDTQGSRFALNTEAAAAATLAHDEEDSAARDEDAPHREPLFAADTD
                     ASVVLLTRVSPSAADVDGIRKAAKLFGAAFQLPATTTSVGRRRLVLLPFYRGECVYKG
                     VSTPFYVDGQTGTVLMDPRTLSAAGKRQYALQVLSSPLFFILLNSTLSVFLHRRYKLE
                     IIYK"
     gene            <751357..>752298
                     /locus_tag="LDBPK_302070"
                     /db_xref="GeneID:13385627"
     mRNA            <751357..>752298
                     /locus_tag="LDBPK_302070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862871.1"
                     /db_xref="GeneID:13385627"
     CDS             751357..752298
                     /locus_tag="LDBPK_302070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862919.1"
                     /db_xref="GeneID:13385627"
                     /db_xref="UniProtKB/TrEMBL:E9BLV0"
                     /translation="MKFTHREIEDDRRKPVGSLFMHLIDRDSMPSRSHRNAAAQKMNT
                     HSLPNTELSLYAQDAPQISSTPVRGRRHFPKQDRHVDCNKAEEVRPSRGVRRGATANG
                     SIDHIGGDMTPRASTEVSMPRQRRYVPPPARSSTHRPFWLGDDEIVASARCRRGAGSA
                     ARSVSVGSQSFSRNSSTADHLTVGSLVPLPEKPVEKPVPPPLPIKPRRKGVRMFPGLR
                     SRSADNARRGIRMVQPQPHWRSAADRQWDFLELGVGRRETPAPLYRNESHIDVGGPII
                     VREGPSTPIQRWRGGRRYGGTPVRRTFDIITGRPLVY"
     gene            <753371..>753997
                     /locus_tag="LDBPK_302080"
                     /db_xref="GeneID:13385628"
     mRNA            <753371..>753997
                     /locus_tag="LDBPK_302080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862872.1"
                     /db_xref="GeneID:13385628"
     CDS             753371..753997
                     /locus_tag="LDBPK_302080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862920.1"
                     /db_xref="GeneID:13385628"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="UniProtKB/TrEMBL:E9BLV1"
                     /translation="MVFYFTLTSDPSVMCYMGRDKYENEELIKFGWPEDLWFHVDKHS
                     SAHVYVRLPPGKGMNDLTPEIIEECCQLVKENSIEGCKLNDVRIVYTPWSNLKKTGDM
                     AVGQVGFHKEELRRYHTISSKNRSMLKALEKTRVEKNDVDFRKLREDRDMEERRKQRA
                     EKAAREQQDKLEREEKKRQEDLRMYKDVMDENNMRLNTGEVPDEDDFM"
     gene            <754760..>756415
                     /locus_tag="LDBPK_302090"
                     /db_xref="GeneID:13385629"
     mRNA            <754760..>756415
                     /locus_tag="LDBPK_302090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862873.1"
                     /db_xref="GeneID:13385629"
     CDS             754760..756415
                     /locus_tag="LDBPK_302090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862921.1"
                     /db_xref="GeneID:13385629"
                     /db_xref="GOA:E9BLV2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLV2"
                     /translation="MLASPSLMSVNRALRTKVGINTSERLRAAERDEPTTSSARPPPS
                     AMDLSYITGKMPDTLAAYQTERAVWSATTFRSAWSKLHKAYASFLETDPARAAELRAK
                     DWQGLALYNAYAETLHLMSLLPATLRTAITQHPSFDYTEVEELFVHLGQDVEVRGSGG
                     WVIQLPPPTTADLQYLVKHIGRFGADGRGCVANTAHRASAWRGRFGEALGVTLRVGRY
                     VPGAARALLPLAQRGSLLILSKAGMGKTTLLRDLAAALAQEPGTPRVTVVDTSNEIGG
                     DGPIPLPYLGRCRRIQVARREDQGRVMMEVIQNHTPEYLIVDEIATEEEAEAAWSISQ
                     RGVHLIGTCHGEHLEGLLQNRALNLLVGGAAQAFLSNEERRLRNKTKKTVLERPYSSP
                     FSFLVELHARNRGHLYVDVNKAVDLVLDEQPAQLNAAVGAAVELSARLPSRVEKLLRL
                     QEERKRKLTYVAGTDTNDDEVDEEDDGTATFSSATRGTVYEDGYTLLTDDGKDPESNP
                     SIASSTYAAANHASGRRPHWQAEKQRRHRKTDEELYRELKGFF"
     gene            <760199..>761398
                     /locus_tag="LDBPK_302100"
                     /db_xref="GeneID:13385630"
     mRNA            <760199..>761398
                     /locus_tag="LDBPK_302100"
                     /product="alcohol dehydrogenase, putative"
                     /transcript_id="XM_003862874.1"
                     /db_xref="GeneID:13385630"
     CDS             760199..761398
                     /locus_tag="LDBPK_302100"
                     /codon_start=1
                     /product="alcohol dehydrogenase, putative"
                     /protein_id="XP_003862922.1"
                     /db_xref="GeneID:13385630"
                     /db_xref="GOA:E9BLV3"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="InterPro:IPR018211"
                     /db_xref="UniProtKB/TrEMBL:E9BLV3"
                     /translation="MACRSYQFTICATSYLLRWRAPAVTQGSGALATLPHLVRGARLK
                     RGLLVTDAMIMKLGLVDDFIDEMKKQGAELAIYKDVLPNPTIDMVEEASALYKKNKCD
                     CLVAVGGGSVMDCAKLIGVRQARPRTPLPYMRGLLRVLWPLPPLIAVPTTAGTGSECT
                     IAAVVSDPAKKDKLVVMDPFLTPSHCVLDPALTMTLPKFVTATTGMDALTHVVEAYTN
                     VFHYRTVDKAALRAMELLAKYLPCAYKDGSNLEAREKMLQASYLAGLSFTRAGVGNVH
                     AAAHAVGGLYNVPHGYANAVILPHVLDMYGSAAHKSLARLAEAANIVGGNDAEKAANF
                     ISWVREMNAQMQIPTTLGASDSRWVPQEEDIPFLVKHAVIEANPFYAVPVIFGEEEMT
                     ELFRRIM"
     gene            complement(761888..761959)
                     /locus_tag="LDBPK_30tRNA1"
                     /db_xref="GeneID:13385631"
     tRNA            complement(761888..761959)
                     /locus_tag="LDBPK_30tRNA1"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:13385631"
     gene            complement(<762326..>764236)
                     /locus_tag="LDBPK_302110"
                     /db_xref="GeneID:13385806"
     mRNA            complement(<762326..>764236)
                     /locus_tag="LDBPK_302110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862875.1"
                     /db_xref="GeneID:13385806"
     CDS             complement(762326..764236)
                     /locus_tag="LDBPK_302110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862923.1"
                     /db_xref="GeneID:13385806"
                     /db_xref="UniProtKB/TrEMBL:E9BLV4"
                     /translation="MSALWARFTEKLKGSGYTLSDLVYCSEDTFLTLVANMNAFTPLQ
                     IASLAKEWQRSLSAAATPAATISGSALPFSRRHAESTRLSSSPAPSSALNRATLPATG
                     AAETSPNHSTLSTALREDSFVPPRRSPAKVKEEAEYLLTKLGAQSGAEYQVSLTEGIV
                     AVEASPEAWGPLLDRVSRMHVASHRGSAAAPPATELQLLWKLCSPATLRKMEKACVSG
                     APFGLSNQDDADELCSSAVVLYDKDATRLAAPAQELEQLFREGWGLVAFDVAVGKART
                     VTKEEAQDLNANLYRFSMEQCLEMLEEAGFDAFHIPSRNAVAVCHMHQLMPRFVVFVS
                     TLEPVVVTRRLGDTVPAVGNGRPSRAPPAPAASPSPSASAAAALPAARRTINGGNDAL
                     VPASRSSRNSEDLQCAVHSKKTVEFWSPTEKRLLCSHCLYYDGYSQENCVPIEQATRE
                     EAPRLERWVQNAITFSQEIKSVFDLFEAAQTDVSQTHKQVRSDIAHSFTRLRARLDAL
                     EANLQQQCQQKAQQNLQALQDTLSRITATVQFVSEVVQDADGPVAAYRGGVADTSTCV
                     ALLRSAQRAFGAWEPVTISAYEDVRIVDGSALLQPVEEALKAVQSISSEAGKVQLPEA
                     IDVNYLKSDCDV"
     gene            complement(<765539..>767149)
                     /locus_tag="LDBPK_302120"
                     /db_xref="GeneID:13385632"
     mRNA            complement(<765539..>767149)
                     /locus_tag="LDBPK_302120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862876.1"
                     /db_xref="GeneID:13385632"
     CDS             complement(765539..767149)
                     /locus_tag="LDBPK_302120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862924.1"
                     /db_xref="GeneID:13385632"
                     /db_xref="UniProtKB/TrEMBL:E9BLV5"
                     /translation="MPSMDSLRTAVDNAPLLVNLLRLIRDARSPNYKDHEKGPVTFHF
                     GGLSMRDTGSYEEAEELWRQSSWSSGALAPNAAGPFRGPLHLVVYLNHSPVEVWTLQD
                     YREPATDHSVPRDFEQLEALNTLVRVLFAHLRCQDIYGVVLQSCVTATDDANNHFPAS
                     PSGNVRSPPQSPPPRNASLSRERTPHSPANHVSLRLFRSAEECPTIPVHARRQYLWSS
                     DDFVRVDVTMDRTWRHHSWVQPGTQAASPVLAAGDRERGTAACAAAERSSPIRTASPG
                     LRRFGSEGDTRSQSISPEAMGSLGKSSLPTPYLAPAATLALSSHLSRSPRTNLSPLMP
                     GSRLSPAQGVSEFALPPADVSSPFDCDRSRQSRSSPPITHSCVFASSHRAGGGGATYT
                     AAVGAVNQVEDAVWLSNAEHVRRMGTLVCSRKHSPSASSSPVMGKKSRNSFTHQKHEM
                     GSLVPSISIGALSGIGFDGRLLSSDVDLEDLAAETASAGSSASVPNSAAMEQLVSLLG
                     LCSKVKLQHVPSAPFGDLVLSLNLREVP"
     gene            complement(<769687..>769974)
                     /locus_tag="LDBPK_302130"
                     /db_xref="GeneID:13385633"
     mRNA            complement(<769687..>769974)
                     /locus_tag="LDBPK_302130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862877.1"
                     /db_xref="GeneID:13385633"
     CDS             complement(769687..769974)
                     /locus_tag="LDBPK_302130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862925.1"
                     /db_xref="GeneID:13385633"
                     /db_xref="UniProtKB/TrEMBL:E9BLV6"
                     /translation="MWNGCSCACTYVQARLFMYAYQTAHKECAALPSPHPDCPLFSCF
                     ISSVCLLFVLQAPSLPDTRSPLYLPPPSPWHYESCAQARRMAVAVEVWFLR"
     gene            complement(<771266..>774232)
                     /locus_tag="LDBPK_302140"
                     /db_xref="GeneID:13385634"
     mRNA            complement(<771266..>774232)
                     /locus_tag="LDBPK_302140"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003862878.1"
                     /db_xref="GeneID:13385634"
     CDS             complement(771266..774232)
                     /locus_tag="LDBPK_302140"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003862926.1"
                     /db_xref="GeneID:13385634"
                     /db_xref="GOA:E9BLV7"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR006633"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="InterPro:IPR022441"
                     /db_xref="UniProtKB/TrEMBL:E9BLV7"
                     /translation="MEEYNIKRKIGDGAQGVVYEVEHRTSKTSYAMKVICCTDQEQVN
                     MALKEIKVLLQLRHPSIVSYVDFFLVFNSVKLRREFAAQSEGACGSGGCGDGQQREAR
                     VQREQDSLFLCSLSNSEFHHGCAADSGWKQATAEASSNAPTGKPQSGAARVVPTSLLS
                     KHRQQAGAHWLGEEEIAVCLVMELCSNGDMQGLVREARQEFMKTGSHSITEAQAVSWL
                     EQAAAALQFIHDKGFLHRDLKPTNIFFDEYKNIKIGDFGLAATVGLGRNSAVGTPYYL
                     APERMLQQRYDGKVDIWGLGVVLLELLTLREQPINSMLLENPKVVDTVIPQITKMGYS
                     TKLAALLRDMLQRQPQGRPTPSSILHRLASITATSPHPGMSATLFAGMSCPKLTEALC
                     DVCEVEVAGVMCSSCKAAFCAGCDRARHRHHSRQSHDRTNMSSIVNSMNGASSLPLSA
                     TPMQQQQQQKTLSFSRGPSPANTSDQTRASMQNIVVFPSSSTSHSRTLPREREMNSRT
                     FTRFQLALPGCSVSMSEYSMAQGFQGRRDGSGINAAVAETVLRVPDDVPSLAQALQVV
                     ESMPHIRKILVAGNTTHTVPLVLTSRLPDSIKLVGESPPPMLEVADSPFALHCQSGRG
                     SVENFILRHVGRFRSKLLKLDTNLHQADANAMASAPARKPSRPTAVSITGGEWRLHKC
                     RISCVEGSGVTVGGGKHTSSSSTNGQNTSATGTRSSRPPPSPSLVARSSLVNGVEEGA
                     EDADVLSMEPIITKCSFIDVTAAGIVLMEKSRGLYEGNTFSGCGFAAFLLRKDATPRI
                     RANHITDGAEAGIFCQDASGLMEYNVIAQNAGCGIVVKGASAVPVIRKNRVLSNVQAG
                     VFCCDKAAPFVSDNEIRQNGKAGVLVKTTAAPKITRNVIESGKEAGIYVFEKGAGIIE
                     ENRIRGNQNAGLLVTTGGNPHVIHNTISKNAYEGIWVCKHGGGTFCDNDLRGNTKGAK
                     DIEADSRVTWVGNVEQ"
     gene            complement(<775746..>778418)
                     /locus_tag="LDBPK_302150"
                     /db_xref="GeneID:13385635"
     mRNA            complement(<775746..>778418)
                     /locus_tag="LDBPK_302150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862879.1"
                     /db_xref="GeneID:13385635"
     CDS             complement(775746..778418)
                     /locus_tag="LDBPK_302150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862927.1"
                     /db_xref="GeneID:13385635"
                     /db_xref="GOA:E9BLV8"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:E9BLV8"
                     /translation="MPRDAPAPSSALRRRTATSALGGDTRTQERRRPRPMRKALRHFP
                     LATAARRKPLLPPAASLRTHFTRVQEAAAALGHVLGYLIRQVLSLSVLLDLAQGVLGR
                     LFALLRWLNDYPARVQFRRTTQRFLSVMNTTESYTTFVEAAASLDHYCGVAKWAQDAP
                     PLDRCNAVGLLVDATAAQHLIRTNNLYAMETFLCSLLKRNAHGLMDASIYRYYNSAPH
                     CLEDYTDSIECLITAYAAGAWHGESAVSDSSGAAADRALPPTSAAPVLRDLRPCWVRL
                     EASAGAEVRPPLLAGTPPPVWSATHSGPSAALPAVDVTAKIQQVWQAQFRKTVSAIQA
                     PWATATAAPSRQQSTSASVHCLGSSAASAAMPLTDTSTATVPTCASTLAGEKSILLTR
                     DDAAPVSHTFAKPKTSDDAKPAGDFASVSPPLSPLLRTEDTTSGNATALLSFGAHMSV
                     APPLSANPMAAAPPSPEVALARQLRSSCASLCRFLDGCALPSALPQQHHAHQQRCSVY
                     KPAVVTVGHRLKVLRKVLHSYGRTALVLSGGSSMGTYHAGVARALHEAGVLPDILCGS
                     SAGSIIAAMICTKSPDELHAFMQSHVLSTEAMHMSPFGEDSDLPGKLKRFFKTGFLMD
                     VRSLMGCMRGQCGDMTFLEAYQLSGKVLNVSVTRSQQEGMPSDRHVLLNYVTAPDVVI
                     WSAVSASCALPGLFTAVQLIEKPSLGGGTFAPYLPGELWCDGSIAQDIPRRLLIQLFG
                     VNYLIVSQVNPYVIPFLRPPKSHHIIATSGSWLARLWFAWVDVCGWVLTVLFSVHLLP
                     RFGRFEMLFMLFAQFYSGDLTIQPIDSVMKAVPDYMNLVNNPSADYISYVASRAQSRT
                     WPLVTRIRLATRIERCLQREIRALEAMELREQTT"
     gene            complement(<779552..>782107)
                     /locus_tag="LDBPK_302160"
                     /db_xref="GeneID:13385636"
     mRNA            complement(<779552..>782107)
                     /locus_tag="LDBPK_302160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862880.1"
                     /db_xref="GeneID:13385636"
     CDS             complement(779552..782107)
                     /locus_tag="LDBPK_302160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862928.1"
                     /db_xref="GeneID:13385636"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BLV9"
                     /translation="MVVSSDASLIAVVSSTFMALLEIEHTSSPTFLRMGDADAFGEAS
                     GDEVVITAEERRRVACTIGDVRGVLFNSDASLAAVCTDSALLLWSNVFGDASNDDEDG
                     TGSHLASFDCTHLGASTQGCSVICFTGARQLLVVDDVNHLVLLQCVSEDLSDVSEDAH
                     MPVACQPNASPMAVNLQLMVDGHICGRTARVTSVACSHSGVYGESLVVLGFSNGTVQL
                     LNGRQLQALRTWNVRDAITAAFIDSSDEAAAASSRRRSGLSQVATRDRRGIPYAAAST
                     AAPQEVTIFDVCVGAHLITVCTSHGVVYYSRFTFQLESAYTQLFTTPLVQAGAAAAAA
                     GTSVLGGVAMRGGSNGRWAYTNVFDGVLYFSWRDVDTHHTLEARSAERNAASNDIVHA
                     RAPLPAAWLDNVATARLAQRPFLSSDARRRQPAKGSGYTDAPWSVQQERKRKARAAAA
                     RDRKAQAFGAVSASAAASTNELRFQYDFDSIFGVGRATLTRMEASSSALRGLHTRAVV
                     ATAFATAGDALITAGADGRIRQLHFPIARAKGADGVAGRILAGHAAAVTAIDANLSRQ
                     HPLILSAGAEGCLRLWSPGARDTPIAECTVGCSGGKVARPAPGKTIVSAQFFYLDKLL
                     LSCAADALELRRNAGGVCSSRATAAPSSTSESDRVLSEAPLYRFSVGSGHTITSATAV
                     NHFVSNLIFLATSEKEVQVLDVAANTVLWREGTTHTRGIYRVATGRTSRYAAAGVDSG
                     AAHLFMSASLDSTAALWDVRIAKPVQLFTQHSNTGVPSLALEVAPGIGVVAVGSQDNA
                     VYMYDLRGGCGGVALDVLRGFDSYVTSLAWHPLRPFLVAGLASGDVHVLQHAT"
     gene            complement(<783039..>784988)
                     /locus_tag="LDBPK_302170"
                     /db_xref="GeneID:13385637"
     mRNA            complement(<783039..>784988)
                     /locus_tag="LDBPK_302170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862881.1"
                     /db_xref="GeneID:13385637"
     CDS             complement(783039..784988)
                     /locus_tag="LDBPK_302170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862929.1"
                     /db_xref="GeneID:13385637"
                     /db_xref="UniProtKB/TrEMBL:E9BLW0"
                     /translation="MELCIAWPNAIAAHMEVCRVCRGELSPVRASSPLAATPGEGETD
                     EPSWQLKHFTREETLLVLLADEIEATAATQDGFLTRWGVRNAWDHDRALQGRSWWVSG
                     GIVTVLPSEAATRLVEPFLMLELSRMENGCPQLPRHPESCRDSSQTLEEALTHAILER
                     ELSHSVRAYLRKEVEGRIESRPLHRMIVVVPPAMALFLRGAPSSMLHDCFLYHTVDCP
                     LFAVEGGSCDAAQSSTDRATGLVAPATSPTAFLRPVKSGLSSADLLERQCRVAHDETS
                     RLMELFREYDLLLSGDGYVRVPLAPVSRYVFTQLLCQSELPSALILALMRRHSDVTHR
                     ACDVGHRIDLAAVSSRPPLPTEEEVMLGIKVTWAVERWTAALRRGSAAAPPVGLHMWN
                     EEQSLRKDKLCRWIHERMRKAKREAAELYSLEDAADTHATDREEDGVASKVSALPVAS
                     GDTADPLRRCRGAALKQLERRLFAPFPSSYRGSSTEWLGQALRDVAREQTHAASSMAQ
                     RDDVCSSFAGPAPAAPRAASTNALDNSSSSSHSDATSEDGSDGAGGVGIPTPQETESL
                     LAQLTELEVVLQNELASRATVPLASGGDSRTTDLRGGVGDAVTEDQEMDVTSWLTAAD
                     MQQITRNELFLHHVQLLESEMEQDQ"
     gene            complement(<787759..>789339)
                     /locus_tag="LDBPK_302180"
                     /db_xref="GeneID:13385638"
     mRNA            complement(<787759..>789339)
                     /locus_tag="LDBPK_302180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862882.1"
                     /db_xref="GeneID:13385638"
     CDS             complement(787759..789339)
                     /locus_tag="LDBPK_302180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862930.1"
                     /db_xref="GeneID:13385638"
                     /db_xref="GOA:E9BLW1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9BLW1"
                     /translation="MGKKDKEVMYDPGYDKEYYGEDDDEYAYEDQEAAATVVPSASVA
                     AEQKYAQCEERTMDVSEVLAMQSAVVREVVNLTCLSTSAATLLLRRYRWSRDVAVERY
                     FENSTAVLSDLGITEEASLHEAKLLHGEAGGPIVCGICAMEYNPQKVACLSTCQHYFC
                     LECWRDHIKSRIVENLIGTHCPEQGCCQLVGLSVMCELFSECDDEAKNGKSKSILKQI
                     HRKYLTSFVETCPTLHWCPNRQGCAAVIYAPVPPLQGQGVRCLLCNRSYCLRCSYEPH
                     RPATCENIRQWKSYCSKEGANLAYILSRTKQCPECKKTIEKSGGCNHMTCKCGHEFCW
                     VCLGPWKQHSGDYYSCRNVEHHGSAASEEAVDASRRFTYHYERYTLHLDSAERDEKLL
                     RTMAHNPTMRERLIKAQRRMDENRAPGVVSGALKQEGVPLVGLTCATSEVVSRVTDTL
                     FTARDILAHSYVAMFYLCENDSEGQLMAHRVGKLEEATEAMSGSLIKLFTATGSQLGT
                     FFDAADVLVAWMKALCDV"
     gap             792113..792211
                     /estimated_length=99
     gap             793632..793730
                     /estimated_length=99
     gene            complement(<799096..>800607)
                     /locus_tag="LDBPK_302190"
                     /db_xref="GeneID:13385639"
     mRNA            complement(<799096..>800607)
                     /locus_tag="LDBPK_302190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862883.1"
                     /db_xref="GeneID:13385639"
     CDS             complement(799096..800607)
                     /locus_tag="LDBPK_302190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862931.1"
                     /db_xref="GeneID:13385639"
                     /db_xref="GOA:E9BLW2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BLW2"
                     /translation="MTSLQNLFVAKLPRNLTDADLEQIFVQYNPTGAKVMLDATTGKS
                     KGFGFVLFASEDAGRTAYEKLNKTHVTLHGHNFNLCIFPSKHDGKVAMEESNALYVRN
                     IPLKLSQAEVEQFLRGFGPLTYCAMREDNFGGSVWVVYAEFDSVESAKRALMCLHGNR
                     TYFNTSVAILAKYADSEETKRERRRRREQQQAEQQHLDTIHNFGSPTAALDSNKGFAV
                     QIQNAPLPPPPPPPPLPIRTSPGHSRTGSTLANSYSASDMHMEGTSASLHPPTFASIS
                     HHFAPGRHGGGGPPPGMGQPAAPPASSMLAPSTLQPTQAVSGQPQQSPTPSSGSFLNV
                     TFNPTSANNFGNSFTHYGGLDQTPSRSSPGTPLNFSFGPEMENSGALANGLGTGSNGM
                     LDASGHAPMTPVRRSSNLSTSGSYRHNPYAPVTPVSSTHNSTGPSTPLVSSIAYPTAP
                     LVNMHFGASHHLHSSPVALHPPGPGIGVANNHFASRGNNAYLAAPASLNDLSQ"
     gap             803350..803448
                     /estimated_length=99
     gap             804973..805071
                     /estimated_length=99
     gene            complement(<806948..>808456)
                     /locus_tag="LDBPK_302200"
                     /db_xref="GeneID:13385640"
     mRNA            complement(<806948..>808456)
                     /locus_tag="LDBPK_302200"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_003862884.1"
                     /db_xref="GeneID:13385640"
     CDS             complement(806948..808456)
                     /locus_tag="LDBPK_302200"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_003862932.1"
                     /db_xref="GeneID:13385640"
                     /db_xref="GOA:E9BLW3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BLW3"
                     /translation="MSLQNLFVAKLPRNINDADLLHIFSEFGPSSAKIMLDAATGKSK
                     GFGFVLFDEEEKGAKAYRALDRKMARACGHSFTLVIYPSNHNGKIFTEESNVLYIRNI
                     PMSVGQEKMERFLKTFGNLIYFAMREDHYGNPVWVVYAEYETVEDAKNALAKLHGNNT
                     YFHGSAPILAKFEDSDDAKKERRRRRDGMQTHAPNSGCIFPPPHSHHENSGSLHTSST
                     TLSSENGVSSSHGGSSSRTVESKTSSKSTAGPRGSGTGGIAAALPSVTPASAPPMPPP
                     PPPFLPAMTDVTQHTPTAAFSMPQQLLQPTPGYCYTLGESGQQIFIPASSFSSPMPPY
                     NFAPATQSAPLLLLNPPLQTTDAAAKPNFSLLNPTANATVVLMENGLQYMLTPDAMNM
                     NCEPFTSPTSTFGPMLAGSQPKSLLGISSNQAAYTNGSAGSMNSFGTCLDAVYTDPLQ
                     VVPPRCDAEDEVLGEASVAGPNNEDAVRVHALQSASAEGSVITGQRGPGVWW"
     gap             815899..815997
                     /estimated_length=99
     gene            complement(<820795..>821304)
                     /locus_tag="LDBPK_302210"
                     /db_xref="GeneID:13385641"
     mRNA            complement(<820795..>821304)
                     /locus_tag="LDBPK_302210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862885.1"
                     /db_xref="GeneID:13385641"
     CDS             complement(820795..821304)
                     /locus_tag="LDBPK_302210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862933.1"
                     /db_xref="GeneID:13385641"
                     /db_xref="GOA:E9BLW4"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BLW4"
                     /translation="MQLSRIPSYEEASVAGAEYSLSPMSPLAHLSKKIDVTKLKTKAC
                     RYFLLGVTCPFGDSCAFSHSEPVSPAAYAPARMAAKSSASLSFEDLSKSGSAQLSDTQ
                     SNDAAGDVSERVVFGQPPPAYEVALKESETLAAAAAAAEELATPPAYPKRFRFDPYSV
                     NWIAYEKTA"
     gene            complement(<822568..>829932)
                     /locus_tag="LDBPK_302220"
                     /db_xref="GeneID:13385642"
     mRNA            complement(<822568..>829932)
                     /locus_tag="LDBPK_302220"
                     /product="endosomal trafficking protein RME-8, putative"
                     /transcript_id="XM_003862886.1"
                     /db_xref="GeneID:13385642"
     CDS             complement(822568..829932)
                     /locus_tag="LDBPK_302220"
                     /codon_start=1
                     /product="endosomal trafficking protein RME-8, putative"
                     /protein_id="XP_003862934.1"
                     /db_xref="GeneID:13385642"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025640"
                     /db_xref="UniProtKB/TrEMBL:E9BLW5"
                     /translation="MMSTTISSVVSSSSAASSAPLDHRSFTSCYTVTKHSWRGKYTRI
                     FCVGPRGIATCDVRSLTKLTNYWPYTSSVRSILAEGVGNGHFLLITQSNGSRAEELRF
                     SCGTDTERAQLLTDVNRYRLWFDCNYRASLAVQVYGAMKYTINEMLRPCTLRVTATGV
                     EQLCRIGDNTGANAPADGGASASSQVSASPTAAKHGTSAPPEYEKVGEYLFCSIRGIT
                     TIADRPGSIVIAYGTEMKMHLYDVANVKLLIESIYRNATEYIGLPRYREMNVLQQSVF
                     DSERLGIRRDSLEAVEEFSVLKHSPKQRDGAVRRLLSTTQIAIVERDPVNYNPISAHF
                     LHSIFALVRCEDDDQRFLILFKDSPVMKSYQSPARDTILAHVLTACYSAGDGNVCVMA
                     RPLLRRNRLSSLDTPVTEEVESLLLKGLVEGRLAGSSVAVDTAGSTEDGVRAGLMASL
                     ELFNANVPRTGLTWSENRDGLFSENREKLIFNAVEAVLKHFTWVKPSASDANEGSSSS
                     GSSGVTLDAVNQHFIVEQFQALGRLSVSRVGFSSIALVPSLFKSVGVYSVQALRLNNL
                     AVSFAVIEFLNTLMTPFHNHYEIEHESMNKNRLLSAEGFIRSLMEVLRDHIPNESASL
                     LVLELLFFFEFALCPPYSNTTDPAHFKRILGDLVDILGRHLFELLGRTCDIIRYTAGQ
                     LIRVVMEEGDKAQFERMQQLALSEGGILTQFNTAVFSSNRKLRDLARRLIAYWAHGHV
                     PTQDILRRMVPLTLLNFLQSQEQAPPNEQELEERKKVTQMTEAFRESKTGWFKKSFNP
                     RDVTLEANRGVGNGPTAAVSSYAADPASPDGGRVRYRVRNVNVTPTINWSMFFYQAKL
                     DHLRPDLIWNHTTRAELKAAVQAELDAFRQYSDMRREKLIAWNYAEFEVVYHSLDSEL
                     KIGQHYPRLLFEDARPMIARPREFFNDMYHRFLLVQDPKSKLECLHGLALLYTHYAEE
                     IGEFHDVPFLLQMLEKTMDPMMRDRLLLLLAHLLKARHNIKLFLDHDGLAPLMELVTV
                     AHLHIDRPQLKSVSNTIEYAGTLEEMQGREKEWHYTQNGAKAGPVSFSELKELYKKGE
                     VTATSKVWAQGMSGWRELGAVAQLRWGVLSADLPSILTLTEVTCTVLDVFLLLCEHYP
                     SLNGEGAIMQPQPKVKRILSSPSVLPHLVQLLLTFDSGVCSRVHTLLLSLMEANPFVG
                     RFFLTGVFFFSCLYTASDVLPMCRLLAATHHRQSFQYTAATNDLVRDSILAPLLPPAM
                     VCYLSHHGPEAFADVLLGEYDNPEAIWSPSMRQYLATKVAAHVADFTPRLLGNNTAVY
                     QYCPIVGVQYESLQRELFCCQYYLRHFCDELRFPNWPVRDAVRFLTDVLQQWREELNK
                     QPSSLTREKCYEILELQPQPSKQEMRKAYYQLAARYHPDKNPNGREAFEQIQRAYEFL
                     AADSVESSEPSPYNISLLLKAQTILYKRCGATLRQYKYAGFGLLLHLIEKEFRAPDVL
                     HKDIVLLDPATELCYFTIRNAPLNADELQEENGIHLLADIATYCFDRITPNSHDTEVH
                     VRIATHCMLTFSISARFPDCRLKMLREEQIPYLTAKGIAYYQAPELSRACTQACASES
                     RSEKMQSELIRYGCVWHLLQPLFSYDASLDKAGVGLDEEHHKQLFANRAAVFALHAIY
                     ALSGISRPRSTAFGNAVGTAALDGEDVVASDGGAAEGIADDNAQTKRHAGVYELLQRL
                     LTPFILYKMERQQDSEAEVLMLLNSNSDTPYFLWNNSCRAELGELLQMNSKQFREAAF
                     GATDLPSLSTSVADFAYSLHASEVVVGGVFLRLFIAQPNYPIQNPVGFFMALLLFLLD
                     NEAGAASGKGDDAAAQPAPPSSASRLTLREAPLLAAQSLRLLSSGYTETLSATASKQM
                     RSLVALLTPSFAVDTAGVAAAENEEDIRSAVFVEIAQALSKFLSSDACLQALSTVETA
                     MTAVVLLLERMLGRHNEAHGTSALSSEEPDAVLALIRLMLTHRTLVQQSLDRGLYIFL
                     LSMYATSPREKVREECCRCLAKGYEDRLVGPQLFIRSSKYLPPAFLEMMKDNVKQACR
                     MLDAWQENPELLWTKSQREELVEQLQASRRQIVAALSADALACWKPSEAAGSSMGTTQ
                     SSFDGGGGDACSADRRLRRLQVGGVYVALYVQQPGWAVRHPKEFLVSLLERFVEEASK
                     ATSPTAALSGDAGAAPDTDMLELLTKAGEILLSNSPGLRDYMTSLGYGSKVDRQLSPA
                     TADHATNEAVVRYSLRWLREMSRSAACVESTSSSADVLTSLVNVIEQYPAVTMEALQT
                     LEGFLSNATRRSRVLEYALRDHIPERLLKYLEEGLPDSASAAADVSAATIRAALVKVI
                     KALLAVPDDVHTTHIQALLDKSLVWAKYKNQSHDMFLMQTHFGGYLTAGGNTHPGAMA
                     ATLSLTAPATTEANTRSEPPPLEDTSGAPPSF"
     gene            complement(<831732..>833348)
                     /locus_tag="LDBPK_302230"
                     /db_xref="GeneID:13385643"
     mRNA            complement(<831732..>833348)
                     /locus_tag="LDBPK_302230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862887.1"
                     /db_xref="GeneID:13385643"
     CDS             complement(831732..833348)
                     /locus_tag="LDBPK_302230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862935.1"
                     /db_xref="GeneID:13385643"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:E9BLW6"
                     /translation="MDMMSGLGTDTVEAGGVVEELLVSTWPQSRRFLESRILQTADMQ
                     AEDMISGDGGSQHIEDDSISVTPSTSAPSPAPRSAAATGAPPLAPRPLTDTSPLLLRP
                     RMQETEMPADPRTRLLDLVITNTTASITLAEMEQEMNWNAQYAATYGPLKEYLQSYQS
                     IFVVSPVDDRVRLRRLFSIRTNALAREVRRSTPHSSSLSSRQRHGRRTGRDAAHRSQS
                     AADRRTGKPSLPSAEALAAHIGSVSYSCIAERLDLDALETVYHRRGYKTEIAHAVLHV
                     SSENCFDLFLFSNGAVVWWGMDRKNHWMVDDDFLSASNHLLEGVVHRYPQAEIDALFP
                     IWCSYELDEQCEVVQTPSTLGFQPLAVEPALDRLAKVLCFDHYLVPASEPARSLVMLT
                     FSHSLGRSAGVDYFEYVTKWSHRHILSTPAEFTGLLDYYSTKRRIARLEGEIAVAQLA
                     IQSAHDIPDVLWEAPWLQGYYDLAEQQNTTESRLSWFNSRSDTLLEQLSHIKGRRYRL
                     FMLGSDVFLIVLLILDVIFMTSRLVAKMYF"
     gene            complement(<835006..>835761)
                     /locus_tag="LDBPK_302240"
                     /db_xref="GeneID:13385644"
     mRNA            complement(<835006..>835761)
                     /locus_tag="LDBPK_302240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862888.1"
                     /db_xref="GeneID:13385644"
     CDS             complement(835006..835761)
                     /locus_tag="LDBPK_302240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862936.1"
                     /db_xref="GeneID:13385644"
                     /db_xref="UniProtKB/TrEMBL:E9BLW7"
                     /translation="MRRRCLLVDTIRLSDFADMEAVLLRCPKFYAKESLVTVFPEAER
                     RVRFIQAAQADGESSEANYYLLYTFQSSDFVPGGEPARLDSGELQKLTSEDDGAATLE
                     TSAAPSSVCSPLKKEEDGFSALIQYSPASVEWKDRSRERFFSFMAAAQARLEKRLGSA
                     NKSSSRFFMDWPDPATGLPLCTERGATIFCDADAILQFFSFNSVLIAGPGGGCRMIEH
                     PRFGLNVYPAAGVLVLPRDAEEALRETIRSFAA"
     gene            complement(<838279..>839199)
                     /locus_tag="LDBPK_302250"
                     /db_xref="GeneID:13385645"
     mRNA            complement(<838279..>839199)
                     /locus_tag="LDBPK_302250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862889.1"
                     /db_xref="GeneID:13385645"
     CDS             complement(838279..839199)
                     /locus_tag="LDBPK_302250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862937.1"
                     /db_xref="GeneID:13385645"
                     /db_xref="GOA:E9BLW8"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BLW8"
                     /translation="MFELVTYAYNGVLTAVHRSFKIQKETPKTLTDPGTFLAGAVAGG
                     LGRVAALPCDQGGPKGIMQTVGRRIPQFGFLMMFYCPIAHKLLPGLEEDPVSKMLTTF
                     MIGAFAGLNMRLVCNPISRVMDESRRTGKSPIDTARIMKNKTILHFWYTTPNLIANAM
                     YFGTLFTVFEGLRRFNERNFAAIVQNEPAEDTFVVREEVQEQLVGQRPRHRGPAVVDH
                     NWSWKNYTTTVASNFVLGGAAATVASTVCYPLSAHQYMQTVIHDSAICRGLTPTLLKE
                     VPMVAVMFGTFSAIQPLLAPRHGVRCGFGY"
     gene            complement(<840629..>841744)
                     /locus_tag="LDBPK_302260"
                     /db_xref="GeneID:13385646"
     mRNA            complement(<840629..>841744)
                     /locus_tag="LDBPK_302260"
                     /product="zinc-finger protein, conserved"
                     /transcript_id="XM_003862890.1"
                     /db_xref="GeneID:13385646"
     CDS             complement(840629..841744)
                     /locus_tag="LDBPK_302260"
                     /codon_start=1
                     /product="zinc-finger protein, conserved"
                     /protein_id="XP_003862938.1"
                     /db_xref="GeneID:13385646"
                     /db_xref="GOA:E9BLW9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:E9BLW9"
                     /translation="MSRCGTCNVVLENGEVLRAHYGSEFHLTNVRRRVDGLRPLSQQD
                     HRFSRNEMEGAVLGEKGTPVYSCTLCKKTFHSVQTLQTHIRSTAHLMRKEKRIIARDS
                     ETASMLTSTSLGSAAMGLHRRHNAKKSAAARGDAKPKTAPKVDAEEREEDASELRCMF
                     CGFLSADVGSNVHHLECVHSFTIPLTAHCTNQAALLAYLARKINGLMCIVCNERTRSF
                     SSLEALRDHMRETNHERLILSPEYQEFYDVVLEDPEAARPVQLEGVRGDELVLAHDKA
                     LGKRRVVLKRENDVPRARPRETEEHNEKRMAILAEEQETRALARQEQKELIMAQNKEA
                     AWVAKRSGGDRHNLQLDVSMRTNRLHPKGYDGNMMFS"
     gene            complement(<843592..>847431)
                     /locus_tag="LDBPK_302270"
                     /db_xref="GeneID:13385647"
     mRNA            complement(<843592..>847431)
                     /locus_tag="LDBPK_302270"
                     /product="phospholipid-translocating P-type ATPase
                     (flippase), putative"
                     /transcript_id="XM_003862891.1"
                     /db_xref="GeneID:13385647"
     CDS             complement(843592..847431)
                     /locus_tag="LDBPK_302270"
                     /codon_start=1
                     /product="phospholipid-translocating P-type ATPase
                     (flippase), putative"
                     /protein_id="XP_003862939.1"
                     /db_xref="GeneID:13385647"
                     /db_xref="GOA:E9BLX0"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9BLX0"
                     /translation="MRRIRLLDEAVGNQYCTNLVINSRYTVQNFIFKNLYEQFSRPLN
                     LYFLVVAVLQFVSVIAPVNPLSTLLPLLFAFTLTAAKEGYDDLKRHRQDHKYNHTLRR
                     VLDTEKVAWVSRINADIRVGNVLLLREDEEIPCDVVVLGATSGVYIRTDNLDGEIDLK
                     PKETLQLTTVDPGNLSRRTRAVCDVSSETEPPPAVNVISALTGVCLECPPASAIMDSF
                     EGCADLQPTAQATVSCVGAPSGRVPLTHHHLLPQSCVLKNVAQAVCVAVYTGDDTKCG
                     MNKREAPVKWAQIDKDVSRYSACIFVCQILNALVFGVIGFVKNGSMHDMAWYLPLPVS
                     EASGSAVIYPLRFFLLTTVMIPVSFKFVVDVCKYYMARAVEWDISMMHTAPAAAGSQR
                     PDQSQQIGCKVKNSSILEDLGQIDYVLSDKTGTLTQNVMELDAVTVCPGHHISVSKIA
                     DTCATLPEELKKQDPATLATVRRFAQMVALCNTVEVAHPQASSGAGPSGAAIAYHAAS
                     PDEVALCVGMRKLGVSLVYRNEHRAVLRVRRGEGSSDTVAAAALGACSHGNSGIRVAG
                     TDDDAEDELTWTVHHTLPFSSERRTMGVVVEEPGSGRIWFIVKGADDRVMEMASPPPS
                     SSDASWHPQNLPLHPECAAKLSLYAHRGFRTLLVACKELTRADLSVFLRNIAEASCLA
                     EGRQARLDALRAQMESGVTIIGITAIEDKLQDDVGETISDMLLAGIKVWMLTGDKMET
                     AEQIGLSCGLYRASDMVIRISETQCSTDLGRGTCERGDAATNARSWREELLSFPMQQL
                     PSPPSWHFRQRSAASAFVSASAAQMCGKALETRVLGFDASDSSQLSNGPLRTMALAAD
                     SVAEASGSGAGGGAFVSGGPERIAVLVVEGGSVLETILQDPTLRARFREISSRCGSVI
                     CARATPSQKAAIVRFVRGGGFMTLSVGDGGNDVAMLQEAHVGVGVAGKEGQQAARAAD
                     FSITQFSDLRALLFVHGQQAYTRTAYVIKYSFYKSMLISFIQLAYNVIGTHVSGGTFW
                     NSFSLTMWNGFYTLPQTIFYCFDRCASRVVLERNPYLYKMTRHAVDIRPGEFFGSFVA
                     RGVLQSVGLLWLSTRLYGPDFAYAESGGTATNDVTFSVSYTALMLSQVYTMWWESHAV
                     TPLNLLMLLGMPLFYVYSTSVYSDSPTLQYFGVFRKSLDTAGILSAFGVSVALMVPSI
                     IYLTAMVFQTPNPRDVLRQAEIRRQRLLLTRRDYKRMQPLWVRWFGATPEDRSVLCRR
                     CYSAHSMDGDDVGDGMI"
     gene            complement(<854358..>854648)
                     /locus_tag="LDBPK_302280"
                     /db_xref="GeneID:13385648"
     mRNA            complement(<854358..>854648)
                     /locus_tag="LDBPK_302280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862892.1"
                     /db_xref="GeneID:13385648"
     CDS             complement(854358..854648)
                     /locus_tag="LDBPK_302280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862940.1"
                     /db_xref="GeneID:13385648"
                     /db_xref="UniProtKB/TrEMBL:E9BLX1"
                     /translation="MPRLVTVHDARSLLCLRGIACPPPYFSPSLPLPTAPVRTRDVSA
                     TEANVAAYARRPRCTREVPGRRGTAVCRALFLCHVVLSRKKGLRNKKASRIL"
     gene            complement(<855859..>857973)
                     /locus_tag="LDBPK_302290"
                     /db_xref="GeneID:13385649"
     mRNA            complement(<855859..>857973)
                     /locus_tag="LDBPK_302290"
                     /product="tubulin-tyrosine ligase-like protein"
                     /transcript_id="XM_003862893.1"
                     /db_xref="GeneID:13385649"
     CDS             complement(855859..857973)
                     /locus_tag="LDBPK_302290"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase-like protein"
                     /protein_id="XP_003862941.1"
                     /db_xref="GeneID:13385649"
                     /db_xref="GOA:E9BLX2"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR027748"
                     /db_xref="UniProtKB/TrEMBL:E9BLX2"
                     /translation="MFRHHGRLCAAVAAAVAAKAGESASSCSSKSSSLMHAVESVSPM
                     PVYLKPSSSPQRKASFYFPRMREKCPPDYAFQPSSLGTALPLFSITSSSCEYYALRLP
                     LLKAGFRRVPAEARDVASNLVWGRSMRFCEMLRDGQPTPLLDFPAADSSEQAAYMDKL
                     RMINSHQRYNHFPLSHANLGCKRGMAVNVRRAFKDAMQRATTPGERKAVQSRYSYMPR
                     TWFYPQERESLVTAMKAAPSNRHFIWKPSRGSCGRGILMSQGGTAHAPSWERIMEEID
                     CKAASKETRRLFSSYVVQEYIENPLLVEGRKVDLRLYVAVTSYNPLTVYWHEEGLVRF
                     AAEPYSDATSASSSSIDGDGMEVGDGAGLPGALTGGTSRESAASRNRGDHDSGSAALS
                     DHCPKHMHDRFRHLTNYSVGRRYVATHGNGRSVLSFPTETNAVDGDEAAPALKWSLQR
                     LWDYIDAGGGSTVTIGTGVTPARRASDAVREEIAQLITRTLMAVRPVVNDAVRRVPMP
                     GSYFELYGFDVMLDASLNPFLIEVNTLPSLESSSTFDYATKTNVVADLLNLAMLEPFE
                     RNMAPGSTLWNSSQLREDLHGPLAAKDGGLFHAAETGDVDVVACGNAAVAREDVELRM
                     RDELAYARGFHRIFPAKTLSGTSSQQIKMESSASFSGLSAPPTLHQPLDLLAMCSSYL
                     ADLHAYESQGLLSEEDTWALAS"
     gene            complement(<860030..>863041)
                     /locus_tag="LDBPK_302300"
                     /db_xref="GeneID:13385650"
     mRNA            complement(<860030..>863041)
                     /locus_tag="LDBPK_302300"
                     /product="ATP-dependent DEAD/H DNA helicase recQ
                     family-like protein"
                     /transcript_id="XM_003862894.1"
                     /db_xref="GeneID:13385650"
     CDS             complement(860030..863041)
                     /locus_tag="LDBPK_302300"
                     /codon_start=1
                     /product="ATP-dependent DEAD/H DNA helicase recQ
                     family-like protein"
                     /protein_id="XP_003862942.1"
                     /db_xref="GeneID:13385650"
                     /db_xref="GOA:E9BLX3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLX3"
                     /translation="MSMNQVGFLHARKCTRRDLLGTSLGNRPASGNVLVNGASHGNEA
                     LPVPESRSATSKSLASAASAPLAPMAESECDVTNLEQMLMQIMDAAKAAASTGQTPSP
                     DSAPQSADTLPACEYLLRTCFHFDTGAFKPRQQEVCLSVLAGVSTLAVCPTGWGKSLC
                     FQFPMLVHRLLFQCRYTRWCRQAATAPATAQQSSETAAKEGQTAAPRSAGALLSSGLP
                     AHLFSRFCVVVSPLLALMEDQAEKVNAVDHLSAFVLSGKVGADREARVLAQLESPVCP
                     LDILFVSPEKLIASVPLRRLLQTQAHRLALVCVDEVHCVSGWAYDFRPTFMYVSRVLQ
                     SPLLGDPAAHPCQERQAMCAREALAAVPYLCLTATATKAVTHDIQASFGIVRTVTCGD
                     PWRANLRLQVTDLVERHASFHHLPSASGNDAEAREPSARVTQDALLEAVQQLPKPMIV
                     YVQSRADADALSGLLSSKCGQSHSPSPSAASGTRSGVFHAAHYPLPREQASPAYDAEG
                     EGTEENPNDEHAEAPRAPEVAMVIRPYHAALTQTMRSATQRQFLQGKIDVLVATIAFG
                     MGVDKANIRSVIHASAPSSMECYVQEIGRAGRDGAPSICRLLYNPFDFYTLRCRLWGT
                     LLSPSEMHSIVRAILSCSATHVGQRLMLVSVSALSAELGFSEEIIETVLFLLLTTTHV
                     KAPLAEDFSSCASPSRLPAPFKSVCGAYPLSYKVLRVQEEAGKDGDPELASSASNATL
                     HGRATPLKRRRTGATAALGGSSSAVAGVGLLLRQLGATDAVLELCRVTPNMPNQIEMA
                     NKLSMPLYEFQQRMQDLVESGIVTVAKYGRSSALLLELADSFDEAASPAGQQALASHL
                     LALHRGRLDAQVAGLRRMFSVLQRPTHEAIAAELSKEPGWCDTGLGNGHRSWRPPGRE
                     MGKLKAVSLVNAFVEENRLRIHSTYEALRALLGIRPRSLIQHGKYAGQLPLAQSWYVN
                     SPYFGALRTFELSWVLQVLAPHHLEAPTPDA"
     gene            complement(<864017..>867931)
                     /locus_tag="LDBPK_302310"
                     /db_xref="GeneID:13385651"
     mRNA            complement(<864017..>867931)
                     /locus_tag="LDBPK_302310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862895.1"
                     /db_xref="GeneID:13385651"
     CDS             complement(864017..867931)
                     /locus_tag="LDBPK_302310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862943.1"
                     /db_xref="GeneID:13385651"
                     /db_xref="UniProtKB/TrEMBL:E9BLX4"
                     /translation="MTDWRAEASRVIKAFDDALGRPPFPVNAPDDLVSKAQAVQGTLG
                     TVAAAGKLESLEGVSEVTTTLPILCASLKEGTPNHTPCLRLYRPLLLAAAHASSLSTY
                     PISYLLRDAEQVLAPQEVPSLSGSSVACTLARASTAASREVDGDDAEVEKEVTLFTFM
                     ALTHSLTPAYMRRFLRLGALEPPAAGNAANSKPGKGKGGASHAGDTDKKAHPSSPSTT
                     ASGANRAGEVGGGYSAVPCALLHSMIEAPLSEECRAVFESFVDNTAKFLACVAGDGEL
                     ARRILDVYAGHLVPKLKPSSLLPCLDAPLLDYFVDVVAASQRAGHTTLLSSRELRDVA
                     LRAWDAARLRRLGCAAVSRSIGTEDATASLLVYVFLYLIYCDLGSDETPTTPPPSQPD
                     TAATEPRLSVTESHLIAAVCKASKAVFLADRAPASCASVSSAYVQSELGVLLVEGSAL
                     PMALAPLQVFGDLLLARPAAVALWRRGLVRQLEWGTEDATLMMATATASASLVEASVV
                     SVLEGVLRGVPRSDQGVRPSTKHEQESAKGGAAKSKRKQKSAAGRSGKGSRIDAASSS
                     PNGGLPSAAAAAVPAPVPLSELLSGCCTCLLLTALLRAGAEASRGEGGSSVDSVCYQD
                     GHVLDCVVRAYSYLLQHQSQRLSAALWHKFSIFTCFMWQWAMTALCRDTEGGGMTYLA
                     SMRTLLSAPSTIAVLTALTEDTGSMLWLSPLLLPSYFFLPSTSNAAAEMLSQVLWGSP
                     CRALWIAVVRAAASGEIVGGGGKTAGQAAKTTSSLLTQQLHPIPPAFLLGLLCSQWSD
                     PIVADVAECVAATTVGAGDGTALVASLIRMRTSSACAGDVALPPTCGLAFERAPASAS
                     QHGLQRLLDEVERLQEKYLTAAKSARQEAHEEDHQRMQEQLQSVRALADAHRAFCNTA
                     EAKRAARTAEQQHVQEELQRRRAAHVARLHDDAAALERKRQVALETLRRKAMQSRVDA
                     EAARQRRFDSYRRRLESDYRVSTFLEHLQLSSARVMEVREALRTVMDSITPDDLLEYL
                     VSGKAKVPADMLDGDEDVNAADEIEASGGNVDQRTAPSTKRATDPQAPVSPPPRPPAT
                     GERRDFWADVMDGASTNRGTGSPGDEDSSYHRISETAPAPTMRTADANVAPAPHNRSF
                     HARIAPLMDLFCYDDGDEFGRVPDMLPIVRLRMASRVWPAPQVQSLGFTDVRDAFERM
                     RDRGLVCIQDDVAQLTLLGFRYHYPFHDPDGMLEVHLREARERVRALVEARKGWRRDN
                     ATDDEGSKGGEDMVAKEEEDEEDEASVYPSEDRLLPDVEFGI"
     gene            complement(<868608..>870002)
                     /locus_tag="LDBPK_302320"
                     /db_xref="GeneID:13385652"
     mRNA            complement(<868608..>870002)
                     /locus_tag="LDBPK_302320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862896.1"
                     /db_xref="GeneID:13385652"
     CDS             complement(868608..870002)
                     /locus_tag="LDBPK_302320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862944.1"
                     /db_xref="GeneID:13385652"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BLX5"
                     /translation="MHAKVLGPLAGSRIQAAHKFPQLRLQPTQHRLMTRRRQCNLPLR
                     LFHPSSVDFARHELEAGRIVEVRRDDNSLVALGFYEPHLKRVDVFDMTASLAAMLPAI
                     SEDFFMARVHEAWERRRRILPQTQSNTYRVVNGYADSLPSLFVDVFSECFVRVVATSF
                     GAERLVTPLLDFLSRRGAEDVLLDTPTLGDTARVSIVTPTISLPQLYVEGGVSHLWLR
                     PDMRMPSTENLFLINPAHRRTRRMMRDVGKGKRVLTIYDRSGSAAMNAVMTAKHVTVL
                     HREETSLEWARANLICNHSASVFKTCETVCCDPAELRVRHQQDVVYIECHPKFLSTSN
                     QWAELVRSLANNKVIGVGTMLIVAQEEAPLGVHDLLPRRKVFYGGDESKANQDCPMKR
                     RPLADALRNALEKCHLRLKFLRAFSVACDHPLLPESESASFSQVYLIEGPALEQVFRV
                     PTSSHRKVRTDEAT"
     gene            complement(<870866..>871930)
                     /locus_tag="LDBPK_302330"
                     /db_xref="GeneID:13385653"
     mRNA            complement(<870866..>871930)
                     /locus_tag="LDBPK_302330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862897.1"
                     /db_xref="GeneID:13385653"
     CDS             complement(870866..871930)
                     /locus_tag="LDBPK_302330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862945.1"
                     /db_xref="GeneID:13385653"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BLX6"
                     /translation="MSLLHRLHGARWCALRQQRRRCNGVRGVFAAAALNRGDLVLSVP
                     LRYCFITQLDLPRDGGRSSSPLLDNVKGARHLRHCNRGVALFPEAWVWLQRFSTDAPA
                     DRVSLSSAISCEAAPGSIAAAPSVMALTLSPVEAALATCVALRYFYAHALNLSAATRV
                     AHSIGPAPHDLSDRFTASLPFEDYLQWGLESIYSDASSAEAHLCLEQLSSNLRDAIMT
                     HASNVEFRFLDEAPSLFDTVLLTSLYLVRSRVLRMPLLSSTSNTPDSSCSVFAPGLDA
                     LNHCGTSPAAAAVVSAVRRSVVVRARRRISRGEEITLDYRLAGGGRGVSRGHPSHNGS
                     LLRQSVICMNDVWAARYLMD"
     gene            complement(<875182..>876231)
                     /locus_tag="LDBPK_302340"
                     /db_xref="GeneID:13385654"
     mRNA            complement(<875182..>876231)
                     /locus_tag="LDBPK_302340"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862898.1"
                     /db_xref="GeneID:13385654"
     CDS             complement(875182..876231)
                     /locus_tag="LDBPK_302340"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862946.1"
                     /db_xref="GeneID:13385654"
                     /db_xref="UniProtKB/TrEMBL:E9BLX7"
                     /translation="MPAPAVHTVFGVEDFKIDARFLSHMAFLCSPDKPVETSTLIGSY
                     AMCEICVSEPETADIMMYLDTLRSPGQQAYVGKVTSEMRQAAGASRNTAVAEAADAMD
                     AEFARLKSVFFLRVRSFVVIDTETNETVGRVVTFPGQISDDYGNNLEEHSEHGANQIK
                     VVRAHTAEELITVYIGHGQGAAMAQLCACASGGQAIVFDGTTLSELLVHNAVQHKCVK
                     SEPIDDGVERDWHILHYRSEAWAKKQDATVRATVAAARKIDAEERAANEAAREGKGPE
                     AKRKGESTTRAAEKEDCSAEKWFKKCEWITVGGIIPVVAQCRFARTGRYNAKALSDMI
                     TDYTASMQAAEDPYA"
     gene            complement(<877746..>881210)
                     /locus_tag="LDBPK_302350"
                     /db_xref="GeneID:13385655"
     mRNA            complement(<877746..>881210)
                     /locus_tag="LDBPK_302350"
                     /product="zinc-finger protein, conserved"
                     /transcript_id="XM_003862899.1"
                     /db_xref="GeneID:13385655"
     CDS             complement(877746..881210)
                     /locus_tag="LDBPK_302350"
                     /codon_start=1
                     /product="zinc-finger protein, conserved"
                     /protein_id="XP_003862947.1"
                     /db_xref="GeneID:13385655"
                     /db_xref="GOA:E9BLX8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9BLX8"
                     /translation="MPFRFRLRDPPSDVAFLSLVDGETLYNADGAATRDVKEATIRQM
                     GWHRVELPQDWFLSRHALDTSRQLVQGMQCTMQYLKYCCKNEERRAQKATAQLRRCEE
                     ELIELRECVAVYKQQLRELRQERQRARSTPSRAPLTREGQASHSRGAVDTVLQLACSF
                     CGNVYPSRHAVESHIRKRHKRLEGCAVMAAGSAAVSLKQFEAATQAPTSSAQAPPGGL
                     FVDHAPTVLQETADKCGDRGLRKEISELRLAVAKLMEQQAALQRGMPPSYVAAAPKQS
                     AGEAVTAGEAVASSGPLSGLQQRGSRLDEEDILLRIHRELLRTGAELQQLQSAVGRES
                     EQGRRSAADDRGSCNLRNDLPRKQAQQQHRDPLAAPRSTRAALTLDPQSVLHGPPRTE
                     GSDGGEAARRRGSAGESLVVVSPITPPAAARARTQHALANREDITAALKQKDVEELPL
                     MASESPCGILSGPGASLETKPPAGAMSTMSPFPSSALGLPFGGNSVVDAAGAARITGD
                     CSPDGLGATTRGGDGEQTASREPGATQLVLPSSASQSYLPWMRPESATARFGRADPAS
                     ANRYGSAPIDEATSWTRGRLLPAAEKKVPAQLNLLPAFTRRDATPTPSLAAAEVMTNS
                     KRELIPAMSTGAPRHRSFLESSEAALPGEACRRSSGATPGEQVGASAVHMVSNQHQVA
                     RDEERGRTQLAFCEQTLPGDRVASVPVLSVPGSAPFPGSAAAGAERPQCSQAAAPGAG
                     VGKGSNGGDVRESLTSRPHVPVVRAQHSLAATVQTEHGSTSKMIPAVHLVPAAASESG
                     DASLQDPQKRKEEHVQGERPSFSAFLPQATRGLDESRQQSAAPQPQPLRSGDEDSSES
                     KAGAEDTDSYSVEIPPLEASEQGDADDGPFSVPLDATVEEGSNVNEGFFGHLVMEDVS
                     SDKLADPTPYAVDDARATRLPAFGARDDDIEEDASRFMSYNLARPTDGGASTPSQADR
                     PTPESIPAGCSYYTYSYSYSDDDDEEAEEAGGTAQEGIPVKLRVNDGGKETQQPSAIH
                     DSAAAGFPESTFHADVIPVAHAEWAPTSGEVAAQREDVGKAGAEKLKKSRQGVKGNAR
                     LSAAQQGAPSPKQQPPARVGRGGKPASEEPSIVARRHSSQPSDPAPQQVVKKGKGFLA
                     KFFSKKGK"
     gap             881546..881644
                     /estimated_length=99
     gap             883373..883471
                     /estimated_length=99
     gene            complement(<885223..>886836)
                     /locus_tag="LDBPK_302360"
                     /db_xref="GeneID:13385656"
     mRNA            complement(<885223..>886836)
                     /locus_tag="LDBPK_302360"
                     /product="sphingosine phosphate lyase-like protein,
                     putative"
                     /transcript_id="XM_003862900.1"
                     /db_xref="GeneID:13385656"
     CDS             complement(885223..886836)
                     /locus_tag="LDBPK_302360"
                     /codon_start=1
                     /product="sphingosine phosphate lyase-like protein,
                     putative"
                     /protein_id="XP_003862948.1"
                     /db_xref="GeneID:13385656"
                     /db_xref="GOA:E9BLX9"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:E9BLX9"
                     /translation="MTTISQYLNERLKDKSPTQVIAITLSGAVAVRIAVDCFRDGRLT
                     ARSYQAVWRGIRTLAAPIIRKEVKKAVSGVKMPSKEGEFKALVLPEKSRSEAEVLQLV
                     TQLHHDLDLSYEKGFFSGAVYHGGRSHTAFMNDVMAIFQWSNPLHSDIFGATRKMEAE
                     IVSMVLHMYNGHLLPDAGGVVTSGGTESIMMALKTYRDWGRVTRGIEHPSVVAPITIH
                     PAFDKGAEYFGIDLIKVPVLATTGRVDPKEMEKYIRYDTIAVAASAPNFPHGVVDPIE
                     EIAEMAYKHNIGMHVDCCLGGFIMPFLEKTGRSAPVVDFRNRGVTSISCDTHKYGYAP
                     KGTSTVMYRSKELRSFQFCCVSEWPGGMYCSPAVSGSKPGNVIAGTWAAMVRMGMEGY
                     IDCCHKIVTTRETMTTELSKLPYIRIIGEPTASVFAFTSNVIDIFRLGDDLKLRGWVL
                     NTLQFPSGLQFSVTLLQTPTAVTARFLSDVKEIGDTLFAESEKLIADGKKPVLGESSG
                     TLYGTAQRVPDRTIIKDVLREFLNTYYQA"
     gene            complement(<889360..>891000)
                     /locus_tag="LDBPK_302370"
                     /db_xref="GeneID:13385657"
     mRNA            complement(<889360..>891000)
                     /locus_tag="LDBPK_302370"
                     /product="zinc-finger protein, conserved"
                     /transcript_id="XM_003862901.1"
                     /db_xref="GeneID:13385657"
     CDS             complement(889360..891000)
                     /locus_tag="LDBPK_302370"
                     /codon_start=1
                     /product="zinc-finger protein, conserved"
                     /protein_id="XP_003862949.1"
                     /db_xref="GeneID:13385657"
                     /db_xref="GOA:E9BLY0"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:E9BLY0"
                     /translation="MSARVITCGICFNVLDHPLTFDCQHSFCTGCVRRQLSENGSNGF
                     QCPLCATSHTEVHLHNLAQYADHEAEVYVEILARGTSNPPKCQWCETTSAKVQCGECM
                     CVYCEDCCIAVHRNSAKRDHAIGKLSESSRNFMTRCPLRGHEEYRAEFFCSQCRQVCC
                     AYCLQVGPHRDHLHVTVAVAAAEARQQLSRDMESLLEVKHRLEQQAAEMNRVSLLYSD
                     TYDAVENMVTERFEAFKQQLMQRELEVRRTLTNLRDSGDAALTASRRQYLDKLNSVNE
                     TLLQFHTIQNGGTDDEVLKRHSQFGKCLNTDLPAVTGSGFKVVSLGEMTLTSLDIGLD
                     LQTIEHNHPTLSRLNRSGRLSAASNMSMNGGGSVSPFAGNTLSTPLRLTFPVDDDVEA
                     TVLAEGVRLRCVASGGGDTQIGVRSKEMFQTLLDQFPEDRGVVSWQVRLDSISDTFIG
                     VVEKTSQSSQVPEGFYWKAACADVVDGRIGRYTPAVRRLPVCRNGDRIRFLYDGVQGT
                     LRIVVNGSDDRGVVVADLHPRIAACFVFYPGESLTILF"
     gene            complement(<892139..>892678)
                     /locus_tag="LDBPK_302380"
                     /db_xref="GeneID:13385658"
     mRNA            complement(<892139..>892678)
                     /locus_tag="LDBPK_302380"
                     /product="ADP-ribosylation factor-like protein"
                     /transcript_id="XM_003862902.1"
                     /db_xref="GeneID:13385658"
     CDS             complement(892139..892678)
                     /locus_tag="LDBPK_302380"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein"
                     /protein_id="XP_003862950.1"
                     /db_xref="GeneID:13385658"
                     /db_xref="GOA:E9BLY1"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BLY1"
                     /translation="MLRGLRNRMKRENEPRVLILGLDNAGKTTILNKLGVAEEHPVEA
                     PEGPTQGFNVMNVNRDGKRAKLCDLGGQRALREFWEDYYANTDCIMYVVDSSDQRRLH
                     EAHEAFVDVVKSVPKVPVLVLANKQDLATAKDPQTVAEALELSDYRDRSWHIQGCSAK
                     SGDGLEEGVAWIFDACNVK"
     gene            complement(<893723..>894625)
                     /locus_tag="LDBPK_302390"
                     /db_xref="GeneID:13385659"
     mRNA            complement(<893723..>894625)
                     /locus_tag="LDBPK_302390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862903.1"
                     /db_xref="GeneID:13385659"
     CDS             complement(893723..894625)
                     /locus_tag="LDBPK_302390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862951.1"
                     /db_xref="GeneID:13385659"
                     /db_xref="UniProtKB/TrEMBL:E9BLY2"
                     /translation="MSAHDSSAVVLIAHMNDIERQRRVLSMSQREQEAKIAFTTAEKE
                     QLVQAAKAAEAEEAQLKDDLEVLAAEQQQLELQKMEATDRLRKTQAEEALHTAAIEVD
                     LQTLAKEKVLWHERAQDLESLRRSWEEDAATSSCIGALRQESEMLALLKTEKTAVEDA
                     LAETMAAIEKVRAEQQARLTCVGPIGAAADAVQCSGLARALASMHDSALSDGNSATVN
                     DDDSAAALEEEMKRADYEAAQATARHGRTIAVLQREVDALSTRAGELQQLLSSIGASR
                     QEVLSRTRDLQHCKETGLCRRCFT"
     gene            complement(<895333..>906705)
                     /locus_tag="LDBPK_302400"
                     /db_xref="GeneID:13385660"
     mRNA            complement(<895333..>906705)
                     /locus_tag="LDBPK_302400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862904.1"
                     /db_xref="GeneID:13385660"
     CDS             complement(895333..906705)
                     /locus_tag="LDBPK_302400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862952.1"
                     /db_xref="GeneID:13385660"
                     /db_xref="GOA:E9BLY3"
                     /db_xref="InterPro:IPR000585"
                     /db_xref="InterPro:IPR018487"
                     /db_xref="UniProtKB/TrEMBL:E9BLY3"
                     /translation="MASSITPVALPSSALLNPKEAAAFYESVCRSEGVFIQSTFLKQL
                     LLGSVIIQFENGYLGESGVGPIIRTLQCTPLRALLLAKCALSTEDMKIVCAGLAQHPQ
                     LEKIDIRGVPLTIGGAKELLHLVTHNTRITEVLMDESVPKYVAIQQQCNRHAEATHQI
                     SECMICGAAVSSKAGTSCETLVTRLLLEYLMPASKSVSVAGLRVLCGAWQECLNRNKG
                     ILAVCAGLCAESLAEDLCRCVSSVTKALVMHKPYNAPNLVFLRAYLTREHMRLQAEVE
                     AEQAPQPEHGSAPSPSLLVPGPVDAVLEERWRTKRARIDIDAFFQDDNPLCLPRCTVC
                     GCPAECSQDGPTWLLRVLQKDITEHGAVVTPVALVRLWRLFGLYANLQPCSRRCVRHL
                     VRYGLYGYGGVNCSYASGYPPLSSAAGGHAALQRLPLVNFSVVDIEREVVEDVCGGEL
                     NCALTVASALADEEAAPMDPYLLFAIGRQLRRQSVRTIGMDLASACEAARLVGCLPVS
                     EAPFKYRGRNSTAEAPPRDLVADWATWSSSSGEATVRKWLHRAFAHRRQRVCVVDGPH
                     RDLFDNIRAALWTLRRQARSILVTVKFVVAWLSLPNGVIAPDTSVHKHGFYTTAKVIG
                     QITLHSTVYIILQFPFGIHVGYKGFFYLPKTVFLQIVRGLAFVFLDTVGIEYRSAGRA
                     ACVHGYELVGRPVGATSPDALALLRRLLMCLMVLGLEQRQAAVTVWGAALGSCDVKEM
                     RRLLSHEHLPAPLRFLRSLLEARQVAMAAPDLSDCRPGMGRRRQGHATASRTYWERVL
                     LFSRFPSQLLFFFSELIGTRECFDWLQEALRAASAVLTTAKDGGTSDQAALSLSTVKQ
                     GADLMSHPLTSTAERQWIVTLPAPSQVVTMVRVPEFSLQLDSTPTGVAARRSTSASQQ
                     RRSVRREQMISMAPKHAAAKTPSPPSALPLGERRRKTLRQSAVTSSAPKGSLRAKSAE
                     SQASEEGMSTTNAASTALRTESRPSFPFDQNLQHQLHRKWAGERAKRQESLQAASSVG
                     ILEFLRALRQPRSAVKQLRRGSNSALQRMHADDMHALDASNCGDAPAAIPGRLLGKPW
                     LVLPFPGSTGNSNNTATSSSSPVSDILLLFIGDTVSAYSQCESRLLCGPVAMCDDPLL
                     VDFPFRTGVDAAVAHPTEPHLAFFFSGREWLLFDFYLAECVDGPYATSSHGQFRRLPS
                     IFHDRVDGVVHIPHTQLLVFFRDYCYVVFDTSTRHCVGGMGFLDPPSRETVGPGGPPV
                     LAGHNSSSMPPALMDLIRTLQQTTAASQNAKSAQMQRDKSSDVDSDADDDAARAMAGP
                     SSIGTTALPLLLSVQLQGLLGTAPMTAFCIRSADSEKSTEACYVVSRTGAVIPVCWQP
                     LEDVASEAETQESGAGVRPERQRRWLLNVQEHSSPTTETPLRNLPLLFRQFTTAALAG
                     LCKLAVETECTLTHPCTVSAASSPQLSVFDPERQVQTSNVSPLAAVAPHDAGTERNSA
                     TANTSSGAPYSPEGSCGKPLSTSPLTRITSSLIATDLGERVPLALSRCWSAQETGIEF
                     TGNSTWHDEVFFYGDAEEPQRPRASEISDSLAAEGQSSPPPPQQEASGGAADVDGVQR
                     VSFIEYDLGASAPPRIFTALLLVLDTSALPSSLLQLSSLVASVDSSTDGTMYFSQALV
                     RITSPVVAARWGSGAGSVTFSAARFWRLRFRTPVPACLGVVRLFWMETAPGSFAETQL
                     PAPTVLSPCIPVTLTAPPLPREPSAGDGDVAAAQPSSHSGRAATGDPLIIEAEELFQA
                     SRKLISSDNFHPVFADDPSRSGAGWFVPHAVMPVLVSSSISTCVFVCASSILQLGWAH
                     QGASSASPQAEAQPMVRRTGFRDIPYPFVLGWDAVFYVAPRKHPGRVALLRGDWMLLW
                     DLHEQRPLSDVLLWRTSALLGKLGSLPIATVIAVINCWSSEEGDAVIGIFHVASSLEE
                     REVKYVEFDLETGAVLDLPVLLAACLTNRFRAPPPPPGSTLHTVLCTPSSPSTWYMFW
                     DRSVQRVSRAELMAENGNGGDDGVAAADPLSESRLFYSVPLYLSEWGQPQHHCSVLLD
                     VPQLLKDAQGESGDDLMITGMQLYSAGGRAGERTCWQVQCSENGGGEWKDVAMHYQAA
                     GGRVCGDTLWTPTDACALSKCPYWRLSRVASSQDPNAAFAAMPSSTASESAVAQSYSQ
                     LRLLTVPRRRCRQLPTRISGDAATTPVADINSFFSQRATGVVTLSLQPCASATATPLS
                     PSPDGVTYELMWDYGSSPVALCSVAFEPRDTSPFTVQCTWTMWHSSTAAGPGICSATT
                     TKLIRGSDTCGRCTLSWLPDGPYRYWRLQCEWRTIAGAASGDCPPSSLIISSFSAHEY
                     DGPLITVYNADGGCLRATPLLWPMADRATTSPYQLQCVANSVIQLMNVPLGLTLWETE
                     FFGERGSCTARIAVESTNDARQWYIAAETTICTAMATASRPQLCSLSWPSCGAHVLWR
                     LRVLESSADVTLHLTRVRLGHRPTASHISIFVPQPTTSNPSSAATAAATVGALHRNLS
                     VTAVAEAPVEHASVSMLRLTRPQRMVRVRATLPSSAARYHVEYLGLDGTSWLFAAVMD
                     SGCADALYSAYSSNSFSAVVASVSWDGTLVSPSTHWRLRPVNETSLDQPQGVEWFEHS
                     SEYAELVDTAEIPGMIVSTSGFTEVHLPSMLSGSAPHRRTTEESTARIAPPMPVLQCA
                     AQSLQSSDTAQDSTPSAVTWSFLSPVMFDQVLLFVQYTVDKPVAPAVAEALGEESGGS
                     ASADAEAPAPAPPAPQVSANQPLQQVLVETSDNGQDYVAVAETVLRLCDQTVSLRWVE
                     VPKAAFWRLRFTRRVVPPEALPGEAPLPVDKPFTFTLSLYAARWLIRRGGHALLAQVA
                     KPTPGHYTNTIFRSWISEAFSREGAFMQSCLHAFEEYTRAQNQPRQTDAISRLGQVAG
                     TVQKMKQMYQSFLQKAAKEAGSYMRLGGEEAAQEADGRSSRAVAPLLPPSIPAEVSEW
                     LSKEHLSSDIIYLLVASTTATSIGGPHVLHLAELLNHPLAFRQALQFTKRTTSWFYPC
                     LEAVGPLAEDWYGFPASRVCASLSVFWSLSTLLQRQLGALLSTADAITPLSEHVASPL
                     VVVRVTESNWDPIHHFPTVAPLLYAVGFHERPFTMAFAINDIVFTPPYAMGVPSTRDS
                     QPLVSPYPYMIAAGVNFVQQCPLACCPAPVMDVLRYILPASAFVVDARGNAIVLTTLV
                     LTVGSLRAGSGVGGEERSAVLRFTVSGNGVNFGLTGLVMESIEFEVLMLSADGVSADR
                     DAPAEQRFHQMNFVSHGARFVGGAGALAGGRPVAQPENDVSTPEVELPLSLMGAVDSD
                     GLPLVSLRGDFGNARFATVAELPGAVVTHLQFTTICHVEGSVPVVDASSTGGGEGDSN
                     VAHWVFAPLEGEGQVLLPGVLCSCNCACTVDTTWGESELPVRLSSFHIAVDRCAVEDL
                     EAIFRACRGDERDLGQELFLSARRDATAYDVGGLRIEVAASLRVLTGHVVDDRVRLSL
                     KGMAVLSLENTAIPDATLEMDCEAGFIALTARCVHSLVVGAILVEGCTEKPILMQLLR
                     PVGVPRGIGERTDQGSAPASAIRFLVCGYGRLFSAHHMAQVTLELSQSTERFNSVTLV
                     AASLRHVGLAVTLQDCVVSEVWRFAQMTINERALRGVIERDMGGVPIIAAMQAHQIPL
                     ALSIASIAPEPYDLVAQRLSCRVKGLLYGTCFDVVTSVVAPDDSDDLWSLLGAQCIPA
                     MLEQCEANLWASYANVIGLRETSSGCRPDTDATV"
     gene            complement(<909727..>910548)
                     /locus_tag="LDBPK_302410"
                     /db_xref="GeneID:13385661"
     mRNA            complement(<909727..>910548)
                     /locus_tag="LDBPK_302410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862905.1"
                     /db_xref="GeneID:13385661"
     CDS             complement(909727..910548)
                     /locus_tag="LDBPK_302410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862953.1"
                     /db_xref="GeneID:13385661"
                     /db_xref="UniProtKB/TrEMBL:E9BLY4"
                     /translation="MSGFHQADAGTSSTHYLPKTSSNLETVRLAYGAFLRLCLHSTVY
                     YGSQGFVAEKVFGNKGAMIISEREAMRYVLSMGAEVGISVLLMPVRYLAASTTPRFML
                     DYMFTRWSDVLALLDRFNPSTYASYAIYAFASSDDEWNFDFFTWQIPSVLMTIGKLIA
                     RRRLVGSARCRTKRVFGVLLSQLILRAYMSTFSVMIPEQGSEAVVAILVTVLEGMATS
                     YLARHTWPFPWDDVTHTASTNTTSSSTAMVSEGADTPPRDHSRSTEKPCYDADWK"
     gene            complement(<911310..>912587)
                     /locus_tag="LDBPK_302420"
                     /db_xref="GeneID:13385662"
     mRNA            complement(<911310..>912587)
                     /locus_tag="LDBPK_302420"
                     /product="pre-mRNA cleavage complex II Clp1-like protein"
                     /transcript_id="XM_003862906.1"
                     /db_xref="GeneID:13385662"
     CDS             complement(911310..912587)
                     /locus_tag="LDBPK_302420"
                     /codon_start=1
                     /product="pre-mRNA cleavage complex II Clp1-like protein"
                     /protein_id="XP_003862954.1"
                     /db_xref="GeneID:13385662"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="UniProtKB/TrEMBL:E9BLY5"
                     /translation="MQPRKTHTSLHLRQEAVTIQWNAGQEGGSVLLLSGKVELFRSSL
                     TRNLRYAFPAEACIVLEAFGDAVVQIDGDAITVQTPISGALDEIHALLDTARVDAMLA
                     IDERSKKSLSSSEELKDSWQGPRVLVVGENQWEREVVSRALLNLAVRHGSPYGICYVD
                     VDVAMPMVGCPGTVSAAFVEEPVTAPEDFSVMMPLTFFHGAASVTSATRKRYLDLCVC
                     AAQAATSLGFANSKFEAGGFLIHSLSPSTDIQHDVLSDVLSIFAVTHVVVTGADWELE
                     KFLNNAVVGRTVHFVRLPKLAGGQSPSAAGAEQRRRAQLEHYFFGTPRTPLMPVRGVA
                     RMSELVLLHAETFEPLSWREVPDLGLAAVVWADTAASAVEANVAGFVALLEVGKQFVS
                     FLAPSGGELPKPFLVVSPSLHLPRELVMPLPVT"
     gene            complement(<913555..>914055)
                     /locus_tag="LDBPK_302430"
                     /db_xref="GeneID:13385663"
     mRNA            complement(<913555..>914055)
                     /locus_tag="LDBPK_302430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862907.1"
                     /db_xref="GeneID:13385663"
     CDS             complement(913555..914055)
                     /locus_tag="LDBPK_302430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862955.1"
                     /db_xref="GeneID:13385663"
                     /db_xref="GOA:E9BLY6"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:E9BLY6"
                     /translation="MDVDSEYEQMEALRLKMVFVVSSRVQPKITAQEVAVLTASAGVQ
                     LVELLQQETKLSAAVSVPASESLCAADSQDHQRWRHWYLWWNRIGCGKITLKCPDKDT
                     MELVVATARKHRLPMAMARRSETAVTGGEQVEIVAKPSDVVVVALGPAPSDVLEPITG
                     SLKLFS"
     gene            complement(<915427..>919089)
                     /locus_tag="LDBPK_302440"
                     /db_xref="GeneID:13385664"
     mRNA            complement(<915427..>919089)
                     /locus_tag="LDBPK_302440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862908.1"
                     /db_xref="GeneID:13385664"
     CDS             complement(915427..919089)
                     /locus_tag="LDBPK_302440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862956.1"
                     /db_xref="GeneID:13385664"
                     /db_xref="UniProtKB/TrEMBL:E9BLY7"
                     /translation="MFKSSLATHSSIDHDLFPLLTVRSCVSEADESKNGPRFCAEDKM
                     TGGAYEIRSRKLDLEAEQLVDGVGCRGTHRNLSPNDLRAIRRQQERIDALLTATAHCA
                     VPPCVALPIDVYIQEQPSTGHTYVASVDAFSGLSLGDIIRSGWGMMEESVFLEILNAV
                     EAFGYASASLPPHGNISSDAIKQLLIVRDGASEARQPSRWVVSDWLLLSDDSVTSFDP
                     QAFVADLEWVLHSSFAQLHISTTTTQGSTFMPAARVEELVTETVDRIRAHLLHQGAEA
                     HHTSSADALAQPSDGGPQTDMKAFHAHLDASSSGVTDVDGASARQTSASNEDGVPTSF
                     DTTYENTANWDSGATGSALESQATAPPSSPPRSVPDPSTTTASTAAASSLNTLPAASL
                     VSNKSQDSRGAADKRDSAKEAFRVARHMSLKDKVAYHQAALRREQLLVNRHRRKNAPL
                     PPRPQPVSVHLQNARPFLSPSASEEDEEFYYDPPALTSPIDVKPSAYLMQGRRSSPNR
                     RGAGSARKLQSPRSARTLNGEARTPCERSRSSTTPPPSQRSQATSHASASCDQLRERL
                     LDDVVSIAVLNQRRRAEDHLLQQEAERRRREQRQQVLSLSTPPRGVAGQRLSTPNLLD
                     NPGASISYPAAPSSPSVEAKAAETGDNHRRASRRRGTAPCGSAANVSHGGSASPSGCC
                     LVLTAAPHDAAMNRFGDASKSPEPTPPSPHWCRIVRPTFCENKPVVKAAAGTRVALPR
                     ASARGAASTAVASRLPQTAGKTTAPSQTVLYGLRTGTASTIVRSDAAKMPVTARAAAT
                     MGGVATAAMARNGSNLSRQLAAGTVPRSSRSTTTAGNRAAWAVGQQQRSARARAAAPL
                     VQRNTRASTSSPLSSPRQKTAQQSAAAPCVKPLPFASFLGCLASPREAPTLIGASSPP
                     LASRAAVGQLVPARRAAATTSGSLSYSNGSTRKYVMDAKFQALRCPNTARPPPTQLRL
                     ATSPRVYQRVSSTGVLRSPRNGVGVTPLRQPSAATPATAPQSSSSIREVSRSVLQKPA
                     KLEAATPIALRTTQPRLPVAADSASAKGRASVSRKPLQRLVLQKGSPGLSARHADTLD
                     TQATDLPPTSANEDSLTSPHTPPPPSPPPLASTNAAAAAAGAVRRFTCTDPLAQSSVA
                     EVENHAPRGRNAGGSSLSPGSRSMEASALATQRENKGKAHVAGPCAEPLTLGSVRPVK
                     KASPGILLLRHRSSTM"
     gene            complement(<923209..>925554)
                     /locus_tag="LDBPK_302450"
                     /db_xref="GeneID:13385665"
     mRNA            complement(<923209..>925554)
                     /locus_tag="LDBPK_302450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862909.1"
                     /db_xref="GeneID:13385665"
     CDS             complement(923209..925554)
                     /locus_tag="LDBPK_302450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862957.1"
                     /db_xref="GeneID:13385665"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:E9BLY8"
                     /translation="MWGTFNGDEARLPLCDDDDDHEASSSGDGGEDGVLFVPDPVFDL
                     TSLQQKAVMPCLTQDQLPLGATVWVVDEDDVATQLTCNFSASYPPVCNGRLSGEVVRH
                     TGHMTLVRFRSKASDLYFTLCLPTSCLSLQPIEPYDSVPHHDDSYGIGSGAYGMLGPR
                     AACRGGAETCGSDGFVGHCLFEAMPAYDFEKVRGTTLEKAQEAFFGGIFEKALTSVNE
                     YIDAQPTSPTASASTEKDPSVSLATSGDAPPKAAALVDALILRSRIFVFLERYHEALA
                     DAQRCVQLEPRWVRGYLSVARAHCGLGQFSEAAAATAHACIILPYSLELERIRELNNH
                     MHYLQSQLRAEKASCYLVLDCYYRKRLCINASVTAETLLCTEATPIVATHSVFVAKEP
                     PHRCPVCFRVFSTAEQPGSVAADPSSAALTPEAANTPPTNDISPPLSSPGGTDIGDDV
                     EYCSTECTQRASLYRPLELKHRAPLAQVRSLILSKGAVTLNVLPLEMAAMTVRLFLML
                     VTIHRRLSAKRRIEDSSRRNLDGEAPCSCHDKMRTWPDVDAHVSSALASSQCPSPSPP
                     LQVETSLRRLGVYPLCTEPIAHNKLDELKIVYDALTADFKAEDRAIFSYEVLSQLYAY
                     VSAYFTPVDLNSLQPPDSPGGTASHQTVFYLPHYVGCIETAKVISYTAASRRRRSSEE
                     SAHAEDDLLASRVTERPTMSEMAVPSSRQSSSTHSHASSTSTATGDANDRAAASSSDA
                     NCIVRMAPPPALLELVTVVPVNREGKLRCVPVTIALDSDVA"
     gene            complement(<928918..>929928)
                     /locus_tag="LDBPK_302460"
                     /db_xref="GeneID:13385666"
     mRNA            complement(<928918..>929928)
                     /locus_tag="LDBPK_302460"
                     /product="DnaJ domain protein-like protein"
                     /transcript_id="XM_003862910.1"
                     /db_xref="GeneID:13385666"
     CDS             complement(928918..929928)
                     /locus_tag="LDBPK_302460"
                     /codon_start=1
                     /product="DnaJ domain protein-like protein"
                     /protein_id="XP_003862958.1"
                     /db_xref="GeneID:13385666"
                     /db_xref="GOA:E9BLY9"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:E9BLY9"
                     /translation="MLSLVHSRRLLPQRDPFKILGLTRSATKAEVKMKYRELARIYHP
                     DAGSGDSAKMEEVNHAYKLLLKEGGYERLHLPGSSRARPHGANGPVGVTSESRRELPR
                     ETATAPFTVDQQSSGTAGASSGASAGTASSLLTDEEAEKVSALDPATERRTPEGKYLY
                     QSRDDQSWVELDRPLLRAQQPHYASFSAQADMKAELRRRAVLKEKEQNEKSRFQRTAD
                     RLADSAELPTQNPHLLRIYALVVVCVFYLMYKRTFERTHHQRKRAKFYQALEENREEL
                     MATYEKHKEGLQVTAVAAALVFLAAAEHKTADDPVVPSPPEVFYRSVKPPSDHYTVVA
                     GG"
     gap             931074..931172
                     /estimated_length=99
     gap             931625..932534
                     /estimated_length=910
     gene            complement(<932536..>932805)
                     /locus_tag="LDBPK_302470"
                     /db_xref="GeneID:13385667"
     mRNA            complement(<932536..>932805)
                     /locus_tag="LDBPK_302470"
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003862911.1"
                     /db_xref="GeneID:13385667"
     CDS             complement(<932536..932805)
                     /locus_tag="LDBPK_302470"
                     /codon_start=1
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003862959.1"
                     /db_xref="GeneID:13385667"
                     /db_xref="GOA:E9BLZ0"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ0"
                     /translation="MFARRVCGSAAASAARLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTF"
     gap             934890..934988
                     /estimated_length=99
     gene            complement(<934990..>936495)
                     /locus_tag="LDBPK_302480"
                     /db_xref="GeneID:13385668"
     mRNA            complement(<934990..>936495)
                     /locus_tag="LDBPK_302480"
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003862912.1"
                     /db_xref="GeneID:13385668"
     CDS             complement(<934990..936495)
                     /locus_tag="LDBPK_302480"
                     /codon_start=1
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003862960.1"
                     /db_xref="GeneID:13385668"
                     /db_xref="GOA:E9BLZ1"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ1"
                     /translation="MFARRVCGSAAASAARLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTFYAVKRLIGRRFE
                     DEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV
                     SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYD
                     LGGGTFDISVLEIAGGVFEVKATNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKER
                     MALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHISRSKFEGITQRLIE
                     RSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVA
                     LGAATLGGVLRGKVSGLILVDVTPLSLGTSVVGDVFVPIIPRNTAIPCTRSHIFTTVD
                     DGQTAIKFQVFQGEREVASKNQMMGQFDLSGIAYAPRGVPQIEVTFDIDANG"
     gap             936575..936673
                     /estimated_length=99
     gene            complement(939138..939296)
                     /locus_tag="LDBPK_302490"
                     /pseudo
                     /db_xref="GeneID:13385669"
     misc_feature    complement(939138..939296)
                     /locus_tag="LDBPK_302490"
                     /pseudo
                     /db_xref="GeneID:13385669"
                     /db_xref="PSEUDO:CBZ36270.1"
     gene            complement(<940688..>941737)
                     /locus_tag="LDBPK_302500"
                     /db_xref="GeneID:13385670"
     mRNA            complement(<940688..>941737)
                     /locus_tag="LDBPK_302500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862913.1"
                     /db_xref="GeneID:13385670"
     CDS             complement(940688..941737)
                     /locus_tag="LDBPK_302500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862961.1"
                     /db_xref="GeneID:13385670"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ3"
                     /translation="MGNAYEPPTKTACRLEVVGMVSSIRYDCTTSSCLVTTILNGTHV
                     FNLDDSFYGANLAAGLSASNVESYPYHSIGEEPLMSSCFFNAGQLFAVGSSCGSVTVV
                     SRRSRALTSCYATPDSFPIRSLSEIPAQPNCLLTCTEQGAAIVDVERSQLRMSLANPA
                     AGRAVAAVPLQLHTFIVANYDGKVLLYDTRYRSSPSSVLSLPDQITCLAVARDTSEVC
                     VGTVGGRVFTLRCAEGPQREQAFGMSNRRSPVRCVAIDNGRIAAGDLAGRLALIDTAD
                     VPDPTVYWSAETLLRLSRPSGRAGTLDVPVDTAAASAAFSGTEVTAVALAQGTAWMSF
                     CSPKNATSQVVAIPA"
     gene            complement(<942258..>942866)
                     /locus_tag="LDBPK_302510"
                     /db_xref="GeneID:13385671"
     mRNA            complement(<942258..>942866)
                     /locus_tag="LDBPK_302510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862914.1"
                     /db_xref="GeneID:13385671"
     CDS             complement(942258..942866)
                     /locus_tag="LDBPK_302510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862962.1"
                     /db_xref="GeneID:13385671"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ4"
                     /translation="MSYIPYPSAASRCTTTQTSGDARGDAFGEYATYRRVIRTVLCGV
                     LFATPLCAAAPMSPLLKLSQTQENKKSIIPRMMSDFFYVNFLASTAAYWVLVEPFIPN
                     PRAKEGFVPYLGPVTAEIPAVSCLFVSHLFYPGLWAIVNEPTWKLRRREFVRLNAKCF
                     VAFGPVHVPAAVGLGMAVGVVLYPFKYMKLRAQRRDERQHAS"
     gene            complement(<946476..>946826)
                     /locus_tag="LDBPK_302520"
                     /db_xref="GeneID:13385672"
     mRNA            complement(<946476..>946826)
                     /locus_tag="LDBPK_302520"
                     /product="AAA family ATPase-like protein"
                     /transcript_id="XM_003862915.1"
                     /db_xref="GeneID:13385672"
     CDS             complement(946476..946826)
                     /locus_tag="LDBPK_302520"
                     /codon_start=1
                     /product="AAA family ATPase-like protein"
                     /protein_id="XP_003862963.1"
                     /db_xref="GeneID:13385672"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ5"
                     /translation="MAEGGGTGPGPCDCTRLRQVWVGELRAFKQSWHSTAPHLRTFSL
                     WSILHVTRSASVLARMGLIFLCSPLFLYRAHSHVFFFLLSILSASRIPLRASSCSHCF
                     FNARKEAARATPPA"
     gap             949009..950381
                     /estimated_length=1373
     gene            complement(<950383..>950652)
                     /locus_tag="LDBPK_302530"
                     /db_xref="GeneID:13385673"
     mRNA            complement(<950383..>950652)
                     /locus_tag="LDBPK_302530"
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003862916.1"
                     /db_xref="GeneID:13385673"
     CDS             complement(<950383..950652)
                     /locus_tag="LDBPK_302530"
                     /codon_start=1
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003862964.1"
                     /db_xref="GeneID:13385673"
                     /db_xref="GOA:E9BLZ0"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ0"
                     /translation="MFARRVCGSAAASAARLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNPQSTF"
     gap             954963..955061
                     /estimated_length=99
     gap             956206..956929
                     /estimated_length=724
     gene            complement(<956932..>957189)
                     /locus_tag="LDBPK_302540"
                     /db_xref="GeneID:13385674"
     mRNA            complement(<956932..>957189)
                     /locus_tag="LDBPK_302540"
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003862917.1"
                     /db_xref="GeneID:13385674"
     CDS             complement(<956932..957189)
                     /locus_tag="LDBPK_302540"
                     /codon_start=1
                     /product="heat shock 70-related protein 1, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003862965.1"
                     /db_xref="GeneID:13385674"
                     /db_xref="GOA:E9BLZ7"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ7"
                     /translation="MFARRVCGSAAASAARLARHESQKVQGDVIGVDLGTTYSCVATM
                     DGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKRQAITNP"
     gene            complement(<961605..>964838)
                     /locus_tag="LDBPK_302550"
                     /db_xref="GeneID:13385675"
     mRNA            complement(<961605..>964838)
                     /locus_tag="LDBPK_302550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862918.1"
                     /db_xref="GeneID:13385675"
     CDS             complement(961605..964838)
                     /locus_tag="LDBPK_302550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862966.1"
                     /db_xref="GeneID:13385675"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ8"
                     /translation="MRGVGDVRSGTVPVRGLQYTTSPSLPSAVKLTRDIMMRTSSTLQ
                     CVAGETGSSAMGSATTPAAPARAIPFPQGTLQLYDSYYKSCRDTEPTVPETSGGGSRA
                     EWTDSLTLPDDLSGIGPSARRLLRLDAAQQHPRTNKNGSKKASRAPVALPVASRILPA
                     QTCRSRAAATTPATGAAAALSATAHLPLPSRKCMGDTDNGAHASTATLRQVSLTANVR
                     PTMLLCNITNPVHGGGGCGTSTVSAAAAPPPLVTRLQSYIKRELVLNSGGTAIPSAMD
                     QLNPYREAFRALGSAFPAYGSLFDDIQCAYDNVIQAQAELLTDAYSAVAARHVEKMTQ
                     QENAAALHQQVSALQVELSKMETALKSRALAEEQERQQATMQCSRTCRTNDTLELQRE
                     LKAANQRVSELERASQIDLEKILVLIGAVRECDRRLKEYERLVTSVMGQVSELDEFKC
                     IAGEAQAELQQFRKKYSEYVPASDFCLMREYLTSELQAAQLMTRRWRRTAAVRGTQLD
                     VMQCRLSALEEDREALVKAAAAAAAHPADVEAHDSDTDTVLTPRPSWKRLYERYPELS
                     GYAADVGRLTTELDRDAADIDPFADEERSAVRRTSTSSTLAQDMPAVKGPKETGLQVE
                     YLVQRIVALEGLLRTQWQQQQQQQLQRTSTTGLVERGDASTDAARANSEKSLQEASLA
                     TKDEPTDSSAPLQHRNSRRPHGLGDAPHNAVSGAIVGAPVPRMAPPLELPLLGLGYAP
                     WVPLCWRASGVLCRRSVAPSTIMALIYHFFLDVLPTYLDKEDKAQQALEQDGATAQSS
                     TDRLAPFLYELLQSEMQTREDLHAYDSVAHLMMNLERDGQMQEWHSDALHLFLWIAHG
                     VMPPRLGVDAVVVVAQVKRDVRALAKELQSSRLRRQALGECLQPVLELKTAAELAELR
                     AALGGETTFSAEALCSDTHPFMQVLLVQECRAGMELYVSFLRALTARACFMTAGGDRA
                     APAPSAGAALKGARDPKAQPAPQLSEGDRVLSLSDVSAAVLEVEPCTPEVVLRELSVN
                     AVIGAVPVPGASEEPPVVVRLSEMVRAIGTAPLIRRTVRSAKNDCVL"
     gap             971276..971491
                     /estimated_length=216
     gap             971782..971880
                     /estimated_length=99
     gap             973709..973807
                     /estimated_length=99
     gene            complement(<975105..>976331)
                     /locus_tag="LDBPK_302560"
                     /db_xref="GeneID:13385676"
     mRNA            complement(<975105..>976331)
                     /locus_tag="LDBPK_302560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862919.1"
                     /db_xref="GeneID:13385676"
     CDS             complement(975105..976331)
                     /locus_tag="LDBPK_302560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862967.1"
                     /db_xref="GeneID:13385676"
                     /db_xref="GOA:E9BLZ9"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:E9BLZ9"
                     /translation="MPKVVCVWRGSDEIDNAIEHLDEAKVQLLYSKFPVGSGTFKRNK
                     FIYVQYIGPKCSIVKRGQGINEITNFTTNNIRGVPGFSTTDKASLSFESLVRHMRDTF
                     VMDSGNFSMEQIREEYRERLAAEQMMMHQEREQAAVVAATAKRGRRNTAPSVRLAPKP
                     APPPTKEERPSSPVEVSAQTNRVMTSLRQDNGSVNWVVFESNSEVLTVRAYGQHGIFE
                     MVKNLPDEEWLFGLFRISFSNGEVHQRRMIFFQWIGSSLKAMRGGSHAGVYPAMAKAL
                     SPFNYEIYLVGRQDLNPQAIIAKSKSAFRTPADRRIGVARDFMIDSTVFTEENYRQSL
                     VEEQATAEVFEERPKKTHRLTMPIIPDGIEQSSASVATTGTADSPAAQSFSIEETIDL
                     VQAKEGGLVWAIFEVL"
     gene            complement(<982383..>982976)
                     /locus_tag="LDBPK_302570"
                     /db_xref="GeneID:13385677"
     mRNA            complement(<982383..>982976)
                     /locus_tag="LDBPK_302570"
                     /product="reticulon domain protein, 22 kDa potentially
                     aggravating protein (paple22)"
                     /transcript_id="XM_003862920.1"
                     /db_xref="GeneID:13385677"
     CDS             complement(982383..982976)
                     /locus_tag="LDBPK_302570"
                     /codon_start=1
                     /product="reticulon domain protein, 22 kDa potentially
                     aggravating protein (paple22)"
                     /protein_id="XP_003862968.1"
                     /db_xref="GeneID:13385677"
                     /db_xref="GOA:E9BM00"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="UniProtKB/TrEMBL:E9BM00"
                     /translation="MSAIAKEFKGLTTKDVVTWRRPVASGLIFSSFFTMWAIFVFAEY
                     TLTTFVSRIVSILLIAGAAAAVTKRTIVTSPEDVTASMDRAYESVRPCVTKFVDCTIS
                     LLTWRDYAASAKFFMTTLVMAFLGNWMSDTTLMLVILIVAFTAPVAYEKKQNEIEHAV
                     QQVRAYADKYLGMIKTHAESKKSSVEQQLQDMERKAQ"
     gene            complement(<984009..>985490)
                     /locus_tag="LDBPK_302580"
                     /db_xref="GeneID:13385678"
     mRNA            complement(<984009..>985490)
                     /locus_tag="LDBPK_302580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862921.1"
                     /db_xref="GeneID:13385678"
     CDS             complement(984009..985490)
                     /locus_tag="LDBPK_302580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862969.1"
                     /db_xref="GeneID:13385678"
                     /db_xref="UniProtKB/TrEMBL:E9BM01"
                     /translation="MHPHTAAKVETTASDGATMTQTTSHPVLLGCGLNWASFVASHPF
                     EVKELTSVLVGEGSDDDGAPEERDALVQAQLPVASVVTSGATLERVFTESMVCASSMA
                     EVARKVQHIATLWCLHPSSEYVATLCWPMRGSESASTTTAVLKVRTEGWRAPLDLRAV
                     SLHVVDRGSFVFHPEFTRCILAQGAEKFMFYVPPNPLEPTTALPFMRGLWYNGLFSLP
                     ESLRIGPQHVAMFFVLPNGDTRYTLDLAPESPAAPAASSTHQQDSGALGSATRRDATA
                     SLYPWRRQSKVRRVIRSGAYVVVVRDDTAGVVASLQRACSYHGQNKRSTWLNDIFINL
                     MGQCSRRDISSSADTAASQAAEADRAKYVRLLCIELVEKATGEVMAGCCGMTVGCAYH
                     DYTMYTLRQSKDGLGTFLTKLIGEALQRCGYTLWYWGFCVEYMRHFERHFGAVDMPRD
                     VFYRRWSAARDAVPECDIDAYLRSHKGMVPYYEGTSALVKSKP"
     gene            complement(<987974..>989842)
                     /locus_tag="LDBPK_302590"
                     /db_xref="GeneID:13385679"
     mRNA            complement(<987974..>989842)
                     /locus_tag="LDBPK_302590"
                     /product="formate--tetrahydrofolate ligase"
                     /transcript_id="XM_003862922.1"
                     /db_xref="GeneID:13385679"
     CDS             complement(987974..989842)
                     /locus_tag="LDBPK_302590"
                     /codon_start=1
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="XP_003862970.1"
                     /db_xref="GeneID:13385679"
                     /db_xref="GOA:E9BM02"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BM02"
                     /translation="MTTRKLHCVWPVPADIDIAQSIDAQPITSIAEAAGILLSELSPY
                     GSTRAKVKLSVLKRLEGSPNGKYVVVAGMSPTPLGEGKSTTTIGLAQALGAHLQRRCF
                     ACIRQPSQGPTFGIKGGAAGGGYSQVIPMEDFNLHGTGDIHAITAANNLLAAALDTRI
                     FHERTQDDAALYRRLTDELKTFTPIMQKRLDKLGIYKTDPKSLTEEERVCFARLDVDP
                     DTISWRRVTDVNDRFLRDIEIGMGKAEKGISRRTGFDISVASEVMAILALVDDLADMR
                     QRLGAIQVAKSKTGASVTAEDVGCAGAMTVLMKDAVEPTVMQTLEGTPVLVHAGPFGN
                     IAHGNSSVVADRIALKLAGADGFVLTEAGFGADMGCEKFFNIKCRTSGLKPDAAVLVA
                     TVRALKFHGGVEPKDATKENADALRAGMSNLVRHIQNIRKFGVPVVVALNRFSTDTEA
                     ELALVKELATQEGGAADVVVTDHWSKGGAGAVGLAQALIRVTETTPSNFQLLYPSNAS
                     LKEKIETVCREIYGAAGVEYLNDAEEKLADFERMGYGDFPVCMAKTQYSFSHNPELRG
                     APTGFTVPIRDVRVNCGAKFVFPLLGDISTMPGLPTRPAYYNIDIDCESGRIVGLS"
     gene            complement(<991335..>991979)
                     /locus_tag="LDBPK_302600"
                     /db_xref="GeneID:13385680"
     mRNA            complement(<991335..>991979)
                     /locus_tag="LDBPK_302600"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_003862923.1"
                     /db_xref="GeneID:13385680"
     CDS             complement(991335..991979)
                     /locus_tag="LDBPK_302600"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_003862971.1"
                     /db_xref="GeneID:13385680"
                     /db_xref="GOA:E9BM03"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BM03"
                     /translation="MSSNQDDHGGEMISAEDQFNVDMDAEAELEEMKRQVESLQEDMQ
                     LKALQESAAKDEGTRKTAAAAAASSGQTKTNTSIFVGDLDLRTTDADLRVFFASCGAI
                     TRVTVLKDRQGNPKGTAYVEFETEGQAHAAILKDGQSLHGKPLKVAMKRDNIPAFQRG
                     ISRGGAYALRGRGAGNPMQQQIAALAMMAGMMSQGFNPYNMGRGGGRGRGRGGY"
     gene            complement(<993468..>995627)
                     /locus_tag="LDBPK_302610"
                     /db_xref="GeneID:13385681"
     mRNA            complement(<993468..>995627)
                     /locus_tag="LDBPK_302610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862924.1"
                     /db_xref="GeneID:13385681"
     CDS             complement(993468..995627)
                     /locus_tag="LDBPK_302610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862972.1"
                     /db_xref="GeneID:13385681"
                     /db_xref="UniProtKB/TrEMBL:E9BM04"
                     /translation="MELHVCHVTDKSEAPESQPPSRPREDESNADRTASKSEVLSHSS
                     SSSCVPDRDPKGTGGENAPVSGSGTPEATSVPASQPAIATTGATAALMSLPQQSLCEQ
                     GKVHPAYAEAEEAHGEAAEGVAYQCAEKRPSSKHGDTVASENRLTGASTSSAHDSVCE
                     AGSSGAPVAPHLSSGRTQVPAVLHNGAATARQKAGEAKDRSCRPLHLASNDYVRAYAL
                     SLASSSSLPRQTPAHAVVHRHTPDRSPETKWNASRVSTTGAAQHEMLPPISVGSKSKP
                     RVRSSNSSRKTRTAPNKVSKAAPTSRSMPAVSHASNALSVAGSATARAVVPTGASYRT
                     LYSTTGGAMKGLVDHVDRNSFGFHLRNMFQRIDFAEVQREAQRGEKESAALQMCRRLF
                     RVIAKNKDFVSVEDLHELLLIFTPCGVSLREGADFLWEDCGGKLSLTFRDFLRYGAAL
                     RARLRDYELFEQLSDQQKLIVMHARILPVEPPDDANTARVNLLRVADHQMQGQLPRHT
                     RSLRLYEELFLVDYHERLHDAALIPASEVPPQGLKSDYAHEYGREQQGRPFPALPPLS
                     VPALKEDMEWRHTEVVYSTDSDASDVAVHAAAAEKRAAAAHNESEYPTLSRSIHLVGA
                     TKAPGKAGSRTAGQRKHPQRRYKAAAASSMGAGATYSDRSRRTGLGSERFVVDLQRQP
                     LPPQQKKMGRFVEEEYWERRVMDDHLITQLQSMYKTQ"
     gene            complement(<996207..>997271)
                     /locus_tag="LDBPK_302620"
                     /db_xref="GeneID:13385682"
     mRNA            complement(<996207..>997271)
                     /locus_tag="LDBPK_302620"
                     /product="replication factor C, subunit 2, putative"
                     /transcript_id="XM_003862925.1"
                     /db_xref="GeneID:13385682"
     CDS             complement(996207..997271)
                     /locus_tag="LDBPK_302620"
                     /codon_start=1
                     /product="replication factor C, subunit 2, putative"
                     /protein_id="XP_003862973.1"
                     /db_xref="GeneID:13385682"
                     /db_xref="GOA:E9BM05"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BM05"
                     /translation="MSSSSQPAQKRAKTEGAPDTAGAAAPWVEKYRPRTLAEVEAQDE
                     AVGALRACLKEGANMPHFLFHGPPGTGKTTSILAVAHELFGPDYIRSRVRELNASDDR
                     GINVVREKVKIFAQGAVSSSGSSVTQSDGKVYPVPPFKLIILDEADALLPDAQAALRR
                     MMEDFSDVTRFCILCNYVSRIIDPIASRCAKYRFKPLVKSALYHRIEYVAQAEGITLS
                     PASLHALDTVSGGDLRLAIMHLQSAQKAKGDDLSKEDFVSVSGSVPADVMQRYLSALF
                     SHRLEEVIQASRRLVAEGFAAAQVLLQMQHYLVSAECPLNSAQRGKIMLKLCQTERRL
                     ADGGDDYLQLLDIGSAVCSA"
     gene            complement(<998064..>1000559)
                     /locus_tag="LDBPK_302630"
                     /db_xref="GeneID:13385683"
     mRNA            complement(<998064..>1000559)
                     /locus_tag="LDBPK_302630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862926.1"
                     /db_xref="GeneID:13385683"
     CDS             complement(998064..1000559)
                     /locus_tag="LDBPK_302630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862974.1"
                     /db_xref="GeneID:13385683"
                     /db_xref="UniProtKB/TrEMBL:E9BM06"
                     /translation="MDVDTLLTRQMELHTSLRQPPKNPQDLVRLMDMMRNYKHYFGSL
                     RTLAERFSVEPETVFQAFMHISVGGTVNFDRQHQDGAVPMHQAKVLPRSKAIELAPRL
                     CKELPNPELMVYVGLCRDLRNTLRVKVEDGNDLKTAEKSVCEAVEYLSFINNRAHHNT
                     EKLYALYMAEDPNSLSSLLGDGESSMTASWATFQDTFSSTIPSMQLPTLGDDGAPLEN
                     EPTALPSPLSSFIPELKKQCAAASDVSSVNGGATKRLKASQVLLDWIATVPAEYFAQH
                     AEGIVGAVSSTLALLAAEKRSALCRVGCDIIIMLMQRLSPEPVFIEDVHRGTCSTNPA
                     TFSGALSQWVSSLAKGIYVTIAAISSATDAALRAIAIQSHGHPNVVKTLLKALSGGAQ
                     TELRRKCLGYLALCVVAAHQKRPERMQELVHLLGPVAVKYVANGDSPSRKMARALCSV
                     LRVLGPATSPRGSDRLLHIADERIEVLVQQERPQVEPAVLGGPQELENLLFEVDTFVS
                     SIRSTFSAGSQRSLLGSMRGRGHQGSFGAGRRALPQRDVAAGDRGGRGRQSKPGATDV
                     GAAAGSRPSTRHSESTATAALGELCVTVRSPTCQHTTAYAVPHGRAMVEVQAPTRSAV
                     GRRSLSPSGGLSPTSNVAAGQTRTHKVSSHRAKMRLGSIYDAEAFLGGHNATPTSAAK
                     RAAAGESPHRTVVSRNTSATHAPPVESAMSGHGGGAGHVTATTAGSSGGHQPLLPTLT
                     SAQRRTPHADRTAAAEEEGVLPPPRGAALPSSDRLVPLSLRNHAGHDSEAAYRGLVSP
                     SCSSGSAAAGPNAPRISQSLRRKIEENKGALGL"
     gene            complement(<1001916..>1002257)
                     /locus_tag="LDBPK_302640"
                     /db_xref="GeneID:13385684"
     mRNA            complement(<1001916..>1002257)
                     /locus_tag="LDBPK_302640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862927.1"
                     /db_xref="GeneID:13385684"
     CDS             complement(1001916..1002257)
                     /locus_tag="LDBPK_302640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862975.1"
                     /db_xref="GeneID:13385684"
                     /db_xref="UniProtKB/TrEMBL:E9BM07"
                     /translation="MMQCPWDDVMTEAFRRAQMAGRVFPQLCDFPPSVPRDVAELKYL
                     MPLRAFSEVGHGGTPTHTAPLWCGPLESTGFSDSMEGEEESLFMTYGGDAWSAALFVA
                     SNTRSGDSGVC"
     gene            complement(<1003129..>1003599)
                     /locus_tag="LDBPK_302650"
                     /db_xref="GeneID:13385685"
     mRNA            complement(<1003129..>1003599)
                     /locus_tag="LDBPK_302650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862928.1"
                     /db_xref="GeneID:13385685"
     CDS             complement(1003129..1003599)
                     /locus_tag="LDBPK_302650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862976.1"
                     /db_xref="GeneID:13385685"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BM08"
                     /translation="MTTSYAAGGAASTAAVVPFNYLRLKRHRRTIFLYCDFQQDTVQA
                     IKERIEKLTSRTFYTMCLYYGTQRLSDESTLFSAGISDDGTELWIAYSKGKTVEGETI
                     WEDVEEAMTPVAAAAPEVAPEHTGESHAGTTFGADGQGAGQHSVTVTDNVEVIM"
     gene            complement(<1004526..>1005791)
                     /locus_tag="LDBPK_302660"
                     /db_xref="GeneID:13385686"
     mRNA            complement(<1004526..>1005791)
                     /locus_tag="LDBPK_302660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862929.1"
                     /db_xref="GeneID:13385686"
     CDS             complement(1004526..1005791)
                     /locus_tag="LDBPK_302660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862977.1"
                     /db_xref="GeneID:13385686"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BM09"
                     /translation="MRAVVSAVLQPSSAVGALRCQARLITRLYTSYFKGELFPNQLVR
                     PLERLPRGVSLAAARKGQLAAAPSSSGPGKPATAASPEVVAWGDVDSTDLVHANEQSR
                     AVAPQAGLAPRRPYVPLGEVAKMELQGDYLTEGGLHQEALEYYGVVAKAYELAYPKDH
                     PQVAGIRLKLAGAFRRTGRLASSKTNCEAALQMLDNAVQPPLELIVEALFELGLTSEA
                     MSDDAAGTVFEEAVALVDMFHNSGQSHKMLRLLPRLGRRFNLNFEEKFVYFSPFDYDR
                     VFALADQCLERAEVFYQARNDRAGVMRVLQQRKELIDKKFFNMRDFAGRIHTMRGHWK
                     RRAQVLTNAPTPDELLRYSPTIHQVYRDFKYELNAPIGREKEVQPGVNRVVHDMGNPY
                     RRNGVRSQRMFRDAEKNFEKYIRADAFEA"
     gene            complement(<1006450..>1007556)
                     /locus_tag="LDBPK_302670"
                     /db_xref="GeneID:13385687"
     mRNA            complement(<1006450..>1007556)
                     /locus_tag="LDBPK_302670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862930.1"
                     /db_xref="GeneID:13385687"
     CDS             complement(1006450..1007556)
                     /locus_tag="LDBPK_302670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862978.1"
                     /db_xref="GeneID:13385687"
                     /db_xref="UniProtKB/TrEMBL:E9BM10"
                     /translation="MSDLASGSSRRPRAAGPLLASGILLLALLTVMCAPVSAEVVVAP
                     LCAEKHGFAGEFNDHYTIPVEQAPAAGEAIVLIARAFPLNLGNMLARWLYINATYRIS
                     EGAQLTEVSDNNGILELANVAAGTDIEVRVMRVRTDGPTPFRFFSFFANSPVCHVAVA
                     PDNSFIAPVPRRLRATPQLPLTMYFKAVLPPNVNALIIRVSADGRTDEKFRSGDKVYA
                     SGDLVRAASGGAVLFAYTFPMENAATPYYFTQVSVSYGEWEGGDAAKPSASNTSSSGG
                     DSKDTMQPTRSTPVLRRLLLISLFLFLLYQAAVSAHNYYVLGKRDVMDIVPCAKSAAA
                     GARTAQLVTLRFMGMSQRHKEGYNSLQNPDDPYS"
     gene            complement(<1008315..>1009292)
                     /locus_tag="LDBPK_302680"
                     /db_xref="GeneID:13385688"
     mRNA            complement(<1008315..>1009292)
                     /locus_tag="LDBPK_302680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862931.1"
                     /db_xref="GeneID:13385688"
     CDS             complement(1008315..1009292)
                     /locus_tag="LDBPK_302680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862979.1"
                     /db_xref="GeneID:13385688"
                     /db_xref="GOA:E9BM11"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:E9BM11"
                     /translation="MSTASLLFSLLLNITSSIGVIIVNKRFVFVEAHFEFSTVLTIIH
                     FTTTFLGCVFFAYGAKLFTPKKLSIRRVLPISCAFCGYVVFNNLSLLTNSVSVYQVLK
                     ILCTPMIVLVERVHYGKREKLSTLLSLLPVCIGVGVTFYADTDVNWMGTVWAFLAIIA
                     NSLYTIWGKTKQVELGAQPMQLLIYETPLSAVMLLLVVIPLDGGEKLAAYEVTFKTVW
                     TVLLSCIFAFGVNFSFFLFVGKTSPLTMNVVGYLKTSLVFVLDFIFVSANMPQKKLIG
                     ISLTLLGLAGYSYSKIESPLPRSPTIWRNSRQSSPYQRHRGAEVKVISV"
     gene            complement(<1012156..>1013040)
                     /locus_tag="LDBPK_302690"
                     /db_xref="GeneID:13385689"
     mRNA            complement(<1012156..>1013040)
                     /locus_tag="LDBPK_302690"
                     /product="SH3 domain protein-like protein"
                     /transcript_id="XM_003862932.1"
                     /db_xref="GeneID:13385689"
     CDS             complement(1012156..1013040)
                     /locus_tag="LDBPK_302690"
                     /codon_start=1
                     /product="SH3 domain protein-like protein"
                     /protein_id="XP_003862980.1"
                     /db_xref="GeneID:13385689"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="UniProtKB/TrEMBL:E9BM12"
                     /translation="MRYFVVAHEFQAEEDVELSVFKGEILCATEGIAQDGWIKVEVTM
                     DARRRGFVPISYLREISAAEASASMPAPASSAPPSAGESTSPMRTPQRAGGESPARAA
                     LANTTISTSLNLGNCSDVVKKGSSPSLQPMRSPETAAAHAAPTSSSIHLTPAQQAAGP
                     VNRHLLENPNAVVDAFMKNEVYFNQLMQRRASALAQMQSGLEEAMTEVAACKDRSAVL
                     TRKLHDLDGVVERERQRWMDRVEEEKAHVSRSAPYSAPLAVPVSCGTTPVRSPIIGPR
                     SGLGRSVLDDDSPRQLRA"
     gene            complement(<1014546..>1015718)
                     /locus_tag="LDBPK_302700"
                     /db_xref="GeneID:13385690"
     mRNA            complement(<1014546..>1015718)
                     /locus_tag="LDBPK_302700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862933.1"
                     /db_xref="GeneID:13385690"
     CDS             complement(1014546..1015718)
                     /locus_tag="LDBPK_302700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862981.1"
                     /db_xref="GeneID:13385690"
                     /db_xref="UniProtKB/TrEMBL:E9BM13"
                     /translation="MGLLRQVLDPNRRCVDLSDQRGGLTAGVLESLRTFLRYNDRYVH
                     LCVSDNVLGSAAIAGLCALIKRHPHLIALEAQHCGLLDKDFRFYVGPAILTMRHLTFV
                     DLSRNCGLTDVSAETLARILVETDVETVRLFGTSLTECGGRVIATAAANTTTLVSCEL
                     PFTVGSAVLEDIEVCTRRNRAHRAILNNASAHYTRLQVRRSRLPCPPALKHMEANPMV
                     AIDELLSLESKPGAPPRSPVIDVVPKVCYTETDRRWRACIHKGRKNALMHTETLLPPS
                     LSSSVPSAQVPSSFAAASVANTKVASTAVTRRGKVTPDSLDEVTMWDWADPAMSTTLH
                     CLYLLDRQAQLAPNRANSVVAVPNINGLSHTGPSKKATGGTVRLPYLRVGKRAAAG"
     gene            complement(<1016975..>1019773)
                     /locus_tag="LDBPK_302710"
                     /db_xref="GeneID:13385691"
     mRNA            complement(<1016975..>1019773)
                     /locus_tag="LDBPK_302710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862934.1"
                     /db_xref="GeneID:13385691"
     CDS             complement(1016975..1019773)
                     /locus_tag="LDBPK_302710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862982.1"
                     /db_xref="GeneID:13385691"
                     /db_xref="UniProtKB/TrEMBL:E9BM14"
                     /translation="MDGDRYIYSRPVAVTEDRIKEALEKQAKQKALKAALDRQVREAE
                     RLKAEKHRAKGKQDKRWGDPKVNVPPTSSSANAENKTQTASTAVTASVAGPSPPTMGT
                     TVAPGAVESTRYNFSFRKGQGTFEVDGSPARRLRTTFQTSAEARERGGGAAPPGTGGE
                     NGKAPAPRGRRQPASRDASSGAGPCNTRGSRSTAAANGGEYQTNSLPINFSMTKEGAG
                     KKAPPLERRPSDCGRLTCGTSGERGGGSDASGHSRNKGNGGYDTQSLPTELIYKLGQA
                     SSNAAVAKPSLRRVTTPLRAPSSGRTSEPRGHQSPLGLLTGAVSGSPMTAGRENFKSP
                     LNDRTKSPDYAGVGGAHPRLSPGGGLKAVPRVLGSGGGTPNAKALGARYVSPRPTARL
                     AGGILPPLNPHNDSDVIEMSAVLDVVTPTREYSVIGTATGALSGRTPGSAAPPLPCKR
                     TNSTPAERPARRSPPESPHAAAAAEQERKQAEREKAWAQQVKQIKAELRRTRAKGPGK
                     GGMKLEDRGAMSNIPRRAETAPDPAPHPPMRGALGGAAGGGASGAGGAHGRNGAGGGG
                     KGNVGGGRSHQVEKMDFAKAHIFTRENFRPITAPEDATSYFGMLSPPPSLPPLALAPK
                     FKSREQARSSSESVREAERKEEAIGTEAASSPSINGIHTFASTGTSGEESLKLASLTT
                     RQVTLGLPDYGDSDPVPIQFNHLLEFVEAQIITASQAENLWDFFSASADVARGGGSGS
                     DAGRAGSSFSVSSARDMWGRAARGDVNGAVGEGKPSTLEIEAVDERPAANGVGATKGD
                     ENVKGDNGRVFYVPYSPSQLPTSAVLAPALRRKISQQHSEQEAARLHQPYKPLQNGRP
                     WRSSSGAGGRGASGGPGDGDSGQRTAPHIARGLQNHFSTAAEPGDKGGDEGHGGANMF
                     DTFSELVLPTDLKDEDNG"
     gene            complement(<1021891..>1024083)
                     /locus_tag="LDBPK_302720"
                     /db_xref="GeneID:13385692"
     mRNA            complement(<1021891..>1024083)
                     /locus_tag="LDBPK_302720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862935.1"
                     /db_xref="GeneID:13385692"
     CDS             complement(1021891..1024083)
                     /locus_tag="LDBPK_302720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862983.1"
                     /db_xref="GeneID:13385692"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:E9BM15"
                     /translation="MSAKNRTPAEIQRSFVQHVQNISAHNRGISDELALMSQGLRDGI
                     QSNTGPTTDLLAAASELSRFAMRACTNLSSCLEDLVNMGEAMAPVLAANPEAAEPLLL
                     NFFSTFVTQMGAFYNEIDAWWGKGCESLGRGKAAFFRESSVSNTALATREPTASTAPT
                     GAMPTADREREVSETAAVSTVHAGRRRNHQLLEDDVADGEPPPAHDCYSESAPGGAAP
                     KKGRKKKATTAAEAEASATAATTPTTKRTQNFDPLPNSQSSRGSAEDTMAGLAAAAES
                     GAQTALPQRPEKSSSRSVLPVADELAELTPEDLNALAQSEPSYLFLTSTLEDALGAVV
                     MASRPNVFSNLASFTYNEPVSTYYIRLIRPGSLAYFVYCNYILGSADTQADFLCDVLE
                     TDCAEVDPFTSPAGEVIVEDAADLSSLPACAWAIGSSEDNERRLYTMYALIEQPPRVG
                     PTAIIQDSLNMGAARDEVLHMVTLVDGAPEFARVTCMVYSEMRTAEIPTQKQAAILSF
                     SRSGFAHTGFVEVPDSEVEAAVSRMRRKKQNAAGYKTVLFSKQELDATTTFQPPVQLA
                     SLNQPAGDAGISLGGVARGAVQGGFEVLKAPFTVGRAVGGALLDATGVTGAVRNNIEG
                     VFRKSFPDLAGETLLDSFNCAWVEGSALKQGYLFITPHWLCFQSTLAAAHFSIEYDEI
                     KDIIKSKSVKMFENAIEVKTHLNDTIFLTNFLQRDQAYSALMSQWLKQ"
     gene            complement(<1026845..>1029676)
                     /locus_tag="LDBPK_302730"
                     /db_xref="GeneID:13385693"
     mRNA            complement(<1026845..>1029676)
                     /locus_tag="LDBPK_302730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862936.1"
                     /db_xref="GeneID:13385693"
     CDS             complement(1026845..1029676)
                     /locus_tag="LDBPK_302730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862984.1"
                     /db_xref="GeneID:13385693"
                     /db_xref="UniProtKB/TrEMBL:E9BM16"
                     /translation="MRKSSATAVSAPLLATSVIVAEFDIDTGACLRACYPPVPTSPST
                     ALLSSIESGAPPGIAGHTEYFANVMLPDGAEKVNVTRTVFVVNRPQPPLYLRFPVYRF
                     ARASASTGSTDTQAAWERRPGEETARYVPEILLINATTEEVSLRYKDTEIEAPCAVPM
                     ENISSLPNIPADVVRFSKQLEAMLKNEATLDRSYSVSFASGGDTNTMDAGAAATSGAG
                     GRGVGLGGASTAVGGGGGGSSIGDYTFVLVDYTTAAVARQEGYLMKVSNFDRLLKTMT
                     TLLQRKKTAAAAAASGAPRANNSGDASAAAASESIVTPLTEAGSLSTMNSTRKEQPGS
                     SANDTFKTTVHDIRLPFMPDMYGGRHPGLSGEGSPASPEPRLAGGGGGADTQSTTSSM
                     EQSGHLMLPRTDPTSSGDDSDADSVAGGHHVDASSTAAVAAAATEKGGQGASTEASRP
                     VLFGLCAVVSKRDSTARRGGITKSVAVLGPSLVWLEPFFPILVAAAQYCCDVNGTDKS
                     AVRELQRILKRCYDSVNNAAGMVAAGRAKVDQLTAEISKYCTLSSGQQAYVYYNDAPF
                     GNTIKAKIPLSPESNDIVFTRYSLESLIETLGPSSLHLLLGILTEKKILILSRKGEAA
                     DVCEAALSLGIIGNMLDRDFMARKVFPYVSVSSVNYFMQVPGYIVGTLNPIFDNVNPW
                     GWDLLCDLDNKSVITAAERLQRKTTGLSSSAGGNWSAATAGLANAVGVGGGNDAEALR
                     NFPAPLQQLYKQLLNTIYHLRALRIGAVERSHRLRLMVEDFVYTVVLVGYVNGASVSV
                     PNALYSTFAHRSLSALRSEMMLTSMMDNIRTHILHRGENPALLLHCVALRHCAWGETP
                     VQRTLQALLDLLNTACDLKLFLRRMPLAVGGLNAVGMQLTSPSAEARAAAAALLARLE
                     LVPEGKAAIASMNNFFVMIYESGMTGAGR"
     gene            complement(<1031040..>1032266)
                     /locus_tag="LDBPK_302740"
                     /db_xref="GeneID:13385694"
     mRNA            complement(<1031040..>1032266)
                     /locus_tag="LDBPK_302740"
                     /product="TPR domain protein, conserved"
                     /transcript_id="XM_003862937.1"
                     /db_xref="GeneID:13385694"
     CDS             complement(1031040..1032266)
                     /locus_tag="LDBPK_302740"
                     /codon_start=1
                     /product="TPR domain protein, conserved"
                     /protein_id="XP_003862985.1"
                     /db_xref="GeneID:13385694"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BM17"
                     /translation="MEERDLPITDDHRKLVFSFIRMIRRSQVENPERAEAVAQMLGEE
                     FGVDPAGSGGLHDTEVDVLEAFKTALREHERRSGVEQDEKFVCFVELLEKKGYFKGVE
                     KGSDEYAQRLEKAREKFNQRNNPYEGLTAEQIKNKGNELMSQAKYKEAIAYYTKAIEL
                     QPDNAVFFANRAAAHTHLKDYNNAIIDCERAIIINPEYSKSYSRLGTALFYQENYSRA
                     VDAFTKACELDPDNATHKEDLKRAEEKAKATALSTGGGMGGFPGMGGFPEMGGMPDMS
                     QFANMMSNPQFMETAQRMMQNPEFSNLVANMASKFSQGGMDPAELNRLGADMGMRNVD
                     EEGNVVTPFGKVNRAAIEQLQEEEVRKNPKLAGIMADVQANGYGAFQKYLGDPDVMNL
                     MMKFQNLMFTNPNRSP"
     gene            complement(<1033044..>1033748)
                     /locus_tag="LDBPK_302750"
                     /db_xref="GeneID:13385695"
     mRNA            complement(<1033044..>1033748)
                     /locus_tag="LDBPK_302750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862938.1"
                     /db_xref="GeneID:13385695"
     CDS             complement(1033044..1033748)
                     /locus_tag="LDBPK_302750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862986.1"
                     /db_xref="GeneID:13385695"
                     /db_xref="GOA:E9BM18"
                     /db_xref="InterPro:IPR026569"
                     /db_xref="UniProtKB/TrEMBL:E9BM18"
                     /translation="MLRQSSLLRFSTFALNPETSRAPHGPPRGLINRYISMGLPPWAA
                     WCNRVNRHALYRMSDVSPRSFLPKAPHEMDVIWMNERIRERVRTSRQVQHVYRQLKYP
                     FVKTGIHYSDTLDHWVQVPMVEAAMFEIEKDGGFDNFILKRSGPELRSTYGERIRRHL
                     LVRQKETQKNFVLDQQAKTLAGVAHAELMKATSEEELDAVLSKYGMDAEEFKRLMAKR
                     VMEQRKSLATAGLHSK"
     gene            complement(<1034718..>1034867)
                     /locus_tag="LDBPK_302760"
                     /db_xref="GeneID:13385696"
     mRNA            complement(<1034718..>1034867)
                     /locus_tag="LDBPK_302760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862939.1"
                     /db_xref="GeneID:13385696"
     CDS             complement(1034718..1034867)
                     /locus_tag="LDBPK_302760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862987.1"
                     /db_xref="GeneID:13385696"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="UniProtKB/TrEMBL:E9BM19"
                     /translation="MSSRQGGKQKPLKQPKKERCEMAEEDIAFKQMQREQKKAEKEAI
                     AKMKK"
     gene            complement(<1036733..>1037062)
                     /locus_tag="LDBPK_302770"
                     /db_xref="GeneID:13385697"
     mRNA            complement(<1036733..>1037062)
                     /locus_tag="LDBPK_302770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862940.1"
                     /db_xref="GeneID:13385697"
     CDS             complement(1036733..1037062)
                     /locus_tag="LDBPK_302770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862988.1"
                     /db_xref="GeneID:13385697"
                     /db_xref="UniProtKB/TrEMBL:E9BM20"
                     /translation="MLPPTHVYSLIIHNKTSKEMTVMVTYSNMIDNTLAQHSVVVAAG
                     EKGVAEQRTFAWNGATFAVVITAVDVKDAQTALTAPFPGVDSPTSDYLITIVEESGTV
                     HLKAGQP"
     gene            complement(<1037965..>1038771)
                     /locus_tag="LDBPK_302780"
                     /db_xref="GeneID:13385698"
     mRNA            complement(<1037965..>1038771)
                     /locus_tag="LDBPK_302780"
                     /product="superoxide dismutase, putative"
                     /transcript_id="XM_003862941.1"
                     /db_xref="GeneID:13385698"
     CDS             complement(1037965..1038771)
                     /locus_tag="LDBPK_302780"
                     /codon_start=1
                     /product="superoxide dismutase, putative"
                     /protein_id="XP_003862989.1"
                     /db_xref="GeneID:13385698"
                     /db_xref="GOA:E9BM21"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:E9BM21"
                     /translation="MRVSLLRRFCEYVPKGAPTQVSLAVETPYSVTRAFRMTEMAAAA
                     ADAERDAKGFFYLPRVDYDVGQGVAPLMSRKQFDVQYHVFHKAAVDRLNAHTLGSELE
                     GHNLNVVIRNSSFDASRAVIHAAASEHFNYCFWYRSLRPWGTAVPARLKEELQLQYSQ
                     NGTLDAVEEVQRLFTVAALSQQSAGGWVYLVWTGKAFDVIPFDHGSCPIGSDLIPLLA
                     LNTHESARCYDYPLAAEDEEGDEVERFVRNFFKTCNWRLVEHYFLQCARA"
     gene            complement(<1040593..>1041609)
                     /locus_tag="LDBPK_302790"
                     /db_xref="GeneID:13385699"
     mRNA            complement(<1040593..>1041609)
                     /locus_tag="LDBPK_302790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003862942.1"
                     /db_xref="GeneID:13385699"
     CDS             complement(1040593..1041609)
                     /locus_tag="LDBPK_302790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003862990.1"
                     /db_xref="GeneID:13385699"
                     /db_xref="GOA:E9BM22"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BM22"
                     /translation="MSGQTAMDELPSTARLSSDLCATFSEYLESAYPHSGPLSWNEAA
                     QLLSAFTGVSVHHIAAALGWAAACEKAAVSKDDLHSSLEQLMRTNGSSDAWWDSPGVT
                     MPELTGAADQESSEGAGSTKHCGWESLASVRARSHRPLPPGSTSTEGPHDSKMGAWSG
                     QPSLHPTLNSWGRRDSKLSGTCSVPRVLPDRPQSTAASMECVVATALGELDLYVEDEQ
                     CSIQFHPDRRSLRFPSEVTNETERFGMAAAQHRRVGNRSHSPSPVPLADKQAACHPRS
                     PVAPTTTLAELDRFVHRGKTAKVCKQFVQTGRCTFGARCLYHHPTAAAAAPNALHVVP
                     QRLP"
     gene            complement(<1042537..>1043100)
                     /locus_tag="LDBPK_302800"
                     /db_xref="GeneID:13385700"
     mRNA            complement(<1042537..>1043100)
                     /locus_tag="LDBPK_302800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862943.1"
                     /db_xref="GeneID:13385700"
     CDS             complement(1042537..1043100)
                     /locus_tag="LDBPK_302800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862991.1"
                     /db_xref="GeneID:13385700"
                     /db_xref="InterPro:IPR008590"
                     /db_xref="UniProtKB/TrEMBL:E9BM23"
                     /translation="MRQRKHAPNASATPVLLDPNVDLSEEWRAMNAEYDGYSSEQPPR
                     TLSEFREQLQQARQARSKRSLESEGEEDAFYRTVDGNPKDYALRAVFEFLCPANPTKA
                     RLRVERIYWIAWKQFLYGFFMSGVGTMLMLVGIGCTAQYCVEKARGVGVMLGAFLLCV
                     PGYYSLFVLYMYVTCRGGYTYLQLPEA"
     gap             1043965..1044063
                     /estimated_length=99
     gap             1044967..1045065
                     /estimated_length=99
     gene            complement(<1045545..>1046369)
                     /locus_tag="LDBPK_302810"
                     /db_xref="GeneID:13385701"
     mRNA            complement(<1045545..>1046369)
                     /locus_tag="LDBPK_302810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862944.1"
                     /db_xref="GeneID:13385701"
     CDS             complement(1045545..1046369)
                     /locus_tag="LDBPK_302810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862992.1"
                     /db_xref="GeneID:13385701"
                     /db_xref="UniProtKB/TrEMBL:E9BM24"
                     /translation="MLRKHIVSAPLTCSSLPEVLFSGSACVVATRPFHSTRVSFCNGS
                     SGNGTQQRSAAEEDKEELERERHLREQFAQKIQQGLPRQQGGAGAGAGNMGGGFGQGP
                     EWGMGGGTAPFAGQPPLNPDMFRKMFNFMFYLTALLFLMLMVPLSNANSPLYTMQGLP
                     WWELPIGSAAYFLLLRALYSRQEQNRIKTEFENAARANPTLTFDQFITQTYPTMFQGY
                     RTSQPEVLAAVSACLSSAKDLRFAQTMVRAAGRAKDPRSSADDVMDALRRDFPQLF"
     gene            complement(<1047309..>1047926)
                     /locus_tag="LDBPK_302820"
                     /db_xref="GeneID:13385702"
     mRNA            complement(<1047309..>1047926)
                     /locus_tag="LDBPK_302820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862945.1"
                     /db_xref="GeneID:13385702"
     CDS             complement(1047309..1047926)
                     /locus_tag="LDBPK_302820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862993.1"
                     /db_xref="GeneID:13385702"
                     /db_xref="UniProtKB/TrEMBL:E9BM25"
                     /translation="MLRWSRLLREMAPELQLEYIPVIFTRTILGPQGGFAGEERLIKR
                     EVAQKYMSEGNAVTPNAEFRQGVWCYNPDSEQYDRFVERNAEFLDFAARKRQWLDVYW
                     RVNTGYLLFGRQSWGQGWLLNCPLRKKDVAQKLWEQYKVRVDPRLIEFREKDRRTGIQ
                     DLGHNWCWLYLPGAEELAIDREVYDNKRVKVRMHIRKMSSYGALY"
     gene            complement(<1048890..>1050506)
                     /locus_tag="LDBPK_302830"
                     /db_xref="GeneID:13385703"
     mRNA            complement(<1048890..>1050506)
                     /locus_tag="LDBPK_302830"
                     /product="chaperonin HSP60/CNP60, putative"
                     /transcript_id="XM_003862946.1"
                     /db_xref="GeneID:13385703"
     CDS             complement(1048890..1050506)
                     /locus_tag="LDBPK_302830"
                     /codon_start=1
                     /product="chaperonin HSP60/CNP60, putative"
                     /protein_id="XP_003862994.1"
                     /db_xref="GeneID:13385703"
                     /db_xref="GOA:E9BM26"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9BM26"
                     /translation="MFSLSRRLASGKSIEFGGEARQLILSGIERIATAVGVTLGPKGR
                     NVIIRQPDGEPKITKDGVTVARSIEFHDQFEDVGAKLIRQVAGKTNDVAGDGTTTATI
                     LAWSIFAEGYKSVATGANPMDLKRGIDAAVEIILDDLAEQTRPVKDFAMLENVATISA
                     NGERPLGTLIAQAVQAVGMKGFISVLDGNTATTEWSRYDGWSTEHGFLSSALMTDSAN
                     LRSRLDNPLVFVTAQPLEAVQDVVRLLEAARAQQRPLVLIGPSFAKPVLQTIILNHEC
                     GVVQCGVVCVPELKEEELHDVAFSCQCSVEKVSSVGYVEDVRCLLGSAKHMEQTMDNT
                     VVCGTGDTSARVRLLQSRLERLMTEESREAMRERISKLNHTHAVIRVGGRSAIEVSES
                     KDRVVDALNAARNALSEGIVAGGGAALLHASKKLDELLLNDEEMEQDRRTGIQIVRNA
                     IRLPLKKISENAGEEGAVAVENVAEYQETSMGYDAQHSTYVDMFEAGIVDPVHVVRSC
                     VVDAASVAGLMITTEASVCDYRPTPDKRRK"
     gene            complement(<1051671..>1054067)
                     /locus_tag="LDBPK_302840"
                     /db_xref="GeneID:13385704"
     mRNA            complement(<1051671..>1054067)
                     /locus_tag="LDBPK_302840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862947.1"
                     /db_xref="GeneID:13385704"
     CDS             complement(1051671..1054067)
                     /locus_tag="LDBPK_302840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862995.1"
                     /db_xref="GeneID:13385704"
                     /db_xref="UniProtKB/TrEMBL:E9BM27"
                     /translation="MSSLKDAPSLSPTSRKGFSFAAIDYDDDYTGPEETVEEIHPPSK
                     STSRSKKNKARDSKKPKKNKGAAPVSEVDEPVSSSSVKKTSGSKPVAMSDNQGEDYAD
                     DFEDPVDSDDYIPSVGTSPPAAALRPVTKSKALMADVEAEEKRLYATVQEQLRLEKEE
                     VMQRIAKWEADQAQKAEEMRQREEELKRQLAAQQQREQEVKQRLSDLVEQQVSQHVAA
                     ASAAGKAAAAPTNTATHHAAAKAVENDETEDADEQGTGVSRAELQRRRRREHERAVSL
                     RRAEEEEAAHALFQRLAQDVREVFHELNLSVVAAEKERLIKDERYRRERELRDRREDM
                     TRTEKLEKELKEREEREAKFWAMVEQRDEKFRTFLEERMNKDEEEREARLRRDLEDRA
                     TRLRNERELREEMDKMEKERRAKAEEESRHHDGLVLTAQIEEVSARYRAQLEEVRRQM
                     EADSLRKDELQKAELAMMAKRHEAALEQLQRQHAQQLATMDGHAGNVSRIEALVATMQ
                     ETMEATKAMNEKLLAERMSVLKQKERQLDERQAVLDAMVAEMKANQETVAAERARVAG
                     LYAKFELALSSFSKNSEEDRRTFREAHAHYDTLRQQAEKDRRLMLGEVAQERKLLEQQ
                     FEEFLAKKMEAMAELQNERIAIARERAEASMVRERQNRDETDLLKALRSREEEYKMKL
                     ESIESDRATACHMKDEHKRLCDAAAAERQALRQEREKFELEKKELLSRFEAIRRQAED
                     AASSQERLRIQLMGDRSDALDGNGAAVGLLRGGPLVCNAASRFQMDLARQRAVLQNIS
                     "
     gene            complement(<1054717..>1055691)
                     /locus_tag="LDBPK_302850"
                     /db_xref="GeneID:13385705"
     mRNA            complement(<1054717..>1055691)
                     /locus_tag="LDBPK_302850"
                     /product="GTPase activator-like protein"
                     /transcript_id="XM_003862948.1"
                     /db_xref="GeneID:13385705"
     CDS             complement(1054717..1055691)
                     /locus_tag="LDBPK_302850"
                     /codon_start=1
                     /product="GTPase activator-like protein"
                     /protein_id="XP_003862996.1"
                     /db_xref="GeneID:13385705"
                     /db_xref="GOA:E9BM28"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9BM28"
                     /translation="MGFYPTSTKRWAAIEAERLQEYNGVLEACGLGPEPSKLEPSDVS
                     RFIDVDVPRTMPSLNFFLADESRLEISRDDSTAEVAHFTPSQHALRRILISTAMANKS
                     LGYVQGMNEYVAHLLYAFAEGKASNVTASVEADTFFCFQTLLSYLGDDFCRSFDFDPA
                     CGLTSTMRLFDNVLRFFDPSLFQHLEYLGINAEHYALRWIMLLFTQEFNIADGLRVWD
                     FLFSFGDEIRNAAFFVAAAMCHHLRSSILSGEAMSDVLPLLQEYPAEDVNLFLRIALK
                     WIVKFDFDLLQELKPLSPEGVQALRRSRGLEGGMNFVQVMQSWVPSMF"
     gene            complement(<1056645..>1056959)
                     /locus_tag="LDBPK_302860"
                     /db_xref="GeneID:13385706"
     mRNA            complement(<1056645..>1056959)
                     /locus_tag="LDBPK_302860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862949.1"
                     /db_xref="GeneID:13385706"
     CDS             complement(1056645..1056959)
                     /locus_tag="LDBPK_302860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862997.1"
                     /db_xref="GeneID:13385706"
                     /db_xref="UniProtKB/TrEMBL:E9BM29"
                     /translation="MPATVKRPLWSLLLPQTYTSRVHALAFHAPTIVFMIAVCAIVSK
                     QSYYRSSLADEDPKTYDRIDRRAYVALPDGRMALVYPIIDTQTSFTRTVISFLDAVNP
                     FP"
     gene            complement(<1057519..>1057866)
                     /locus_tag="LDBPK_302870"
                     /db_xref="GeneID:13385707"
     mRNA            complement(<1057519..>1057866)
                     /locus_tag="LDBPK_302870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862950.1"
                     /db_xref="GeneID:13385707"
     CDS             complement(1057519..1057866)
                     /locus_tag="LDBPK_302870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862998.1"
                     /db_xref="GeneID:13385707"
                     /db_xref="UniProtKB/TrEMBL:E9BM30"
                     /translation="MPNLCVSCTFNPPTITLLGSTIREDTVRAMEAQLPLATSTAVNP
                     SKDPAKFIFLSNPDHWRMDLNQHFCDELHKSSVFLVILQSLEEEGWRLRASNNVVNKE
                     NDRETVKLFFTRA"
     gap             1059874..1059972
                     /estimated_length=99
     gap             1060915..1061013
                     /estimated_length=99
     gap             1062844..1062947
                     /estimated_length=104
     gene            complement(<1064382..>1065449)
                     /locus_tag="LDBPK_302880"
                     /db_xref="GeneID:13385708"
     mRNA            complement(<1064382..>1065449)
                     /locus_tag="LDBPK_302880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862951.1"
                     /db_xref="GeneID:13385708"
     CDS             complement(1064382..1065449)
                     /locus_tag="LDBPK_302880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003862999.1"
                     /db_xref="GeneID:13385708"
                     /db_xref="UniProtKB/TrEMBL:E9BM31"
                     /translation="MISVSRALLSPLRSQLQDILCQPLPITEEGLLCALQVGADLTVP
                     LTIIGSCDDGDGEADLKSKLVVHTTGLPGGFVVSEEELVRGRARLRPPLPPAAGDTPS
                     SLGSVCLIEAVTRDLLTASNNSPTPSASPRGVLDAFYRLARRRHFSLAGMARVLECGS
                     RLHPGALQLDFPYHCGSAHATKRYLDITTEVADVFGANMRHGTKVLSRYGVAVSVGVV
                     DRLTSLTMPALMWHPSGAPAACLAPILLGCPVLPLGTVALDYNGPVPGSSLTIKEDPR
                     RYMNIIGDDRYDNSVWLTQGLFGVKPGASWPRPGKAGNDAGTALTGYEVVGVRYDEAA
                     EEMELLVRDAVTNEVVAAADV"
     gene            complement(<1066333..>1067745)
                     /locus_tag="LDBPK_302890"
                     /db_xref="GeneID:13385709"
     mRNA            complement(<1066333..>1067745)
                     /locus_tag="LDBPK_302890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862952.1"
                     /db_xref="GeneID:13385709"
     CDS             complement(1066333..1067745)
                     /locus_tag="LDBPK_302890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863000.1"
                     /db_xref="GeneID:13385709"
                     /db_xref="UniProtKB/TrEMBL:E9BM32"
                     /translation="MFSLLNDWVESAADAVKSVSSKGIDVVRQTGVLDALESVSVNPD
                     SAAAAAAPQEKTLSVPDIMAPPATWAGSEEEWVWCVEAALRDPNTCALTPATLRADAS
                     LWEETKTTVAHLLEAPPPPGKNDLSAPTPTGNSTEAPAALAAKLLERTGDAYTPAADL
                     VKYIQEHYEVYQVRSYIVPRFTSDEDYWLNIGWRINLYRQCTNAGQLLALMQTLSRLP
                     QPLHDIAAAARKPEAPKSEAVGSAQHEGGGDARQNDDVDEDFEEEVIHLKDNAKYWHN
                     TCMQYEVIQEKFVWLQETEERVRKEIELAGGNVKLLSSLIQRKEASTALGASVFDSCQ
                     YHKVKLSRLIADICAAPAEHSEGTLLDSHSGTLFHALVKCNDYVKAVLEAYADRPPSG
                     SGSPKGVVSSPTSAAPASARQDSPVQCEEPSTEVGTGGSSPVELRLSASGSSLDPDSN
                     KADGSDEEPFEAKLPWSMDD"
     gene            complement(<1069343..>1071364)
                     /locus_tag="LDBPK_302900"
                     /db_xref="GeneID:13385710"
     mRNA            complement(<1069343..>1071364)
                     /locus_tag="LDBPK_302900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862953.1"
                     /db_xref="GeneID:13385710"
     CDS             complement(1069343..1071364)
                     /locus_tag="LDBPK_302900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863001.1"
                     /db_xref="GeneID:13385710"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:E9BM33"
                     /translation="MKAGGGLAALLAQTVVAGDVNACCGVLRRVFSETLQEDRRVTAL
                     ASNAARSVRRRGHHSAGTSPSLATAPAAATTTLSSSASSSSLSSSSALAASGGHNDVV
                     NFARYAQHQRAQAHSFANAAAQAVLRTSFVSPDGAQPGAVAAAGTKGRQTDAGVPQSH
                     RASTAFGAPTDIPIAQRVWKLARSTLSTDSALVKTSSLHVLCHTAQRTGYWEEALHFC
                     EYLPKSPAPLFLSSLLRPDNVNPILRHCATRGWALDVTNAIRVLAEEHGSWSAALVVA
                     QDAEHRLPCGEAYSLGVLVPYLAASGATAQARQLFESGLAHGALIDPVLVQQLVMQTA
                     TLRQWETCLHMLQCLYRTQETAQLLPADADFFCRLMEVSPGWVTSLQLLHMARASDVK
                     PNERTVAILLTQCDQAGAWREAAAVYDMAVKEDFIDSLAVGSTYHTLVRSFSAIQQWQ
                     KALEALSWMSKADDASLTAGMTELVTLCEQSGQWEAALSIGSTLMDSGVHLLSAQTSM
                     ALLFLCAKGAQWEFATRLFDAQLHDVRVDPHPLSLCAVMQACVAARQWEAALRVYGGA
                     KSSQPRMVVPPLAHRIAVKACVSAGKWNLAIAVLDATRQDGLPLDNYSQRLGLWAAAI
                     QGQWELSLAFFQGIPRRSRTPQDRMMVRHVTRAISPAVDAIAQRFLQSH"
     gene            complement(<1072078..>1073451)
                     /locus_tag="LDBPK_302910"
                     /db_xref="GeneID:13385711"
     mRNA            complement(<1072078..>1073451)
                     /locus_tag="LDBPK_302910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862954.1"
                     /db_xref="GeneID:13385711"
     CDS             complement(1072078..1073451)
                     /locus_tag="LDBPK_302910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863002.1"
                     /db_xref="GeneID:13385711"
                     /db_xref="UniProtKB/TrEMBL:E9BM34"
                     /translation="MSVFPGLCGDVATTNYRVFLGTLPNLTVEERFLRQVQPVFPWYA
                     SRKHVKEQASEFLEIDLASCDPELLLRYTHVYYVRRQLYDELVDRQLTLMETGKAAKV
                     ADSALLTCLAQVNAAITPRLQYELHLLQQAKKACRVPRRRELNPDAALEAHDYLCMMR
                     VVEEDVAGVPDAEMQARAYLPREVLEAKVKELAAMVFGDGGSATKGTGAALERKEQKL
                     LQRMIPADYNKVGAVEKLRPVDVTALYRFTGERVCGWPADKPFSRALWGHVFRKVGSH
                     PLYLQRASLYWARHSGLDPQSATSTMPADLATAVCVQQTLFPALKYRCQYLYTSPDIA
                     RQQWRTGHVVPLLRLFPLLGAPAAEDLAAQLVVEGEWAKLGIEADTNLLQDTVLRQLK
                     DMVEQVSALYESDAGAVLKRVEDGAKVFCPSLSERESLTMHGVPEDTSREVSAAAAAR
                     AANAAPA"
     gene            complement(<1075035..>1076792)
                     /locus_tag="LDBPK_302920"
                     /db_xref="GeneID:13385712"
     mRNA            complement(<1075035..>1076792)
                     /locus_tag="LDBPK_302920"
                     /product="aldehyde dehydrogenase, putative"
                     /transcript_id="XM_003862955.1"
                     /db_xref="GeneID:13385712"
     CDS             complement(1075035..1076792)
                     /locus_tag="LDBPK_302920"
                     /codon_start=1
                     /product="aldehyde dehydrogenase, putative"
                     /protein_id="XP_003863003.1"
                     /db_xref="GeneID:13385712"
                     /db_xref="GOA:E9BM35"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:E9BM35"
                     /translation="MFLCYLLMVDLFLRAYTIFKWLWACVAQTFDRYTAPTIQVPLPE
                     VNFTTAPAAEPLHPRSAGEGQIQCYDKGTNAPIGTVKAFTPAEVREVVVKARKAQQVW
                     ALTPFSTRRKLLFALMDYILAHQEFICQTACVECGKTMMDGTLGEMLTTFEKLRWTAA
                     HGEEVLQEEVRDVGLMTIHKRASVRYVPFGVIGAIVSWNYPFHNIYGPMISALFAGNA
                     FVGKVSEYSSYYASYYESIVKDGLRQLGYSPDLVSFLTGFAETGEAVVSSVDKLTFIG
                     SPSVGKIIMRNAAATLTPVVLELGGKDPAIICEDADLEQVIPVVMRGNFQNCGQNCVG
                     LERILVQAKIHDQLVLELTRLTRALTQGPASQGQYDLGAMTMGKAAIPKIQQLVDDTV
                     KAGATLICGGKTTSDQFYPATILTGVTPDMPIAQEEVFGPVMVIMKFKTDQDAVKMVN
                     ACAYGLGSSVFSADIPRAQAIADRIRTGMVNINDFGINYLCQSLPFGGVKISGFDRFA
                     GREGLRGNCIVRASTTDRIPGVKTTIPSILQYPISPVAFTFMENLAQVIYGRLPRMIT
                     SVSKLLVIKPGNSTDKKKA"
     gene            complement(<1078736..>1079896)
                     /locus_tag="LDBPK_302930"
                     /db_xref="GeneID:13385713"
     mRNA            complement(<1078736..>1079896)
                     /locus_tag="LDBPK_302930"
                     /product="mitogen-activated protein kinase 5, putative"
                     /transcript_id="XM_003862956.1"
                     /db_xref="GeneID:13385713"
     CDS             complement(1078736..1079896)
                     /locus_tag="LDBPK_302930"
                     /codon_start=1
                     /product="mitogen-activated protein kinase 5, putative"
                     /protein_id="XP_003863004.1"
                     /db_xref="GeneID:13385713"
                     /db_xref="GOA:E9BM36"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BM36"
                     /translation="MASNAAANGSFGSSANAVQLVSTQRGRKVYCVRGQSFDIDDNYT
                     VTSVIGHGAYGVVCAALDDRTFQEVAIKRVSRVFEDLIDGRRIWREILLLRILKECGC
                     RNVLRLIRVLPPRDPIMEFRDLYLVTDLYDIDLFSIIRQNKCESIDLLRRISVRVLRC
                     LADMHSMGIVHRDIKPSNILLRDEKNAEEAIVCDFGLARAGLHRLSEPLDLTDYVVTR
                     WYRPPELLLMCPYSYPIDIWAVGCVMAEYAMQRPLFAGRDYIHQLQFVLSSIPITGVD
                     FIERSSSSSGLANMNEIAKKYKGTRPLPQLLSKLPKDGLELVTEMLAFEPNKRITAQE
                     ALKHPFFSSVGGPDCKSYPAPPELDLGFDMHAEVSECQLRRAIWDELQYYRK"
     gene            complement(<1081369..>1082733)
                     /locus_tag="LDBPK_302940"
                     /db_xref="GeneID:13385714"
     mRNA            complement(<1081369..>1082733)
                     /locus_tag="LDBPK_302940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862957.1"
                     /db_xref="GeneID:13385714"
     CDS             complement(1081369..1082733)
                     /locus_tag="LDBPK_302940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863005.1"
                     /db_xref="GeneID:13385714"
                     /db_xref="UniProtKB/TrEMBL:E9BM37"
                     /translation="MAALLLASRRHVFLYMDESMSAEEMLATTAEMQQVRESLFSFST
                     PLAVDAERARRTVGSSNGGASPLHMSCTLNALAHTDGEYEVLLAAVSREWAQQQERRS
                     TQHPHGAATAPGDGEAGSVPLPGAFQRELEDARAAQRDAEDALADQRRAHRKEVLLLR
                     AELESAQRSGDDTVGSEVPNGSTVNGRAVSQTFSHSLQQQQQHSHRHHSSDAESSAVV
                     SQLQKALQDARKAQQFAEEKARLLELRQSLTSGSKGAPTGAGDASGAVTSPRPSLRLQ
                     PSRATSIAALSPSAAAPPAWEQNLLKQENAALVAEFQRKERAWQQQLLQASAEAAQLK
                     QERATMKATLQLQSQAIAAAQQALVDSRVAQEQEMKQLLERVRVLSQESRSRRRSQTQ
                     SADTDKTRGSHAGGDVPDAGVLSPSVRLSRPLQRQATPEPSPVGSPRPKTTASICGIM
                     SPDR"
     gene            complement(<1084034..>1084609)
                     /locus_tag="LDBPK_302950"
                     /db_xref="GeneID:13385715"
     mRNA            complement(<1084034..>1084609)
                     /locus_tag="LDBPK_302950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862958.1"
                     /db_xref="GeneID:13385715"
     CDS             complement(1084034..1084609)
                     /locus_tag="LDBPK_302950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863006.1"
                     /db_xref="GeneID:13385715"
                     /db_xref="UniProtKB/TrEMBL:E9BM38"
                     /translation="MPISANSLVRWSLAAVGVSGAALGGTYVYKTYFHQHPARNEKIV
                     QLAAIALSGEVVDKSLHDPEVLSQLSTFGLQVLTHPVVLAHLKKFFIHELTDDTPTRA
                     ALRTFVVRDVIQDAWVEEELIGVAEDLVDSVKDNPDLFPDRILAQIGASALEGLQTEE
                     FWWAVRRSSKAAGWIAFISPPPHDMTFEAPF"
     gene            complement(<1085875..>1086897)
                     /locus_tag="LDBPK_302960"
                     /db_xref="GeneID:13385716"
     mRNA            complement(<1085875..>1086897)
                     /locus_tag="LDBPK_302960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862959.1"
                     /db_xref="GeneID:13385716"
     CDS             complement(1085875..1086897)
                     /locus_tag="LDBPK_302960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863007.1"
                     /db_xref="GeneID:13385716"
                     /db_xref="UniProtKB/TrEMBL:E9BM39"
                     /translation="MLQPCVPQLSAALCVMAVVVLLGCVTAQAQENCGTTALCKPYDT
                     NGPACARKKRMNLRFMLQTSRENNFTVGTQVHHLATYSFCPIVDQLSSFTLISAPFMT
                     SCYITKDETSGAVTDHLSMDMGPRYLSVYGFGASNSTLYPQKGVSTGTVLIAVNGTDH
                     TGVSNSVGIVTMLSLEIGLHNGLFNYVGAAAASETTVANPNYDSVLCKNGTVPPAGIN
                     YCDKNITIPVAATVVQPAKVGFAPTCNAEDVCTLGDPSVYTCIGEVPGQKNCGVYRTD
                     PTDIRKLQMTVWVSYYGTDWRRNVLTSGGRNPLNYLTFVKENALQTLANKIDSLFHGN
                     FSDRTL"
     gene            complement(<1089826..>1092039)
                     /locus_tag="LDBPK_302970"
                     /db_xref="GeneID:13385717"
     mRNA            complement(<1089826..>1092039)
                     /locus_tag="LDBPK_302970"
                     /product="phospholipase c-like protein"
                     /transcript_id="XM_003862960.1"
                     /db_xref="GeneID:13385717"
     CDS             complement(1089826..1092039)
                     /locus_tag="LDBPK_302970"
                     /codon_start=1
                     /product="phospholipase c-like protein"
                     /protein_id="XP_003863008.1"
                     /db_xref="GeneID:13385717"
                     /db_xref="GOA:E9BM40"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BM40"
                     /translation="MPALTIGSTLPDPPQTSEELLAVQNLLARLQTSLTLRRVTKRNS
                     VRRRTVSLTSDGKALEYKPTRKSRRQLLVFRDLYEVTKMDPASKVYKKAKLNSNTNVV
                     VEMNTRIHRGWRIVFDDKASANTWLQMIGYKVKGGALAPSGAVPNEDTLTGCICATWE
                     RADTNRDGKVDLKEAKKMMVRMNVEISDDLLADLVRKHDASGDGALDLEEFTTLFIQL
                     TQHEELRPLFASFAAQVDWMTRAEFDCFLKAQGDVPSDILFNTLKPDKNSRITFTQFV
                     HYLLSPCLNPALDPAHQTGVVDEMTHPLKDYFINSSHNTYLSGDQFQSSSQIEMYRRA
                     LLAGCRCVELDCWDGKDNDPVIYHGHTRTSKIRFVDVIDTIRRHAFTASPFPVILSLE
                     VHTSDEQSMVMADHLRTILGDMLMTAKDIPNMMYTPESLKGKVLVKWKLPHNDVDDAK
                     EGLAGSDNDSGAARSPSQKAEASSQGALSHLLRSCVTVGAFKTSDWGRDAEPYYIQSY
                     VETVVKELALSHRDEFIGQTSRMMVRVYPKGTRIGSSNYNPTTAWSVGAQLVALNYQT
                     WDDDMRLNDGMFSLNKGCGYVLKPDYLRNPSGKAKATPCTITVTVLSGTQIPKPSLQK
                     KGDIADPYVKLYINKRDRTEVKTSVVRNNGLNPYWMETFTLACESKEIDLLTVKVMDE
                     DTTSANDSVCEMVIPVRALRTGYRAVPMKLCKNGASLPGASILCKFDIVDLPPQS"
     gene            complement(<1093575..>1094252)
                     /locus_tag="LDBPK_302980"
                     /db_xref="GeneID:13385718"
     mRNA            complement(<1093575..>1094252)
                     /locus_tag="LDBPK_302980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862961.1"
                     /db_xref="GeneID:13385718"
     CDS             complement(1093575..1094252)
                     /locus_tag="LDBPK_302980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863009.1"
                     /db_xref="GeneID:13385718"
                     /db_xref="InterPro:IPR019401"
                     /db_xref="UniProtKB/TrEMBL:E9BM41"
                     /translation="MKRTFPLLWTFSDNRGYYGPPVYMPLEYASRITNQKQLVFTHPK
                     DPKYTWNTGIDELSSLHPGILGPGRKTPQLNYTSRGGIICEIPPVPVYRSRIWCMGHG
                     HFILQHPRIFIKCPRNKVVCCKWCRLKFINMSTDEDNDDDWFEEEHKISTTPESEEDL
                     RQPIRDLGGVLRNSPFQDGKEPDPHVYRSVFDPERYRWKHPGKANYEVHPAYAKKDSA
                     HEDCGHH"
     gap             1094858..1096607
                     /estimated_length=1750
     gene            complement(<1099143..>1100228)
                     /locus_tag="LDBPK_302990"
                     /old_locus_tag="LDBPK_303000"
                     /db_xref="GeneID:13385719"
     mRNA            complement(<1099143..>1100228)
                     /locus_tag="LDBPK_302990"
                     /old_locus_tag="LDBPK_303000"
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     glycosomal"
                     /transcript_id="XM_024473481.1"
                     /db_xref="GeneID:13385719"
     mRNA            complement(<1099143..>1100228)
                     /locus_tag="LDBPK_302990"
                     /old_locus_tag="LDBPK_303000"
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     glycosomal"
                     /transcript_id="XM_003862962.1"
                     /db_xref="GeneID:13385719"
     CDS             complement(1099143..1100228)
                     /locus_tag="LDBPK_302990"
                     /old_locus_tag="LDBPK_303000"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     glycosomal"
                     /protein_id="XP_024329252.1"
                     /db_xref="GeneID:13385719"
                     /db_xref="GOA:E9BM42"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:E9BM42"
                     /translation="MAPIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNA
                     EYFAYQMKHDTVHGRPKYTVEAVKSSPSVKTADVLVVNGHHIKCVKAQRNPADLPWGK
                     LGVDYVIESTGLFTDKLQAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTTHH
                     VVSNASCTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAA
                     AMNIIPSTTGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDK
                     AIKKAAQTYMKGILGFTDDELVSSDFINDNRSSVYDSKATLQNNLPGERRFFKIVSWY
                     DNEWGYSYRVVDLVRYMAAKDAASAKM"
     CDS             complement(1099143..1100228)
                     /locus_tag="LDBPK_302990"
                     /old_locus_tag="LDBPK_303000"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     glycosomal"
                     /protein_id="XP_003863010.1"
                     /db_xref="GeneID:13385719"
                     /db_xref="GOA:E9BM42"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:E9BM42"
                     /translation="MAPIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNA
                     EYFAYQMKHDTVHGRPKYTVEAVKSSPSVKTADVLVVNGHHIKCVKAQRNPADLPWGK
                     LGVDYVIESTGLFTDKLQAEGHIKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTTHH
                     VVSNASCTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAA
                     AMNIIPSTTGAAKAVGMVIPSTKGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDK
                     AIKKAAQTYMKGILGFTDDELVSSDFINDNRSSVYDSKATLQNNLPGERRFFKIVSWY
                     DNEWGYSYRVVDLVRYMAAKDAASAKM"
     gene            complement(<1101068..>1102294)
                     /locus_tag="LDBPK_303010"
                     /db_xref="GeneID:13385720"
     mRNA            complement(<1101068..>1102294)
                     /locus_tag="LDBPK_303010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862964.1"
                     /db_xref="GeneID:13385720"
     CDS             complement(1101068..1102294)
                     /locus_tag="LDBPK_303010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863012.1"
                     /db_xref="GeneID:13385720"
                     /db_xref="InterPro:IPR021259"
                     /db_xref="UniProtKB/TrEMBL:E9BM44"
                     /translation="MAVSCEFILSAFLVIITGLLFIDLVPLQETMLCPGNYTNAIECP
                     EVYYSSSYQLARERFLAAAEAAHAQIEHHLITKRGNEEYYMDTAFFAGKRKDKLLVHT
                     SGTHGVEGFTGSAIQVKLLQEWNETALSGPSILFVHAVNPHGMAHFRRFNEENVDLNR
                     NYLSTEEWAEVKARDANIAGYEDLRPLLVPQTPPRFIDRYVLLYVAAKTLARHGFVKL
                     KRAFVTGQYHDPAGINYGGDREQKSISVLREVLKKHAVATGATEAVYLDVHTGLGPTG
                     VDTMMMKSSQEAEKCRKVFPGARIDNSQTATSGPSAGYNLAAGSIRPVAELGPNTLAV
                     TEEFGTVNPLFVARAVILENAAYRLCRGSYVHAVMQSWMRDVFYPQEISYKRATLKRG
                     SVAFWKAWTYLAESQA"
     gene            complement(<1102973..>1103587)
                     /locus_tag="LDBPK_303020"
                     /db_xref="GeneID:13385722"
     mRNA            complement(<1102973..>1103587)
                     /locus_tag="LDBPK_303020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862965.1"
                     /db_xref="GeneID:13385722"
     CDS             complement(1102973..1103587)
                     /locus_tag="LDBPK_303020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863013.1"
                     /db_xref="GeneID:13385722"
                     /db_xref="UniProtKB/TrEMBL:E9BM45"
                     /translation="MTTLSPPPHAGGTPRHSSSISTVKDFRPDDRPLLSFIALSAAQS
                     SMARSAEVVLDAALMPPTTPSPSASLVSSVDETSSADSLSARYPEVRVLLHLHYLRCA
                     LRDLQECPAHARRTFFSIIHEHLASLALVLPEPLFTAIAAVLQRFLAMSTDEALAKDR
                     CHVLEVQLMHIVEATQTELLRATKQLSMRAGVMTLRFHHDIPYL"
     gene            complement(<1104113..>1106656)
                     /locus_tag="LDBPK_303030"
                     /db_xref="GeneID:13385723"
     mRNA            complement(<1104113..>1106656)
                     /locus_tag="LDBPK_303030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862966.1"
                     /db_xref="GeneID:13385723"
     CDS             complement(1104113..1106656)
                     /locus_tag="LDBPK_303030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863014.1"
                     /db_xref="GeneID:13385723"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BM46"
                     /translation="MHTSTSSLTGATTSSRVPVSHYNPCLPPVDVVAHYTDLLKRGAE
                     TRLTRLLRAKAYVQLHDYASACADLDDWIQEIDRTAHGISAGAAADSLTEALFYRGVC
                     RARLSQVKDAVADFTEVLQRKPGHRRAHYERAACHAQLDDFFNAIADYEAALQLDEVG
                     REKENLRRYRERRCCSAQQQPRRMRFASSRPRLSPLPLCSIAVRPPSNAVSPLRQHVP
                     TPASEKAQLTDGPLAPEQSAPCSPVSTRGAMASSSRCMPMNEASDSAVATVSLSEYTM
                     PAAGAGATTLSAILGRRISQGFSDHSHDNLTSVSSSTESLLDGSVMEVDETVEDVSAA
                     RTHEIAASYSTRHENPENGHGMLAAMDPTCILSSSNSEGEEWLPDDVLEAETWQQSKG
                     SCAAARLATAGQLLLNAHYFYQRGLEHRRRGELEAAIHMYTRALELSPTHFKALFNRA
                     FCEDKLKNYTRAIEDYTAALDLDPRNPFTHYNLGISYDHKGRHARAMQAFTRAIELDD
                     RHPDFFHNRGFTQRKQGAYAAAIADYTTAISLDPKHFKSHYNRAYCFSKLGRYEEAVA
                     DYAAALQIDSGNANAYHNRGAALAKLGRLEAAVENFNCALRLSPKLTFALNARGLVYD
                     QLQQYDKALADFTEAIRLDQRNPVWLHNRGYTYRNMGELELAIADYSASIKLAPHSHT
                     AYTNRAFAFRKLGRYEAAIEDYTRALREHPGVATKVLNNRAYCFARLNLFEDAVRDYT
                     EVLATDPVNAHALYNRGISFEKCGKYNAAVDDFTRAIRLAPEVPSTACSYYSRGTSRL
                     QLHQVPQAAEDLKQALKLDLVACGLRGEALYAFRAEHPAWRLLQDLGAD"
     gene            complement(<1108014..>1108400)
                     /locus_tag="LDBPK_303040"
                     /db_xref="GeneID:13385724"
     mRNA            complement(<1108014..>1108400)
                     /locus_tag="LDBPK_303040"
                     /product="Lsm5p, putative"
                     /transcript_id="XM_003862967.1"
                     /db_xref="GeneID:13385724"
     CDS             complement(1108014..1108400)
                     /locus_tag="LDBPK_303040"
                     /codon_start=1
                     /product="Lsm5p, putative"
                     /protein_id="XP_003863015.1"
                     /db_xref="GeneID:13385724"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:E9BM47"
                     /translation="MITTAASSAVVAVEKRNLVMYVGNRVKVTLDDASVLIGRLVSLS
                     SCGNLILTDVERQRILKRRRNRDGVHETARECYAAVLFVRGSSVVSVGYDSGITTDKS
                     VIDHVGGREANSSRMVQLANAAPSTR"
     gene            complement(<1110025..>1110990)
                     /locus_tag="LDBPK_303050"
                     /db_xref="GeneID:13385725"
     mRNA            complement(<1110025..>1110990)
                     /locus_tag="LDBPK_303050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862968.1"
                     /db_xref="GeneID:13385725"
     CDS             complement(1110025..1110990)
                     /locus_tag="LDBPK_303050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863016.1"
                     /db_xref="GeneID:13385725"
                     /db_xref="GOA:E9BM48"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR024166"
                     /db_xref="UniProtKB/TrEMBL:E9BM48"
                     /translation="MAAATNSNSKFFVPELTQEDVPGGACCVDETTFATLFPSYLESY
                     IKSIWPAVEELLGQHQLVGKLDLLEGSMTVATTRRTWDPYAIIDARDFIKLLARNVPL
                     AQAQKIFQTDITCDIINISVKGGSVRRFVKRRDRLIGPQAQTLKALEILTGCYVLVQG
                     KTVAVMGPVKGTQMVRSIVEDCMNNIHPIYGLKQLLIKRELSKREDMKHEDWSRFIPV
                     YKKTQPNKEKQKAVRKMKKERMKEAKRKQAGKEKSIFPPAPPKRLEDIAMESGQAFLA
                     PRQRRHTDELELHSATSPSPSASARTRNSKGSSSKRDAPASKIKK"
     gene            complement(<1112183..>1112470)
                     /locus_tag="LDBPK_303060"
                     /db_xref="GeneID:13385726"
     mRNA            complement(<1112183..>1112470)
                     /locus_tag="LDBPK_303060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862969.1"
                     /db_xref="GeneID:13385726"
     CDS             complement(1112183..1112470)
                     /locus_tag="LDBPK_303060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863017.1"
                     /db_xref="GeneID:13385726"
                     /db_xref="UniProtKB/TrEMBL:E9BM49"
                     /translation="MDQTKLFQDFACSVRCESKNTVVFVACPKGGRYGDVRKTLAGLL
                     QRPFNSVHVASPAGDYAVPLDDDQVVEPAENEVIVPARILKATEQGGWEFE"
     gene            complement(<1113979..>1115478)
                     /locus_tag="LDBPK_303070"
                     /db_xref="GeneID:13385727"
     mRNA            complement(<1113979..>1115478)
                     /locus_tag="LDBPK_303070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862970.1"
                     /db_xref="GeneID:13385727"
     CDS             complement(1113979..1115478)
                     /locus_tag="LDBPK_303070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863018.1"
                     /db_xref="GeneID:13385727"
                     /db_xref="GOA:E9BM50"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:E9BM50"
                     /translation="MESSHSDGHGEESLSSTQMFWYSVAAVVCVASAGFFVGLQIALF
                     SIDRLFLRVLSTTGTPKERQQAKSLLAVLKLQHWTLVALVLMNAVFVMTLPILLETMF
                     DEITALIVSITAVLFAGEVLPLAVFVRWAIPVCSYFIHAIWFAIIVTAPVSYPMGKVL
                     DRVLGHSEEPLDREDLAALIVGPRLGENEEESTMMEVTSVRVGDGDGGGESAQTAKEK
                     SSPGQLRDSEVKMLQAAMLLSTDTVQQHLRTKAEDAFMLSSHDSLDRETILCILTTGY
                     SRVPVYFGEDRRHIIGVLIVNSLVSLCFSHPDPPPLVSDYSLREVLRLSQEASLYDAY
                     LAFRNGPSNMAIIYDPSGAMAGLLTLNDVLAILYNADPVAPATLSEQYLRRQRKMVEL
                     VEGMKVLQATKRVVPVSVSTSRLGGAGPQDVQKDDAQDQTATIGTLIPAPRHGLSLAK
                     PTPLPRSFMPLAGDQLFASTPFLSTSSPTRSAESKTGHEGTALRGATSP"
     gene            complement(<1117225..>1118820)
                     /locus_tag="LDBPK_303080"
                     /db_xref="GeneID:13385728"
     mRNA            complement(<1117225..>1118820)
                     /locus_tag="LDBPK_303080"
                     /product="eukaryotic translation initiation factor 3
                     subunit 7-like protein"
                     /transcript_id="XM_003862971.1"
                     /db_xref="GeneID:13385728"
     CDS             complement(1117225..1118820)
                     /locus_tag="LDBPK_303080"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit 7-like protein"
                     /protein_id="XP_003863019.1"
                     /db_xref="GeneID:13385728"
                     /db_xref="GOA:E9BM51"
                     /db_xref="InterPro:IPR007783"
                     /db_xref="UniProtKB/TrEMBL:E9BM51"
                     /translation="MSFELPELYINPQFSWGPPEEEMKLDDGAPFELYSKADPLEALD
                     WFTYKKEADVSDSDSDDEAVAANKRKAFKQVEDNARLNALRTEREKTVMFNPRNNGPR
                     NAKLAAGKKGGKDSRNNNQRRNRRKVTELPNTYNASAMAVVQHVMKQTDMTKLRMSAL
                     PKVIELGLYGTPPIYNTGIEAATCARPLPLDESKYEEDYFMRGLTTEDPELRKIMGEA
                     QRYPLVVVTDEILSLLMVCTRSSYPWHIRVLNYNNIWILVKGEDSNIEKQWVSETAGH
                     EIRPSEGADNRAERISSLGEESTKVYDCFARASCAKSFAQIKTNRSPFSRKQPRMYSY
                     RRYIMHDGTPDRYDIVVRCEVDALMPRTNDRVRCFALLEQCVVSEKDSSWRREGLLKN
                     AASFLPIEYAHNGCKIARWTALSLLSDAKLMKIGFVTCEERMEKGQRVFDHKQHEVLS
                     VQTYSPASLATQFGIDVSNMWAIVDHIMRPFIEGHSICPSILMKPGDKSELIVVEEED
                     DDDESDEDDSEEDGDDGDDKDDE"
     gene            complement(<1119686..>1125388)
                     /locus_tag="LDBPK_303090"
                     /db_xref="GeneID:13385729"
     mRNA            complement(<1119686..>1125388)
                     /locus_tag="LDBPK_303090"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003862972.1"
                     /db_xref="GeneID:13385729"
     CDS             complement(1119686..1125388)
                     /locus_tag="LDBPK_303090"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003863020.1"
                     /db_xref="GeneID:13385729"
                     /db_xref="GOA:E9BM52"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BM52"
                     /translation="MLWADFGPPLHNFSGSDGQAAMGPILFAEATTVHYRGSVYHGLT
                     EEMLQRGGSTFSIQVSIPTFPTNITLVRSIMMSILTSNVRLVDDAGTFVRRMQPAAQG
                     EAAAHAFNHTKAWLTWRRFVKDILSHSEIEVSPNGHAVKVRFASGKWVLPAQTSALIV
                     PCLPFSLFEQLGRLGVQDLPNNCLAGDPFFVSKKSFLQLDEARWNPSQQVLVTGGPIS
                     IPLAGTSSTVSDKAELERRLRVMEGYTCLHTRSAFVRGSRWDVRGSVYRFTPHRGGMQ
                     TLCYVPYPDTLPFLSVKLMDSYEVAGPEGVSTDPPQVHADLEFSGTIYGTNLTERDTV
                     VITDELCADFTSQNVFFVDLFFSSSSRVSFFGTFHKRGIYHVCYHREGSPMYVLVSTL
                     LVERGADVVIDNDSPNVLIDQDVKLLQSASVSRLNVQDKGNLNLRQRSLNVSYFLWSG
                     GSISGRGTINCTGYAKITTQGYETRLLSVPLYNYGEMTIDVQRLSMERDGAIHNYGNL
                     TLAVSSMGVDSISSVLSAGRRNAITNYPGGVIRIMALDERSYALLTGRFIFQGGSVLL
                     LGKINLTDASSFADSTVTLKSGTLLTTHKMHLGGAVVVEERSVLTLMKGCVFVSATVS
                     GDGVVRLLGDDVVLNSLTVTGSIRALFGVGMTDPISVIAYGTTHFGEDTLVHVTNANF
                     VTSSGLAKVTFLGRLLADFVTVRFAGNMILQIGGVAALYGNMSGEALNFRRTLTKLSG
                     YSLPLAMASFVSRNATMFVIDTFRLDEAVDASARGGSSTAKGIVSSLDPFNKSIFSGP
                     AAVETQACEVYLPTSQRLTVSGRLVLRGCVQVPAGGTISGAVVKLEDSADWELLHQTF
                     CIFADPETLPHLCRHNRRSVPPLRSGLALSEKVYVRSPASFLLDELTLVHSHTRVTES
                     VPITIKDTIIVRVGSTLVLAYGIVMAARHIIIEGTLVVNDPRNTVLKGLVEVKEEGII
                     ELRGVSGMSCANELLVEGRLYLAPNARGFHFRCLSASDDDIGGEDSEAAPADPEGGET
                     MKPMGRLDALLRKRALANLQPDMTCPDDVVHDYDSRRQFINLYWMRQAYDPPADQPTR
                     RDMIWMTLFGIACCFGTFHILLTMWGYTYKKWWSDIRTPCPLQLTLTWDELSYSAVNY
                     FSFCRFIIIHLLNTMAAFHPGLPAPLPSVAGMLLRGMGLLMPHHQTPISRPRKVGIFY
                     IVWLFTFLYVKKRGSWLISYLRRRHPYLLDVVQKLYTVLTILNFIFLAPLMSSVVDAI
                     AWPTLLRNVPTYELMQQDIWVAISIISFLSMGVMAPSSILTNQMFIPHMDLRVRASNM
                     FVHFAAQMWETVMWKVFYNNPMCVVFNCIFFQFIRLAFLLCFPATPYKNVNRFMMFLL
                     MQPFLVYLAIILYVVLVRTGVYTSCTQGTDLFRVVAAAFVISLFVNFWRNVLFTQEQT
                     TATGDVSIDALRCSMTQIRNRIHDLKFEVYACTDAMERENILNAIARMRIEYLEKQER
                     YRFETHRILRPFFFSGTGFDGDTHLQSHSSVASYSNDDGDDASNVHPAMSPNMQQGTL
                     LSVEEMETFSCGPALGKGSYGTVHLGILTNGKMVAVKYVNVVSESPEALASVEAEVNM
                     LRELSHPNIIRYFGAHTIQDTMLVFMEFAVGGSLTSIVKKFTHLTEPVMQLYTFQILK
                     GLQYLHDKGVVHRDIKGENILIDGYGVAKLADFGCSKSLANIANSSQVGCGTLVGSPF
                     WMAPEVIRSEAYGTKADIWSVGCTVVEMLNGGEPPWREEFDNVYSAMFYVGSTNDIPQ
                     IPAETSDPCRDFLFRCFERDVMKRASADELLQHPWLKSAAAASHAEDSSDNFLSFSTV
                     SSPSLKSAYDGHRTAGFSRSTPHSSREDLTSPLNGSTAPQPPNGSIASITSNASKKFK
                     "
     gene            complement(<1129239..>1132811)
                     /locus_tag="LDBPK_303100"
                     /db_xref="GeneID:13385730"
     mRNA            complement(<1129239..>1132811)
                     /locus_tag="LDBPK_303100"
                     /product="kinesin, putative"
                     /transcript_id="XM_003862973.1"
                     /db_xref="GeneID:13385730"
     CDS             complement(1129239..1132811)
                     /locus_tag="LDBPK_303100"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003863021.1"
                     /db_xref="GeneID:13385730"
                     /db_xref="GOA:E9BM53"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BM53"
                     /translation="MSSAGEVSVAAGSAVEGEDSRLRVGDALDEVDDGSAAAASPTST
                     TSAATKAKKKSAKTPTNRRTSGSGIDVCDNDDGQALSRCLVYCRLRPTIKKDYKEGGH
                     ALVTLEDKRVVVKDERHYDFDGSFGPLAEQSEVFESVAIPCIDHAFNGFCSALMCYGQ
                     TGTGKSYTMCNTDPHHLGIIPRAAKYIFEKIQANEASDPTRTYVVTGQFVQIYRDNLG
                     DLMVHEGKDRVEIHYDEENGVSLTGCTSHALASSKDFMRFYNEGNARRVIGSTAMNAE
                     SSRGHTAMIVYVTSEDMEDISKGKLRGKITFIDLAGYERFSKTGITNADPIRKDEAKT
                     INASLLALGHVVSSLSAGTKHVPWRNAKLTRILQDSIGGRSRTSIILTVGPSSEHLYE
                     TTNTLQFGLRAMAVKVEAKMSVTVDYVKLSKKLMGLLSERDERISSLEVQIANRDAER
                     QELLERYQRDRGDLEQRFAAELQQLTASGASEQQIRNLKEVYQVEIENLQDQQQEEIG
                     YHDEIHSKEITQFIKEQKHQEAKSLMEMKLAQERLVEEFQRKLDNARGGTNEDLVRAL
                     QQLAEKDAILASRANDTARLHATIDALTTQVRSFGGTVQADVDFPETFLDVSQVEEMR
                     ARLQGEVERNYNKVVDLSTQLDRASMLARDRMEEVSKLQQEAERLHEKLVQAGVEISE
                     SNEELQELREKRAELVDPEELESLRLLMQTDIDELRSQRDELQAELRRVNEARVRESM
                     ARRRNVLDSPETLKRILAEDVGEGTEDLGGNASREQGRGDSGNAADGVHKMGPKAKAM
                     QRAYKKMIQKLNRQLSDSSRDRAALVQRIQQLERTLTLYGIPVQATPGCATEYKEAEA
                     SHGGNTRGGPARPDASASDRESSSAESHTEESLLTAGSADAALVLLFKEQEIEVRDGL
                     IAQLERQLSKAVSAYENDQKYIQELKTLLRDAGETPPETSSSGSQPVEGVPLEEYSTL
                     LRQLRSHNRKLLVELLVLQSRQKAEATESPTTERLLFEEQLEERDTELEMKDEMLLEK
                     NAMLQYMATLSARLINQMEALGLEPCCHLPERYQDLVKAEKDQLDIQAAKQRELEAQL
                     QREQDEKKKMKRLLEAINAEREQGAAVLRQTELRNKELRERENSAMTALQELTERTIQ
                     KEMMSDEALRRTTHELMELQARYANQQHRRSSNLFERLLRSIIE"
     gene            complement(<1134245..>1135408)
                     /locus_tag="LDBPK_303110"
                     /db_xref="GeneID:13385731"
     mRNA            complement(<1134245..>1135408)
                     /locus_tag="LDBPK_303110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862974.1"
                     /db_xref="GeneID:13385731"
     CDS             complement(1134245..1135408)
                     /locus_tag="LDBPK_303110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863022.1"
                     /db_xref="GeneID:13385731"
                     /db_xref="InterPro:IPR007356"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="InterPro:IPR028564"
                     /db_xref="UniProtKB/TrEMBL:E9BM54"
                     /translation="MMSRCAAAVTASPATPCESSLRTSGANAQDANASDTCDGVAEAS
                     HRTPTGHRRQRRSWTQEEKRAFWKQKKLEKRGRRKAAAADRQKEQQAQWVRLTEEEKE
                     ARRAEAVLLHERRRQAETALVNRCKAQLADPHVPTIVFDLSFAWCMTEANTKSTVSQV
                     MLSYSALRTAGFPFRPVITSLMGKEASDTEHDATAQAKVLQALNNYEGFRRFPPSVTQ
                     VQHWSELFAPSQVVFLTADSPDTLTSIEPDTAYIVGAFVDHNAHKGLSYASAQRHGVR
                     TARLPIKESVVLGNRCKVLTINHLVEVLIQYEKLRAAGTPNWAQAINGALPTRRAQQV
                     IKGRRKRWRVSVTGSGDEEGDDEEVSDDGCSNCRLDSENGSAAAEECPCERVE"
     gene            complement(<1137241..>1138266)
                     /locus_tag="LDBPK_303120"
                     /db_xref="GeneID:13385732"
     mRNA            complement(<1137241..>1138266)
                     /locus_tag="LDBPK_303120"
                     /product="homoserine kinase, putative"
                     /transcript_id="XM_003862975.1"
                     /db_xref="GeneID:13385732"
     CDS             complement(1137241..1138266)
                     /locus_tag="LDBPK_303120"
                     /codon_start=1
                     /product="homoserine kinase, putative"
                     /protein_id="XP_003863023.1"
                     /db_xref="GeneID:13385732"
                     /db_xref="GOA:E9BM55"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:E9BM55"
                     /translation="MSDEAATPLPKKVSLRVPATTANIGPAYDTLGMALSIFMELTVE
                     LAETFSMTVTGEGQEYISTGEDNMVVQTCRIAFEEYAHKSMPPLKFTMHNNIPYKCGC
                     GSSSAAAVAGFVAGMTLSGLTMETHNNESLLSAISKIEGHSDNAASAIYGGIQLVYKK
                     DDDRAMTYHVPTPPNLSIVLFVPHKLMKASTHVTRDLVPTTVSLRDAVRNISGTAILT
                     LALSTGDLRMLTDASDCLHEQQRSRKLYPHYSACAKAAREAGAVYAFLSGAGPSVCAM
                     VPGRHGDLLTQPMEERKAEVVAEAMVKAAEAVGVQGRVIITMPSDFGVHLSGTTCIRP
                     NIQYTSI"
     gene            complement(<1140732..>1141730)
                     /locus_tag="LDBPK_303130"
                     /db_xref="GeneID:13385733"
     mRNA            complement(<1140732..>1141730)
                     /locus_tag="LDBPK_303130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862976.1"
                     /db_xref="GeneID:13385733"
     CDS             complement(1140732..1141730)
                     /locus_tag="LDBPK_303130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863024.1"
                     /db_xref="GeneID:13385733"
                     /db_xref="UniProtKB/TrEMBL:E9BM56"
                     /translation="MAAAQQVANAFTVDFVERVAKNAANIADLYGRHATLTVNDFELG
                     ISEVHDSYVPIAVQKWAVSLQGSRLRVDSVNAAPLYGGVNVFVTMTAFGEMQQYYHIV
                     TTLESFQDTYGMDGYYVRHQVIARIGAVTPEPPAPEPTPAAAEKSKSPTPEPEAAPAQ
                     PAPKPEAAEEPASAAAPAELEDEEEKPAPAPVSSKPKSWASLVSRAPVKTAEHKPMRV
                     VAHEGGKKPTTEPAATAAAAPASKRLPPRERKVSEAVGDRLMFNTTGSVTDDEIRAAL
                     GPMSAHLVSLRNNSAKGHVFMDFAEKVNVFDELSKAQPVIGVSKVKMSVFRQRARE"
     gene            complement(<1142786..>1144705)
                     /locus_tag="LDBPK_303140"
                     /db_xref="GeneID:13385734"
     mRNA            complement(<1142786..>1144705)
                     /locus_tag="LDBPK_303140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862977.1"
                     /db_xref="GeneID:13385734"
     CDS             complement(1142786..1144705)
                     /locus_tag="LDBPK_303140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863025.1"
                     /db_xref="GeneID:13385734"
                     /db_xref="UniProtKB/TrEMBL:E9BM57"
                     /translation="MRCVTLRLSSQAAGRRSFTPYQVVLKAVEHDGRGLLAAAEVFKQ
                     FQRFYRSYQQEEAQRTQAPSTSAESSSATGGDNATAEPRFIPGKPLTQFCGRLEDVEP
                     MTVLLLKVLCDLQKLEEMRFLFTQCLLEMEDRAPSVELFNVFLLAISMTDTFNQYEVE
                     NLVELQRSKGIVPDVVTKLSMFLLYLRLGHQNCVAWWPGIREEVEIIIDTDAVARYPL
                     LPLRLQHCFQTLLRVHYDTAVIHESFELLHRAAPERVTPSIVLPYLLLSAMNMSTPPS
                     AVVKVLKLMQARERHSSSSPAKAASEQAADTSSPSSPTATTAATQEPVLSSEITVFRL
                     LAKCAKYGDADAAAYMRSYIDTHRQFGLVAKENEPVAALLYVEALTKAGRIRSALRVL
                     EKEVPAPYNRPGERPKLFLQSRRLSLLSTDPVRNVVAALTPLVAAAHLKDPAVPLVSE
                     KTSATDAEEREPVPVTSVTLDLLLAACQFAGSAKRAEEVLSLYPRYETAPTSTTYALL
                     LEVYAATAPVDGALRLPSLQREMEDAGIAVNAAWLHAAMAVALDARDIGAALRVAELS
                     VAHKSSVDVKHGARLLRELAVAADAAAMRRALHLLRSSNSTVDSRSVALCTAVLRSLG
                     VPAAALKVDAPAHKS"
     gap             1145640..1145738
                     /estimated_length=99
     gap             1146741..1146839
                     /estimated_length=99
     gene            complement(<1147546..>1148694)
                     /locus_tag="LDBPK_303150"
                     /db_xref="GeneID:13385735"
     mRNA            complement(<1147546..>1148694)
                     /locus_tag="LDBPK_303150"
                     /product="S-adenosylmethionine decarboxylase"
                     /transcript_id="XM_003862978.1"
                     /db_xref="GeneID:13385735"
     CDS             complement(1147546..1148694)
                     /locus_tag="LDBPK_303150"
                     /codon_start=1
                     /product="S-adenosylmethionine decarboxylase"
                     /protein_id="XP_003863026.1"
                     /db_xref="GeneID:13385735"
                     /db_xref="GOA:E9BM58"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="InterPro:IPR018166"
                     /db_xref="InterPro:IPR018167"
                     /db_xref="UniProtKB/TrEMBL:E9BM58"
                     /translation="MNVCSNTTKDPLTLMAMWGSMKGYNPEQGFSFEGPEKRLEVILR
                     CTLETHVDGLRSLDDSVWSGVVGSLNAQIVSRESNECINSYVLTESSLFVMKNRIILI
                     TCGTTTLLNSIPNILEAISAVRGELEWVSFMHKNYSFPWMQKGPHTSLADEFATLKQH
                     FPTGKPYIFGPVDSDHYFLFCYDDIIRPCSSEDDTQLSMTMYGLDKEQTKHWFSDRFI
                     STSAETAAIRAATHLDRVVDGTWTLHDLQFEPCGYSINAIRDEEYQTMHITPEDHCSF
                     ASYETNSRAANYSDRMKKVLGVFRPQRFTVIVFLDPESPVGKAYNEGKGIGVEPEYYP
                     EYNLLHRTTNEFAPGYVAMKINYVRTAAVEETDTAVGGAEPGAEGGPD"
     gene            complement(<1153950..>1154843)
                     /locus_tag="LDBPK_303160"
                     /db_xref="GeneID:13385736"
     mRNA            complement(<1153950..>1154843)
                     /locus_tag="LDBPK_303160"
                     /product="S-adenosylmethionine decarboxylase
                     proenzyme-like, putative"
                     /transcript_id="XM_003862979.1"
                     /db_xref="GeneID:13385736"
     CDS             complement(1153950..1154843)
                     /locus_tag="LDBPK_303160"
                     /codon_start=1
                     /product="S-adenosylmethionine decarboxylase
                     proenzyme-like, putative"
                     /protein_id="XP_003863027.1"
                     /db_xref="GeneID:13385736"
                     /db_xref="GOA:E9BM59"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="UniProtKB/TrEMBL:E9BM59"
                     /translation="MSLWGGFSNPTSYSDSGLEKRLEFDFAAAVDVRTFTVEELEEVL
                     AAAGQRLQHHSSADGLLSLEMTQCIIILTPCKLVVTSASEVMLHQVITPTIALLTSKG
                     VRVEWASYLRKNITSPWCAESEMSDIMAQEYAELKAAFPAGKSFLTGPVDGHHCFNFV
                     YDNVERMAGRKEEDVQVNVFLYDVAAGLEEVDKTTQRFHALQSGEYEVMRTFAGVPCI
                     SFETNAKAAVASPTRVQKLLDTFQPAHFTVAALQDRDADGLALRRNFNSFTPYTLQNR
                     TVNLFGEGYAFHQLLFARSAD"
     gene            complement(<1156853..>1159756)
                     /locus_tag="LDBPK_303170"
                     /db_xref="GeneID:13385737"
     mRNA            complement(<1156853..>1159756)
                     /locus_tag="LDBPK_303170"
                     /product="valyl-tRNA synthetase, putative"
                     /transcript_id="XM_003862980.1"
                     /db_xref="GeneID:13385737"
     CDS             complement(1156853..1159756)
                     /locus_tag="LDBPK_303170"
                     /codon_start=1
                     /product="valyl-tRNA synthetase, putative"
                     /protein_id="XP_003863028.1"
                     /db_xref="GeneID:13385737"
                     /db_xref="GOA:E9BM60"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR019499"
                     /db_xref="UniProtKB/TrEMBL:E9BM60"
                     /translation="MAATYDPAAVEADWYPWWEKSGFFRPASDHKSETATKPFVIIAP
                     PPNVTGYLHLGHALTGAVQDTLIRFHRMKGDNTLYLPGTDHAGIATQVVVERRVMKEE
                     GKSRHDLGRDEFMKRLWEFKKNHAGMITEQFRRIGLSLDWTRERFTMDEQSSAAVVEA
                     FVRLHEDGLVHRDTRLVNWCCALQSAISDLEVEFVEVPKTSKMTIPLYDRKVDMGSLT
                     HVAYKLADSDDELVIATTRPETLLGDTAVAIHPDDERYKKFHGKFLKCPFRDDIIPIV
                     LDATLVDMNFGTGAVKITPAHDPNDFESGKRHNLQQLVMMDLKGYVTMEPFKGMHRFD
                     CRREIVKKLEEMGLLRGVEPYEYRVGRCERTGDIVEPMLMPQWFIDCSDMARRSVEAV
                     RNGDLRLYPPSHEAVWYHWLENIKPWCVSRQLWWGHRIPAYKVVGSLPKDVDPWVVAR
                     NLQEAHAKAKKKFGLTDEQVAEASFEQDPDVLDTWFSSGLWPFATLGWPTDSDDMKRF
                     FPNSLMETGHDILFFWVARMVMLSLHFTNKLPYKEVFLHAMVRDKNGEKMSKSKGNVI
                     DPLYVIHGVSLQTLHNTVRSGNLGDKEVEKAIKQQKEFFPEGIPECGSDALRFGLLSY
                     TQSGRSVNLDIQRVVAYRQFCNKLWNVVRYVLYHALGTDYVPSKQQFSPAEDAAMLPL
                     ECRWILSRLDAAIAEATQGMSEGLYDFALATGAVYRFWLHELCDVFLELTKPTIQKGG
                     EKQQLVQDVLLHVVEKALRLLHPMMPFLTEELWHRLPNYSSFGSESIMLAKYPTPSGW
                     LSAASDSAMSIILDVVHSVRSTKASYSLTNKHKPEVWVTAHTAELQELFAAEKMMIST
                     LGVVGEVTVVSPAEEAVAVPKGCGFSVVTKEVGVNMMLMGFIDVGKEVAKLEKQLDGL
                     MKQIEGMKKKMSIPNYETKVPAEIRVTNTEKLKTLEAQSAQLRDGIEKMSSLK"
     gene            complement(<1173023..>1173712)
                     /locus_tag="LDBPK_303180"
                     /db_xref="GeneID:13385738"
     mRNA            complement(<1173023..>1173712)
                     /locus_tag="LDBPK_303180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862981.1"
                     /db_xref="GeneID:13385738"
     CDS             complement(1173023..1173712)
                     /locus_tag="LDBPK_303180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863029.1"
                     /db_xref="GeneID:13385738"
                     /db_xref="UniProtKB/TrEMBL:E9BM61"
                     /translation="MSEEDRMLHVVVLSDDSNESSPCDQLEQSFASIASSLGPPCTAH
                     SDSFSCKGGDVLYEFDEENSEESEETPAEAAERMRQERHYRLRYGPSRANRSHDRQSI
                     LSARQNLLNEFILRETKEATVSRQDHHIMLRQLISAAYFRDPNRVSNRPLWRRIMAAI
                     GKEYYGSKAIFSLSPDPYESVVAKLSSMMLWDDEIRHWAYGYCDSEITRRRNAQVETL
                     KKLEASGRLFL"
     gene            complement(<1175526..>1176164)
                     /locus_tag="LDBPK_303190"
                     /db_xref="GeneID:13385739"
     mRNA            complement(<1175526..>1176164)
                     /locus_tag="LDBPK_303190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862982.1"
                     /db_xref="GeneID:13385739"
     CDS             complement(1175526..1176164)
                     /locus_tag="LDBPK_303190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863030.1"
                     /db_xref="GeneID:13385739"
                     /db_xref="GOA:E9BM62"
                     /db_xref="InterPro:IPR001434"
                     /db_xref="InterPro:IPR008856"
                     /db_xref="UniProtKB/TrEMBL:E9BM62"
                     /translation="MATLKVLLLLCLATLVATTCFAQVAQEAEINPHPLLFVSKTTSS
                     DDIVLGSSVEVVVTVTNYGQSPAFDVQISDLLEDGSLQSKSIAYLPYGASETLRYTVT
                     PTALGNYAVSVAEVTYNVEQGNTATARKALSNLIREGEAYYYGEGVDDESFRGVISVL
                     TRDRYDRLHARYIKESTAYIFLGAIPALFPYVLYRVKQSEVDALLRQRKASK"
     gene            complement(<1177422..>1178369)
                     /locus_tag="LDBPK_303200"
                     /db_xref="GeneID:13385740"
     mRNA            complement(<1177422..>1178369)
                     /locus_tag="LDBPK_303200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862983.1"
                     /db_xref="GeneID:13385740"
     CDS             complement(1177422..1178369)
                     /locus_tag="LDBPK_303200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863031.1"
                     /db_xref="GeneID:13385740"
                     /db_xref="UniProtKB/TrEMBL:E9BM63"
                     /translation="MRGQERIWKAAPLPQAFHAALESGNWLRALQLYQRHPYHTPPAD
                     TFDLLKAIMHYTGVGIEDVKVRFNEKIRLSASLQRRKSEEVEWSLFWEALNKGDGKMI
                     SEALSGASVSGATQQIGMAEACAVLLKGAGKEWHTRLVDDLPFSTVTRCSLLHAALAE
                     KRPDVAAEMLSHARVTRSDLSSLWPLMAKCTWEEVLRMISACPKNAVPYSQALPFILK
                     QGCSLQTLSEHLEHARVLGDADVVAPLLAYAVEMEDWPYVERCVGHLVDIGRITPSAR
                     EAFGHLCKLHGPKRVCHRLMEHHVELSSMTIEDLESLRF"
     gap             1179744..1179842
                     /estimated_length=99
     gap             1180722..1180820
                     /estimated_length=99
     gene            complement(<1181585..>1182820)
                     /locus_tag="LDBPK_303210"
                     /db_xref="GeneID:13385741"
     mRNA            complement(<1181585..>1182820)
                     /locus_tag="LDBPK_303210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862984.1"
                     /db_xref="GeneID:13385741"
     CDS             complement(1181585..1182820)
                     /locus_tag="LDBPK_303210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863032.1"
                     /db_xref="GeneID:13385741"
                     /db_xref="InterPro:IPR026504"
                     /db_xref="UniProtKB/TrEMBL:E9BM64"
                     /translation="MRAAKVKAAAADEALAAELAEQQRLELKDAKMLQLVRDYPEVRA
                     LESQLKDAYLRKSRAEQVTDRSAAKALEVEEQRRHMKYLAEQDRLAKAEEEKKHQENM
                     ERFRRHQAAQLEIIRQHRCAAMEEAKQREQERIAVDAVMARVQEQDFLETLARRDRQR
                     RIMEEQDEFCRLRAAIKKAEQDREAKEEAAIRAYLDEQARRKEMDDKMARERDVFKAR
                     ILEEQGRRIAEEERKKRELEVLLQEYYEEERLTKEQMLIAAEKASRDRMAAAVNHENQ
                     KLIEQRRLAKEEQLAEEMRFRQEAMEQMAAEAKLQQLNRQKQAEIKRQHIAEAQQRLE
                     ERRRLKEQEKELERKVEEQDRKQEEQIQEYIRRARAQLLAQHLPKLGSYAPVFAMRDE
                     EKLQFLPQSKTADAALPAR"
     gap             1184008..1184106
                     /estimated_length=99
     gene            complement(<1185565..>1185990)
                     /locus_tag="LDBPK_303220"
                     /db_xref="GeneID:13385742"
     mRNA            complement(<1185565..>1185990)
                     /locus_tag="LDBPK_303220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862985.1"
                     /db_xref="GeneID:13385742"
     CDS             complement(1185565..1185990)
                     /locus_tag="LDBPK_303220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863033.1"
                     /db_xref="GeneID:13385742"
                     /db_xref="GOA:E9BM65"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BM65"
                     /translation="MNSKAILFVSNISSIANAQYLERLFSAYGTVHHVELFGEGPHRY
                     AEVTYGTVDDADAAVAALHCHYQTCRNLPMIVLYSQNSPAVSVYGHQVGEEFMKAAEE
                     KRPPRPLMLDEFDSNYQRLGVQPPPSESEIILEHHTPGY"
     gap             1187788..1187865
                     /estimated_length=78
     gene            complement(<1188152..>1189456)
                     /locus_tag="LDBPK_303230"
                     /db_xref="GeneID:13385743"
     mRNA            complement(<1188152..>1189456)
                     /locus_tag="LDBPK_303230"
                     /product="3-hydroxy-3-methylglutaryl-CoA reductase,
                     putative"
                     /transcript_id="XM_003862986.1"
                     /db_xref="GeneID:13385743"
     CDS             complement(1188152..1189456)
                     /locus_tag="LDBPK_303230"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl-CoA reductase,
                     putative"
                     /protein_id="XP_003863034.1"
                     /db_xref="GeneID:13385743"
                     /db_xref="GOA:E9BM66"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="UniProtKB/TrEMBL:E9BM66"
                     /translation="MRRSLLLACSAAKGGSWASMPDAEIMKQVENKKIAFYGLEQALA
                     PDYDRAIAIRREIVKKKMCPSTAATHPLERVPYKNYDWSSVVGQSCENILGYVPVPVG
                     LAGPLLLDGKEVALPMATTEGALVASAHRGARAINLSGGCRTAVLKEGMTRAPVVEVN
                     SFDEAITVIKFCEERFDVLKEAFESTTRFGKLLSIKCAMAGRQVHMRFSAFTGDAMGM
                     NMITKGCDKALQVLQQHIPSVRVLTLSGNFCTDKKPSALNWVEGRGKSVVAEAVIKRD
                     VVEGVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAANIVAALYIATGQDPAQIVE
                     SATCMTTVDKAGEDLVISLTMPSIEVGAVGGGTGLSSQRAMLELMGCAGSNKEDPGAN
                     SRQIARVVAGAVICGELSLLSGLAAGHLLSAHMKLNRKPPTQ"
     gene            complement(<1191045..>1191383)
                     /locus_tag="LDBPK_303240"
                     /db_xref="GeneID:13385744"
     mRNA            complement(<1191045..>1191383)
                     /locus_tag="LDBPK_303240"
                     /product="ribosomal protein S26, putative"
                     /transcript_id="XM_003862987.1"
                     /db_xref="GeneID:13385744"
     CDS             complement(1191045..1191383)
                     /locus_tag="LDBPK_303240"
                     /codon_start=1
                     /product="ribosomal protein S26, putative"
                     /protein_id="XP_003863035.1"
                     /db_xref="GeneID:13385744"
                     /db_xref="GOA:E9BK95"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:E9BK95"
                     /translation="MTTKRRNHGRSKPAHSRGRVKPIHCFNCGRLTPKDKAVGRFVVR
                     RMLDAASARDVAEASPVYGANFPMPKLYMKQRFCIACAIHSRTVRARPVGNRKIRYTR
                     KVPFRPAGKK"
     gene            complement(<1192050..>1194701)
                     /locus_tag="LDBPK_303250"
                     /db_xref="GeneID:13385745"
     mRNA            complement(<1192050..>1194701)
                     /locus_tag="LDBPK_303250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862988.1"
                     /db_xref="GeneID:13385745"
     CDS             complement(1192050..1194701)
                     /locus_tag="LDBPK_303250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863036.1"
                     /db_xref="GeneID:13385745"
                     /db_xref="UniProtKB/TrEMBL:E9BM68"
                     /translation="MELMPAADFTCIVNVVLYSFSETAGTYDEYGPVSCALIGSKAND
                     TTFKLGCYRDNKYICTATISPSNDAGAHIARDGAYVTFRDEKSHYWSLQFAAEDAAIE
                     FCAQVAVAMFGAAGEPTDSILSCDVVKGKENKQIFVGDLVKALYRVWVVQSSDSSDGL
                     PRLGSLLEKESEDAVKFMAPASHQCVTASMRGFEGMTVGMREGGQRLMVIPLRAKRGR
                     GPNVNMCFYVEVIRRKDQQTSTSQSHRSAKERGQLLLTGGDGGTATGSPAQPLAINSG
                     FADGHSAMMASGFSKEQFLLVDRLRDQVFTLTQQLRDTRRELDSLCADLKRHERQSGT
                     QSLTRAQIEYSIEHLLAEGDTKKKVLEDKRALIGETEARNQVLEARLAKFLQTTKTLG
                     EEAKAALDDSAGERIELDRQLADTQARIVRLNGEIEDLGRLLCCLEDTFRLTALKVKE
                     EKLRLTLSITDHEKHEERLLRLQEKYSEEVARRKLLESKLAPLQEELRNLEDDMQLKE
                     SLTQQIRAKTESDRTHYAQLIQQEREQAAIELRQLKQDLIEELAARDRQYEEAKERVS
                     TEAYEQGMAQGVEEGLADAANEGDVIAHDMAVNAQRCKAEAAALQVRVQANCAANEAD
                     ERRLTSEIESLQTSLARVLHDNNTLSTQLEAAQEEHAVKVGEVYQRLVRLIRLCGAAS
                     ISQPCLAAMMRAAESGAEFDPFRFQQMESAREAQLARDERAAVAAWVRASVYNQPTYM
                     PPLRPPFPYAPMSKGPVLSAETMGTKVLLNPAVHHRLPVLTETTTSITAETPAPIPSA
                     TLAAPGEVESVIPAPSLALPPAPVAPAQPAEVAESQQSEPQDTAAIQKASPRQRVKFP
                     STKIRYLGDSGAAGGTEATAHQRQPSF"
     gene            complement(<1195130..>1196269)
                     /locus_tag="LDBPK_303260"
                     /db_xref="GeneID:13385746"
     mRNA            complement(<1195130..>1196269)
                     /locus_tag="LDBPK_303260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862989.1"
                     /db_xref="GeneID:13385746"
     CDS             complement(1195130..1196269)
                     /locus_tag="LDBPK_303260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863037.1"
                     /db_xref="GeneID:13385746"
                     /db_xref="UniProtKB/TrEMBL:E9BM69"
                     /translation="MLAKYGDLTVVKDDLTLLEKTESYIAKWRLNRWEFRVPPLLYPS
                     EREKVMLQHETLKALCLNRAEEHKHVLGDIQIVAAITGISPESVREKNRAWLQEEASK
                     LRWKGEVNKAKELRDAFLRLEVYGSRDHRLLERLCCIYGMGMQGTFDEAFSNIIVQDP
                     STGKLYVDEANPFAELQAYILSRYPQIDLIHDFLGLNVVSGYRPSLGRFLIHCLSKKN
                     SISNPVSNGRVLLHVSASKETLFDYGDSKNQITHDDSIYGLPDFMYVRGSDIFLITIS
                     ADNHWLRKRQVPHNKQLEGIARRCSFVLGIPLDKVRIRNLLLPPNYVDSSSLRRLTET
                     VLDMSPASVKEAVPWISLYEKELDAQDVDYCELEKTVNEEEWLTL"
     gene            complement(<1196978..>1197403)
                     /locus_tag="LDBPK_303270"
                     /db_xref="GeneID:13385747"
     mRNA            complement(<1196978..>1197403)
                     /locus_tag="LDBPK_303270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862990.1"
                     /db_xref="GeneID:13385747"
     CDS             complement(1196978..1197403)
                     /locus_tag="LDBPK_303270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863038.1"
                     /db_xref="GeneID:13385747"
                     /db_xref="UniProtKB/TrEMBL:E9BM70"
                     /translation="MLRRTAAKLYRYQEFEMHNEAKYPFNYPREAPNTSVFHQYQLNF
                     WMFWGYGRQELWIDRDNRRYETTWEMFRRLLMWFFPCYFVFPFGLPKFIAANAFGEYG
                     EKPYLDAMMHSPMDNHYIEWGGSTLDAEWLRHIHSKESF"
     gene            complement(<1197804..>1198091)
                     /locus_tag="LDBPK_303280"
                     /db_xref="GeneID:13385748"
     mRNA            complement(<1197804..>1198091)
                     /locus_tag="LDBPK_303280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862991.1"
                     /db_xref="GeneID:13385748"
     CDS             complement(1197804..1198091)
                     /locus_tag="LDBPK_303280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863039.1"
                     /db_xref="GeneID:13385748"
                     /db_xref="UniProtKB/TrEMBL:E9BM71"
                     /translation="MLRRSSRYCMKYANLELTTRGEFPHGMKEPGFVKKLDKNIPWYF
                     STYRSMYHWPVAGEGWSDLNEAEKHHDLHMYYTLAWWKLGEGIFDADDEDR"
     gene            <1201974..>1203758
                     /locus_tag="LDBPK_303290"
                     /db_xref="GeneID:13385749"
     mRNA            <1201974..>1203758
                     /locus_tag="LDBPK_303290"
                     /product="glutamyl-tRNA synthetase, putative"
                     /transcript_id="XM_003862992.1"
                     /db_xref="GeneID:13385749"
     CDS             1201974..1203758
                     /locus_tag="LDBPK_303290"
                     /codon_start=1
                     /product="glutamyl-tRNA synthetase, putative"
                     /protein_id="XP_003863040.1"
                     /db_xref="GeneID:13385749"
                     /db_xref="GOA:E9BM72"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:E9BM72"
                     /translation="MRRFLPMHMLVNIHLKALTLSNTYFTAAPQREENEKLQLSNAEK
                     GKVVTRFPPEASGFLHIGHAKAALINRMLADAYEGKMLFRFDDTNPSKEKEHFEAAIE
                     EDLKTLGVRYDFGPTYSSDYFDLMFEKAEDMIKRGLAYCDKTPREEMQKCRFNGIPTK
                     YRDASVEENMRLWREMKKGTEEGQITCLRAKVSIDDPNKAMRDPVMYRVSMTPHARHG
                     TKQVAYPTYDFCCPLVDSVEGVTHALRTNEYHDRNAQYYWFCDAMGIRKPTIEDFSRL
                     NMEYSVMSKRMLTKLVDTHVVDGWDDPRLPTVRALVRRGMQIEALRQFVAEQGMSKSV
                     NFMEWSKIWYFNAQILDPTSPRYTVVSNTLKVRCTVEGQRHMEAEKKPLHKKDSSMGE
                     KTYYKSDIIFLDAEDVVLIKDGDEVTLMDWGNAYVKDIKRPSADALPTEATIVLHPEG
                     DVKKTKFKLTWVPESDKAVILTLNEYDNLLTKKKPDPEESIDDIIAPVSRYSQEVIGE
                     EALSVVKKGDIVQLERRGYYIVDDDKAEKKVLISIPDGRDKVNHLSAKAQYLKTLPKK
                     ASAADELAAKRAAKAAKKAAQKAAAKSS"
     gene            <1204729..>1207818
                     /locus_tag="LDBPK_303300"
                     /db_xref="GeneID:13385750"
     mRNA            <1204729..>1207818
                     /locus_tag="LDBPK_303300"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003862993.1"
                     /db_xref="GeneID:13385750"
     CDS             1204729..1207818
                     /locus_tag="LDBPK_303300"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003863041.1"
                     /db_xref="GeneID:13385750"
                     /db_xref="GOA:E9BM73"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BM73"
                     /translation="MPKKATISFADLGLGTPLPSVLAKSRDERRKEQRVEKKERKERT
                     REAMAEVAAARDIVEQHKRLVEAETAQERKLKEMHKRELRVEHLKARCEREESQRQHT
                     AQLRVTQEKIITELRTARREEEAEMQRLQALLERETAERAKVAPANVHIEIHRTDEVK
                     QQRAGLPVLREEQPIMEAINETRRTCVLVCGETGSGKTTQIPQFLWEAGYGHPEGHLF
                     GREGCILITEPRRVAAVSMARRVAEELNVSFGKEVCYHVRYDNNLSDKCRLKFATEGI
                     VLKEIQSDFLLRKYSVIVIDEAHERSISCDILIGLLSRIVPLRNDMFEEELRKHHGDV
                     DKTCIKPLKLVIMSATMRITDFKDNRTLFPITPPLINIEARRYPVTNHFARRTELKEY
                     VDQAFDKVRQMHKKLPPGGILVFVCTQQEIEDLCGRLRRHYAATKIEYYDNAYSKHRL
                     LTGRSQEETAAASSDSEGGGVATAEEAEEKDEYGLHTTDYALDDENVTCSNSKEIETV
                     HEGRLRRPPQPSGGRGKYPRGEAGARLAGRDHWGRSDEHSAAAAEGLTTFPGDEEQEE
                     EVNGELNTLHVLPLYALLDFQKQQEVFKPPPKGTRLCVVATNVAETSITIPNIKYVVD
                     AGRAKSKVIDEETKASCFRIEWTSQASAEQRSGRAGRVGPGHCYRLYSTAVYANLMAK
                     HGDPEVLRTPLDSVVLLMKHIGVKNVGGFPFPSPPRESDLKAALQHLSVIGALDAANN
                     YNITKLGRQLVAYPVPPRFARALLEVLQQQKARSADVQDMVAAIVAVATTTTNVFTGE
                     GNQLKARKLNELADTPTDPRQGRIRSLLNPGSDLVTYLNAFYAYRSDPWHSCGMFCLV
                     QKSMHEARLLYTQLRSQMRQHNKEQDELADTLDEGEASVHEKSEQKIGSHTSGGCPLS
                     KETELLLRQVFIPGLMDQVARRATVHECRSLGVEYNDKRATKTPYLVLGVNRTIAYIH
                     PTSAVARTFPPPEYVTFGFLQKVHRSDTKVAQAMMMGVTVVMPEWLRAYGFEEEEGD"
     gene            <1208837..>1210072
                     /locus_tag="LDBPK_303310"
                     /db_xref="GeneID:13385751"
     mRNA            <1208837..>1210072
                     /locus_tag="LDBPK_303310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862994.1"
                     /db_xref="GeneID:13385751"
     CDS             1208837..1210072
                     /locus_tag="LDBPK_303310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863042.1"
                     /db_xref="GeneID:13385751"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9BM74"
                     /translation="MNFGVIGGQQGPKALLDAVQQAVRDGNLEALRRLSKEFLAISDN
                     VEKCRDENGNTIVHLALGKNTTTLEYVIESLHANVNATNAQGRTPLHEAVTRDYIACC
                     QVLLDHGADDTIQSTTQSTPFHTAAACGSIEGMEVILRHSDNPEVKVNELDRQRSSAL
                     HKCAFDGDVRVSRWLVEHGANVDATDSTDATPLLIAVKMGQTEVAEYLLRNGADCNRQ
                     DRQGNSGLHFCAVRGDVKAAQLLLAAGANPCLLNEEYDTPLHIIARNSRLDSGAWEMV
                     GLLLMAGCDPLQVNASNKKPSDYVSRGLKKMFTKEEVEQRLRREAQLQEESDAELSRA
                     WEQCAQWKTKVLENISSRRLVEAAEDARLAREKEERIRAANDARMTYDEALAKCQFLE
                     AEIQRKKAMLEKTLTKSGR"
     gene            <1210761..>1211258
                     /locus_tag="LDBPK_303320"
                     /db_xref="GeneID:13385752"
     mRNA            <1210761..>1211258
                     /locus_tag="LDBPK_303320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862995.1"
                     /db_xref="GeneID:13385752"
     CDS             1210761..1211258
                     /locus_tag="LDBPK_303320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863043.1"
                     /db_xref="GeneID:13385752"
                     /db_xref="UniProtKB/TrEMBL:E9BM75"
                     /translation="MKSVKERDVAGMVAFELALQYSFIRQDRSYHFVQLLTALCSFVF
                     FSQLTALNVLLVLPPLLPSVEPHVEFLRAYSHPLLAVLSLVALLLIRASKKRFVIEPG
                     EHTMERLNRDVLEPCLGMKFDARTGMLFSDCRAGSLRGRENYYSLRYLDDPPQSLASA
                     RETEA"
     gene            <1212213..>1213328
                     /locus_tag="LDBPK_303330"
                     /db_xref="GeneID:13385753"
     mRNA            <1212213..>1213328
                     /locus_tag="LDBPK_303330"
                     /product="serine/threonine phosphatase, putative"
                     /transcript_id="XM_003862996.1"
                     /db_xref="GeneID:13385753"
     CDS             1212213..1213328
                     /locus_tag="LDBPK_303330"
                     /codon_start=1
                     /product="serine/threonine phosphatase, putative"
                     /protein_id="XP_003863044.1"
                     /db_xref="GeneID:13385753"
                     /db_xref="GOA:E9BM76"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BM76"
                     /translation="MASLWKKSLSLLLSAALIIAAFAVALSAEARRLVAVGDLHGDYE
                     QSVSVLRLARLIDNRNHWIGEDALLVQLGDILDVGPDDILIVRLLMRLQQEAHAKGGD
                     VIELLGNHELRNFRGDYKAVDKASLAASGGQKGRDVLLSNATDLGRYLRTRKAIFHYG
                     PFLFMHGGFSTATAGMITSLSKVEEFNSELTKALMNGTISPLARGGLDLTEDDVDDVA
                     NPILVRSILNVKCNALSKVLDKKFPGIQSVVVGHVPHDPRDFDGWRLCGGRIIDIDFG
                     MSRWKKGDPGHVAALEIEEATWHVQLIETSTASSSVSGTHAPFQDSVAAYYLVSFSAL
                     IVVCVASVLLAAYYLPLCSGAAREPLLKVGTNYYGTV"
     gene            <1214678..>1217800
                     /locus_tag="LDBPK_303340"
                     /db_xref="GeneID:13385754"
     mRNA            <1214678..>1217800
                     /locus_tag="LDBPK_303340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862997.1"
                     /db_xref="GeneID:13385754"
     CDS             1214678..1217800
                     /locus_tag="LDBPK_303340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863045.1"
                     /db_xref="GeneID:13385754"
                     /db_xref="UniProtKB/TrEMBL:E9BM77"
                     /translation="MPKKEKEKRVPTPSVTSPGITEEECLLEVYLHWDVEAQAAPDIL
                     VFLRLCQEDHFILPRQLPADANSDCTADGQQQSRHQQPSAAPPLLLLVKQTVFVGGSA
                     VRHTLLNDSKANRIDVYALPSAGVGDEAGGKQAGGAAGKRFKSVTPAVAKSKGKSATG
                     LAALPDGARHIGGATLSFVPLLASSTMDVSVPLTAGSLVDADKCLNFRVRCHDSLLLS
                     AQCMSQCRPVLVRVYGVAGLPTLESTSGSSSTKDIAVAATADSRRRLRACVTLAGGCV
                     TAPILPITPAISADEAVAPSSFPSHRPAATFHDHILFLQELGTPLDVYRKLHSAPCEV
                     SLWQSFEMDAQGTAVAAASATSPPEKGTEVLLGSGGFSVRDFLTDDQTRFTETVQLLP
                     GRSTVNLAKDSTCLTTGCSVSVRLDFFQPFTPLQHVDKEGQPLPRKAFLTRALVRLPY
                     AVPWIADFLALLLREVTALPRATEDVQLYLPPPPPLPPTETAEKEKPAGGRSGTTHAR
                     GAAPPAASSSSKRSGSGSGNRKAGKAIGRPAPADPVPAPPLPSFAGELKVYSPPGLSG
                     FEVADGEERLWCFEATVPELQRILSELGSFVEARGGATSQVHMHFNAELFVPQRAYVK
                     FPPLVVPPVGMAAASPPPSEADDASVALEVEPSGTGGRLHRIRLRSAVGALCQTQSHY
                     IRHNLSDDCLRCLLSLAALLRAASMREAEMRGWMPSATLLIAAERSFGQTLEKEDLFG
                     VTFPTPAASQTTVAASVSMYDTTDRVSESNASGAAASLMAEAVVGSVVFFDGMLRAGT
                     RRPVPAAVLLRFPVSFWMVVTKTKEEVLCTFPHNTPTGLVQYHIEGQVVRCSTVTLLY
                     VLKCVCLARSVTQSHNAAYELVLRQRQREQHALQQERMAPSATSKLMAVWQASADAAG
                     DGRDALRRGADKTRGSAVGQVRGTDSSDEDGAEEVDWLDSSMDRYLYTSSASPSRSSA
                     LSRRLRTDRTSSHKTSVHKTQRRQVLGAAPSPTELTYDDLWRMYEKRAPASATAAPAR
                     GHEKLPPIRF"
     gene            <1218957..>1220246
                     /locus_tag="LDBPK_303350"
                     /db_xref="GeneID:13385755"
     mRNA            <1218957..>1220246
                     /locus_tag="LDBPK_303350"
                     /product="UV excision repair RAD23-like protein"
                     /transcript_id="XM_003862998.1"
                     /db_xref="GeneID:13385755"
     CDS             1218957..1220246
                     /locus_tag="LDBPK_303350"
                     /codon_start=1
                     /product="UV excision repair RAD23-like protein"
                     /protein_id="XP_003863046.1"
                     /db_xref="GeneID:13385755"
                     /db_xref="GOA:E9BM78"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BM78"
                     /translation="MKVILKTITGKQHEVDVEATSTILDVKRLLEDEYEPASLRLCFN
                     GAVLEDSRMLADAGVKDNDSLVLAGRKRKIPKPPAPQTAEPPKTEAAPESSAPASSAT
                     PPAAMPTPALTTTTPATSAATVDPPAPAVPASAAAPSAPVASTTPAASAVPAASAASA
                     TNTYGVSLNLIDEVASMGFEDRNQIALALRAAFMNVERAVEYLFEGIPPHLVEELTPF
                     SALAAPAAAPGASNPSASSAAAAVPASDSPAPAVAPSTAESEMRAALSRIPQFDEIRI
                     LYNQNTDTLPVVMQQIALRHPAVYEQIERDPEVFLSIMGESGQPGSASAPAGPAAPST
                     AQAVVGDAEESSFMNQLQSGLELTAEDRTAVQQLVELGGGMWDEQSAVLVYLATQRNQ
                     EVAASVLFEHGGVPAELLAEIATQMVDEEAEDYEDEQ"
     gene            <1224391..>1225467
                     /locus_tag="LDBPK_303360"
                     /db_xref="GeneID:13385756"
     mRNA            <1224391..>1225467
                     /locus_tag="LDBPK_303360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003862999.1"
                     /db_xref="GeneID:13385756"
     CDS             1224391..1225467
                     /locus_tag="LDBPK_303360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863047.1"
                     /db_xref="GeneID:13385756"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9BM79"
                     /translation="MMYTGEIENGQMHGRGCLIYPNKEKYEGDWVYGKRHGHGVYTYA
                     DGSKYDGEWVEDKVHGKGTCYYASGNRYTGDWTFGRINGRGTLEYADGDRYDGEWKDG
                     RMHGKGLYYYSNGDRYDGEWKDDKRHGKGTVTYAGPDGSVSEKFDGDWVEGRMQGWGK
                     YYYADGGVYEGEWQDGKMHGKGTYIFPNGNKYEGEWCDDVKQGYGVLTYVNGERYEGY
                     WLDDKAHGTGTLTYLQGDRYTGEWYQGKKHGRGTLAYSNKDTYEGEWRNDSATGRGVL
                     EYANGCRYEGDWLDDRRHGEGQLLLPDGSSYEGGWVNGKKEGRARIILKCGAVFVGTW
                     KDNRIVGQGEFYLSENCDLNNPDY"
     gene            <1227871..>1228953
                     /locus_tag="LDBPK_303370"
                     /db_xref="GeneID:13385757"
     mRNA            <1227871..>1228953
                     /locus_tag="LDBPK_303370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863000.1"
                     /db_xref="GeneID:13385757"
     CDS             1227871..1228953
                     /locus_tag="LDBPK_303370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863048.1"
                     /db_xref="GeneID:13385757"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:E9BM80"
                     /translation="METLKGFARRTTQSLREMVSRTEVSPEEMRLTEVMAKVRIMETK
                     GEMICEKVIQAARLMGELGTTLREIGEEYKGVPDLPKESRELADDVFEVGVKLVETSQ
                     EHQKGLKDNGFELLRSFAKQCAQLREVEDARRHHQLEYDFFKSKVQYLRSSPQRDFTR
                     LPRNEQILENWRVELWRATERSKALCSELFVSGRQAIDRSVLTTIQVLHSFVEIASTG
                     FSQTFQGVRLPTYPKTPVLPPTALPPAPAPAPPTPYAYSSQTAVAVPTGAIIPASPGT
                     QAPMPGTAYASTSLPSPANPPGPVAAPQPAPLAPAIGTPYGGAPSYAVTPGAAGRGPA
                     GYQPPPLDIPTSTDNGTTTYQPPPLQ"
     gene            <1231356..>1232528
                     /locus_tag="LDBPK_303380"
                     /db_xref="GeneID:13385758"
     mRNA            <1231356..>1232528
                     /locus_tag="LDBPK_303380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863001.1"
                     /db_xref="GeneID:13385758"
     CDS             1231356..1232528
                     /locus_tag="LDBPK_303380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863049.1"
                     /db_xref="GeneID:13385758"
                     /db_xref="UniProtKB/TrEMBL:E9BM81"
                     /translation="MQRLVLSRRNLDGCSNTPAIVVTEVYVGGTGAQPKAEIFAQDCV
                     TQVVFVKEEVIYMRLKGMSAFAAPSRLASPPPPPQQTNGSSTTCGAIAACSDHAAQPT
                     ATETASSLLKESATLKNEDELVAEVKRSASKTPAPPPAAAKSAVTHATTLKAISDGAA
                     TAAAPTTAEPPVPKAAAPRRRPGWGPEAHELFPENYMSTPGKRPRTVRSEKKTTLAQA
                     AKRSKTESNNAAVVSMKAGWGEEPSDKRVPADKHLGWGPEASKLFADNYVSSPEKLAR
                     LQRSQRRVMNESAESAAPAGAAALTKSALKAPVSRTLQYPTADTEEGRTTVGHAVDDA
                     IVVDETSPTVELPKGWGRESLKFFDPNTYCDDPAKARLLPNMDYSRSRRLRRPAAL"
     gene            <1233508..>1233783
                     /locus_tag="LDBPK_303390"
                     /db_xref="GeneID:13385759"
     mRNA            <1233508..>1233783
                     /locus_tag="LDBPK_303390"
                     /product="60S ribosomal protein L9, putative"
                     /transcript_id="XM_003863002.1"
                     /db_xref="GeneID:13385759"
     CDS             1233508..>1233783
                     /locus_tag="LDBPK_303390"
                     /codon_start=1
                     /product="60S ribosomal protein L9, putative"
                     /protein_id="XP_003863050.1"
                     /db_xref="GeneID:13385759"
                     /db_xref="GOA:E9BM82"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:E9BM82"
                     /translation="MVKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLD
                     LRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVR"
     gap             1233785..1233883
                     /estimated_length=99
     gene            <1235125..>1236090
                     /locus_tag="LDBPK_303400"
                     /db_xref="GeneID:13385760"
     mRNA            <1235125..>1236090
                     /locus_tag="LDBPK_303400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863003.1"
                     /db_xref="GeneID:13385760"
     CDS             1235125..1236090
                     /locus_tag="LDBPK_303400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863051.1"
                     /db_xref="GeneID:13385760"
                     /db_xref="UniProtKB/TrEMBL:E9BM83"
                     /translation="MRCTPVRCMSMWDSPVFEHNSLTRYWKKMMDRTGNTLSSQSIPR
                     HIHGYLEGSNARTESHIRWFPYKQEMTVEGRYIPTFKDVIYTHYFPKEFNDDERVKYI
                     SIKTGRSELEVADEIFLMRKMKLFTAQLLRNKLRSRPLRMPQGVDYSGIERRYTIGVS
                     KVAQAMGMSMYSTNSYDPVLMYSPYLDMGDCVDLIVTKQLRTSLQYLLCDIIVHRGIH
                     RARLPHLKGEPKEPLCHIEPCLYQFIKLRLAVLSLIAKQEQYVVDHHFDGNHRYGGCL
                     IHLFPSPLDPEIIDHHVEHIELDLELAQTWMKHYYDHYIAPRRSA"
     gene            <1236978..>1239155
                     /locus_tag="LDBPK_303410"
                     /db_xref="GeneID:13385761"
     mRNA            <1236978..>1239155
                     /locus_tag="LDBPK_303410"
                     /product="calmodulin-related protein, putative"
                     /transcript_id="XM_003863004.1"
                     /db_xref="GeneID:13385761"
     CDS             1236978..1239155
                     /locus_tag="LDBPK_303410"
                     /codon_start=1
                     /product="calmodulin-related protein, putative"
                     /protein_id="XP_003863052.1"
                     /db_xref="GeneID:13385761"
                     /db_xref="GOA:E9BM84"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BM84"
                     /translation="MSFSKRPDDVMDGTGDREVATILRSLAPEEVDMLRDTFIYMDRD
                     SDGFVSREEMMAKVASCVGAERFPPLQEYLVPLFQVADKDRDERLSLTEFLMAFADGP
                     GVVPAEVVNSCVADVQVRLTDEEVSALQSNFNRIDTNQDGVIDSEELEVALRTYLVPT
                     FPDLTDENFKEIVSVVMASADADQNGVISLSEFIRSYQEDQGVLPATYLEPTQKSLAG
                     ARQLTDDEETVLREAFAVLDRNNDGFVDLEDLYHALSDALGSATEDESQIRDLCNLVM
                     RSSDRSKSGQLTVTDFVRSFLRNIQLMQIPVAVAHERVRVACEKLQQMQDSGELERLV
                     KVFEDLDSDGDGFVVRSELVKVLKVLFHDAFPGWDEEMLTSIMTAIVVGAERNNGGRL
                     SLEEFIRSFVEGSGVLPPEAVKKWDSAPRRGSYSTEDALKQSCYRSSTATDADLGLIG
                     EALSRLYAEKGADGVITEDELHSGIAELYVDDPNRGEEMFHFALQQFVLPRKNGGLMW
                     SANVLFEDEVEEDDRGVRASRLNPSDSAVMRSSTSPSRRPRASVLISANEVVEPTSSA
                     PSRTAWMSSTQSPRHQILPHAADATVHAAVPRSQSSSDKALSCTHTQPKLIDEAATTP
                     AASVMHSWGEKRPLSVNELCSFRPDSTILTEKLKQQFEYYDVEHRGYLDRDTFKKIYA
                     TMENYGLDPSPMEVDRRFRRYSRMSDKIFFNEFCILMLQRARL"
     gene            <1242998..>1244872
                     /locus_tag="LDBPK_303420"
                     /db_xref="GeneID:13385762"
     mRNA            <1242998..>1244872
                     /locus_tag="LDBPK_303420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863005.1"
                     /db_xref="GeneID:13385762"
     CDS             1242998..1244872
                     /locus_tag="LDBPK_303420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863053.1"
                     /db_xref="GeneID:13385762"
                     /db_xref="GOA:E9BM85"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BM85"
                     /translation="MGGCCKGARCPFSHELVQLPPKGVDASGGYFISGNVANYKAAAS
                     TTAAKPPSRSLVGRWDDPTASSSTDGLSTLASPSSCCVTTGTSLSAEAKEWVGADSAA
                     ASSSANSATASITSVQSLRGAASPTVCVSSSSLRYRSATLRRTAQQVSPLPVPHSQRD
                     SQPQPQQAQMQLQSQHSQKPQPSPPQPQLHQQHKRQYQQPPQPRSVANALSALLPNHS
                     EGSGAAETRRTSAAPTHPAATARTVSFTQSSNGSGSTTIAALASFFDMQRVSTGAPSV
                     TSSSVVSQPSKVIFSTRRDDQPPATAPSPATAALPRYTAACVTVAASNQRFDPLPSVP
                     SVPTTATPAPAHGSSRSATPSQNVEAPLPRSREALATGAERHAATEAKAHVAQSAAPP
                     STAAAPTSPPQYESRTASSAQTRVMPPAPRSQQQQAAHQAQQLRAQEAQHQAQLQQQF
                     HPQQQTQQLAQQQAQLQPFQQQIQPQKPPPQQQTVYMLTTSRPPATSTPPHEGIAAPA
                     QLPLGYTLAYAVPAPTPTAPAATPILISEQPSAARPTYTLLSSCPPQSQLQSFQTAKG
                     TVLYATPAQVLTQAAAPSESDAPRLILVNTDGTFSVLKAETLAATAGPGLSPAITQAH
                     "
     gap             1249288..1249386
                     /estimated_length=99
     gap             1250547..1250645
                     /estimated_length=99
     gap             1251870..1251968
                     /estimated_length=99
     gene            <1254731..>1256314
                     /locus_tag="LDBPK_303430"
                     /db_xref="GeneID:13385763"
     mRNA            <1254731..>1256314
                     /locus_tag="LDBPK_303430"
                     /product="PAS-domain containing phosphoglycerate kinase,
                     putative"
                     /transcript_id="XM_003863006.1"
                     /db_xref="GeneID:13385763"
     CDS             1254731..1256314
                     /locus_tag="LDBPK_303430"
                     /codon_start=1
                     /product="PAS-domain containing phosphoglycerate kinase,
                     putative"
                     /protein_id="XP_003863054.1"
                     /db_xref="GeneID:13385763"
                     /db_xref="GOA:E9BM86"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="UniProtKB/TrEMBL:E9BM86"
                     /translation="MYQDSKILLIFKSLRDIVVIGDNDMVITDMNTAAVAFFGWKVDD
                     VKGKSITFLVPTHPLDVQDNTVTLMAHLANSTDVPVVIQTTRDPHATVVAWTILPIRL
                     PRVYEFGVHINIRAALTPKLSVSDLDFKNRTVFLRVDFNVPFDRETGSIRDDSRICAA
                     VPTIRKIMEDGGRVVIGSHLGRPKKPNANQSLKRILPRLQEVLEKEVTFCTDAFKAGK
                     DVKEMRNGDVMLLENLRFFKGEDSKDAAERNKLASALASFSDIFVCDAFGTVHRMTAS
                     MTGVPRVLGAGVTGFLIEKEISAISMVMRNPEQPLVAVVGGSKVSDKINVLSSIFNFA
                     HTVIIGGAMAYTFLEAQGYSVGKSKVERVVREKGRDVDLHNTARDLMDLAKARKVRLI
                     LPIDHSCAKEFKDAEPFVTNNADIPAEYMGLDYGPKSIEQAKKAVAEARTLIWNGPLG
                     VFEFPHFATGTNAIAESIKDNKHVVSIVGGGETAAATKGYHECITHVSTGGGAFLELL
                     EGRALPGLICLTARASPKL"
     gene            <1259469..>1262396
                     /locus_tag="LDBPK_303440"
                     /db_xref="GeneID:13385764"
     mRNA            <1259469..>1262396
                     /locus_tag="LDBPK_303440"
                     /product="CAS/CSE/importin domain protein, putative"
                     /transcript_id="XM_003863007.1"
                     /db_xref="GeneID:13385764"
     CDS             1259469..1262396
                     /locus_tag="LDBPK_303440"
                     /codon_start=1
                     /product="CAS/CSE/importin domain protein, putative"
                     /protein_id="XP_003863055.1"
                     /db_xref="GeneID:13385764"
                     /db_xref="GOA:E9BM87"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR005043"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BM87"
                     /translation="MQPINPNDRNTQARFVEIACRAASPDPTVRTPAERELLAYLDAV
                     DQQSGLPQLLLELTHGETPHDTFFAISFKNMVKKCWDPSTSEHCIQECDKVAVRATII
                     ESMLRSSGAVQRNLAEAIALIAQVDFPTAWTDALSLIVKVLTSGNDVAQLRAALSTSH
                     SVLRKYRHQGELTEALVHELRAIYSLLCPALVRSMESLLLTTETQGANVTEVYKGITD
                     AVECLRDITSLDLGDEFIERIGPIVSMYNQCLSRVSAPPALYGVQASAMIDMNSAVIA
                     CMTHWLNSFDEDFENFAPQFIEVVIGMLANQLSSDPSMDDLVVCSLELVSSACRGTTR
                     SHLNTREKLQYILQFILLPNLALREDDLETYTSDPDEYIKKNIEGSNFHTRRRAAVEL
                     VRSLLLYLPEVARPLLAEVTTALLQTAHGDWRAKDTAIYLAFVLVVDGQLVNTQRGVT
                     AQQLSEIIPVAQILDGHVFPEIRCDLSAQSPGIVKADCMLVVAAFRHLIASTAYEFLV
                     PALTRHIAVGDAVVMTYAAHTLKCFLSITEASAAAAIEAVFAGNALSILEGLCVRIQQ
                     AEAPNPYLMQYLMSVCFRFPKLVAPFVTQVMASLHTPLYRAVRNPSNALYSQCMFEVI
                     SKCVALQPGARGEFEGMLWPNFAHVLRENVAEYVPYVLQVFAQLVRTYQSSDAAQRWA
                     ENPAENYQALVCPLTQPQMYEMRTQIPAPVCLLCAFVEVYPGYMHRNGMTNPALNVFN
                     ILVRLKNYDNEGLNILTSMLLAYPADVMDMYMDTVFKVLMDRLQSSSTPKYVRILILF
                     LSVVVVQRRDADYLVNRLNSIEGGLFMRVLGNVWLPRVQKITGDVERKICVVALARLL
                     CESTALQSDTAAWVTSASSCLRMLHDGVEPDDHISFTPAAGAAQNPESLLGSAIGSDE
                     FTSSFHPLREAMQRPRDVCSHVPDAQAFFQAELSSFLKGRGAHLSASLKQWLGPHTPA
                     WLS"
     gap             1263197..1263295
                     /estimated_length=99
     gap             1263778..1263876
                     /estimated_length=99
     gene            <1266672..>1267376
                     /locus_tag="LDBPK_303450"
                     /db_xref="GeneID:13385765"
     mRNA            <1266672..>1267376
                     /locus_tag="LDBPK_303450"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863008.1"
                     /db_xref="GeneID:13385765"
     CDS             1266672..1267376
                     /locus_tag="LDBPK_303450"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863056.1"
                     /db_xref="GeneID:13385765"
                     /db_xref="UniProtKB/TrEMBL:E9BM88"
                     /translation="MKLHLEDAYEELCAEYNTTPLCTFRSSLRNTYASLDGEVFMDAS
                     YVEGDHFCVFAELLRRLLRRPIAFIQPTIVQLDTAAPQLEHSVLYAPEEQVGHAYYAV
                     PPRLLRIKLLLSRNVNNADVERVCRLIVVQKVLDCVPFPASHSNSTKASVQATGTLPQ
                     LSWPERATIESIDLHNCVFVSLPGGRALRAAARRNVYVQNVFLEGCSVNAAVVAQIAR
                     ATRGNREQFRLVGISS"
     gene            <1269606..>1271459
                     /locus_tag="LDBPK_303460"
                     /db_xref="GeneID:13385766"
     mRNA            <1269606..>1271459
                     /locus_tag="LDBPK_303460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863009.1"
                     /db_xref="GeneID:13385766"
     CDS             1269606..1271459
                     /locus_tag="LDBPK_303460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863057.1"
                     /db_xref="GeneID:13385766"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BM89"
                     /translation="MATVYTSVPGKEFAKGVTLDEANRIVRVDAGLPSLSALQVGMVV
                     RSIGGVPVGDGRCEQARHHSNRSQVLVVLGAPPKDEFDLSSDDDDAANFKPPSTLPPL
                     PPEFNNSVAQNSSAVVYEATVKCGAGGCVIIMCEGANPALAITLAAEKAKAEVMYIDT
                     VARMKTRQTIENAGGVLKKSLEKGLWIYVEQATKSITLLRQISDCIMEVRAAGKMHAQ
                     SRVLLMCEPHPHFPEALMRGSVTLRSRLQNNNMAEVDIREDLSESAHRKQAIHGDDVA
                     SSETAAKPEVTKTRKKVRISNQVNIVHLEKSTFMEMSASAQPPLESGTSHDGISRVAK
                     YSFGSNENLISLSYVRDHRFAIGTNSGYVVLIDRNGLPLIQFRPHKACIWDVSFSSQF
                     DFSTACEDGTSVIYNYSLANQELTTVSVASFQNDVFAVTYANPNDVNSGVLSGGLSAT
                     VCVLHSDRQNSSFIACRTSIQAMCATQMNQVIVGGGTGACTLIDTNHCVVTDITHAHN
                     KKVPAVGTHGNVAVTGGFDCVLRLWDVRNGFHLTSQRQLNEVITAVAMNERYISACSG
                     SSLYVWDPRKMDRTLAVKANAWKDLTRGLVLDGSTIVTASVDGVARIWEVN"
     gene            <1273824..>1276445
                     /locus_tag="LDBPK_303470"
                     /db_xref="GeneID:13385767"
     mRNA            <1273824..>1276445
                     /locus_tag="LDBPK_303470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863010.1"
                     /db_xref="GeneID:13385767"
     CDS             1273824..1276445
                     /locus_tag="LDBPK_303470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863058.1"
                     /db_xref="GeneID:13385767"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:E9BM90"
                     /translation="MLTGADAAGDGGDVAAPKGAPAPKQRVRISDSMRELSADLQQLE
                     DLGLSLDPLTPPSSDSVEHILITDSWSCTVCGTTGAAICPLTGKPHRRRLVSIAQHAL
                     RLIELHVGKVYVRSAPLSKRVDGEVQVRTQRRLTMNPHTFLLAFYFASQASTAPKAAA
                     DGAQTPPLSRKSGTPGSRGSAEWTGECARHLLDVVREIKVYGASPTDDAYCHSLLKSM
                     RSAWLQYSRQVKRELAADSASELESPKSRPSDENTQASLPKTAKARDELVSCTRSTLI
                     EAVAHSRKDPDNQDLKRFTALLYQRLSRLCTADEFADVKRRVEKIEAYDSTPRIEYAT
                     PPCVMLDANTTASEDEAGGATAALAGSSTPGGAAASGCMRRRAGPELPPGWYVDERGV
                     SRPPADHEERKRRERYLQKEFKAQKAYEAVMQMDTDKDKPEQPQARVAAALTQAELQL
                     LATDLNTTPPHLKRLFGLLTLVEDRFVEALPPRLRPRLRQEFHDVLDWNVIQRQARGN
                     ARNISNLVRFVGEKVIECSSPAREATMVARMSAVCDDIERCTPDVGTAVANAFAFLFE
                     AIRELREDVAKFSLVMINASLKQNAVHYIQEFISACLPLPRKWTHSIAFLQRFINDER
                     VLLWSSVSVPQAWTSVTAEERRVRGALLIGTLDLLRSGRHTSLDRWVDLPPEIFYFEK
                     HIIFKAANTVQECTLLLLLDGAISSVLARRAMKPATVSAVIRHLHSQIMLLLAEDIRL
                     DTLKDSVIDFVESQLYHLHVGEAAPDDEASLAAVGPKVTLTDTEKQTVRSTIDKMTNT
                     EDPLYVTFERRVLQFMEAMLVRNTDDVAPLGLVTNTLKQQVQLLRHMLVFHWEVYMPS
                     YREMLPSLSLESTATVT"
     gene            <1278517..>1280916
                     /locus_tag="LDBPK_303480"
                     /db_xref="GeneID:13385768"
     mRNA            <1278517..>1280916
                     /locus_tag="LDBPK_303480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863011.1"
                     /db_xref="GeneID:13385768"
     CDS             1278517..1280916
                     /locus_tag="LDBPK_303480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863059.1"
                     /db_xref="GeneID:13385768"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9BM91"
                     /translation="MYPHSKQSMASTIHSFVTENKIEEKGLKLSELRRLPNSNQVSIV
                     FDGNRVLDDVVQDVHVTGPLTIFTASTPWSAYTVISEYTEMVRKLGEYFRACDADFKP
                     MFVFNGCGFHPMEDQDTTSPAPPMEVASYSAYNKNKTVRSVPAEAQKKFASRFAIEED
                     VEGLIVRKLCEVAEETMRAPYLAWSQISAFFAPSNTMTSETFGSLELLAFPGIDRVIT
                     NIDVDAGTFDCVSKASMMAALRRRYDAEFSEDDFSAIALYETKNRLFRVKNRRETFDD
                     LCRLPRDPTRVDAFMKQHRVSEDQKLLLRRNLGALDAPVFTVDAQLVPLSTLHNRPRR
                     CEIRPIFGSPMPIVFFYLFMSGPLLPLPFAIHSQEVLADDWPLIDTSAYRRAAESILP
                     LRVQVVFQLFPIAPKTSDFYWIRQYVVFKKQQQAPESQSRVCKLSNPPTIDLAYWSFM
                     EEELLQSTRDADNVYFTDIVSFCGCAVAEPVIYKSVQATLAAVYLRSLDFLGYFTHAT
                     DGAESSGPSVYCKALERFDCPTLSEYGVLLIELMRTGTLNDDPLVVVLNRVDDTIPMG
                     VRFASRLVSIIPANVCGPWSGPFDPEMAAFGVISRLFSRTLRVLHEVVAMLLFANRAT
                     TVPWDQFSNVVQRLPFNFPAEFSAGFLMTYVLCNPQCTMEELCATFPEMYALDTDLQT
                     LFWFFTMGFEAIRVINYEEPLSYDMVQVVNAARQLVGQACERLCPDVFVAHFPTADIL
                     FVAQNQGMDMGPMDPQMDVPMPMNNMHGQMPSNMNMNMNMNMHTGMNSNMMQYQPPRM
                     Y"
     gene            <1286642..>1288645
                     /locus_tag="LDBPK_303490"
                     /db_xref="GeneID:13385769"
     mRNA            <1286642..>1288645
                     /locus_tag="LDBPK_303490"
                     /product="DNA ligase I, putative"
                     /transcript_id="XM_003863012.1"
                     /db_xref="GeneID:13385769"
     CDS             1286642..1288645
                     /locus_tag="LDBPK_303490"
                     /codon_start=1
                     /product="DNA ligase I, putative"
                     /protein_id="XP_003863060.1"
                     /db_xref="GeneID:13385769"
                     /db_xref="GOA:E9BM92"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:E9BM92"
                     /translation="MAKLFQESSFDPVTTFEAVWLPPRVPVAPPTAGASEPVPFAAVV
                     DVLADISATGSRLECLKQLTFLLLAVIERCPEDLVPVMYLVINKHAPQHEGVELGIGD
                     AVLVKAVAECCSMTEARAKEAYRQSGDLAEIAQMHKQKQSTLMKPKPLSARSVFKTYK
                     EIAMMSGRDVMRRRSDLIKGLLRDAQGPEVNLIVRGLQQKMRIGLAEPSALAAVGYAF
                     ALHFLGGAQMHKMDEVQLQTLLNTGADSLARIFYEVPSLDVVLSAVLANGFMTLVPGS
                     SIAKRYAKDLSIRPGLPVKPQLAYPTSSITVILDRLQGKKFTSEYKYDGERAQIHYDK
                     DKGFHIFSRNSETHTGKYPDVISMLPKVFDPVEVQSFILDSEVVAVHPETGALQAFQV
                     LQHRGRKNIAEEDVSIPVCVFVFDILYFNGEPQLNKTLQQRRELLWRCIHPLPAKLSF
                     ATYLDSDKVEDIQTFLERSIADGCEGLMVKTLDEEANYTPAKRSHYWLKLKKDYMDGV
                     TDTLDLVPIAAFHGKGKRTGVFGGFLLACYDPKADEYQSICKIGTGFQDEELEKLTQS
                     LKPFVVDDKPRYYRAGGEEPDVWLTEAQVWEVKAADLSVSPVHQAAVGLVDPSKGIAL
                     RFPRYLRQREDKKPADATNAQQVADMYKAQSLAVQHEANGDAE"
     gene            <1289346..>1289777
                     /locus_tag="LDBPK_303500"
                     /db_xref="GeneID:13385770"
     mRNA            <1289346..>1289777
                     /locus_tag="LDBPK_303500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863013.1"
                     /db_xref="GeneID:13385770"
     CDS             1289346..1289777
                     /locus_tag="LDBPK_303500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863061.1"
                     /db_xref="GeneID:13385770"
                     /db_xref="UniProtKB/TrEMBL:E9BM93"
                     /translation="MGTYLSLLVRKRPREDGSDDASSAAGCSASHAASLPPSSLSHLL
                     RSLRYRCASPSRIGSEVCRSVAEDEATRRTYGCHAHVYETDTVDGSHGVALAWSVDEF
                     ASPLSALSLLSLCRVANSCRKKTLVTTPKGEAVVLAYAAAL"
     gene            <1290887..>1292092
                     /locus_tag="LDBPK_303510"
                     /db_xref="GeneID:13385771"
     mRNA            <1290887..>1292092
                     /locus_tag="LDBPK_303510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863014.1"
                     /db_xref="GeneID:13385771"
     CDS             1290887..1292092
                     /locus_tag="LDBPK_303510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863062.1"
                     /db_xref="GeneID:13385771"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BM94"
                     /translation="MAALAALEKEVADLKRVRVFNETVRTGVERVLASLPSPENEKDT
                     STKARILLLRSQATLLLPRVSREAEKDLNAALKLQPGSTTTWVELSECLLRRNAFKEA
                     CDALDNALRVNPAHTEALCKYSQIQRNRCGEEGVTAEQRKAYLEDAVAKARAAVGSNV
                     DDADAWNTLALSLLSKVTLEGMTFDGVRKALAAMQQAERKCPEDPDVPYNKAVLESLL
                     GHFGAAAMDYWKAHALDKDRLKGTRHLSEENAKVLLRAQSRMRTSSGIGKRDFQRIRT
                     RIEQAHKKYTQSTSAKVVGVLDIVTEPTMQPVTLLVSDGKGDFGLLLLHEVRPTCFKI
                     GDVIAYPVTTPVETITHNVVACPGVVEEPLKLTLNHAYPNPKGILVNGQPLPSSAHVP
                     LQMSSRLFA"
     gene            <1293018..>1293452
                     /locus_tag="LDBPK_303520"
                     /db_xref="GeneID:13385772"
     mRNA            <1293018..>1293452
                     /locus_tag="LDBPK_303520"
                     /product="zinc-binding protein (Yippee), putative"
                     /transcript_id="XM_003863015.1"
                     /db_xref="GeneID:13385772"
     CDS             1293018..1293452
                     /locus_tag="LDBPK_303520"
                     /codon_start=1
                     /product="zinc-binding protein (Yippee), putative"
                     /protein_id="XP_003863063.1"
                     /db_xref="GeneID:13385772"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:E9BM95"
                     /translation="MVRRLRTRLAAPSGGEGGFGCAFCGAHLCIAEDIVSDNFRGRHG
                     KAFLVSRCENTYYGHQEEKQLMTGLHRVRDVFCSNCDQYVGWGYDFAVDEREMYKMQR
                     FVLERQLIRVITHGQLRGALGYSIPEGSITFALPVARSYTLE"
     gene            <1294338..>1295468
                     /locus_tag="LDBPK_303530"
                     /db_xref="GeneID:13385773"
     mRNA            <1294338..>1295468
                     /locus_tag="LDBPK_303530"
                     /product="casein kinase 1 isoform 2, putative"
                     /transcript_id="XM_003863016.1"
                     /db_xref="GeneID:13385773"
     CDS             1294338..1295468
                     /locus_tag="LDBPK_303530"
                     /codon_start=1
                     /product="casein kinase 1 isoform 2, putative"
                     /protein_id="XP_003863064.1"
                     /db_xref="GeneID:13385773"
                     /db_xref="GOA:E9BM96"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BM96"
                     /translation="MGTRSKRAQDVLIGGRFRIQERLGGGAFGEVFRGVELNSGHPVA
                     MKMELTKDGHRSHLNLENRIYKKFNECPVTVGIPKSYYCGRVGDYTVMVMDLLGPCLD
                     DLFEVCHRKFSFKTVCMIGIQLIQRLQYLHSVGYLHRDIKPENFVMGVGANSHIVYVI
                     DVGLSKAWRDSTGKHILYAEGKSLTGTARYVSINTHRGIQQSRRDDLESVSYLLAYFA
                     RGNLPWQGLKSPKRDARFERIRDVKTATSPAELCKGYPRQLADYIEYTRSLGFEAEPD
                     YSYCVGLFSSAMADMGEQYDYCYQWIDRSEAEVKAASDARGSAHSLRTSGAQTSVAVG
                     GSNLMTSSVFVGDSAVNEMSKSLLNSNFMEEIQDYYGLNDYI"
     gap             1297688..1298749
                     /estimated_length=1062
     gap             1299153..1299589
                     /estimated_length=437
     gene            <1301523..>1302269
                     /locus_tag="LDBPK_303540"
                     /db_xref="GeneID:13385774"
     mRNA            <1301523..>1302269
                     /locus_tag="LDBPK_303540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863017.1"
                     /db_xref="GeneID:13385774"
     CDS             1301523..1302269
                     /locus_tag="LDBPK_303540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863065.1"
                     /db_xref="GeneID:13385774"
                     /db_xref="UniProtKB/TrEMBL:E9BM97"
                     /translation="MEAVAWTPDVVEDLLFRQFIKDEDISRQLPPAPQVSSENFLERY
                     DQATKILFSYVRNGPVAALASQNVNTAAVGKYGGATPLKGFVGRTPATKPVPPESSRP
                     FARTATPTPAPTSRAPSVPKATASSPPPAKAKRQRVEWPADVPTNQMLKSNSRSKVAH
                     LTAKRVAAQQGVDPDLIFTQNCGDLPLSVIFASYPKALKSVSAVRNASGDWRTDTFTV
                     EEEVSYKKDLGYVHYGPSQCTYGDWLPSQS"
     gene            <1304502..>1306280
                     /locus_tag="LDBPK_303550"
                     /db_xref="GeneID:13385775"
     mRNA            <1304502..>1306280
                     /locus_tag="LDBPK_303550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863018.1"
                     /db_xref="GeneID:13385775"
     CDS             1304502..1306280
                     /locus_tag="LDBPK_303550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863066.1"
                     /db_xref="GeneID:13385775"
                     /db_xref="GOA:E9BM98"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="UniProtKB/TrEMBL:E9BM98"
                     /translation="MQYPPDTQVWVKCDDGVWWPGTLRETDTEMQAFLCAGEDCCVEF
                     YHSPGELYPLFSADKAHVRPLHAEPHTRTPEEDAWFANETVAEAAAKALRDYQCCRLL
                     NSPPDGPPAGPAPISERENTRDALPFTATELRNIESLLGAVGNSTAARLRQELQQARA
                     SVASRGLRRQDAPRRQARKRQRPAEPPPSPAPPAATHRSVLAAASRPTEEAPTCPRHD
                     PSGVMHALSEALPTARRVAKRSSGRSSSPLSAGDGEGGDASEEDEDAVPFVQAARRHV
                     LEVLRHEVFENPSRFVLSPVYHFVDMLGAVVVENSNLTTTLPAPRTLHERPAEGFSPQ
                     RRVLLVPLTDTYEHTTGWMLPTEIEGAQLAMSLYVNDTPVSLPPNWQLSPAKEAAAVK
                     TAITVDITPLVLPIERDLFSLQVIFSGDVAEMEMWRGVIACVLVEEVGLAHLGERIVS
                     TYHKRRAAAIRQSPSSSCGERGAVAITEASVKIQCPMTTLTMEIPVRGMYCEHLQCME
                     LAAVLIQCARQNVWNCPLCSAAMKPEDIIVNYRLKDWIASHSQEVVAQVEYVVETEPG
                     RPLKIVYKAARPEQHSTIEVIDDEEG"
     gene            <1306971..>1308149
                     /locus_tag="LDBPK_303560"
                     /db_xref="GeneID:13385776"
     mRNA            <1306971..>1308149
                     /locus_tag="LDBPK_303560"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_003863019.1"
                     /db_xref="GeneID:13385776"
     CDS             1306971..1308149
                     /locus_tag="LDBPK_303560"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_003863067.1"
                     /db_xref="GeneID:13385776"
                     /db_xref="GOA:E9BM99"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:E9BM99"
                     /translation="MSVHSILFSSEHVTEGHPDKLCDQVSDAVLDACLAGDPFSKVAC
                     ESCAKTGMVMVFGEITTKAVLDYQKIVRNTIKDIGFDSADKGLDYESCNVLVAIEQQS
                     PDICQGLGNFDSEDLGAGDQGMMFGYATDETGTLMPLTYELARGLAKKYSELRRDSSL
                     EWARPDAKTQVTVEYDYDTREGKQVLTPKRVAVVLISAQHDEHVTNDKISVDLMEKVI
                     KAVIPANMLDAETKYWLNPSGRFVRGGPHGDAGLTGRKIIVDTYGGWGAHGGGAFSGK
                     DPSKVDRSAAYAARWIAKSIVAGGLARRCLVQLAYAIGVAEPLSMHVETYGTGKYDDA
                     KLLEIVKQNFKLRPYDIIQELNLRRPIYYETSRFGHFGRKDELGTGGFTWEVPKKMVE
                     "
     gene            <1309775..>1310518
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /db_xref="GeneID:13385777"
     mRNA            <1309775..>1310518
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_024473482.1"
                     /db_xref="GeneID:13385777"
     mRNA            <1309775..>1310518
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863022.1"
                     /db_xref="GeneID:13385777"
     CDS             1309775..1310518
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_024329253.1"
                     /db_xref="GeneID:13385777"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BMA0"
                     /translation="MKAARLLFQSDRRTRHHMMIDGEINPREWLNWHPKEYQPWYFDR
                     HKFLYEQGQYAAYNHLLCHQAYLKDIEHLTRYPEPLTFIIDCRMSPAKMHRWIPNSMW
                     LPRDEVEYALQLTNDEFQEMYGFTKPAKDDDVILISHNGLASEQAGWEWRKQYYQHVY
                     NYRGGTNELFGEDYQDFILKDRLDPWKGPYPQKSIFVDKWSKRKVLTRTGPFDRQYEM
                     QDFALPDLELERPRHSEDGPRQNMPYGLQ"
     CDS             1309775..1310518
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863070.1"
                     /db_xref="GeneID:13385777"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BMA0"
                     /translation="MKAARLLFQSDRRTRHHMMIDGEINPREWLNWHPKEYQPWYFDR
                     HKFLYEQGQYAAYNHLLCHQAYLKDIEHLTRYPEPLTFIIDCRMSPAKMHRWIPNSMW
                     LPRDEVEYALQLTNDEFQEMYGFTKPAKDDDVILISHNGLASEQAGWEWRKQYYQHVY
                     NYRGGTNELFGEDYQDFILKDRLDPWKGPYPQKSIFVDKWSKRKVLTRTGPFDRQYEM
                     QDFALPDLELERPRHSEDGPRQNMPYGLQ"
     mRNA            <1309775..>1310512
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863020.1"
                     /db_xref="GeneID:13385777"
     CDS             1309775..>1310512
                     /locus_tag="LDBPK_303570"
                     /old_locus_tag="LDBPK_303580"
                     /old_locus_tag="LDBPK_303590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863068.1"
                     /db_xref="GeneID:13385777"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BMA2"
                     /translation="MKAARLLFQSDRRTRHHMMIDGEINPREWLNWHPKEYQPWYFDR
                     HKFLYEQGQYAAYNHLLCHQAYLKDIEHLTRYPEPLTFIIDCRMSPAKMHRWIPNSMW
                     LPRDEVEYALQLTNDEFQEMYGFTKPAKDDDVILISHNGLASEQAGWEWRKQYYQHVY
                     NYRGGTNELFGEDYQDFILKDRLDPWKGPYPQKSIFVDKWSKRKVLTRTGPFDRQYEM
                     QDFALPDLELERPRHSEDGPRQNMPYGL"
     gap             1310869..1316355
                     /estimated_length=5487
     gene            <1317195..>1318565
                     /locus_tag="LDBPK_303600"
                     /db_xref="GeneID:13385780"
     mRNA            <1317195..>1318565
                     /locus_tag="LDBPK_303600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863023.1"
                     /db_xref="GeneID:13385780"
     CDS             1317195..1318565
                     /locus_tag="LDBPK_303600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863071.1"
                     /db_xref="GeneID:13385780"
                     /db_xref="GOA:E9BMA3"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:E9BMA3"
                     /translation="MRRAAVVPRSSVFSHTIYDGACFVHAGESVEKRPSRRRYAAFNT
                     RGRASQAKELVDMMKKKSAQDAKAFYEALQPRDRLDILRLLYERRKKRQSDQASSKLT
                     KYYSVPFEKKYFFREEDVEEKSTLGRGPGGQATNRRMQTAIVKHVPSGLIVKFSRFPS
                     LWLNRRAARELLNLRLEEHLLGPASRIVKARVARERRRRRRQRTMAYLSEKGARLQAR
                     DSRRCHWLAFLTGESPLPSAAVSQMALKEDAAAVPVTTAVLFGSECHTWWPKLKAATE
                     SAAAAAHDSTGDDCVPLLLQYLFPVVYADSGRAEREEMEACKSNKAVHTNVRRALTCF
                     CELFGLRLRHIPASVPPEASRVVLEKDGLNWVEYRSRMIANGSLTRLARTCWPRVYMS
                     VRELGMTPEARAIIVFFKKEASAAEGSAGGAWAAEALQCFSEAIPRRKPSETVQLSSA
                     PSSPGT"
     gene            <1319674..>1321200
                     /locus_tag="LDBPK_303610"
                     /db_xref="GeneID:13385781"
     mRNA            <1319674..>1321200
                     /locus_tag="LDBPK_303610"
                     /product="cytochrome p450-like protein"
                     /transcript_id="XM_003863024.1"
                     /db_xref="GeneID:13385781"
     CDS             1319674..1321200
                     /locus_tag="LDBPK_303610"
                     /codon_start=1
                     /product="cytochrome p450-like protein"
                     /protein_id="XP_003863072.1"
                     /db_xref="GeneID:13385781"
                     /db_xref="GOA:E9BMA4"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:E9BMA4"
                     /translation="MAAFSRLLGVQLPYMVEVVIFLALAYATAYVLTSIMFARIHKFK
                     MAGPLTAIPVLGGVVTMIRDPYSFWERQRQYEPHGYSWMAILTQFVVFVTRADLCHKI
                     FTTNGEDTLTLQLHPNGKLILGDNNIAFQSGPGHKALRSSFMNLFTTKALSLYLPIQE
                     RIIHEHMSRWARDYPWGGKPEEMRLHIRELNCETSQTVFLGEHLHNRTEFTHNYNIIT
                     RGFLSAPLYLPGTPLYKAVQARKLTMVELQAAVRRSKARMAKPDAEPHCLLDFWTATV
                     LEKIKEAEEEGGDAPAYSSDHAMADTILDFLFASQDASTASLTMITATMADHPEILER
                     VRKEQARLRPNNEPLTYELVQEMTFTRQCVMEQLRLFPPAPMVPMKVHSDFQLDEKTV
                     VPKGSMIISSLVACCREGFTNPDTYDPDRMGPERQEDRKFAKQFIPFGVGPHRCVGYN
                     YAINHLTVYLALIAHHVRWQRTRTPDSDKILYLPTLYPHDCLQTWRYREGMEPKAEKV
                     "
     gene            <1323222..>1323710
                     /locus_tag="LDBPK_303620"
                     /db_xref="GeneID:13385782"
     mRNA            <1323222..>1323710
                     /locus_tag="LDBPK_303620"
                     /product="mago nashi-like protein,putative"
                     /transcript_id="XM_003863025.1"
                     /db_xref="GeneID:13385782"
     CDS             1323222..1323710
                     /locus_tag="LDBPK_303620"
                     /codon_start=1
                     /product="mago nashi-like protein,putative"
                     /protein_id="XP_003863073.1"
                     /db_xref="GeneID:13385782"
                     /db_xref="GOA:E9BMA5"
                     /db_xref="InterPro:IPR004023"
                     /db_xref="UniProtKB/TrEMBL:E9BMA5"
                     /translation="MAEQEDLAAVSPAETMDSQLYYVRYYSGHTGRYGNEFLEFEISE
                     TGSLKYVNNSNYRNDFIIKKQARVSPAVLEEVKKLIVQYSVCESDDERWPAPDRNGRQ
                     ELEIHLGNTHISLLTNKLTSMAEIPKSSETDSLVRFYSFVRDVKALIFALVSIHFKIK
                     PI"
     gene            <1324770..>1325579
                     /locus_tag="LDBPK_303630"
                     /db_xref="GeneID:13385783"
     mRNA            <1324770..>1325579
                     /locus_tag="LDBPK_303630"
                     /product="zinc finger-domain protein, putative"
                     /transcript_id="XM_003863026.1"
                     /db_xref="GeneID:13385783"
     CDS             1324770..1325579
                     /locus_tag="LDBPK_303630"
                     /codon_start=1
                     /product="zinc finger-domain protein, putative"
                     /protein_id="XP_003863074.1"
                     /db_xref="GeneID:13385783"
                     /db_xref="GOA:E9BMA6"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BMA6"
                     /translation="MTFSVKGGSYSSSHPSPAMHPYVSPSLPPQSHGQQAPPSFSLGD
                     EQYVGVPKRVGVDPTKYKTTICRNWEQTGTCTFRGCTFAHGVEELRAPLRPDGHTPVL
                     RPQHISPGSTPPLRASQPPPPPPPPSSGHYTLEQLLDMLYKEVLHQRELVTVHVEANT
                     TLEGMLRREQAQHDLSKKQLEEKTQQCELLARELFARNQQLRKAADSSPEIKGLLDQW
                     ETQLASFSEADAKKDDVFYTATATSSTDDGGDSGKEYESARIEELLRALQR"
     gene            <1328032..>1330281
                     /locus_tag="LDBPK_303640"
                     /db_xref="GeneID:13385784"
     mRNA            <1328032..>1330281
                     /locus_tag="LDBPK_303640"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_003863027.1"
                     /db_xref="GeneID:13385784"
     CDS             1328032..1330281
                     /locus_tag="LDBPK_303640"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_003863075.1"
                     /db_xref="GeneID:13385784"
                     /db_xref="GOA:E9BMA7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BMA7"
                     /translation="MGKSKKHGKPVKGASKKGSKHDKSKRKAKFIDPTSSVSRDVRET
                     VAALVQEIEREEPVAEEKLQPLKKGKKCQEIAEKEGILVKTGMTKEQAHTIANRLKQQ
                     QSTTHRSDGEGDVGSDGGCDGDGGGTEEDYSDTANEPSREYRKGGYHHVVIGEVYNDR
                     YRVVKKLGWGYFSTVWLVWDYQKERYQAMKIQKSAASYSEAAYDEIKLLSEIMEADPH
                     KNRCCARLNDYFKHTGPNGTHVCMLFDVYGENLLSLMERYEYRGIPLPIVKCIARQVL
                     IGLDHINSIDIIHTDLKPENVLLSTPKHSIISLMKHFHPPPLHQRPKLTERDPKTMTK
                     SQRRRYYKKLAKEERKTLLGEDDGDHKSRGDEHGSNENGDADSEGSKTDPESEVERFH
                     HVILADFGNSCWTYKQFTDEVQTRQYRCPEVILGEPYSTPIDIWSCACMIFELITGQF
                     LFDPKKGDDYSRDEDHLALMSELLGDLPESMRLGDGKYRSYYYNSKGDLRNIKDLQYW
                     VLEDVLHQRHKFTKKKAKEIADFLLPMLEYAPDTRATPAAMLRDHDAFFDIQDDDYAP
                     LCFVDEDSGDEEGSASDEEEEETDSDDSSQSYSSAPSSELTAKRSRQPDNDADRSDTF
                     RYWEEHPILNRTYLEERGLTIADIQSVLAGNFLDDAAAHEAAAEVIRLLSEETDLLSN
                     DHGSDGHEADNEDGGDGDNDDEEETTQGSEGPEKVVVGKAAPCDDGVDEDDEETTDEE
                     EEGSSDGAE"
     gene            <1331051..>1331485
                     /locus_tag="LDBPK_303650"
                     /db_xref="GeneID:13385785"
     mRNA            <1331051..>1331485
                     /locus_tag="LDBPK_303650"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_003863028.1"
                     /db_xref="GeneID:13385785"
     CDS             1331051..1331485
                     /locus_tag="LDBPK_303650"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_003863076.1"
                     /db_xref="GeneID:13385785"
                     /db_xref="GOA:E9BMA8"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:E9BMA8"
                     /translation="MSKKQEVKAYGPNVKKGDLVYGVVHIYASFNDTFVHVTDTSGRE
                     TYVKVTGGMKVKADRDESSPYAAMMAAQDVVARCKECGINALHVKMRAVGGVRTKSPG
                     PGAQAALRALARAGMKIGRIEDVTPIPTDSTRRKGSRRGRRL"
     gene            <1332356..>1332901
                     /locus_tag="LDBPK_303660"
                     /db_xref="GeneID:13385786"
     mRNA            <1332356..>1332901
                     /locus_tag="LDBPK_303660"
                     /product="ATP synthase, epsilon chain, putative"
                     /transcript_id="XM_003863029.1"
                     /db_xref="GeneID:13385786"
     CDS             1332356..1332901
                     /locus_tag="LDBPK_303660"
                     /codon_start=1
                     /product="ATP synthase, epsilon chain, putative"
                     /protein_id="XP_003863077.1"
                     /db_xref="GeneID:13385786"
                     /db_xref="GOA:E9BMA9"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="UniProtKB/TrEMBL:E9BMA9"
                     /translation="MFRFCGRRLVARTLPLLADYQEMPEAFEFMEHKVVDKDIHSAYE
                     NMETLRLTVTRQDEFLFKEAPVKCVTIVGVNGECGVYPGHAYEITQLTPAPLTVEMPD
                     GTVKKYFTSGGFAHINNEGSCDINCVECIPLTELDVDAAEKALAQQQSALNSAHDDKA
                     RAVIEIRIGVLESVIQSLKHA"
     gene            <1335168..>1336334
                     /locus_tag="LDBPK_303670"
                     /db_xref="GeneID:13385787"
     mRNA            <1335168..>1336334
                     /locus_tag="LDBPK_303670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863030.1"
                     /db_xref="GeneID:13385787"
     CDS             1335168..1336334
                     /locus_tag="LDBPK_303670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863078.1"
                     /db_xref="GeneID:13385787"
                     /db_xref="InterPro:IPR008491"
                     /db_xref="UniProtKB/TrEMBL:E9BMB0"
                     /translation="MTSQPISIHYKQMEEWLEDRKSVFSRKHKNEYNALLSVAPRLVQ
                     MAQYDIPALEKQIKKNENAIEDCHRVCEEAQRTQLKLVERRRTMLREYGIELAAAVGE
                     VEVAFAVDQRVREACAQVNAAFQEYARARVRALKEYYNALLARTAAGWYGTDPFAFHF
                     PWLQRAFSEAEYQPADALSEATDAGGEAADAAEPQIDWGDDDDGAAGTFAGLGKDAVQ
                     INWDATEMEARPVEDDSLPATDGVHFSIDLASAKHRANVMSELEAASCFCRERGTADL
                     LECATETEALRRFLSSAKEGELARMKESYRARGSFVDRITRFQQQIVVAENRSTTHQA
                     KMQDAEDDLAKLKVQQDELLSRLRSMRDEALTHLEHMFPDRRILIVGDLNKYLA"
     gene            <1337244..>1338356
                     /locus_tag="LDBPK_303680"
                     /db_xref="GeneID:13385788"
     mRNA            <1337244..>1338356
                     /locus_tag="LDBPK_303680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863031.1"
                     /db_xref="GeneID:13385788"
     CDS             1337244..1338356
                     /locus_tag="LDBPK_303680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863079.1"
                     /db_xref="GeneID:13385788"
                     /db_xref="UniProtKB/TrEMBL:E9BMB1"
                     /translation="MEGSKKYEEASLRGITRHHVWKSRTSDLTVINLRDPTELLGIQD
                     PLAVAAVAETRQATAASPPPPLRPPLARPVTGKQESLNALLAKLQLCRPAQEPSSHPS
                     AAAKPLPQSSANAAPPAAPSAAAPSALHPTARVTSTAAAASPAIVMPEVSDPSFPDPK
                     ESSSGPSGQFEFITGTNIPGQGVVKKTEAVDESSSMALFHDPLWGGSLDAFALPPTSK
                     PSPKPQLRASLSELYASAASNNTSAFASPPAPASQPQKVASPPVATVTASAVPTAMAS
                     STMPMMSGIVQPPTPPQLNTPFPMYTVPIQYMAQQPQFPAGMVYNAPNFFPYGAAPMM
                     MAQPQHIPQGYAIPAAAMMRPGTNVKAMPFVPGNTM"
     gene            <1340266..>1341027
                     /locus_tag="LDBPK_303690"
                     /db_xref="GeneID:13385789"
     mRNA            <1340266..>1341027
                     /locus_tag="LDBPK_303690"
                     /product="CYC2-like protein, putative"
                     /transcript_id="XM_003863032.1"
                     /db_xref="GeneID:13385789"
     CDS             1340266..1341027
                     /locus_tag="LDBPK_303690"
                     /codon_start=1
                     /product="CYC2-like protein, putative"
                     /protein_id="XP_003863080.1"
                     /db_xref="GeneID:13385789"
                     /db_xref="GOA:E9BMB2"
                     /db_xref="InterPro:IPR012389"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:E9BMB2"
                     /translation="MPLRACVYRTPAQARLVEVVSGYVQHLMDVQASRCTETALDGHV
                     VPPPNAKYPSHDFFCATHAPAISVKRYTERLVTYMHCSPEAFVFAVAYLRRLVLSGFP
                     VHMRSIHRLLLTAVLVALKCRDDVYYHMSFYAEVGGVTTKDLRIMEIRFLSDLIRFEG
                     EVSLADYHVVMVDIMRVTERRMITNINGKTELCNRCGMSAGAFTTSTPGDLGCLHCKG
                     DAFAQSWTSECELFWGPLNSAFSLPAGEVRKTLSC"
     gene            <1345231..>1346898
                     /locus_tag="LDBPK_303700"
                     /db_xref="GeneID:13385790"
     mRNA            <1345231..>1346898
                     /locus_tag="LDBPK_303700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863033.1"
                     /db_xref="GeneID:13385790"
     CDS             1345231..1346898
                     /locus_tag="LDBPK_303700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863081.1"
                     /db_xref="GeneID:13385790"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BMB3"
                     /translation="MSKGFEVYPLTGSHKEVVINEALIRSAISFKPSLTTEDDRVRVV
                     GNQEKALSEEKVRKEAAGIALEDVQTLLLSFRGIKRLENLSCLRSLTKLHLDNNRIRC
                     IENLESLVHLEWLDLSYNAIEVIDGLQALQHLNCLSLYANKITAVDGLTCLPELNTLS
                     LGRNPLENMDETVHYLHHLPRLQVLTLKECPLAALPNYRSRVLAFVRGLKFFDGHLVR
                     QDEAAKAREAFRENLLTVDEEDEARAAAAKLQADQEIIASSYQQYNCPNEVMLFDELL
                     HLDPEGRHMEAILRSDAVFPVAKEPLDRYQTEFNEQVRQLTAAMKDIRERRDADDATY
                     REAVAYTLRQSAASSLAAMQRFEALAKRHIVKGVAQQVPGSAKRLPCQTTRSLHAALG
                     KLKKDLLEEEAHHYDVLEVLHNNTIAKWKSHSVEVVLQSSFEALLRLETDFQLTVRHI
                     FDAVFEERRKGDNAERAFRYVGQDDAMLAFLDNKEEYQRTVNEWYELRRKRVEELEMH
                     HLKAEETLLSARTNSILAAEQDRHRRRLHEVCQYVEEMSKMIDGCDH"
     gene            <1347743..>1348357
                     /locus_tag="LDBPK_303710"
                     /db_xref="GeneID:13385791"
     mRNA            <1347743..>1348357
                     /locus_tag="LDBPK_303710"
                     /product="ribosomal protein L15, putative"
                     /transcript_id="XM_003863034.1"
                     /db_xref="GeneID:13385791"
     CDS             1347743..1348357
                     /locus_tag="LDBPK_303710"
                     /codon_start=1
                     /product="ribosomal protein L15, putative"
                     /protein_id="XP_003863082.1"
                     /db_xref="GeneID:13385791"
                     /db_xref="GOA:E9BMB4"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:E9BMB4"
                     /translation="MGAFMYLNELWKKKSSDVMRFIQRIRSWEFRHQHTVVRLRRPTR
                     PEKARMLGYKTKQGFCVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGMKLNKNNQAVA
                     EQRLGKRFGNLRVLNSYWVNMDSTFKWYEVIAVDPMCKTIRRDPRINWIVNSVHKHRE
                     QRGLTSAGRKHRGLRHKGHKASKLRPSYRAAWRRNNRIVFLRKR"
     gene            <1349208..>1349882
                     /locus_tag="LDBPK_303720"
                     /db_xref="GeneID:13385792"
     mRNA            <1349208..>1349882
                     /locus_tag="LDBPK_303720"
                     /product="V-type ATPase, C subunit, putative"
                     /transcript_id="XM_003863035.1"
                     /db_xref="GeneID:13385792"
     CDS             1349208..1349882
                     /locus_tag="LDBPK_303720"
                     /codon_start=1
                     /product="V-type ATPase, C subunit, putative"
                     /protein_id="XP_003863083.1"
                     /db_xref="GeneID:13385792"
                     /db_xref="GOA:E9BMB5"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:E9BMB5"
                     /translation="MPVEAEVLPTPTRLPPDDAMHVVGSLIRYILIIVIVVFGIIPAL
                     CGTVFPPFSALWSILKAVSPYAWASMGTGIGIALSILGAAWGILTSGASISGAAIRAP
                     EIRSKNLISIIFCEAVAIYGVILSIIMMGKIQASSSSVGSGGVYRYETIVGGYTLFAA
                     GIAVGIGNMACGIAVGIVGSSCAIADAHSSSLFVKVLVIEIFASALGIFAVITGILMA
                     QKVQMK"
     gene            <1350924..>1351358
                     /locus_tag="LDBPK_303730"
                     /db_xref="GeneID:13385793"
     mRNA            <1350924..>1351358
                     /locus_tag="LDBPK_303730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863036.1"
                     /db_xref="GeneID:13385793"
     CDS             1350924..1351358
                     /locus_tag="LDBPK_303730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863084.1"
                     /db_xref="GeneID:13385793"
                     /db_xref="UniProtKB/TrEMBL:E9BMB6"
                     /translation="MTASHLVLQRYTDLINSGDLDAAFNYLSEDIIYVTWLGVVEGKD
                     NVVTFLRDNIRFLHFTKSFNRWRQVQHCLDADLSRRFDDSGVGDSNLFDRDGYDPQGY
                     ASFERDGMIANVVKYSMQKTRVKETVVIRDNKVVLVTLMEQL"
     gene            <1352424..>1353752
                     /locus_tag="LDBPK_303740"
                     /db_xref="GeneID:13385794"
     mRNA            <1352424..>1353752
                     /locus_tag="LDBPK_303740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863037.1"
                     /db_xref="GeneID:13385794"
     CDS             1352424..1353752
                     /locus_tag="LDBPK_303740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863085.1"
                     /db_xref="GeneID:13385794"
                     /db_xref="UniProtKB/TrEMBL:E9BMB7"
                     /translation="MKAIKAAREREIEANIALREREIAALEQEKTELQSFMTRANPKM
                     REDPLLASFPVLNYCGRKPRQTIQNVSVEQYGNIMVQLEIAKKAIDAQNHKDRVEVQE
                     LSRLIREQEKQQKTLTQKARRLGEDAGIDIKYFTERRRGGMMKMQDYKTEVSVAELEA
                     RTRLVDHEVKVARLLAEKKGAAILALTKLVEKRRSTIDDIDSLYNEIRIVDRDTTVAS
                     EELARVNADIQDADAWLEARPNPADSVARKVIEEDSATLREEKEQTVNEQRVPQERVI
                     KAQDYRIAQLEKRAKIVEKAIKNNGLSREVDKIVAHGWSQREVEVPEDQEELYDIEKI
                     IPAQEKVHPGIYNLLLTEKEKTARIVSILTITAKEKEELIAALTTRLEKLAAECTAAI
                     QELDNYASGMVFSEEQQRVQALKWVREQRRRCAKLFYQKSLLESALEEDG"
     gene            <1355404..>1357149
                     /locus_tag="LDBPK_303750"
                     /db_xref="GeneID:13385795"
     mRNA            <1355404..>1357149
                     /locus_tag="LDBPK_303750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863038.1"
                     /db_xref="GeneID:13385795"
     CDS             1355404..1357149
                     /locus_tag="LDBPK_303750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863086.1"
                     /db_xref="GeneID:13385795"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:E9BMB8"
                     /translation="MSNSVSTDAVSMESTISTDGDMPSIHHGVEKAVYMMWNNQYSEA
                     LELLRAKKDKNPRYALEWANVSLVKTLMSSTNEDRESLLDLFKSADSLSTSSKYNDPM
                     FSEDDEDDDKEEDKTRKQLKKEKKKNKKVFKARKRDATKGGEYFDQTWKLECDVVYAD
                     ALLIRSIGQLMMNSYLKGGINLRKAWGCYYSLIQQVEQDTENRIPYELKMCIKYGTGT
                     FYAFLALVPANLMKVLSIIGFISDRDLGEQYLTEVFESNTIRSPFAALVLCTLYLFLP
                     TGLGNVDVTLSRARRVLETMNARYPNNTYFNGYANFYFRKKGEVGPAVRSITLAAENA
                     EKAGLVPLLIKYLYADTLFMNQQWAEALEHYRRILDHLAKTKEKFAYTGQVVLSVAAC
                     YVMLDNDKEALVWFKKVESMYNPKSKSDSNSPRFASRVIANPRLLPLSGVYMLYINRD
                     LAHMNKEQGLRVLAELKRVTKGKDLSGPEAENMYNLFVGVIEKGSENTDAALAYMKKI
                     FDNEKKIPSDSMILPFTYYETGEMEYRRGNIERAKELFDKGSKIKGDGNETLSNRYNI
                     AMKQLRRAMEDREVK"
     gap             1360252..1360350
                     /estimated_length=99
     gap             1360932..1361238
                     /estimated_length=307
     gene            <1362490..>1365063
                     /locus_tag="LDBPK_303760"
                     /db_xref="GeneID:13385796"
     mRNA            <1362490..>1365063
                     /locus_tag="LDBPK_303760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863039.1"
                     /db_xref="GeneID:13385796"
     CDS             1362490..1365063
                     /locus_tag="LDBPK_303760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863087.1"
                     /db_xref="GeneID:13385796"
                     /db_xref="UniProtKB/TrEMBL:E9BMB9"
                     /translation="MNSNSLGAGANGSFYYPNRSKQDEASYEVSIGDGYTTEMVTDPN
                     APATEQTQAENETAATLSNGYDYGNYYDPSLYQNYYYQDDDGNYYYYTDAQQSASNDI
                     AQEIHVSVTPTPQNLVRSYEYASYDPPTYNWFVDIVVDTFLSTPFRVYLTILLYCAAA
                     LIGTLGLNYTFALLYRLYAPPIPNTNKSLQSFAYFALFFYASFVIVATLCALMDMVRN
                     LWTLKRGDVAFWGMSHRSFSKRMPPYLVYLVIILVIVFLPLLWGIMEAGIRKQSLVYV
                     AQRYANVAVLAATFLVVVCYLWFYWRALVYKWSAITKRAERDDFELRRRAYKAHPDKM
                     NKMHWYHASTVLEEFGMDGDTLLYNSVVFTVGCVPLFSLYAAQTLSTYTGTPSVVWPA
                     IASISMVCVYILSWITLMRRKSQWATYASLMLIVLMLALGLTGGAVGGHPITAVIVVV
                     LFVAAHGMVSRKRKHCLTKKELRATLKLPYTAQADDDTPQERRIDTYLFCCRNLILDY
                     MKCCDVKKHFGYRHPDVVEAERRFMISRIALRTDQKALLIWWVIVMLAVAFVMALSNS
                     IQYRFSTPIAVLANTSVTGLTPSLPLCEKVFNANGAAPLKMLDLALLAALSYTYGANG
                     DADFATWFSSKPSLLRMHPVVLPYTLNFHTDGTNISFSHYVDVSSRYHVITLNSNSRG
                     LSLFRDLDDWGESIALQAAGAISPLINIWDEENRAAFVQRARFLKTWLPPSTALDGVK
                     TYIAALNRSGDSTGILIVGDQFNGGYAKRLSAELNLPFVAFNPPGTKYINMFLTNGTQ
                     LSGVRSLWSYVDSLEDAVNTAYYPCKANLSSNRCGRISTVVKYLLETCGDPAGRAMNQ
                     V"
     gene            <1366870..>1370913
                     /locus_tag="LDBPK_303770"
                     /db_xref="GeneID:13385797"
     mRNA            <1366870..>1370913
                     /locus_tag="LDBPK_303770"
                     /product="CPSF-domain protein, putative"
                     /transcript_id="XM_003863040.1"
                     /db_xref="GeneID:13385797"
     CDS             1366870..1370913
                     /locus_tag="LDBPK_303770"
                     /codon_start=1
                     /product="CPSF-domain protein, putative"
                     /protein_id="XP_003863088.1"
                     /db_xref="GeneID:13385797"
                     /db_xref="GOA:E9BMC0"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:E9BMC0"
                     /translation="MYVLSTSRPSTAAFGAAVGNFCGDGTTYVALNRGTLLSLYVCRQ
                     GNCGIDHVQDFRLHCTLKYVRAVLIVDAAAPQKYSRHLLFLCTVKQQIVLAALESCTE
                     LSGGASPLRMTTLFQSAPDDCLYQYDPSEVELCCCSSAVTGAGASPPFVVFALTRGEL
                     FLFDVFAALARDAVKRKQNGNLTRLLSPELMASVARRAKADIFSHCYMDCTEYDVKDI
                     SFGFPSPWLKGQVHGTGPRPGTAAMKGDNASASTSLFVLYGDPYGKVHVSEYELAVSP
                     ATEAEAASETSSVESSIRPPARPPAYPAEFATPARRVRRCGLLQANVDPTASRIVFSR
                     HGLFVVGNHLVTLIQQVRPRKGVFSREIPSRQAILDVSCASVSADASELLIGFSDGVL
                     ARVTVVSRGMVGEDPELAFRFLSRPAPTIPTEVITLHADLYLLCSRFDSSFTVRLDEA
                     SCEEVLHNCGPVLDMTTHQNGSRYSVVASTGIHRGGGISVLRSAVMLREQADIPLCFH
                     PQRVLCAGELMCITTAAAANRFFLVSARALTLKELAPHVFPDIVSRHLLVELGLDAAL
                     DKLVLVSARGIAWLRLSGPRVEAVSQLPRQADDPLILFAVVRHGLTVVCDGIVVSVYR
                     GQDLVHTVPSLAGVAISSVSLVSPTLLVVGQWNGVVALYELGRRQADVVGRLLLDSVP
                     RTIACAVPTPSPSSVVTEAALGIIYVGTLHGVLVETTVALLRRGETRRSVFVAPHPLE
                     LLELAGPHPGLLCLGNVPLVVLCVAGGGLQLTGLHLMGVSAAATVDADLQCYAFYSKQ
                     DGRLHIGSLEALEKTSRTFLPLGETITQLHEAAAWGGYVASVRKVEGDEVLFLPSSAI
                     QFPWAADLSLWRSAAVPLLENERCVFLETVRLDGAEGGGVGERGGDPIDVPASDGAGV
                     SEEEWQHLLLIGSSFTFPDEQRARSGRITWCTLREERQRQRLHLIASKDIGGALQCCA
                     AVPHYKGRIALGVNGCVCLYQWNTEDQTFVAEERCRVGLTVTKLIPLYHTSLAASVLV
                     ALDVRHSAFFIEVDTLQGNLKVLCRDADLRGIMDGHVGSDAENLCLFDDSLNFTALKV
                     VPLPVEARDGDAAAAARATAQYRFEVRAQCHLGDLVTCVRQGSFAATSLMEAPAHCSS
                     AQNQLLLPGIAGPQLVFATAHGGFGVVTPVHAATYLVLRALEASLVRTVPPVGGLSHQ
                     AFREVLRAGQERGVSYLASKTGCALTRERLRRYEPLNTVDGDVVEQFVLLSPSDKKHV
                     CRVATEVFLHAFTQCVNESGIFVAPPSKEEQCILATLGTAMRPFAQYPEETIAQANSF
                     LHQGGLPHVPFAAEAVEQQVMNLQRMH"
     gene            <1371378..>1371695
                     /locus_tag="LDBPK_303780"
                     /old_locus_tag="LDBPK_303790"
                     /db_xref="GeneID:13385798"
     mRNA            <1371378..>1371695
                     /locus_tag="LDBPK_303780"
                     /old_locus_tag="LDBPK_303790"
                     /product="60S acidic ribosomal protein P2, putative"
                     /transcript_id="XM_024473483.1"
                     /db_xref="GeneID:13385798"
     mRNA            <1371378..>1371695
                     /locus_tag="LDBPK_303780"
                     /old_locus_tag="LDBPK_303790"
                     /product="60S acidic ribosomal protein P2, putative"
                     /transcript_id="XM_003863042.1"
                     /db_xref="GeneID:13385798"
     CDS             1371378..1371695
                     /locus_tag="LDBPK_303780"
                     /old_locus_tag="LDBPK_303790"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2, putative"
                     /protein_id="XP_024329254.1"
                     /db_xref="GeneID:13385798"
                     /db_xref="GOA:E9BMC1"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9BMC1"
                     /translation="MQYLAAYALVALSGKTPSKAAVEAVLKAAGVAVDASRVDAVFQE
                     LEGKSFDALVAEGRTKLVGSGSAAPAAAASTAAAAAAVVAEAKKEEPEEEADDDMGFG
                     LFD"
     CDS             1371378..1371695
                     /locus_tag="LDBPK_303780"
                     /old_locus_tag="LDBPK_303790"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2, putative"
                     /protein_id="XP_003863090.1"
                     /db_xref="GeneID:13385798"
                     /db_xref="GOA:E9BMC1"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:E9BMC1"
                     /translation="MQYLAAYALVALSGKTPSKAAVEAVLKAAGVAVDASRVDAVFQE
                     LEGKSFDALVAEGRTKLVGSGSAAPAAAASTAAAAAAVVAEAKKEEPEEEADDDMGFG
                     LFD"
     gene            <1371973..>1372641
                     /locus_tag="LDBPK_303800"
                     /db_xref="GeneID:13385800"
     mRNA            <1371973..>1372641
                     /locus_tag="LDBPK_303800"
                     /product="ribosomal P protein AGP2beta-1, putative"
                     /transcript_id="XM_003863043.1"
                     /db_xref="GeneID:13385800"
     CDS             1371973..1372641
                     /locus_tag="LDBPK_303800"
                     /codon_start=1
                     /product="ribosomal P protein AGP2beta-1, putative"
                     /protein_id="XP_003863091.1"
                     /db_xref="GeneID:13385800"
                     /db_xref="UniProtKB/TrEMBL:E9BMC3"
                     /translation="MALQENRDSYKVKAFSLSEFVQQCSDCHQLCLEKTARVVENRSR
                     APRGWEALFDSVAEERRSEDLDLCESRCRYMQATCPSQDRVQQYEEALAAASLKPKKR
                     TPPNSSVLQDASRCEHAVEVFSNVLFALAHKPSKVSFPTKDLKAGGTNDAESHAEAPT
                     EAHRKVLEGSKSMDNDIWRRWSKLRQERIGSNAQDITSSTGSSSLPDTAAASAGSSGT
                     TPKW"
CONTIG      join(FR799617.2:1..1374157)
//
DBGET integrated database retrieval system