GenomeNet

Database: RefSeq
Entry: NC_018258
LinkDB: NC_018258
Original site: NC_018258 
LOCUS       NC_018258            1531288 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 31.
ACCESSION   NC_018258
VERSION     NC_018258.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 1531288)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1531288)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799618.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1531288
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="31"
     gene            complement(<2794..>5106)
                     /locus_tag="LDBPK_310010"
                     /db_xref="GeneID:13389995"
     mRNA            complement(<2794..>5106)
                     /locus_tag="LDBPK_310010"
                     /product="5-methyltetrahydropteroyltriglutamate-
                     homocysteine S-methyltransferase, putative"
                     /transcript_id="XM_003863044.1"
                     /db_xref="GeneID:13389995"
     CDS             complement(2794..5106)
                     /locus_tag="LDBPK_310010"
                     /codon_start=1
                     /product="5-methyltetrahydropteroyltriglutamate-
                     homocysteine S-methyltransferase, putative"
                     /protein_id="XP_003863092.1"
                     /db_xref="GeneID:13389995"
                     /db_xref="GOA:E9BMC4"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:E9BMC4"
                     /translation="MHSLVTTHTLGFPRVGGQRELKKALESYWRGDLTEAALRQVGSD
                     LRKRHLQEQNERGVTLLPVGDFAWYDHVLTTSLMLGNVPPRHRAGADAAVDLDTLFRV
                     ARGRAPTGAPAAAAEMTKWFNTNYHYIVPEFTSASAAFSVSWPQLFEELEEAKELFNA
                     ERLKAVVLGPVTYVYLGKVKGEEPFDRASLLPKLVPVYAEILKRVAALGVTWVQIDEP
                     ALVLELDSSWRSAYQETYRGLRAAIGTDVKLLLTTYFESVSHHLPLIASLPVNGLHVD
                     LSLQTQSALDVERALPEDWVLSAGVVNGRNVWRSDLLDAYHLLASLRKQSPRRALWIG
                     TSCSLLHSPINLECETGLEPVVKEWLAFAVQKCGELRLLADAVITESEAAVAAYTAPL
                     RARQQTEGVVRKEVRERVAGLTAADACRLDPFPQRWVVQQEKLKLPLWPTTTIGSFPQ
                     TSEVRAQRLAYKKGRVNKETYESQLKVHIAYALQQQEDIGLDVLVHGEAERNDMVEYF
                     GEQLEGFAFTQNGWVQSYGSRCVKPPIIVGDISRPHPMTVSWAAYAQSLTQRPVKGML
                     TGPVTILCWSFVREDLSRQSVTEQLALAIRDEVCDLERAGIKVIQVDEPGLREGLPLQ
                     RSKWEAYLDWASRSFRVSTSGVAPQTQIHTHMCYAEVNDVIKTIASMDADVISIEASR
                     SDMEPLTSFADFTYPNAVGPGVYDIHSPNIPTTQSIVDLLLKATQHLPVRQLWVNPDC
                     GLKTRTWDECRAALQNMVAAATELRRTKPQ"
     gene            complement(<7250..>8194)
                     /locus_tag="LDBPK_310030"
                     /db_xref="GeneID:13385815"
     mRNA            complement(<7250..>8194)
                     /locus_tag="LDBPK_310030"
                     /product="aquaglyceroporin"
                     /transcript_id="XM_003863045.1"
                     /db_xref="GeneID:13385815"
     CDS             complement(7250..8194)
                     /locus_tag="LDBPK_310030"
                     /codon_start=1
                     /product="aquaglyceroporin"
                     /protein_id="XP_003863093.1"
                     /db_xref="GeneID:13385815"
                     /db_xref="GOA:E9BMC5"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:E9BMC5"
                     /translation="MNSPTSTPPACYDAEVQLYMDKEDPEGVPIQNQMHEEEQGQLEG
                     KRNFTSQNRWPLYKYRWWLREYVAEFFGTFFLVTFGTGVIATTVFHAGNAASYQSNSS
                     YMAITFGWGFGLTIGLFLSMAVSGGHLNPAVTLANCVFGAFPWIKLPGYFLAQFLGGL
                     VGAANTYGLFKSHFDDAQKALLPNETMASKYSGIFATYPNVANTYAVWSEVFNTMALM
                     MGILAITDPRMTPAVNYKPVAIGLLLFVIGITSGINSSYGLNPARDLSPRILSAMLWG
                     SEPFTLYSYYFWIPLVAPFVGALLGMFLYVFFIIPPNF"
     gene            complement(<9160..>12318)
                     /locus_tag="LDBPK_310040"
                     /db_xref="GeneID:13385816"
     mRNA            complement(<9160..>12318)
                     /locus_tag="LDBPK_310040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863046.1"
                     /db_xref="GeneID:13385816"
     CDS             complement(9160..12318)
                     /locus_tag="LDBPK_310040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863094.1"
                     /db_xref="GeneID:13385816"
                     /db_xref="GOA:E9BMC6"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BMC6"
                     /translation="MEQDPTSVCRICQADDAPIIRPCQCEGTMAYAHPYCLAEWIASR
                     GELSCEVCGTAYTLQVAIEDVPPLTSLRGLQLAANLLVARPLRRLCGSLSTPLQVLVC
                     CLVVLFASTMMWHSCLTHVMLRHRAPAGLPVLGGLFYVLGALITAVPVALLWVFEQFR
                     VWVFLHEDYVVGLPPETPMQPPANAVQDDAATSALNEAFTRCNAESQSASRSRYLSAT
                     EAQISKDATLQLLKAKVRASRGPAQRLSSWNFGPARYAAKVLFVHMMGVSAVVLGHVT
                     LSTLESLCHGAAVLCRRLLPPAYPSLHLHAATAVTSAVVPPYVYWVAASVVGLMEWPL
                     ILRAAARCRRVADGRLSRSLFLSSLFTRSAASLLALFLAWAIIIPVIVYACLFPFFVE
                     GDLAVLMERRDAWQVLRTEHLLPLRCDSATRASAFAVKPLVQPINVARALFTVLPDVW
                     RGVSPPLFDAATCGAAVSCPSAHPSPASLAEFMWYSAGVLIRISTFSTWLTLIGSMQT
                     TLLWLLTGTFAVLSPYTLVAQDFAENEFFFAFLRLHGGGFWRTLLEVPLLVAVYTVTV
                     GFGAFAGLHHLFPETLPKSLTYLPLYSPEKQDMHFHFLYCWLSILKRLHTLVRRWLSN
                     CFLYSNDNTPEMRQRGSQVVERAAYAVCLVGANMLIGAAVEWASWNVWFPFFGFAFSI
                     VRVLQHGGNLNAAFPQLRRGAQNLKMQAVMLCFYGVSVDFTRVDTCMCRRLVHVKSSR
                     MVPELRQRAGEKNDTSLLLFLSSLADFPGDGVVVCSRDTLRRLTTETAQYLATLPRLS
                     AAAILAVAAPLVVCSQWHLNYVDRLAADYVALPFWFCLLLRWATGALAVTVWVLAEGA
                     LLRTSLFHRYLEYAPQLIQGPPSLEAVHAVLLPSVLHGGLVRFVIGALTCLSDGNLLP
                     TFGQMSLLAALLLLGLSHRTMQLTNADWGRLARFQIHHIIIPLLPGHVAPPAPPDPTG
                     DAAQPVARNEDDGAALPPQEPQMQQAPQPPPAHDVAAPKPQRAARLRARFARWMASQT
                     ASDVVLVAYPRSPAPQSALTGS"
     gene            complement(<14356..>15996)
                     /locus_tag="LDBPK_310050"
                     /db_xref="GeneID:13385817"
     mRNA            complement(<14356..>15996)
                     /locus_tag="LDBPK_310050"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863047.1"
                     /db_xref="GeneID:13385817"
     CDS             complement(14356..15996)
                     /locus_tag="LDBPK_310050"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863095.1"
                     /db_xref="GeneID:13385817"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BMC7"
                     /translation="MSRRKSQREGDTENVNAEDDERHPRPTSCGNGAATEKSWMNSYW
                     DNMMNEEMDMSHVPIFLPWRIGLFLLTSTITQNMNYVLGSFATTNYFSWTTAQQKQFY
                     SLCYNMLYLGPVFGLIVDLIRVGRERFRPVIIIACVINAIVCFVCFATKNIENQYSSM
                     LVLAWIMQVATMFIYMPMNAVVINYGNRLVESSHETSARIGGLMSQAMVWRTAGSLIQ
                     TIFYQFAYGDAMKPYVNYRWMCLIAGICCCVLILQVLFLTKRYYYTDYRRAAIRTSEP
                     VVFYRNTLNMGKQAISTRKEAFGGRFMFILCFTFIYFMLPDALYNTKFSFEYQYTETF
                     SLGLRQANSILGSLGALLGALAYALWMYFAQHSEASHGRMFRANPFIICLAGCSAWAF
                     GTFFHFWGVMGSTNGKFNYNVFIPIESVVVSACLRFAFMPTLSLAAMQAPRFYETAAF
                     QLYSVSVSGGGVVSTAVTVAFMSSLGVTEVNGYWKALPLFMLFQFVPMVIAPTLPKFR
                     EDETLPAAGENDESLEADQAQWREPSTYSTKLADARVA"
     gene            complement(<16611..>17300)
                     /locus_tag="LDBPK_310060"
                     /db_xref="GeneID:13385818"
     mRNA            complement(<16611..>17300)
                     /locus_tag="LDBPK_310060"
                     /product="cyclophilin, putative"
                     /transcript_id="XM_003863048.1"
                     /db_xref="GeneID:13385818"
     CDS             complement(16611..17300)
                     /locus_tag="LDBPK_310060"
                     /codon_start=1
                     /product="cyclophilin, putative"
                     /protein_id="XP_003863096.1"
                     /db_xref="GeneID:13385818"
                     /db_xref="GOA:E9BMC8"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9BMC8"
                     /translation="MALRFSCALVAGSAVHSYLASSSANAAPASKPYLTPYTTNSRNS
                     RVFFDVAEQGGSSFFGMATQEPIGRIEFELFDDTVPVTARSFRELCRGTSSTSPDGKP
                     LTYKGCAFHRIIPDFMIQGGDITKGNGTGGCSIYGTRFKDESFDGKAGKHKGPGILSM
                     ANAGRNTNGSQFFICTIACPWLDGKHVVFGQVLHGYEHVKKLESYGTPHGKPSKTVLI
                     SDCGVVKEMEL"
     gene            complement(<17856..>18257)
                     /locus_tag="LDBPK_310070"
                     /db_xref="GeneID:13385819"
     mRNA            complement(<17856..>18257)
                     /locus_tag="LDBPK_310070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863049.1"
                     /db_xref="GeneID:13385819"
     CDS             complement(17856..18257)
                     /locus_tag="LDBPK_310070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863097.1"
                     /db_xref="GeneID:13385819"
                     /db_xref="UniProtKB/TrEMBL:E9BMC9"
                     /translation="MTNFVRKGAAGRVNAARLYAFNKTLKKDALRERTYWEENKDTHP
                     INRWSYRRWKERNEELSMFENKLSKVPVDQKFKIKKLLTVANVSVIGPIVLVVYFTFC
                     YFRYRWWGITPIDGTSAIARAIQNLPRPPGY"
     gene            complement(<18603..>21455)
                     /locus_tag="LDBPK_310080"
                     /db_xref="GeneID:13385820"
     mRNA            complement(<18603..>21455)
                     /locus_tag="LDBPK_310080"
                     /product="helicase-like protein"
                     /transcript_id="XM_003863050.1"
                     /db_xref="GeneID:13385820"
     CDS             complement(18603..21455)
                     /locus_tag="LDBPK_310080"
                     /codon_start=1
                     /product="helicase-like protein"
                     /protein_id="XP_003863098.1"
                     /db_xref="GeneID:13385820"
                     /db_xref="GOA:E9BMD0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018306"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BMD0"
                     /translation="MLSRSSCRLQTIGFYVAQHPWLKAAGFVKIGYSTCLETRLAMAS
                     FTTCFTPEWHYVSVFECQTSKEALLLEQSVLFCLSAKRVEHRELIRLSEDEVTETAAV
                     LARKLRLSVVQRMRPHYGGTLDAASSADPRQRPRRHTFTGLKATVADEDPDAAPPSPA
                     MVSTTIAPYREVLDGVKAGMHTPHSSLHEDVYPAVSKGEEDEEGLCSGDFSFLSTWID
                     HNDYSLDVLRPYQQEAVARLMAELRERKKAVCQMACRCGKTPVAYHIIQRTLQEGSSG
                     RVLYLVPGLSLLRQTVRKLVAYGLQDTPLLLIGSDPLPVVLSGNKCQSMTTNPDVIRE
                     TILGNPKVVVVSTYHSSPLLKELNIFQLTVFDECHRVCGSAADTAFNTVLKLPLHGQR
                     LFLTATPTYDTPIKMSDTGYFGGIAYRYYLREGINDGYVNPFSVRVVLGGKMSHMNPY
                     LFEAMRMVDKMLVFCRDIAHALKMYEELMAETPPSDVSAFSVLIAHSRMGAAAVAHAL
                     QSFTTAKRCLLLNVRLFQEGVEIPDLNAVFFAAPRYSSRDIIQSICRPLNRMEGKPPS
                     FVFLPAVYDRRHAADHPINLQSFSTLIPFTDALMDEDPKLFEYMIDPQKKSYDIDVVG
                     VRSLRLTSEKLHRFVLPAIRRGVRYSTRDTDRLHRAARLPWKSIFEEMKRIVYDCNRY
                     PKTNDAWVVGGTPVSMNMFYQYVRRGYKMYERGDPTYLQVHQLRDLESLPQWKRYGVH
                     GPYPWKECLQTLERYLRAHKTVPPLDIHKGGYVGLDATPFERLAGCLMNVNQADSRLQ
                     VGLPPEKQADLDRLCAAYRLRWRKRRASSGAIVKNDVTMITQSYMQFKLLYENADKVP
                     AFQRYLHLHFPGYPQKHVRMETLDNLRKGIVPPRRAQQPRQEKRVRKRKGKQAASAAA
                     KGRTVMCRICREHVSVLKWESHLSSKAHLRAQKTLS"
     gene            complement(<23181..>23876)
                     /locus_tag="LDBPK_310090"
                     /db_xref="GeneID:13385821"
     mRNA            complement(<23181..>23876)
                     /locus_tag="LDBPK_310090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863051.1"
                     /db_xref="GeneID:13385821"
     CDS             complement(23181..23876)
                     /locus_tag="LDBPK_310090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863099.1"
                     /db_xref="GeneID:13385821"
                     /db_xref="GOA:E9BMD1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BMD1"
                     /translation="MMQRPHYDAQGQVPQYSRASYNDGGYNMSRHMDGIPPQAYNQPP
                     VNYYQPPQVYPMGNPMYNVPQGYPPAMPGYRGGRGRGGWYYPSAGSGGYNNMRGGFRG
                     GRGGLPLRRKKPFVGGTLETQREWERQTACCFNLQGSCKFGDGCRFLHDDVKGRACQF
                     GAKCRVHGTAKDAEAEAPAKEDAPKKNEKPGESTPEKTEEKTVAKKEEKSAEKAPEKP
                     VADKEVEDAEKKE"
     gene            complement(<24586..>26064)
                     /locus_tag="LDBPK_310100"
                     /db_xref="GeneID:13385822"
     mRNA            complement(<24586..>26064)
                     /locus_tag="LDBPK_310100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863052.1"
                     /db_xref="GeneID:13385822"
     CDS             complement(24586..26064)
                     /locus_tag="LDBPK_310100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863100.1"
                     /db_xref="GeneID:13385822"
                     /db_xref="UniProtKB/TrEMBL:E9BMD2"
                     /translation="MSRAHRDHTWMKNHPLEGDDIVAGLYNILAKRNPKTMKACRGIR
                     IPDTVVFEHNFPRGWYTTDMKAKEVVRKQGKDLDANTIEHGFTQDLCDGSPIAATYLC
                     TTEQTTDDGETEVNTLVEVFTRDTLAAFLARKVKPDGILQKFILPKGYQNSVIKVVWS
                     PRVCMVQRRTNKYRIFDRKRAERDPFSITVTYDGPTFLSDEGSVSGNIAIEVKQLCGN
                     IVQHFYYTEHKYITRMVLYFKGDQRDRLWLLWCGSLRVSDRNTPSEMPVNLITNFGEP
                     SMADNAFDEEELLRSADEAYLRLTNDEMFYETYMKRMGCRGAAYSEAAAQGDKPSSSS
                     ADGQQEGRASSGAAADAFDWSGLPSLAVETRDRILLEKKSMCCLFEDLFYHARNHFLT
                     RRAEPYNMEIPTDAADALTENGVVDLMRTLRLPAKVQESTASAHMCYVIDSVSRQPLT
                     QLADKAQVWIQTYFDTKLRRLQQAVLAFAGDEDALRSDVMEL"
     gene            complement(<26587..>27681)
                     /locus_tag="LDBPK_310110"
                     /db_xref="GeneID:13385823"
     mRNA            complement(<26587..>27681)
                     /locus_tag="LDBPK_310110"
                     /product="O-sialoglycoprotein endopeptidase, putative"
                     /transcript_id="XM_003863053.1"
                     /db_xref="GeneID:13385823"
     CDS             complement(26587..27681)
                     /locus_tag="LDBPK_310110"
                     /codon_start=1
                     /product="O-sialoglycoprotein endopeptidase, putative"
                     /protein_id="XP_003863101.1"
                     /db_xref="GeneID:13385823"
                     /db_xref="GOA:E9BMD3"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:E9BMD3"
                     /translation="MKRTLSLGIEGSANKIGVGVVDQSGTVLSNVRETYITPPGTGFL
                     PRETAIHHSQHVLQVVQRAMHDAAVTPADIDIISYTKGPGMGAPLTVGCTVAKTLSLL
                     WGKPLVGVNHCVGHIEMGRVVTKSENPVVLYVSGGNTQVIAYADHRYRIFGETIDIAV
                     GNCLDRVARLLDISNDPAPGYNIEQKAKKGKCYIRLPYTVKGMDMSFTGILSYIEQLV
                     HHPQFTDPGVCEVSKKRRKAAPSLASTPVPPGETFNTDDICFSLQETIFAMLVEVTER
                     AMSQIKASDVLIVGGVGCNKRLQEMMQLMAAERGGRCFDMDQRYCIDNGCMIAYAGLL
                     QYLSGSFTTMAEATITQRFRTDEVYVAWRD"
     gene            complement(<28831..>31188)
                     /locus_tag="LDBPK_310120"
                     /db_xref="GeneID:13385824"
     mRNA            complement(<28831..>31188)
                     /locus_tag="LDBPK_310120"
                     /product="FG-GAP repeat protein, putative"
                     /transcript_id="XM_003863054.1"
                     /db_xref="GeneID:13385824"
     CDS             complement(28831..31188)
                     /locus_tag="LDBPK_310120"
                     /codon_start=1
                     /product="FG-GAP repeat protein, putative"
                     /protein_id="XP_003863102.1"
                     /db_xref="GeneID:13385824"
                     /db_xref="UniProtKB/TrEMBL:E9BMD4"
                     /translation="MIAPFSLALCALFFIAVSRAQDVEQLVPNSTSQCYPSIDLGWSA
                     HVGSSVYATPRIVDLAHDGHKEVLIPTFSQFLEALDGPTGEDIPGFPFMHPRMKTYAS
                     PLPVDLNGDGQVDWLVALYSGELVVFGQDGKVQGYLQVPPLAMKRNWVKDNLPPQQAA
                     TVRPGTPLKTGTVLEDILKARRMDDLTLTSTEVLDQRRRSSIVQRHHAPTAAAVKSVE
                     YDTHPKGAELRATEDKPDQWNGDDALDIDDDEMELPWEKAEVEVGPNSHLSPEARASL
                     DLLFHPELYQTAKRATSADEATFEGRNLRQATSIAFGEDEIKVDAHILSTPVVTDVDQ
                     NGDLDVILHVSYFFGEDVIAEQPERFAGGVDPHDFVATAVVCLNLVTGETRWARLLHA
                     STKNSTNAAYALSTPLVINADEDRSMEVFVSTSLGFVFGFTADGNTLDGWPVLLGPLS
                     ASPTAEDITGDGTLDICIGDTEGKVRCYNASGSVTLEKDVIGGVADRLTFGDVDGDGV
                     VDIVFGTTSGLIYALRGTDGAVLPSFPIVTGGSIVAPALLLNLNGMLYSNDLDIVVPS
                     HNGRVYLLRGSSGCVQTIDIDEKSSSMVLADDVLGNGQMDLVVTTIKGGVYVFQTSTP
                     YTAMNAWPSKTKGVNGFSASGNYIGIAISPNFRTFRDIQGDTFNVEFTIYDSRPVSPK
                     RSYTVEITVGTRIRLYRERFHKPGTHIVKVRAPLERMYSSLNVALTLPNGQSFTDSIS
                     LSFNMHFMAAIKYTLIVPFLAVSAALMLVHKRHEIIEPEAVQYLF"
     gene            complement(<31620..>32003)
                     /locus_tag="LDBPK_310130"
                     /db_xref="GeneID:13385825"
     mRNA            complement(<31620..>32003)
                     /locus_tag="LDBPK_310130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863055.1"
                     /db_xref="GeneID:13385825"
     CDS             complement(31620..32003)
                     /locus_tag="LDBPK_310130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863103.1"
                     /db_xref="GeneID:13385825"
                     /db_xref="UniProtKB/TrEMBL:E9BMD5"
                     /translation="MLRCLGLLLAKPPAAPRRSTIHATSSCKKGKDRFDLFHALQKDR
                     QRIRHNRTLPWRQRLDQLRVYPWKLFLAFMMFWSWLGTYAVPYLKGMSAGELPSVGQG
                     RLIPAEVRAKATPTPQFAHLKERKL"
     gene            complement(<32503..>34980)
                     /locus_tag="LDBPK_310140"
                     /db_xref="GeneID:13385826"
     mRNA            complement(<32503..>34980)
                     /locus_tag="LDBPK_310140"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863056.1"
                     /db_xref="GeneID:13385826"
     CDS             complement(32503..34980)
                     /locus_tag="LDBPK_310140"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863104.1"
                     /db_xref="GeneID:13385826"
                     /db_xref="UniProtKB/TrEMBL:E9BMD6"
                     /translation="MSKAATRVKRFDEVDSDSDFELREESSSVKVMPTVSFKTATATT
                     DSDSISFQSDHDHSQHLENVVAPATNRPEESPLPAVHPTKSLAPALKQASFVAVAKRA
                     PPASPMPAPVVNVKPGATEKPPQQQKQQSSAPPVSVPAHKRSAAESAVALAAPAASTP
                     IERLSCASLPAQPTPLAMPTEGSVSSPSVIPFCVTAHASRVDPMPVHDDDDEDQASDE
                     FVQHVLPLPPRQAAPRQPPPSSTTSQVWANSTNGVADTSRPQLSAADNATEELLVRAQ
                     LRLEERRRMSMPSQRGCRQLSPWRSAAPNPVNTLFRESLPRPSVNHISPTRSVDPRIR
                     RLQQENARLQDEVAYLGRENQKLRGVQRSADASEAVRLQLTVDMLRKELESKQLGFQR
                     TLDATFAELKAAQRQIEETVEQCEGYQSAAEQYKQLYSDKQKEMEKVKTQLQSLLYDV
                     NAMEQHQRSMESEYADKVASEREKAERAVALAEEVKRQRDHLQFLNTQMRNEVSAAVE
                     AKRQAVDQAAGANDTARRDRADYEQRIQQLNEDIAHLRKALADKDRAHEVQLCEAQQA
                     QAVLQDRLKDHAEEQQREAERNRRTLEAAKEDHKRALQQERMRRVEMEERLRWMEEEG
                     RSTQSRYTASLSAEAENRVRKIRDEMQVERLAREAAEREAARLATEAEQLRESVTYYQ
                     QESQRMSTNLAQSEQLREKTERQCASLTHALEDMMAQEEAHAREIGQLQEAMSAAAQY
                     GPAVAADRGPDADGIVSDLQQLSDENERLTRECTRLAEERNTLIDENGRIAEELLKWK
                     HEMRQYVASHVRTASSQRGPLNSVPAS"
     gene            complement(<35661..>37037)
                     /locus_tag="LDBPK_310150"
                     /db_xref="GeneID:13385827"
     mRNA            complement(<35661..>37037)
                     /locus_tag="LDBPK_310150"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003863057.1"
                     /db_xref="GeneID:13385827"
     CDS             complement(35661..37037)
                     /locus_tag="LDBPK_310150"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003863105.1"
                     /db_xref="GeneID:13385827"
                     /db_xref="GOA:E9BMD7"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BMD7"
                     /translation="MAEIKVKWGKENLTMEVDLGSTVGAFKEALKAKTGVPVEKQKLM
                     GLKPSMNKDDATLSAAGLVTGKTVMLIGSAESTAAVPTVQAAVVEANETGGYTATATT
                     SNGLKNIANTCYLNSALQMMRSIPEIREVLEAYRGDNALLQQLAAVLQLLESTKDAVM
                     PLQFWTTLVQTNPTFGERNEHGGFMQQDSQEVLNMLLQAVNSVLPKKYAHLFEGKLHQ
                     TLTCVDDPADKGKESDVPFTMLSCNITGEVQTLEAGLEHAFDERFTAPCEALQKDVAQ
                     FTRVSKLTEAPEYVFVHMVRFSWRGDIQKKAKILKPITFPFILDTTIISTEALKAAQK
                     PVREGIRERRDKELERRRRPRTEEKPSPVDKPQEEEKVPLALKNESGYYDLCGVISHK
                     GRSADGGHYVYWGKKADKWLVYDDEHVAAVSEEDVKRLRGVGEAHIAYVLLYRSRDPV
                     TRTPVIPL"
     gene            complement(<37702..>38670)
                     /locus_tag="LDBPK_310160"
                     /db_xref="GeneID:13385828"
     mRNA            complement(<37702..>38670)
                     /locus_tag="LDBPK_310160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863058.1"
                     /db_xref="GeneID:13385828"
     CDS             complement(37702..38670)
                     /locus_tag="LDBPK_310160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863106.1"
                     /db_xref="GeneID:13385828"
                     /db_xref="UniProtKB/TrEMBL:E9BMD8"
                     /translation="MRNEGGAVTKALARSLYRRVLKLVSVAEQPHTQRIVQTQWVEFV
                     PSEVWIAPGDELRHIVRRSFEAPYTPAAVANAFNFLKEAQNSLFSIRVLAEWERLEGQ
                     DHWDLYDGMALMSAALYGACVGINFHQSFESCIKDYQVRIRSYVHSIAKSVQERIEVR
                     SLEAGHVEDLNRFMKLVREASALERREAKPEDFSLVSLLQNRCASEYVLNIIVTFVLR
                     ALDIHSTLVGADLSFRWVRVMPRHNASPIFASWTYGAMRRREVERLIRTADTHWYRSV
                     PWDALQRKSVVCALLRRQLGCLPASPDTSAKQIKSSCKKQLLFLLS"
     gene            complement(<39588..>43133)
                     /locus_tag="LDBPK_310170"
                     /db_xref="GeneID:13385829"
     mRNA            complement(<39588..>43133)
                     /locus_tag="LDBPK_310170"
                     /product="DNA-directed RNA polymerase II subunit 2,
                     putative"
                     /transcript_id="XM_003863059.1"
                     /db_xref="GeneID:13385829"
     CDS             complement(39588..43133)
                     /locus_tag="LDBPK_310170"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II subunit 2,
                     putative"
                     /protein_id="XP_003863107.1"
                     /db_xref="GeneID:13385829"
                     /db_xref="GOA:E9BMD9"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:E9BMD9"
                     /translation="MAQDELLDLEDPDIVLDDGIDDENPNDDLDSEDIWEVISSFFRE
                     KGLVHQQLDSYNDFLMRIPKMIESMAVIPRQDDQYDPGVTMEEQRDQPRLVLQDVVIG
                     NPSHQTHSYFAGGPLPPLFPNECRLRDMTYDAQAQVTLGVELYHPHADTPHDTFLRNV
                     ELGRIPIMLKSMRCNLSGKDEDELPRLNECPHDQGGYFVINGTEKVLIAQERQAANHV
                     YTFSRQKGLLCEVKSIVEGSLNKPRTLQIIMQYKNKGPGSGFENLMCRVAQMDETIPL
                     FVLFRAMDMVADKEILQTVVPDLKDTAMLELLRGSMSDASTLQIFTREEALGYIGRRL
                     GKQDAMANLQREAESLLMRDLLPHMGTDPSANRTKCLYMGYMVHKLLLVALGRHEETD
                     RDFLGHKRIDVAGTLLTVQLQTFLAQVRKEMIKTLQDHAANPRGVFSFGRVIHSKLIT
                     DGLRRCLATGNFGDLKTGNIKTGVAQTLNRLTYSSSLSNLRRIQNPIAASSKATRPRN
                     LHCTQWGYICPVETPEGGSIGLLKNVALMCLMSRGTDHAEVVQAVQARIDGFRTIGLE
                     DTADVRVARVFVNGTMIGVDRNPERLLHDLRTRRRNGELSNEVSIVRDIRDREIRVFS
                     DAGRCLRPLFVAENCHLKLRKSGMRNLLVSEKAGGKKSISWNTALKKGYVELIDCEEE
                     DSLLIAMTPNEVEKNYYYSHCEMDPSMILGICASIIPYPNHNQSPRNTYQSAMGKQAM
                     GIYASNFNMRMDTTAHVLFYPQKPLVRTKAMTYMHSNDLPAGHNAVVAISCYSGYNQE
                     DSIIMSRSAVERGFFRSAFWRSFKAKEERQKRDALETFENPDRELCRVKRADYSKLDT
                     DGLIKPGMRVLGGDVVVGKTIPLPEADLEKLTTGNTKITKRDASITSRTTEKGVVDKV
                     MLTMNNNDRFTKVKIRTIKIPNIGDKFCSRHGQKGTNGIQFRQEDMPFNRDGIVPDLI
                     INPHAIPSRMTVAHLIETLAGKVACYKGGEVYATPFCSVVVDDFGKALHALRSQRYGN
                     ECLYNGHTGLPLDHLIFFGPTFYQRLKHLSGDKIHARPRGPLQPLVRQPTEGRAHEGG
                     LRFGEMERDCMLSYGASQWLRERLFRVSDYYTVHVCNMCGTICVADTKLNRYQCKGCE
                     NDTRISQVLMPYACKLLFQELMSMTILPRLGTGPL"
     gene            complement(<44890..>46416)
                     /locus_tag="LDBPK_310180"
                     /db_xref="GeneID:13385830"
     mRNA            complement(<44890..>46416)
                     /locus_tag="LDBPK_310180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863060.1"
                     /db_xref="GeneID:13385830"
     CDS             complement(44890..46416)
                     /locus_tag="LDBPK_310180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863108.1"
                     /db_xref="GeneID:13385830"
                     /db_xref="UniProtKB/TrEMBL:E9BME0"
                     /translation="MPKHSRRELSPPLPKTGMIGAAMECLHAVLHEVTLQQQALQAAI
                     SMQVKDSCAAGSTRMYTFLETSRHYLRYVIIFYVLLMAALVVLVADLSGCLVTSVATA
                     AGIRHLVLANVPGTAVVPLHFNALPFHEDDWMRHLPEDTALRDFILPDRETRELIQSR
                     TQRVDSLSLLHQHMGQFADAKFSLLSHFVNSHLASTTMHIPRTAASAEVFSPRGGVNL
                     ESLFQLGPAMFNAKGEYTAKVQVVLAKEEVGRVVSLILESAMLFSEDAMAVQSVAQLD
                     VLFTKSTSVTVRTGPLNRSWFVLLLEKVLRFWFCLPVWSYEYLVSALRQQDSAPFPPI
                     DSSREVAVVLEVYHRFTPPLDLQPRLRAMNFTLYQLPDVGAPSRVKVSRLIFFSTVQL
                     TGVARWLTDYPVSTFLLLVAILFAAFAVVSVGSLLGLLAHAYWRWFREQPLESFDEDD
                     SGAEFFASPRDMPATAVKNMAPPSLRRHRSSNEFYDSLDTSQLRRSQSFNYSPVKKEE
                     "
     gene            complement(<47043..>47516)
                     /locus_tag="LDBPK_310190"
                     /db_xref="GeneID:13385831"
     mRNA            complement(<47043..>47516)
                     /locus_tag="LDBPK_310190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863061.1"
                     /db_xref="GeneID:13385831"
     CDS             complement(47043..47516)
                     /locus_tag="LDBPK_310190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863109.1"
                     /db_xref="GeneID:13385831"
                     /db_xref="UniProtKB/TrEMBL:E9BME1"
                     /translation="MEKVLAYLEGTLLDQYLELLPSRWSALLPRLAKRTQRLQALTDL
                     TTVNELESAVEEDFQLATKLLHAEHRIYQEGATLFDGLSQASDLVRHTWRLLANDLLA
                     ELAAKELMLAHWKAAVTTITADTLRVYSHALLVHARVTTARVHHLMALLREEEAG"
     gene            complement(<48152..>50038)
                     /locus_tag="LDBPK_310200"
                     /db_xref="GeneID:13385832"
     mRNA            complement(<48152..>50038)
                     /locus_tag="LDBPK_310200"
                     /product="nucleolar protein, putative"
                     /transcript_id="XM_003863062.1"
                     /db_xref="GeneID:13385832"
     CDS             complement(48152..50038)
                     /locus_tag="LDBPK_310200"
                     /codon_start=1
                     /product="nucleolar protein, putative"
                     /protein_id="XP_003863110.1"
                     /db_xref="GeneID:13385832"
                     /db_xref="GOA:E9BME2"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BME2"
                     /translation="MGKKMATVAAKKKVVPQAAAPAAKSLKKANGTAVVVAVKKTAKK
                     SAMAPKAAQRAPVAKEEEEEEDSSFHYDDAAVNSSHYDGAPDDEDGAGDEENIVFDDV
                     MDGDEEDEEDFDAEIQDDDDFEVKAEKYRRRMLAQRQLADAEQQEDIVTRTAKPTPLH
                     DREQRDNEAQQEEDGAAAVQLLGKTSTAEELRDRIQETVRVLSNFKQEREEDRERGEY
                     LELLRSDLLELYEYSEFLMDSILQLFPPAEAVDFLEAMEKTRPTTIRVNTLKAKRRDL
                     VQALVKRGMNVEPLEKWSKVGLQVFESNVPIAGTIEYLAGHYMLQAAASFLPVMALAP
                     QENERVLDMSAAPGGKTTYIAQLMKNTGVLFANDVSEPRCKSLNANLQRLGVTNCIVT
                     NYDGTGYERVMRNFDRVLLDAPCSGTGIISRDKSIKTSKQHEDIQRASQLQRALLLSA
                     IDACKIGGYVVYSTCSFLVEEDEAIVDFALRRRDVQVVEMGLPFGRPGFTKYRHHRYH
                     DSLEFSRRYFPHVHNMDGFFICKLKKLSDSTTKQQDGADKKLSRAGSASASSSKKRGH
                     ASDDVAELQVGSKRVRLEKGKAVVLAEKAPVKNHKLSVPPSSKTTRSERQLKGKRKPH
                     KPRK"
     gene            complement(<50807..>52264)
                     /locus_tag="LDBPK_310210"
                     /db_xref="GeneID:13385833"
     mRNA            complement(<50807..>52264)
                     /locus_tag="LDBPK_310210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863063.1"
                     /db_xref="GeneID:13385833"
     CDS             complement(50807..52264)
                     /locus_tag="LDBPK_310210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863111.1"
                     /db_xref="GeneID:13385833"
                     /db_xref="GOA:E9BME3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BME3"
                     /translation="MASVPSLPSCPCRYTAELHFAFAPSPFKGSASPVASIMTAVRNA
                     PAVQATTGAGGGSAMVTFFTTTYSKPMPEQSFSVPLNVLPDGLNQLVQNVLGVEGQNF
                     DFLHKDEYIGTTLFRFLQRRGISCEELLNIEYTPALQAKEGNLLPHDDWVSSVRAPYR
                     NNAELLLTGSYDHCVRLWDGDSCLALGSFHREAVKEVALHPVTPASSKIGRKRTRLDG
                     DFMFASASKDGSVAAWKLDSNNSHMQLLGSIQAHTDGVDSVAIAPGDGRLVATASWDT
                     TVKVFSWEQMMEGDTVPSKKAPLVAFTDHSRPVLCSRFSAAHGAARLYSAGHDGHIKC
                     LDTEEAQLQSQFKGDHPINRIAVKPAGNSAAADLLLSACTDNRARLFDTRQKDVVKTF
                     SGPRQWLYSVVWLWDAQEGDAEHSGVSLFAVASEDATVRVYDLRCTNTALLTLDAMHT
                     DGVLDVTYVGQSIIASGGKDNKTRSFALSKEGLLS"
     gene            complement(<54497..>56062)
                     /locus_tag="LDBPK_310220"
                     /db_xref="GeneID:13385834"
     mRNA            complement(<54497..>56062)
                     /locus_tag="LDBPK_310220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863064.1"
                     /db_xref="GeneID:13385834"
     CDS             complement(54497..56062)
                     /locus_tag="LDBPK_310220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863112.1"
                     /db_xref="GeneID:13385834"
                     /db_xref="UniProtKB/TrEMBL:E9BME4"
                     /translation="MVALEREYVLGSFCELRIITSLSSTQLSKVTLRKPVEDDDTSTA
                     ARAEVFGTELIPGVPVHLPPGRSLSIFTSTGCTLSLVAPPTVLQRCYATSLGATWVRS
                     LLDFHSHLERARVEARGRDDVGPRVLFVSDRHHCGASTYVRWLSNFAVRLGYHPLLLD
                     GVLDTPAFAFPGSIALFHAQHCMDIEEEMNLTPALYAQVGQSRVANPRLYQHWVQQLL
                     PNGMEKMARSERCRVGGLFFDFGVVEPHAVEQAEAAAAAVPSVDPTASASPAPAALGS
                     GKTQTNPLDTLLDTIVAADIDHVCVVGSSWLRWKLVQRAWERFGGEGSMGIVQAMLDP
                     RWNVPPEVDCGGGQHFKVFLLDSVELVNSVPVPLLNRQRWLQYFFGTPTSPVKPTLIT
                     LEASQVRVATVGAAAIAAMSTLLPMMDSEDVDRQKADVAAVSFITLQDVALKDRIVAI
                     STATEYERSPDGELHRLPFSVFERRIRHGTVLGFALVESVTPERLTLLVSGCPLDKEL
                     GLCFLLTEEVLKS"
     gene            complement(<56514..>57137)
                     /locus_tag="LDBPK_310230"
                     /db_xref="GeneID:13385835"
     mRNA            complement(<56514..>57137)
                     /locus_tag="LDBPK_310230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863065.1"
                     /db_xref="GeneID:13385835"
     CDS             complement(56514..57137)
                     /locus_tag="LDBPK_310230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863113.1"
                     /db_xref="GeneID:13385835"
                     /db_xref="UniProtKB/TrEMBL:E9BME5"
                     /translation="MEPSSTDGQEPHLAAVEMEGEDQAVMSNDEEDEEEQPNDATVSD
                     TNAASTAASDVDQDGADNDDDAVDEEGDEEDDAEEDEEADDGDDSDEEEERQVYPLPP
                     LPPVHAPSKVHGIATAEVYSIIKELRRQMDDPVEREHAKAMLQGDTDVLLAVAQVLQE
                     AHLLRRATVNDHGVVEEQLVPQPAAARPSLPTGYNSWIVETPANARR"
     gene            complement(<57725..>60304)
                     /locus_tag="LDBPK_310240"
                     /db_xref="GeneID:13385836"
     mRNA            complement(<57725..>60304)
                     /locus_tag="LDBPK_310240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863066.1"
                     /db_xref="GeneID:13385836"
     CDS             complement(57725..60304)
                     /locus_tag="LDBPK_310240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863114.1"
                     /db_xref="GeneID:13385836"
                     /db_xref="GOA:E9BME6"
                     /db_xref="InterPro:IPR012929"
                     /db_xref="UniProtKB/TrEMBL:E9BME6"
                     /translation="MNLDVVDATAEALPLELLNNTNKELTAQLTRFEQQLEERQGGVE
                     DQRRRLQFMKEHLGNVRAEIVNTQSLSETKKRELESEESMCRVMERECARLQQRQTQL
                     ERSAEDVRDRLTSVQDRIFHGNLKIEELKTTLDYNQEELEQWDEARRQKEEDELAIAR
                     YCKLDEAKVKQLTQHIEKLETTVRRQRKQLDEEMLATQHVQGELDRVANEYRKLHDDR
                     SGMLDEWEQVVRTIAERDEAIRIAAEQYADGVAWIQKRQQLKKSLSESLEEAKEETAV
                     INYTIQEREKTSQKLQEAVPVLTQQVQSIQDEVDALREEASRATRDKRAAILQLQETI
                     TEIERRNKELTMTEKRRATVAERLKEEEMAATDLQKQADFIAQLLKDAETASHNVAKD
                     IEQLKTAAFKANQELSDVRAAQTTTLGEISGAQAQGKNYNAKINQLDGESFSQQGVLY
                     NIEFSVQQMEKRVGRAKGERTEEERKELHGKIDLLQATLDELEKQNRILQNQVKRVRE
                     EMRQSTMLIEKLEMTKKRSLEEVLEMDLHCTHDEREEKKLEKQREDLLIKVDTLELQL
                     RRMRNALRAKDAELLTLEEKKRQLEADVAEREAEIEVHHRLLKMEAKLAEEERKRLVT
                     ELLDRQKNLTAVKNRQEVLVGRMDPAQARLSQVQLVIAAAKEREDLQYRGDSLDTRIR
                     RMEKEMLKLEKTIAVIKASNAQYKHKFDKVSDKDEEVQTQKALTTKFKELKSAISRRA
                     LEANDFQATTRNKQEELRALSFEKERVGHTQQQMLQQYEAVTQDILTLRETSVRYDQA
                     IGKAKENVDAAVARDVELVCARERLDNTVAQLLSLSREAGDEVLDVVKQMLAAHQLSI
                     ESA"
     gene            complement(<61186..>62709)
                     /locus_tag="LDBPK_310250"
                     /db_xref="GeneID:13385837"
     mRNA            complement(<61186..>62709)
                     /locus_tag="LDBPK_310250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863067.1"
                     /db_xref="GeneID:13385837"
     CDS             complement(61186..62709)
                     /locus_tag="LDBPK_310250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863115.1"
                     /db_xref="GeneID:13385837"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR013109"
                     /db_xref="UniProtKB/TrEMBL:E9BME7"
                     /translation="MTKAASLKKGSGDKRPREASLEVTAGKPKVETAAVLPKASHGSQ
                     AHPNFFSWLLKTSRGEFFRKYFERKHLVASHGSGEYFASGLPGVVPPVNWSTERMLDH
                     VKTHPSRYGADLDVVKFDPKLKRRVSFRTKGLVDAADLETCMKGGWSVRFLRPNEFIE
                     SNSAFIGCMEKEFNCYCGVNSYWTPANSQGFAPHYDDVDVFLLQLEGEKLWCLYDPPE
                     DVDVLARHSSEDYAPELFPTPKHTITLKAGDVLYMPRGTVHQGKTTLKTHSLHITFSA
                     NQMNSWADFMSRAAQYTVEKLAANKLEWRRALPRSMPQVVGEVNNPVFRDTHGLAALS
                     EKQQEHRANLQTKVREMVAELTLLLTDEGNMDMCADVYAKDTIRKLQPPSRTYSGAAP
                     ASTRLSHASRVRLISRNCMRLLLNVPGEARVYHTGRNSTVCLGGELGELRFEADFAPA
                     IATLLSSYPKTMPVSALPFPGFDDSDDVAENQLLLVETLRDAGLLHVGSSANGNAPS"
     gene            complement(<63419..>66157)
                     /locus_tag="LDBPK_310260"
                     /db_xref="GeneID:13385838"
     mRNA            complement(<63419..>66157)
                     /locus_tag="LDBPK_310260"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003863068.1"
                     /db_xref="GeneID:13385838"
     CDS             complement(63419..66157)
                     /locus_tag="LDBPK_310260"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003863116.1"
                     /db_xref="GeneID:13385838"
                     /db_xref="GOA:E9BME8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BME8"
                     /translation="MRAHQRMEEEQESAQRRHEEAMRTDAEYKQRFETMQEMQAAMQM
                     SHAEFFDKYSRQETLLLNHVVTERLDMPVILDLIEQHDVVFICTDTGSGKSTGVPKAL
                     LELSPDTKVVSTQPRRTATVAIANRVASLRRESVGEDVGYWIRGDKKGDEQTRLWYMT
                     SYTLLLRILENPAELPFTHIVLDEFHERQPDLEVTVALLRLALLNKLSHFKLVLMSAT
                     LNTEDWEEYFAGLRVATYKQSEPEHPIHDYFLEDTCTLLGTDYQAPPQLVSRGVVDKS
                     TVDKHFYLAQNLIFFLNSCSNPVHSILVFLPGRAQVETMSTWLHTQLYHRVDAVPWHS
                     AVNLSEIEAAMKRNIPGRQKVYLATDIAEVSITLPDVVYVIDLVLVKRPKISKELPAS
                     IQYPPLVTQWISRGSVAQRRGRVGRVQQGFYFCLFPAAQITDLPAYSQPPIENSRIDE
                     LSLHCLQVVNNPVAIFSLCHGQPLVEAIASSMNMLTQLGCILDAKDPLSAGERIEEIY
                     SHQNESWSRMIMTAAQAEVMTDIPEYQYTFIGRILQLIPVSPQPGMLVFFGFLTGLES
                     LMILAAAVTSSLSPFSINASEGLQRHFNVARAMEETENVMRDFCCGLRSDIVAVMKAT
                     LLFRVEQQRHCDSVETVRHWCLQKHLSYDKLMAIVDLESHIKYELAEFMPFRSIVEAE
                     KLLEQLDKLALMVAVMTNVAFVAQSLEVTSEGNSYTNSKEMALGIFSDLTAVPDIHSP
                     SCLRWQEGDIIIPVQLNLIFDKLLASFSTAIASPKQFWISLLLFSQRVQYATFSDDEG
                     TFHVFALSYSGKERYVEVDEIAGYVVLEFRRKLSAICEVLRLTHANRLLYEDHFNTLL
                     GSYSLAPLQDLQREVITALVSIFNNLEGMTADEVEHDEDDLDLVSLLSFALPTRAP"
     gene            complement(<68445..>68936)
                     /locus_tag="LDBPK_310270"
                     /db_xref="GeneID:13385839"
     mRNA            complement(<68445..>68936)
                     /locus_tag="LDBPK_310270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863069.1"
                     /db_xref="GeneID:13385839"
     CDS             complement(68445..68936)
                     /locus_tag="LDBPK_310270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863117.1"
                     /db_xref="GeneID:13385839"
                     /db_xref="UniProtKB/TrEMBL:E9BME9"
                     /translation="MLPLLEPFHDWSLIVVLRQSGRFLWCSTVQHYKTCLKAETCAAI
                     AGLDAVVFSFGCAERCGTVPKKLARSYQTSGHLILSTAVSAAEWAERHQGVSGFNELV
                     TAVQRELPSRRSLRLLPPRAGGRDAVLPQRRARARRQRSYVQPPRRRLLWFCCAERCS
                     GAC"
     gene            complement(<69760..>70263)
                     /locus_tag="LDBPK_310280"
                     /db_xref="GeneID:13385840"
     mRNA            complement(<69760..>70263)
                     /locus_tag="LDBPK_310280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863070.1"
                     /db_xref="GeneID:13385840"
     CDS             complement(69760..70263)
                     /locus_tag="LDBPK_310280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863118.1"
                     /db_xref="GeneID:13385840"
                     /db_xref="UniProtKB/TrEMBL:E9BMF0"
                     /translation="MRWARKGAIPPSHHLAQLLLLLHDTSADEHSYKLMLLKRAHSAH
                     TRKQAWRRDLQCAPPLFCGAPTCTRLAWMVVTPAQQRRGLQRCVHRHVGLRFRPALRQ
                     RIHAELLSPLQRQLLRPEIGRVHARGGGACGVGHAAAQAEGHLVELPRVRERTLSAVQ
                     VFGAVGA"
     gene            complement(<71299..>72276)
                     /locus_tag="LDBPK_310290"
                     /db_xref="GeneID:13385841"
     mRNA            complement(<71299..>72276)
                     /locus_tag="LDBPK_310290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863071.1"
                     /db_xref="GeneID:13385841"
     CDS             complement(71299..72276)
                     /locus_tag="LDBPK_310290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863119.1"
                     /db_xref="GeneID:13385841"
                     /db_xref="GOA:E9BMF1"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="UniProtKB/TrEMBL:E9BMF1"
                     /translation="MELKFNLADTLKRLLTRERCEQLDLDGYLVLDEQPFPASVAKEL
                     LHEVQYCFDGIDGGKTPNQVEFLTADGSVKLTKPHIYECDLHNAAVRHQLPLFNAFFE
                     GQLGELVEVLRDRLNCCEDLQPCDTADLASRSVTLKLQANGGGAFPWHYDNPGKPNKR
                     RLTMAVYLTEDWAPEIGGELQMMPFLGPCITVPPKFCTVVLFQSDMMLHRVRPILSHM
                     RKTRYCFTIWFDGALTNSDDDLFLKVQHLDEGAIPFLRRSAVQRTLSRAVYEAEYEES
                     LAACFGADSVALGISLREHHAHLQQLLKHERLRAFLKVLKEYREDLRAA"
     gene            complement(<72875..>73900)
                     /locus_tag="LDBPK_310300"
                     /db_xref="GeneID:13385842"
     mRNA            complement(<72875..>73900)
                     /locus_tag="LDBPK_310300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863072.1"
                     /db_xref="GeneID:13385842"
     CDS             complement(72875..73900)
                     /locus_tag="LDBPK_310300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863120.1"
                     /db_xref="GeneID:13385842"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:E9BMF2"
                     /translation="MMRLLHKCDLFRVVQDSENHLTPATPYGAAVSIATMTVLVILFI
                     GECYGYVSGHQNCHITPSAFKNILDADMQRKVDRLHFSISLPYMPCHRIATETVSVFA
                     HDEQAERDTHISLYHIPYGSYVSNSSAAYISGEVLSGTEHGCLVTGTAPIAAKPSSFN
                     IILKDYRVEDSRKYRPDFQIHHFSGGNAYGDWGVPQVRHQTLEPMSGFKSAHALQEPY
                     FFQFFLQLIPTTVDLAGKDSRVGYQYTAFHSMLRYNGQGRAPGLYFSYKLSPFSMDCA
                     VQYDTLSHFVVNLCAVVGGVYTVAEMVEAGMEWLARERRLREVSARNRRNAEALKNAA
                     GGAPIAS"
     gene            complement(<74866..>77721)
                     /locus_tag="LDBPK_310310"
                     /db_xref="GeneID:13385843"
     mRNA            complement(<74866..>77721)
                     /locus_tag="LDBPK_310310"
                     /product="mitotic centromere-associated kinesin (MCAK),
                     putative"
                     /transcript_id="XM_003863073.1"
                     /db_xref="GeneID:13385843"
     CDS             complement(74866..77721)
                     /locus_tag="LDBPK_310310"
                     /codon_start=1
                     /product="mitotic centromere-associated kinesin (MCAK),
                     putative"
                     /protein_id="XP_003863121.1"
                     /db_xref="GeneID:13385843"
                     /db_xref="GOA:E9BMF3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BMF3"
                     /translation="MHTPKDADREGGSWASKVEAGAHQLRRFFHGAENRAHSALPPLP
                     RLAALNDKGAPHILAQVPFPLSTCADAAGTRSRKDSTAARRHFPNSSAIPSVSTLNRE
                     LNSLSLQFAGMGGGGGGVVAGTPLAAVTLHHRDEPRQASAPGVSRAVLRYERGHSVTP
                     SIALHNSTNSELTRLSELPPICRHRRTSASPLKQTSTAQILPSVSGARAPGGAARRRS
                     PSSPSIPAPASEAHTSLEDKVPLLAAPRIEGEEDVASSPPEHPSPAPRTTANAPVSAP
                     SASPLPLKRADRITAERRERSPSAASAARVSSVANSRCKGRDGRITVVVRKRPLAPGE
                     PGVDCVQVDRAHVRIAVTKQRVDLTSYEESSDYVFDSAFGAEATNEEVYAQSVKDLLT
                     VSLSGGSASCFAYGQTGSGKTYTMIGTDTEKGLYLQAAGDLFERLRPGQQLCVSFFEI
                     YCNSLYDLLNHRHPIVLREDANRRVNICGVSWRTVATVEELWQLVRSGMEQRRTGTTT
                     ANEHSSRSHAVLSLRITDSENPDFTGTVNFVDLAGSERAADTAAHDRLTRLEGAEINK
                     SLLALKECIRALDEKKKHVPFRGSRLTEVLRASFTGNSKTVMIAAVSPSSVNHEHTNN
                     TLRYAFRVKGLSVPSVGPSKARNAPRLYLPAARSRSRAAAAANEPTSAPAVTECSFNS
                     KHTDDAGSPRRPRRARRRRHAYKKAHEPQNEIGISDTTESFTSDTATESPRPRMRITQ
                     RARPHQVGRNSTGSSTSAKRQKMSCLVPYIVESLSQRRTRQRTRKERLPLPRAARSIC
                     ESSDLLLANVSGTDSKSRALAEVVLPHVKGATRHPSSLSSVDVAALEQRLTLQIIAQL
                     RLDLGQQLEEVLMEKDTIIAALRSENERLRQALDKAGKDEQFYGGSPCDGEVQNRPAV
                     LPALLYPSSPSILQEQLSSGASTASVGDEAPLRVLSE"
     gene            complement(<78415..>81834)
                     /locus_tag="LDBPK_310320"
                     /db_xref="GeneID:13385844"
     mRNA            complement(<78415..>81834)
                     /locus_tag="LDBPK_310320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863074.1"
                     /db_xref="GeneID:13385844"
     CDS             complement(78415..81834)
                     /locus_tag="LDBPK_310320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863122.1"
                     /db_xref="GeneID:13385844"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:E9BMF4"
                     /translation="MSHAPVLLDIGSGAYAHQAEVDEVKERMGIHHNYFDCWIFGFLE
                     NKNFNVDETVAKLRRRADFEREQLAAYNVTDWMMENMRKGIIQMIGNDKAGRVTFYVC
                     TARDKPVAARREESRMNFDMFISYGTRLRPETKRCQITMLINQDKASMISNLDMTLQA
                     DIALRIAKFYPGCVDKIYICKMGRLLAAMAKPIFSRLPAIVSDRIIIISDGDIRHGKL
                     LDLFDAEVLPVELGGKNDCNQQGNYDRFATTIRDYFEQLKAAILRGEGVKEWELNCLR
                     SAGYIEEASRIDALKRSIIEPSISLRDQLSIAPHETGRYSPPGTNGSATAQCFTPRSP
                     AYYALDVDDDANLITCGTDSIEMDGLYSPGLIQRNSLTMSRSPLRNLFTDYVNQFTTL
                     ESFFRISLTEMHERQWLQIVQWEMQERRTLLLENGLIQGDKLLAGLPSSVLLVAKGFL
                     WLCLMVTSFYFLLGTCFIALLGVVTLINIFFAILVYPYHVFLYGTAFIVVASQFVIFC
                     SRGFDVARSTFQGRVVQAFRAFGAKALAFQLVIYVGCTIAYFVLFCTMAARYDVLTGL
                     QYSLAYGWIVAVCLIFIYHVLFAFGLRRLRKRSYAHGSRQNHAETTLYLFMEVEMDDE
                     QMEQRFPPAEVMLLTMVAVLSVAMGVAFVTGGGFFFLCAAIVAQSVLLLLCATFTIAR
                     NVSSSSDIIICGVFYATVFWMSTLFTMSQHGWSGHWGSSLLASLFVMLFFVFTGLVSV
                     YGRWKGAVRRWLFRISWLLLLLHLISCVAVLMVSNYRFGLFVLALAVHLLLCIVRTNE
                     ASNKYGVFTISACFTLVLLACCIIGRTGANDVYEGSVSDVFLPNYANRSSTPAAAGRL
                     MLANLAEPPTRTSSMSRGSSVSAQGDTSYAMPPLCLTQFSPTVDVVGMALFTKLGLNR
                     DVAGQDADLARWFPSFKRVPISEEVDSAAMSFDVFREETATVNTTIVTARPGSDLILL
                     IESMAMWIDTYALSFFSFLMPAPYIDRVLPYLAFVQGMVPSRWEASIDKTTSVVRALL
                     TKLRGDHENVFVVGHGPVGSRAAVIGLRAQDNVHSIVFSGPPVILSKFNLNVTARVMA
                     RRMLSVQTMQTVFSTWYLRTASVQIIPCSLGGIRCDRIDATIEELRHLCSG"
     gene            complement(<83386..>86799)
                     /locus_tag="LDBPK_310330"
                     /db_xref="GeneID:13385845"
     mRNA            complement(<83386..>86799)
                     /locus_tag="LDBPK_310330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863075.1"
                     /db_xref="GeneID:13385845"
     CDS             complement(83386..86799)
                     /locus_tag="LDBPK_310330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863123.1"
                     /db_xref="GeneID:13385845"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:E9BMF5"
                     /translation="MKSTYTSLSDLGTVAISHRGEIDEVKRQLDVKHGYFDAWIYGFL
                     ENKKFDVGETVAKLHRRFAMEVSELASYELTDYMRESLRKGIIGEIGTDKAGRVAFLI
                     NTKRDYPQSKHRDEQRRSFDMFVSYGTRLRKENKRCQMVMLINQDGASLFKNVDMTFQ
                     ADIALRISKFYPGCVDKIYICNMSRTLATMAKPIFKRLPAIVADRIQIIDDNDIKQGV
                     LLDLFDAEVLPVELGGKNKCDNEGLWGAYADRVEKYYAELKRAVNERGMTVKDYELES
                     IGIDPGTAHERDAANGVATTTPQADTLVQSVCSFPAQTPSRQSSFYPAARDALQPHPP
                     RGPRASSLGMAGANESDDPELKSLRTCRTEGSSLPSPACDEADKREAGAQETISWAEV
                     VAPLPDSLALFFLEELLRWRTAVENSECGERYKILDSFASGLRTTTELGIRGLDVSDR
                     KWYVGVPYPLRALYRILLVAITLMNMIYFSAALVFCAVFCADVIITLFLGLFAKPSYV
                     FPLGAVLLMVAIQGASLCTRAADCILAVYNHNVIPLFERLGSNWGTVAEVILFFVLVI
                     IQFIIFCVYALSSNPLRGLEVSFATGWFSALFVIVFTHVFFFTGIFASPTTRDADNRL
                     AALPFFLALNFGNAPKEQLRELDTRFMLRTSSYVICGIPLAISVLLGISFLISRIVSL
                     YVATFVATLVAAYMVHYYSDALSNSLSGSLLRFTLWMLTLVWCYVTLAIGLHNHNHRY
                     GVSVIVALVLNGAFVLLAISCLRRPGRSRLLRVSYIIVMAYIFGCWITVFPLVDWRMG
                     LFCLAIMIHNVLNIVFAPRTLIGIHASFLLAAAVMLLGVSCVLLGWYGTTLMTTKAHS
                     RPSDPPNATTLSQLELYHRYPVCTLQLAQDGSFRVVDFALLNEVVSARTNATRSVDFN
                     NWFGTRGVTYSGVVGEFETDGISWEMHEFLLPAAANTTVLVLNNRYAMSSIVAMVGWV
                     DAIALSPLSIFMPYDWIDALVHTTSFTTRLIPFAAVRLVDELRDYVYLKKSQLKTNLI
                     LTGGGVAGGFLSAAAAQSKTQAIVFASPGLLHCSRKLRVSFDDYHSYVLSIGVHYGVL
                     NYIGGQDTTVSQRVLCDASALYCMRPQFFSTALLEACGDAEGRRHVAST"
     gap             89386..89484
                     /estimated_length=99
     gap             90791..90889
                     /estimated_length=99
     gene            complement(<90892..>91533)
                     /locus_tag="LDBPK_270530"
                     /old_locus_tag="LDBPK_310340"
                     /db_xref="GeneID:13385846"
     mRNA            complement(<90892..>91533)
                     /locus_tag="LDBPK_270530"
                     /old_locus_tag="LDBPK_310340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863076.1"
                     /db_xref="GeneID:13385846"
     CDS             complement(<90892..91533)
                     /locus_tag="LDBPK_270530"
                     /old_locus_tag="LDBPK_310340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863124.1"
                     /db_xref="GeneID:13385846"
                     /db_xref="GOA:E9BMF6"
                     /db_xref="InterPro:IPR018227"
                     /db_xref="UniProtKB/TrEMBL:E9BMF6"
                     /translation="MSANRNHNTNHAPYPQRGQGRLAFDNMPEDLPEYGEDGLHMLNN
                     EHSQEHLADEVVVGASDADGKTKGSKKLESPSLTDDGEPAAKGNKQQSAYMDIAQQII
                     EADQRNREDRVWRRRHTTNPVLRALQVIMPYGGIFASAFSIASSTIGGGIIGLPAAFQ
                     MSGMGMAIIFLIVLVIMAIYSFVLLAIVSHKTGLYNWEIIARRLMGRGWDYFVV"
     mRNA            complement(<90895..>91533)
                     /locus_tag="LDBPK_270530"
                     /old_locus_tag="LDBPK_310340"
                     /product="amino acid permease, putative"
                     /transcript_id="XM_003863077.1"
                     /db_xref="GeneID:13385846"
     CDS             complement(<90895..91533)
                     /locus_tag="LDBPK_270530"
                     /old_locus_tag="LDBPK_310340"
                     /codon_start=1
                     /product="amino acid permease, putative"
                     /protein_id="XP_003863125.1"
                     /db_xref="GeneID:13385846"
                     /db_xref="GOA:E9BMF7"
                     /db_xref="InterPro:IPR018227"
                     /db_xref="UniProtKB/TrEMBL:E9BMF7"
                     /translation="MSANRNHNTNHAPYPQRGQGRLAFDNMPEDLPEYGEDGLHMLNN
                     EHSQEHLADEVVVGASDADGKTKGSKKLESPSLTDDGEPAAKGNKQQSAYMDIAQQII
                     EADQRNREDRVWRRRHTTNPVLRALQVIMPYGGIFASAFSIASSTIGGGIIGLPAAFQ
                     MSGMGMAIIFLIVLVIMAIYSFVLLAIVSHKTGLYNWEIIARRLMGRGWDYFV"
     gap             91967..95278
                     /estimated_length=3312
     gap             96146..96244
                     /estimated_length=99
     gap             97853..97951
                     /estimated_length=99
     gene            complement(<98181..>99683)
                     /locus_tag="LDBPK_272680"
                     /old_locus_tag="LDBPK_310350"
                     /db_xref="GeneID:13385813"
     mRNA            complement(<98181..>99683)
                     /locus_tag="LDBPK_272680"
                     /old_locus_tag="LDBPK_310350"
                     /product="amino acid transporter aATP11, putative"
                     /transcript_id="XM_024473484.1"
                     /db_xref="GeneID:13385813"
     mRNA            complement(<98181..>99683)
                     /locus_tag="LDBPK_272680"
                     /old_locus_tag="LDBPK_310350"
                     /product="amino acid permease, putative"
                     /transcript_id="XM_003863078.1"
                     /db_xref="GeneID:13385813"
     CDS             complement(98181..99683)
                     /locus_tag="LDBPK_272680"
                     /old_locus_tag="LDBPK_310350"
                     /codon_start=1
                     /product="amino acid transporter aATP11, putative"
                     /protein_id="XP_024329255.1"
                     /db_xref="GeneID:13385813"
                     /db_xref="GOA:E9BMF8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMF8"
                     /translation="MASGETNPLNVQYGEFPGNQVHEDSLDLRSEFDMEVAQGYDAKC
                     VRGVEDVSSAEAPDPYDFSRYDPRRQIELQDKIRADRVARRLVPANVFQKYFDYLVPY
                     GGLVSTGLNLASSSIGAGIIALPYAFNASGLVMAIIYMFMIAYLTIYSYYLLGQAGTK
                     TGLRNYEQIVRTLLGPGADYFLAFCMWFLSFGGEVSYVISVKDVLTAFLEDADNTPAF
                     LLNIWGQRLLTFLVWLVAMLPLCLPKEINSLRYFSCVAIVFIVYFVIAMVVHSAQNGL
                     RADPRPEIRMFTTGNTAVSGMSTFIFAFLSQLNAYESYEEMNNPTPLRLTLGATISVG
                     IVFVLYFLAGLFGYLDFGTEMTGSALKKYNPVKDVMMGVGYVGILFKLCVGFGLHMIP
                     VRDAIYHCVRVDVHTFAWWKNACVCAFMALLSLVAGLFIPSINVVFGLVGGFSGGFIG
                     FIYPSFMVMYSGNWSLSSVGWFHYLSTYFLLIVGVVGVVWGTASSIYGEI"
     CDS             complement(98181..99683)
                     /locus_tag="LDBPK_272680"
                     /old_locus_tag="LDBPK_310350"
                     /codon_start=1
                     /product="amino acid permease, putative"
                     /protein_id="XP_003863126.1"
                     /db_xref="GeneID:13385813"
                     /db_xref="GOA:E9BMF8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMF8"
                     /translation="MASGETNPLNVQYGEFPGNQVHEDSLDLRSEFDMEVAQGYDAKC
                     VRGVEDVSSAEAPDPYDFSRYDPRRQIELQDKIRADRVARRLVPANVFQKYFDYLVPY
                     GGLVSTGLNLASSSIGAGIIALPYAFNASGLVMAIIYMFMIAYLTIYSYYLLGQAGTK
                     TGLRNYEQIVRTLLGPGADYFLAFCMWFLSFGGEVSYVISVKDVLTAFLEDADNTPAF
                     LLNIWGQRLLTFLVWLVAMLPLCLPKEINSLRYFSCVAIVFIVYFVIAMVVHSAQNGL
                     RADPRPEIRMFTTGNTAVSGMSTFIFAFLSQLNAYESYEEMNNPTPLRLTLGATISVG
                     IVFVLYFLAGLFGYLDFGTEMTGSALKKYNPVKDVMMGVGYVGILFKLCVGFGLHMIP
                     VRDAIYHCVRVDVHTFAWWKNACVCAFMALLSLVAGLFIPSINVVFGLVGGFSGGFIG
                     FIYPSFMVMYSGNWSLSSVGWFHYLSTYFLLIVGVVGVVWGTASSIYGEI"
     gap             104321..104620
                     /estimated_length=300
     gene            complement(<104623..>104934)
                     /locus_tag="LDBPK_310360"
                     /db_xref="GeneID:13385848"
     mRNA            complement(<104623..>104934)
                     /locus_tag="LDBPK_310360"
                     /product="amino acid transporter aATP11, putative"
                     /transcript_id="XM_003863080.1"
                     /db_xref="GeneID:13385848"
     CDS             complement(<104623..104934)
                     /locus_tag="LDBPK_310360"
                     /codon_start=1
                     /product="amino acid transporter aATP11, putative"
                     /protein_id="XP_003863128.1"
                     /db_xref="GeneID:13385848"
                     /db_xref="UniProtKB/TrEMBL:E9BMG0"
                     /translation="MEVAQGYDAKCVRGVEDVSSAEAPDPYDFSRYDPRRQIELQDKI
                     RADRVARRLVPANVFQKYFDYLVPYGGLVSTGLNLASSSIGAGIIALPYAFNASGLVM
                     AI"
     gene            complement(<108606..>110141)
                     /locus_tag="LDBPK_310370"
                     /db_xref="GeneID:13385849"
     mRNA            complement(<108606..>110141)
                     /locus_tag="LDBPK_310370"
                     /product="amino acid transporter aATP11, putative"
                     /transcript_id="XM_003863081.1"
                     /db_xref="GeneID:13385849"
     CDS             complement(108606..110141)
                     /locus_tag="LDBPK_310370"
                     /codon_start=1
                     /product="amino acid transporter aATP11, putative"
                     /protein_id="XP_003863129.1"
                     /db_xref="GeneID:13385849"
                     /db_xref="GOA:E9BMG1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMG1"
                     /translation="MPTAATGKSAMPYPNESAHGHEWEYDSPNRDGAELLEEQAYAAE
                     VEGHKKKAAATSEDSQKGVDPFDFSVNSPEQRIARMDRERAERVQRRRTELNFFQRWF
                     SYILPYGGVVASGINLASSCIGAGIIALPSAFNAAGIIVAMIYMVVIAYLTIYSYILL
                     AIVAKKTGLRNYEQIVRTLMGPGAGYFLAFCLWFLSFGAEVSYAISLKDVLTAFLDAS
                     ETAPAYLQTLSGQRVMTFVLWLVAMLPLCLPKEINSLRYFSCVAICFVVYFAIAMVIH
                     SGVNGLQENPRPAVKLFNQGNTAIGGLATFLFAFISQLNAMEVAGEMHKFSVRRMSIA
                     SAIGVCICFVLYFFAGLFGYLDFGPKVTGSALKQYNPVKDTMMGVGYGGLMLKLCVGY
                     GLHMIPVRDAIYYVCQTNVHNIAWWKNACVCGSMAVLSLICGLFVPRINVVFGLVGGF
                     SGGFIGYIYPALMVMYSGNWTFSSAGFFHYVCTYLLLFVGVIAVVWGTSAAIFDEVMA
                     QRG"
     gene            complement(<111528..>114506)
                     /locus_tag="LDBPK_310380"
                     /db_xref="GeneID:13385850"
     mRNA            complement(<111528..>114506)
                     /locus_tag="LDBPK_310380"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863082.1"
                     /db_xref="GeneID:13385850"
     CDS             complement(111528..114506)
                     /locus_tag="LDBPK_310380"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863130.1"
                     /db_xref="GeneID:13385850"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:E9BMG2"
                     /translation="MFQCPREHVAALKEVKRTVGINHSYLDGWIYLFLANKKFDVAET
                     VAKLRRRDDMERTVFAKYTMTDSLRKSMRAGIVQYIGRDKEGHPVLYFNTARDSPKAE
                     QRPERQANMDMFLSWCVRCDRKNPAAMVTWLINQENASMLRNTDLIFQKEMALRISKF
                     FPGVVSRMFICNMSSALTFVMKPLLRQLPKVISDCIFLFSAGDIRKGELLKRIDASVL
                     PVEMGGCNDCDHPPNYERFATTIESYFDRCIRALSKGISIKEMEVMEEFGVDKDGAPV
                     ALAGEGAAAGHGSPIYPSNGSAVMRDTEAYRGISTPRSAMPTTASEETLDFAIMQDPC
                     AVSVDAERRRITVQSAVRPGREGLPLTSPTNGATAIAWNTSFDSTPTASPSLLNHVSS
                     SELFECVSEPGESMEDFLDATITREGLYRVHLNSIEEFSYSAVLRKVFAQGQGGGGGA
                     IAEQQDACLRDWISFRCHCVELVPKLEHLLQALRLGAVLPAEEEDLTTQLRRCSHFML
                     NLFPQTRQTLPFPLLDWYAAGSTACHRSADAAAVSFTGKEEAAAHAVVDLFAVNPRRL
                     AFRLDCTSPDNVLLSAQAGAIEFVENWDDLIAVDERKKRVVRRLLLTWPPQTDRCTFE
                     AQLHARARQLWAQLTPLFRVYIEAKVGISIAEFIQHYGLLVPGGRIDETAEWYRLLYA
                     AVLQYRELHRRNWLFYVFPPLRHAGATADEPPTMERLLQARGDAGADVQAAISLMTLV
                     EQSLRYTADQLRTNGAGGAVATRTIVERYIEVSKAKISIPYDTQRSGVLPSESIAQYK
                     LAAAACLRNVEAPLQEFLFTIVSLAVLKQEYPPDMSKGEIMSRLQLAKTQSEADIQKR
                     RQHQRVAISFARICSELQGSFGNDIHNLLTTYSAAGMQADGYALGLELLLAVAILRCR
                     RNSDGSGGLDGASSSTPADIMPAATAFSEDDSSTGGVDAAVRDSAAPPSLDVESLRET
                     LNAMSHSASRLASLKRMYIF"
     gene            complement(<116151..>118187)
                     /locus_tag="LDBPK_310390"
                     /db_xref="GeneID:13385851"
     mRNA            complement(<116151..>118187)
                     /locus_tag="LDBPK_310390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863083.1"
                     /db_xref="GeneID:13385851"
     CDS             complement(116151..118187)
                     /locus_tag="LDBPK_310390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863131.1"
                     /db_xref="GeneID:13385851"
                     /db_xref="UniProtKB/TrEMBL:E9BMG3"
                     /translation="MRRTCHLFAGSVLDAPSLELRRAAQRVARAETRRLREKKAVTNP
                     YHKEQYISAFLEAHSTALVHQHVVSTSASAKHIDETPATSLTAAQELTTLAQELDARY
                     ATHDSPARLARSSAEASPADSATRPSIGSLWPTPRIMFGAWRSTSGGDTRLRQRLRSA
                     DVMRHCVIREARTPPSLSPEVIERMLPPRLPAPAQRLMVYLKSERFQRSPAPETCDRL
                     ESLLSAALRALHYSHEMQRAVALYAVLCLSTFRDWHMASAIVVSLVQRWSALVALPAM
                     SSSESMKAVHEDRSHMIALFLETARCSSSRPFFTAPSLEELDKVCVALHKPFEEADAG
                     AIACITHGGRSLDDNGTKSNGTAAAFSPRWDPVVSAPLLSVMGLHRLNGSPFSGSETA
                     KMKSLAERFCLHRSRPSPSPSAPARASGPAYMPALAWGEYLRALHRCGASLAEMQEAT
                     DRITDKACTRHADSLLSSTHVWNAYLACSPGSHAKELYEKNLRAYKVRETPATTAAVM
                     IALLREGTAESRVEARTLWKRLQHVHVSGKMVLHTSSTLMAYIRLLEVEGQADELLEL
                     LTSFEGLYEPFGVAPESFSRAVEAVHQRGRGSSGIARGLDLLAHICHAHPFLVPPLVR
                     YAVVQAIERTTTAAAYAKVAVTSHNDRVEASLPAASPLAAAALEFSADDLAATL"
     gene            complement(<118789..>122931)
                     /locus_tag="LDBPK_310400"
                     /db_xref="GeneID:13385852"
     mRNA            complement(<118789..>122931)
                     /locus_tag="LDBPK_310400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863084.1"
                     /db_xref="GeneID:13385852"
     CDS             complement(118789..122931)
                     /locus_tag="LDBPK_310400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863132.1"
                     /db_xref="GeneID:13385852"
                     /db_xref="UniProtKB/TrEMBL:E9BMG4"
                     /translation="MPGSVSSPRGSRTSGDVPANVSRRSASLTSRSSSVHGPHLSCSG
                     RYRNGSSESSAARRRLRRTRCSLKRSYTAHACRFSPYRPPSAAMLDPFPNASINSLCV
                     VGLSTLLTVHRTGVRLYRQRQLPAPAPPSTLNMLASRPSSNAAVPSASPAAVPHGVCE
                     ATGVFELIETRHEFQVRESYLCAAMQPVVVNGSLFLSKWSRYFCVASGSDRIVHGVSV
                     MSSGAHFCLNHTQHQTSKVVCMQCTQLALEPCHPLSLTPAVVSVDEVGVVVLFDIERE
                     VASVLEQAPLWYRQTDARPREKGAAADPSHVTNSTRDSGGHAGSGLHQAPLQQQHLTP
                     EEEDHVLNTIEKAAMSERVVYHLEHGVATRVALVGPCVELCNRCHNAFSRSMSSSRGY
                     KLVSLYLCSRARDVPADATPPEHLGDGEGGGAAELNVVLLRVLWGPRRAFVLEEVHLL
                     HEVAPTDVCDVGIAMNSPPYEVGMPMTLLLARPALELWKLRGCTGDLIETCRVYAANS
                     DGPRCGSCRDASECFLQWVPLGRHRLIVEKATEIEEENSWSCTVAMTNNDTVLLLGSA
                     PMPVNRDALGKTALVAASPVGDQGISTTRKELAAEPFKDTDLEAWLDDISVPASRSSS
                     LPAAESSLTAPAAANCTGPPAAESTATDDDGDNDGVSAACHAVTFPYTVLMELYAPQR
                     SYSSRTRESASAVSTVLLSVMPDWTANRLLLFMEDQETLLSVPLPFLERVVTLTDAKQ
                     HEADGREGTGVAAGPSIPTSGVDDLLPSTSTAQNPHVVSQETQPGRMIQYFKSASTHL
                     WGPSAPSHFFHLDASGGEVTRAPPVLSAPPTEAHTSPADDRSAAQFSDAAAVSSSATA
                     AAGSREPYRFFSLTRPLMAALFHLSGEHEEPASLAVVEAPLKDPVTSVTGDAKAPGIA
                     LSTPPIQQAGNGVIGSPPACPSPLTVSADGERSGTQHRCRRGSSSESSRAGSSRYRRT
                     RKPQRIGNGAPASSAEAAHTVIIEEGAAARASYISAQIALLKEEPKAQRGSRTSETGV
                     IADEDHGAQHEAATTVSQWQYALRRVAEVEEPLERNALLYAWKDGHNDLYIHFSVELD
                     ELRQREAADEEDGHAVPLSRRGETGSISPDASRHSRGTARPRLTLCRPADVEDGIHSM
                     GFLSQYNAVVHRRAATASYGNCFDFSSYFVTLQVPQHVLDVQERDKYRLELEDLRLQQ
                     ARDLASLHPYDMVTIFQNEERVSAKDAAWRLHATFPYDDAQDGHAVDLQQLNRTAVRD
                     PAAAAASEWRWADASEARAWSKEHDLARSSTNRVRSLVKDLKDWEVGPWAYATRWPSR
                     EEELRGDDGFIWSASEAPEHTCRRRRLSRLRVSIAELKRQTELMASHQRELEELREAL
                     GL"
     gene            complement(<125723..>128077)
                     /locus_tag="LDBPK_310410"
                     /db_xref="GeneID:13385853"
     mRNA            complement(<125723..>128077)
                     /locus_tag="LDBPK_310410"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003863085.1"
                     /db_xref="GeneID:13385853"
     CDS             complement(125723..128077)
                     /locus_tag="LDBPK_310410"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003863133.1"
                     /db_xref="GeneID:13385853"
                     /db_xref="GOA:E9BMG5"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BMG5"
                     /translation="MPAATAEPQPFEFPPGYVMPLPTRPSKMDEDTLHPVRVPTPLPD
                     LLPRSMKDIQKMRNLQSDGDTAKKYVPPRRDLPPPYVNDDECDEFEDKTIDTTILNMS
                     EKDRTKRMGHTYQLNGPSVEGDVTPVFENGLLFKVVTPDGSWYYYNDTDKYEMHVKFT
                     FGAKSDLQPGEKVDMYVMSTSELSASLVVFPGETTKLVAGKINGFKCSAKAVPLNDDK
                     RDILYGEVNDRIADDLMVMAQAIGVREDDLTEEKVLAYCEENEKPYIDCDFRPCDYSL
                     YRADVDTYLPRFIPWHRPSTWIPEEQLKEVRLFRRDILPSQVTHGSIGDTYLVSAIAA
                     LTDASGDRLHDLFRHPVSAANGKIERALGAYWVTINFNGWWLPVLLDDFLPATRDGPE
                     FARCAVDIRRMWVALLEKTYAKVHGSYANIASGDPLEPLSEFTGFPVTRYESFWEDAQ
                     GGDDMLFQEMLSYNRMGHLQVLCTPSDGGEAFGNANVVSANPELEATYEKMGLLLHHG
                     YAVLQTEYFEDLDLRLLRVRNPWGNGSEWTGAWSKDDKRWSKYPSVRNACYRHGGSPT
                     DADRTFWVEWSDALKIFSGGGCCHLRTPWFDYRARGEFAQGIPTVSFEVNVSAPTEAY
                     ITLSQEDERDDPSLEYHALLLSVFRHSGKKEKLDATSNSLVEKPDRQLKFNFSRDVAM
                     KYTFLPEHSPYFVIPRIHDPSVTKPYVMGLLCDTYVGNGIKVEFKRVDRNCRVFANMP
                     SFVQVGMMEDTAAEYQIRTPRQPIECIGEEIVDERLREFGILEE"
     gene            complement(<128884..>131694)
                     /locus_tag="LDBPK_310420"
                     /db_xref="GeneID:13385854"
     mRNA            complement(<128884..>131694)
                     /locus_tag="LDBPK_310420"
                     /product="calpain-like protein, putative"
                     /transcript_id="XM_003863086.1"
                     /db_xref="GeneID:13385854"
     CDS             complement(128884..131694)
                     /locus_tag="LDBPK_310420"
                     /codon_start=1
                     /product="calpain-like protein, putative"
                     /protein_id="XP_003863134.1"
                     /db_xref="GeneID:13385854"
                     /db_xref="GOA:E9BMG6"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BMG6"
                     /translation="MSATKAAITESSSNLAAASVVPEERPETRQYGLTDSLHISPANR
                     MAAEKLVAFVQAVSDPEVLHVIYDYLEEHEKAVPRYCLATKACRELLERKEEMLMACL
                     STSGGAHESSQPSAVGARRPRSVSVPQLVDSPDKKAETARAGEGLTEAQRLLQQIEET
                     DGCDKGDDDDADMDEFDDLNYFPAPYTPSSRFNFGQPSVSGLVTRVFSEGMLYKIKTP
                     KGEYHFYNDTLQEVMVVRVQCHLRGNEKINERAMLSPVASTGETEITIAVLPEETNFF
                     MSGVAHMPHFMAKRVPVPRDYVSPSVTQSLRKINAEINAVRKALGKWSRASDQQAYLK
                     CCLKNNLRFTDLNFRPSSESLYRPEFDAVVIPAVTWRRPEEYIYLAEVSQTRLFRGEI
                     SCFLVKQGDLSNHTVVAAMAAVAQFPAHVRWMFRHPVSAHVGKMERSQGCYRVTLLHN
                     GWWHTYLVDDYVPASLRGPLFASCAEDPRRLWVQLLEKAYAKSLGSYAATCLVDAMEA
                     LGDFTGFPVRFLDSMWAAAAQGPRDGAFRSLFRYLELCVRAGCTVLLFSPPPTDEQSS
                     ATVDMSCKRSSRIMPVKGAVPQFLPGHIYFLRDVAFYEALDLRMVQLKNPWTWETKNK
                     IHYEKKWRYTTWYDQPDPSLSAIASATTSLHGQVCSRVLASHALSPRACTDLSPEAVA
                     LNERKGTMWVEWGEALTAFAGGGVCYTMWDRHRYRVRNAFVEGRPRLALELKARRKVE
                     LLVTLSLETVSETLDNFGTVVAARPIPLHGTALAVVHRQANQSAKVVRESCDDIESVT
                     GCRTYVVARDVSIKVVVEPSTSSNGAAVLVVPLLDPSAVSAAAVGAGSGSSSNAASIA
                     AAPEVRFVVSIVSDAVAGDGEDLSVHFVSLRRSCGVFTDSTTAFPLEGASRVTAQYQV
                     CTKAGVATCEGSRISGNETKGM"
     gene            complement(<135569..>137833)
                     /locus_tag="LDBPK_310430"
                     /db_xref="GeneID:13385855"
     mRNA            complement(<135569..>137833)
                     /locus_tag="LDBPK_310430"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003863087.1"
                     /db_xref="GeneID:13385855"
     CDS             complement(135569..137833)
                     /locus_tag="LDBPK_310430"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003863135.1"
                     /db_xref="GeneID:13385855"
                     /db_xref="GOA:E9BMG7"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:E9BMG7"
                     /translation="MSSAQDEFDETTIHPDSLPVPATWRQKTSVFRYCGPSVAGTVSS
                     VIDEGVAYRIMTDGGGWAFYNDTRYYTVHVRYRIAAGSTVTPGHSVTADGKGAQQELS
                     MELGPEETKVLLTGSVVGFENLCKATLLPRRPATTQEDQALCAEPQQYWSVLATSCPD
                     VALPDRRSVSTTHLVARCVAKQIRYVDLHFFPSHASLYRDGQDSFYIPPLHWRLPASY
                     LPGDDGVRREVRLFRGPILHPDGLRSGHLLPNHLLLSVAIGLTCLWPQALRRLFIHPQ
                     GAQEGKRDRAVGAYHVRLCTGGWWRLCVLDEFLPASAQCPEFSHCADDLQVLWLPLLE
                     KACAKSLGSYAAMLEVPLEYFVRAFTGGPCEVLREIWPAHEDLRDSTVKAARFFALMK
                     RLLRQRPTDMPSLVCWLQPYFRGTARTQEIGDRLVVLYEDIGLDPNVATVVLGLETLG
                     DGQCVARLRQTAEKKRSAEWWLDLWRRAGKSWVDEVSDLVFAMEETAGGKLWMALEDL
                     PLYFQGGCVAPLTSDWGTVKVQGEFTQRQPSVVLEVTVTAPTCLLASVTQRDFDDAGL
                     PTQAVKVGSTSIGASQTLAGLSCLLYSKGSGGSTHFCGSSGDTPDVFEVAQYPHFAYE
                     REVTAGHLLDPRQGPYYVAPFVHSISSDVAYTITAQLIGAESVSSATSLVARESSTAT
                     VRFMTAKPGTALFQNLTQPILLESSMEVSATAMHYQSHSPRQLRMHCGSGVAVDLVLS
                     GCDVPPPITAAGTE"
     gap             140167..140381
                     /estimated_length=215
     gene            complement(<141064..>143883)
                     /locus_tag="LDBPK_310440"
                     /db_xref="GeneID:13385856"
     mRNA            complement(<141064..>143883)
                     /locus_tag="LDBPK_310440"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003863088.1"
                     /db_xref="GeneID:13385856"
     CDS             complement(141064..143883)
                     /locus_tag="LDBPK_310440"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003863136.1"
                     /db_xref="GeneID:13385856"
                     /db_xref="GOA:E9BMG8"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BMG8"
                     /translation="MDGNIIRPVCDEDSVTDAMLEEFLRPPSSFALTDTAGDMLTAST
                     LGSAARGPAPCTPAAACTSALGAGSSSTFKSSHDSEVNQIGVGAFEGSVVHCASHLVG
                     ASPALPAELSHSDITSDDSGDFAFLTSNVRDADVYDLIRHYMLYCKQQEKELEDLEAE
                     CARLEAEQQHLYGAAIAADMTRKSLHMSAANSLSPPNSNETAATGAGGVSSSAAVDEF
                     GEAHIDPLKSCPYLDPHDAAHNPQPYRYGQPAINGFYTPAFKNGILYRCVAADGSWIF
                     YNDSEQYAMHIKYIFGASSVITAGPHASVNQRVSGEYEVQVTVWPQETEVLLVGQVNG
                     FKNLSSAVPVNSSYTNPHASASTASARALLNRFAHQSGKPNISLLSTEDVLECCAGQG
                     SELAAAVGSLNGQHFVDPDFPPCGTSLYRKGVDDVFLWDMSWRRPCEYLPASQRSEAC
                     LFARSVLPTDPCAGEGGAVYLCSAACCLAEHPTQVARIFRHPVSADAGICERAVGAYR
                     VALSHGGWWTPTVVDSYLPASLKGPNLGRCSHDLRKLWYPLLEKAYAKLHGSYAAMQC
                     GSALEALQDLTGFPTFHFYDEWAEAVRSSAGARASERTSYSPLSEHLFTSLEEKVHQR
                     GYLVFLSLPDDGPAEAQAAQIGMMFGMSYAVLRLVRHGSFRLLQIRCPTLKLCSSGLW
                     CAGSARWQQEPQLARLCGMDSDGGPELASLWLDWSEALAMFEGGGVCCSRWDWAHDCR
                     VRGFFKDGIPSFVLEVSVDTSAESAGPVEAYCILSQEDDRGMSPDHPNRALRPLMLSV
                     SSHCGDDEAGEGVGGESSADQRIRHVCSTDPDTPTEHLNYVLGRDTALRVTLQPSEHP
                     YYVIPRSRGDMRNKLFTLGFVSSTAPTKTGKLRMRAVQLPSNSAVFHNRRSFSTRQLE
                     SVAAVSFQIRGPDGVARVGCGSSIG"
     gene            complement(<146567..>148741)
                     /locus_tag="LDBPK_310450"
                     /db_xref="GeneID:13385857"
     mRNA            complement(<146567..>148741)
                     /locus_tag="LDBPK_310450"
                     /product="cytoskeleton-associated protein CAP5.5,
                     putative"
                     /transcript_id="XM_003863089.1"
                     /db_xref="GeneID:13385857"
     CDS             complement(146567..148741)
                     /locus_tag="LDBPK_310450"
                     /codon_start=1
                     /product="cytoskeleton-associated protein CAP5.5,
                     putative"
                     /protein_id="XP_003863137.1"
                     /db_xref="GeneID:13385857"
                     /db_xref="GOA:E9BMG9"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BMG9"
                     /translation="MGCCNSKETKKPKEVKVPQAEAQSAKVSSETASVEEQRKIEFRV
                     ASAVEDLRAERIEAICAHSRACPYRYNACTVVGGEVKFYFEGGIIFCIVKEGSWYVYN
                     DSLDYEAHVTVRFGQGSNIVAGERAELEEVEDGWTCAHAVVYPLETVHLVSGTANGYR
                     TSITIKPLDGQYRHDACAAANGTAEAETEAVRSLVTEGMDEEAILHRCMETGTPYVDL
                     KFPPNGEAVARAGRDTRTIPEMAMMRPTQYLSDNNRLSVNDICGPVLALSIEPGNLGD
                     SWFMCAVAIMAENEAAVRNIFAQGSPAEKAVGAYRVLVNKNGWWHTLIMDDYLPTFNR
                     MPVFARSYDNPAEMWTSLLQKAYAKLHGSYAAITGGDALQALADLSGSPMCRFDKEWE
                     EATTDAGKAGTLANALVQFSRSGACVVLSTPGHNSESYLGRSQASDAAAFRAHYKKVG
                     LHLGYTYSLERVVMVEECNTLLFKVRNPWRSSNKWTGAWSYGSRQWDENRDACLLCGA
                     QKDPQDGSFWMCWDDATRYFDGGGVLFANPDATDYRVKGVFCKTIPSAVLEITASEST
                     RVLFTLSQPDKRGVDRKEGAALFAPIMLTVSKAEGGVQRVQKNTSWNPTMPSEEFNFV
                     VGRDVSMWFTLEAEEKYQLVPRMHLKGVRSNYDRPYVISIMSADKLEGNVRVEAKRID
                     SSSKVFTNYIAYSSEELPSAEVESQVRLPGKAPVTYVSTTVI"
     gap             149705..149743
                     /estimated_length=39
     gap             152193..152291
                     /estimated_length=99
     gap             153224..153322
                     /estimated_length=99
     gap             154822..154920
                     /estimated_length=99
     gap             156068..156166
                     /estimated_length=99
     gene            complement(157148..157531)
                     /locus_tag="LDBPK_310470"
                     /pseudo
                     /db_xref="GeneID:13385858"
     misc_feature    complement(157148..157531)
                     /locus_tag="LDBPK_310470"
                     /pseudo
                     /db_xref="GeneID:13385858"
                     /db_xref="PSEUDO:CBZ36448.1"
     gap             158723..158821
                     /estimated_length=99
     gene            complement(<160854..>163187)
                     /locus_tag="LDBPK_310480"
                     /db_xref="GeneID:13385859"
     mRNA            complement(<160854..>163187)
                     /locus_tag="LDBPK_310480"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003863090.1"
                     /db_xref="GeneID:13385859"
     CDS             complement(160854..163187)
                     /locus_tag="LDBPK_310480"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003863138.1"
                     /db_xref="GeneID:13385859"
                     /db_xref="GOA:E9BMH1"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:E9BMH1"
                     /translation="MGTRRRRTIFCAASLLVVVVSLWPRQYRFLCLLFRFHGSVRIRH
                     GITAILILLLFRLSPAPTQLQWFQRLMALCGGSRITSKAGKHYQQKKVHDFKYGGPAV
                     KGDCYPLFEDGRCYRVEVDRHKWFLYNDSLDMEMHVTFTFQKTTAVYKTQHGRTTVRK
                     TPNGGTQCSVVVYPLETLPYVKFAKKTQILYSAACMSRDLAPGYIEKINREAKAKCMN
                     ETQKVAGVAGVSRSEEEILYKCRKSKIPYIDMRFHPSEAALRRPHDKQSVSNMHAITW
                     KRPQDYIPAIAHKAIKLFRHGVSAAGIGQGHLGDCWLMCSIAVVAESKTMVKDIFRHP
                     VSQSQRKKEERAGGYRVYINKNGWFHNVIVDSYLPTYNGAVYFARSAGDPYELWVSLL
                     EKAYAKLHGSYASIVGGNPLHALQDLTGFPVYSFTNAWKAAANGEEAASQFFKDLLRY
                     RKNGYLISISTPGTQTSLHNAGSGNANEASLEARYKAAGLSTGHSYSVLKVRQFVIPR
                     VKLLKIRNPWGSGDEWTGAWGKNSTKWQKHSLVRRSCKPSKVSDGTFWIEWRDAVQFF
                     EGGGVCMVKKAWYQYRFPGQFIGIIPSVVLKIELKKQQKMLFTLSQKDRRLRSPDDPD
                     QLYKGLLISVTGHNMEKGMQQIVALSTDNPEVHPPEKYEYMLARDVGLELELDPAQGP
                     FYVIPRIMATNQNGPMDFTLGMLTPSKSTARGLRVSFVHLPDTCPTFRNLASFHVNGE
                     VATHVQFQYKKRGGAPRVKAGITVFEATNVKQTYPFQ"
     gap             163406..163504
                     /estimated_length=99
     gap             164345..164443
                     /estimated_length=99
     gene            complement(<165819..>166547)
                     /locus_tag="LDBPK_310490"
                     /db_xref="GeneID:13385860"
     mRNA            complement(<165819..>166547)
                     /locus_tag="LDBPK_310490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863091.1"
                     /db_xref="GeneID:13385860"
     CDS             complement(165819..166547)
                     /locus_tag="LDBPK_310490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863139.1"
                     /db_xref="GeneID:13385860"
                     /db_xref="UniProtKB/TrEMBL:E9BMH2"
                     /translation="MAAPSRDCASRPSLDAGIFFPEGSRPPQPLHGHGFLLHGARAVG
                     KTSLAFQAAINTVQRAGGSVVVLCQESTLYAKVPQPFTPLSSLSESALGHIEFIYVEG
                     WTAALREMMGFRTTRAVPALLIVDDDGFEVTVPADGRGKRSGQYLDFLVDTAAASCLS
                     YLENLHDWMTRHDRPFFYILVTNHLPESATQLSLPYAAFPLVNVWVGASGTVQITTTQ
                     AGGTAEVVSPPAYLTWQNGLRMRD"
     gene            complement(<168585..>169739)
                     /locus_tag="LDBPK_310500"
                     /db_xref="GeneID:13385861"
     mRNA            complement(<168585..>169739)
                     /locus_tag="LDBPK_310500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863092.1"
                     /db_xref="GeneID:13385861"
     CDS             complement(168585..169739)
                     /locus_tag="LDBPK_310500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863140.1"
                     /db_xref="GeneID:13385861"
                     /db_xref="UniProtKB/TrEMBL:E9BMH3"
                     /translation="MLRCTALVQLRVLCLTMLPDGGALTPALRKLGYTPYTLRSTYQQ
                     GHASTHPIEWSQLLDGKTNALPAKVLADYDAVVGPPGAMVYDVLLRQAPSYTKVILVE
                     ETEKDKWAEKYDTYLERLQISTKRASKNRITQAFQNMIAKMVVGGDASGAPAAASAGP
                     RSSLSTRHSRSLMISSSGDLRRSFAAEAAELKRGFCGSKAPSPTSASDPSEDSRGTAK
                     ARHAKKESNASDGELQHPRAVALQLYEESVRVSIPPSALLVYRYGDGWEPLCSFLDKP
                     VPSIPFPEYEDGLRVLGNLQERIDRAHTLQYVAGGICVLCVLMTVLPRCEGIVEFVKS
                     LYTDYQVAFGADSAACARTTAGGDCSKTEVETFETAWQKRGGSVTRTAKE"
     gene            complement(<170649..>173117)
                     /locus_tag="LDBPK_310510"
                     /db_xref="GeneID:13385862"
     mRNA            complement(<170649..>173117)
                     /locus_tag="LDBPK_310510"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863093.1"
                     /db_xref="GeneID:13385862"
     CDS             complement(170649..173117)
                     /locus_tag="LDBPK_310510"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863141.1"
                     /db_xref="GeneID:13385862"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BMH4"
                     /translation="MGACCCKNPTSSVAMVAGEGVESIPQGGEGSGGAPTSSTFSGPS
                     AHPLTLPGHPEGETATVASMPLALDSADKIGAEGHFERGDGSDELSSDTWPSLHARVW
                     RRRGGVSGETPSRALTAAMWQWRQPPWESPEEWQVLRRVLCGHPLFAACRDDASMLRD
                     VMEVFERQETQPGEVIASPGDSCAFHVVVKGQAVADVGDGDAVIAQAKNKRQEWAVGD
                     YFGSEGLLYVLNPDDEGAAVCAAGHPDASSPTATWRLNRMLYQMLMRTFYDDAHLQLM
                     KYLFQSPLFQHLCRAQIRHLCEKAEMVTWDTSARLLQRGEVPTSLFLLISGTVALMHV
                     QRGGGGHAGVPRVQSIVLGAGDCVGDAELLLLHRAADEEDVTTASKRLIAMHSLCTYA
                     VQKPVQAIRIPIEDLLAVLSGHDLQHMRERSRSVRELELWQRQAQMPGGLRSLVDECL
                     VLNISNPNSDSDSDSDEDSLVLQGGPGVAASPLSRRLSDDASQDVFVKGADATAFFLE
                     QMFSRQTYRRADGRERGLSMATFAPRQRYLVGTVLFHVEYAASGNGMMRASGGLPPSD
                     DGKGAASTAGSSAAAGSRKSHGCLYAVFSGEVTVVNSDTGEAIYSVSRGNTLGEEALL
                     APLRCCSATNPLRTHAVVSSSDGCEVFELSRRAFKEFLQRPYCEALRDFCSVFCVFPF
                     AWCFPQHYWHFLFNCTTEREAVGGDLIGVRGADCKCVSLILDGRLDAYARSSAADSGG
                     KEQDHDEETSVASFAAGDIVGGWEVMEGRPCNVAYVCVCRTRMLCVPAESFAGLFRPA
                     MPYLRLMWSERRYKRVMVVSATEG"
     gap             174935..175033
                     /estimated_length=99
     gap             176167..176265
                     /estimated_length=99
     gene            complement(<177367..>179286)
                     /locus_tag="LDBPK_310520"
                     /db_xref="GeneID:13385863"
     mRNA            complement(<177367..>179286)
                     /locus_tag="LDBPK_310520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863094.1"
                     /db_xref="GeneID:13385863"
     CDS             complement(177367..179286)
                     /locus_tag="LDBPK_310520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863142.1"
                     /db_xref="GeneID:13385863"
                     /db_xref="UniProtKB/TrEMBL:E9BMH5"
                     /translation="MPGSGSADPKSRPEMCRSPNMEAAKTTASSSEAPTTNSATAATR
                     GSRRAQGWHLAVGGGAPPGTAGANHSALDAKMLGSSGANSGIALRSSVQFSKDTRYSQ
                     NSPSVPRVFHGAASDEAADFRQNMADFLTVMYGDKTASGVVGIDEKSVGAPHAKGKAF
                     VAESGIPAALLAAESGPLPRVSSSGGVSPGSKGPLVKGLTANSRRHSQGDHIDTLVES
                     LVRAYSRRTTSARGEFQGTTGPDDDRPITYNVARQTNYCRTQASPRLSRGNGVGAGSG
                     HNHEVSVFVSQAMGNILSPGGIRGQGAVSNRSILSSLGLDRNLFNLMPFQTRSNLENV
                     TEEDSDTLLEPVYVGKQAMFRSVGTRPNISDISVSKSMRGVMSSAPRECGKNGHRNTT
                     QVPLRGDSGGPRRSSGGTVPLWQRQGLGRSKQSLDSVEVMDKSRVNQRGGSGAGGSTK
                     NRNATLSMSLDSKALGKAGGADEEDDSWSDEPAGILATKVMEGESPAIVSSARSLLDY
                     CKTRADVTLQKALGALQDEEQLKRDVVIAVEHQLCVYIHSLERAERPKKGGGAAGISD
                     RRKGSGEKSANSNLAAEREEVTSGEAGAGGYPSNCDTINSEVAPLTGNVMDFLQESTA
                     GANRSKSLKSASMKM"
     gene            complement(<180430..>182241)
                     /locus_tag="LDBPK_310530"
                     /db_xref="GeneID:13385864"
     mRNA            complement(<180430..>182241)
                     /locus_tag="LDBPK_310530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863095.1"
                     /db_xref="GeneID:13385864"
     CDS             complement(180430..182241)
                     /locus_tag="LDBPK_310530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863143.1"
                     /db_xref="GeneID:13385864"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BMH6"
                     /translation="MFLISWCLANWKLVAAALVAIVFLSRRVTALPQQEAPPVMEQPT
                     AEPAEADGPARGPAPPPPSGRPAPNAPGASPPAIGDSGETPAQGETLDPIFEEITSLF
                     ASRNPKHALQGLSDGLRNAATGVGLGLAGVVAGTYGGAKEGGLGGMAKGFGAGVAGFV
                     GLTGYGAYAGVRQIVRGVGNTRSAVSEVSKGEAYWDSNAQAWVRVNLACDFERLPPTD
                     EDLLGEARKAYEKAKKDGTLPTTLPAMTPNDSAEGGEASASSATTGAGAASLPQGTDT
                     GETKHAAAEPVNYYAFLGVESTATSSEIRKAYTRKALEMHPDKNPNDPNATIKFQELN
                     KIYNVLSHEDTRATYDQYGTVDPMNVPEMTGNPMKELLGAAFLEALVGPLHFFLVFEG
                     GVLFTAEMQRELHARRRLRVAKNLISWLDNDVSGFESAQLALRDAVSTALGPVFVSYV
                     AEEYHLASRQQLHGSSWKREMDSWYSSWATSASSLWHWTTMGARTARRAFVDKNLGEE
                     DILRVLAVANERDVRQIVLQACRLVLFDMSVTPAQRQQRAMRLEDLSVMAMKEVALEV
                     ASRERIGASEATAAAAEKGATTKTPADTSSVTAPPLS"
     gene            complement(<182934..>184814)
                     /locus_tag="LDBPK_310540"
                     /db_xref="GeneID:13385865"
     mRNA            complement(<182934..>184814)
                     /locus_tag="LDBPK_310540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863096.1"
                     /db_xref="GeneID:13385865"
     CDS             complement(182934..184814)
                     /locus_tag="LDBPK_310540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863144.1"
                     /db_xref="GeneID:13385865"
                     /db_xref="GOA:E9BMH7"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR021721"
                     /db_xref="InterPro:IPR022776"
                     /db_xref="UniProtKB/TrEMBL:E9BMH7"
                     /translation="MHVALLYPLSCSFPFLTCSPSFVPHHAPQPFTSTQCIPERRQAL
                     TVSLRRVILPVVRFRTPSMSLAAEQTEAGAPARKASKVEPPTRNPDPHFCSYYVTRKH
                     RFCRTECRPGSLYCCTHDIAETGASPSTTPQAEKDATSSPSDVAGFRGDMRVPCPINS
                     NHTVYASRLERHVKVCPDLRYVTHQLPYFSNDKHANRGAVFVSSACNAPPGGESQRCT
                     HRDFSAEGLAALIRKVHECYDSCIAPDLVVLRQPSRDRDAASGEVGDTTTSQATTSCR
                     GSAPVACEEIASLKHGPQYMGLIRCLSDVVRQAQDTDSILVGRCSSHCAPIHVDGFLE
                     FGAGKGGLSAALQQLIVQRLQGIDCTTTSVSEDAEAGTVPPSQREATAETSPLTPSTP
                     QSSWRSGFLAEVAQRPPLVVLDMNGFRRKSDARVRHSAVPLQRLRINIKDVDLTRAFL
                     SEIRPVPSGEGETAAAAVPSAIPRPLENWAVLGKHLCGACTDFALSCLTESPLLTSQA
                     QVRLPIVVIATCCHHRCELKHVNPPERVEVSPAPLVLPGTSFTWSEQEFAALASMSSW
                     AVCGDFVDEERRAVGRKCKRIIDQLRVHFLRYLGYVAFQCQYTTRDVTEENVCIVAFH
                     AS"
     gene            complement(<190499..>192532)
                     /locus_tag="LDBPK_310550"
                     /db_xref="GeneID:13385866"
     mRNA            complement(<190499..>192532)
                     /locus_tag="LDBPK_310550"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863097.1"
                     /db_xref="GeneID:13385866"
     CDS             complement(190499..192532)
                     /locus_tag="LDBPK_310550"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863145.1"
                     /db_xref="GeneID:13385866"
                     /db_xref="UniProtKB/TrEMBL:E9BMH8"
                     /translation="MDPPEHHTNRVPTLFQRPSGVFNRPVGVSPAHSAHSVSPDPTAM
                     SQDSPARIGSFATTFLGSSGTSVVTVPPAPPQQQSPLQLRCNSEMRSIWSPQQVSRVL
                     QGLPLAHADSIAETELLSRGSCSKNEEEARVEELLDGPASLSADLAELAAPPAPHEME
                     SATEEEPHGLNSNPVIIDSFSGGGCTSFAQRSFFAEVAVEIASPTTAARPEKLRRGKG
                     SLFASPNTPLSLQGAALRSMPLERSAAASGFHSAVALAVTKMHLPLSPTRGVPSTSVP
                     TEPRTSTGASRQSTADTAHVKLPPQPRPPQHTHPPPRFCGSSCGWDAAATSTQSSRAA
                     FGAKRLPPLATFKGVDPSVRTSIADISLHDPRQVGTAPQAPYRESSDSSASSPVALHA
                     ANESSRVMSPNVSNPRTGATNVGESSAVQSLPHASRFDSSGVFPSLVLPSASVALLSS
                     QEEVRPSPSSLHTPLTDRSSRRNTSSSSPRPSFITRANSTALSTSASPHYPISLTPLH
                     PPTSAPAAQHFPAGATRALWSRQHGVRSPLEAIWLRSEGLLAPSESMLSAEGCNKVDS
                     PILNAASPPPAVAARDAGALLGSSSQRQSQLNVHELSSSMLSHEISTVSSGGGVVPGN
                     AMSSAGPQPAGERERRSMMQRIFREPKKGGQRVWVSIVAPDSRSSSVDASEKS"
     gene            complement(<195786..>198311)
                     /locus_tag="LDBPK_310560"
                     /db_xref="GeneID:13385867"
     mRNA            complement(<195786..>198311)
                     /locus_tag="LDBPK_310560"
                     /product="ATP-binding cassette protein subfamily D, member
                     2, putative"
                     /transcript_id="XM_003863098.1"
                     /db_xref="GeneID:13385867"
     CDS             complement(195786..198311)
                     /locus_tag="LDBPK_310560"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily D, member
                     2, putative"
                     /protein_id="XP_003863146.1"
                     /db_xref="GeneID:13385867"
                     /db_xref="GOA:E9BMH9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BMH9"
                     /translation="MVSSEVLGEYVREYAASRLRDPVMASWVGGSLAFLATMYATSSG
                     RQLAKAMPPPPLRGIQGSIVRGTAASEVRKGGGLTLVPQSTPLSPSSPVSRATTSSVF
                     ISASAATAEAYSQVFNQEVSVFNRFMQLLRVAIPNCHGREARSIYILFVLMIVRAYVS
                     VRLVNVSGLVSRTAIEGNLRHAIRALALFAVSCVPATLLNVTLDYYSELLGLHCRDNL
                     AAYFSDRYLKRRVFFQMAGLHEVDHVDQRITEDVRNWARVSASLFTSIPRPLIEAITF
                     SFTLARQTGWRGTLLTWSYYLTFAVWICCCAPNLDWMVQQRTEKEGAVRRAHQRLLVY
                     AEEITLTKGFQFHEKVLQRLFKAVTDQSRYAAYVRSRFDFTETLHNKYGSVLLGYVVC
                     AMATMHQKNQTTTAETATAALTCASYTFKTLATAIGKSLWNVKLVFVVGGYTRRLAQL
                     LAALDRADVLVEMQTSCTAQSPIVSRASGAFPVRGNDGKAMSNYEDSFGRIVRSDHIE
                     FVDVPLVLPTGECLCSSMSFYVKPGMNLLILGRNGCGKSSTFRLLGELWPLRGGRIEK
                     PEAEQLYYVPQRPYMYDGTLLEQVIYPLKKKDLTVGEAELYGYLQMAGLDYVFSKLNM
                     SWETRLPWSDDSLSLGEQQRLAMARLFFHRPRFAILDECSSLVDLDVERQMYDRCVEL
                     GITVITIAHRRSVWQYHNWILYFDGSGGYMFSPLQYETGASALVLTCVRSASDASLIG
                     TEVRIPITDRLCSEDETVTAKKEPPPKLIQTAQKAEVPKSPRAETVTEKVEREERAKA
                     NGDGDGVHGSHRQSRHRRSRKHRASDGNKAVGFETQAETSGGE"
     gene            complement(<199773..>203567)
                     /locus_tag="LDBPK_310570"
                     /db_xref="GeneID:13385868"
     mRNA            complement(<199773..>203567)
                     /locus_tag="LDBPK_310570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863099.1"
                     /db_xref="GeneID:13385868"
     CDS             complement(199773..203567)
                     /locus_tag="LDBPK_310570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863147.1"
                     /db_xref="GeneID:13385868"
                     /db_xref="UniProtKB/TrEMBL:E9BMI0"
                     /translation="MQTAPPTQQRRTFSRANGADGTAVPRLVAAEERHRKNLHQIQQL
                     KQALCSTVSAAAVPCMSALSSRGCSLPSSTLSVPPPSNPSWMAPFLESPSGVVASLSQ
                     TNGATVPVSRQSTWTPVSAAALRESHQEVERLVQERNKLQQQCVEWASLLGEASHRAA
                     ESAGTNAPLVSHSGVEADAWSPVHQAALAVVRQATRCYPSALREARIKSDVGATEDTS
                     TPQCAGSSALIAPHEGELSEPFLHGNSSPPLTTEELANALHRLAEFLPSLASTMTASE
                     LVAASEPDLLHRIRTLEEERRSDCLVVLSITDHLTQVATQLRREAAEKDEALHALQET
                     VEALMEEKSQWARRARESEEALAERYEQYSQREKAWEREVAGLLQSKHNAEAASAAPM
                     ALPASITVALADGSGAASATATATEMGEGHITQLQQELDAKEATLATLEEEHRALQAT
                     HAELQTHSQQAEAAHQKRIAELESQLNPLEEELQTQACIIGSTLRKVEDLSVAHQAET
                     AALTESHNAFLAGKEVTLLSLQEAKERIEVELAERTADAAQMRAELEAALGKLAAAQS
                     ASDRPGSSSLVHDGVSVGNSSVVESTDLLRPTGPSEGDGADASLQMDGARTPGKCERA
                     KNDDAEDAAESPTKLVDVRKLQQSLNRMSRERTALKRKLEHRAGALSEMESELEAALR
                     LAAQRGAQVQALTAELERSKATDTSAPADAKAADEDDTGEEEADAETSLQLMDFSELE
                     RYEDEGTLYPDLVDLSGWLLGHAEGSSVRFSTYVQHHLSENEQLRIAAVGPLYHIGFT
                     LLKVEGLVKQEDDSLCLPMPWRRFLLQLQQVLDAQLQATVLSPADSAKCFYALASSAG
                     LLGNLASPPRDPLTGYSLIIAALCVCLRSPSPSTSTDSSCKWHCCQAILHHVSRYGDG
                     KTASQTGRSIADADSQAPDSLFLALCAEFPAATALPEEDAGDEGATAGGGTASVPLPC
                     SIRLAALLTSDLLSDYLPISHLALCAAALSDIVDNKVAPIEGQLPASSQTEATKIFAA
                     ARPRLSFAQKRDVAPLLLYVARHEYLLFGWAHEMADAAAEAEGGSPSEDGHSTDTASL
                     TLSSLGVSVTWPASATVQKVPSRSAAVSARATPPAEVESITQLLIFLCAGLLPTLVLA
                     IYRCPSLEQESQLIDAFFRTRRLLMAKRTALLAKNSTEACAASGVIPGVTLLLPETRL
                     RNLVNAALAPIKHTAPFPERAVQVPVAEYERLHHELLSLYETNDTYHRYIQELLSAAE
                     AA"
     gene            complement(<204353..>205342)
                     /locus_tag="LDBPK_310580"
                     /db_xref="GeneID:13385869"
     mRNA            complement(<204353..>205342)
                     /locus_tag="LDBPK_310580"
                     /product="mevalonate kinase, putative"
                     /transcript_id="XM_003863100.1"
                     /db_xref="GeneID:13385869"
     CDS             complement(204353..205342)
                     /locus_tag="LDBPK_310580"
                     /codon_start=1
                     /product="mevalonate kinase, putative"
                     /protein_id="XP_003863148.1"
                     /db_xref="GeneID:13385869"
                     /db_xref="GOA:E9BMI1"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:E9BMI1"
                     /translation="MPKPVKRKTTGKNIGYGKVILFGEHFVVHGAEAIVAGISEYTEC
                     RLEINPGVPGLQVDDQRPAIPGYIAQKRDEQIKAHQLVLDHLKVDLSRDGLKMLIGGP
                     LVPSSGIGASASDVVAFSRALSELYQLNLTDEEVNQSAFVGEGGYHGTPSGADNTAAT
                     YGGLISYRRHDGKSAFKPIAFQQRLYLVVVGTGINASTAKVVNDVHKMKKQQPAQFKR
                     LYDNYTHIVSQAREALQKGDLQRLGQLMNANHDLCRQIDVSCRELESIVQTCRTYGAL
                     GAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCPEAKFIWRYTVQPSTASNL"
     gene            complement(<206829..>208247)
                     /locus_tag="LDBPK_310590"
                     /db_xref="GeneID:13385870"
     mRNA            complement(<206829..>208247)
                     /locus_tag="LDBPK_310590"
                     /product="amino acid transporter aATP11, putative"
                     /transcript_id="XM_003863101.1"
                     /db_xref="GeneID:13385870"
     CDS             complement(206829..208247)
                     /locus_tag="LDBPK_310590"
                     /codon_start=1
                     /product="amino acid transporter aATP11, putative"
                     /protein_id="XP_003863149.1"
                     /db_xref="GeneID:13385870"
                     /db_xref="GOA:E9BMI2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMI2"
                     /translation="MKAVEATRVSSTVLAQDIPREVDADAEELAEMDVADGNKVPAHV
                     CPDDSFHSKDRGNRDLSTIGRLLQVMIPYGGMLSSSFSMASTTIGAGILGLPAAFHSV
                     GIIMATVYLVLITAETVYSMRLLVQVSEKTGLRSFEEMAKQLLHPRANIFVAIIRALH
                     IFGGSVAYVVTIGDLLKPILSSSASTPPFLLTSIGLKLLTTGFWLVFMFPLVLLRRIN
                     SLRYVSAFGILFILYLALVVITHSAMNGMRARPRPTTRLISTGNMAIEGLGVFIFSYM
                     CQINCLEVALEMRPRSLGRFTICAAVSMTICGILYYATGLFGYLDFGEMRGSILLRYN
                     PLQQPHVFVGYVGVFIKICASFGLLNNACRSALFPLIGWDPYTVVYWKYLIGAVSLAV
                     LVLMLGLFVPNVNIVFGFTGGVCGGFVGFILPALFVMYAGGWSFRSVGVINYCCTYLV
                     LAAGVVAVVFGTAATIYSVATN"
     gene            208825..208958
                     /locus_tag="LDBPK_31_snRNA1"
                     /db_xref="GeneID:13385871"
     ncRNA           208825..208958
                     /ncRNA_class="snRNA"
                     /locus_tag="LDBPK_31_snRNA1"
                     /product="small nuclear RNA, U2 snRNA"
                     /transcript_id="XR_002966736.1"
                     /db_xref="GeneID:13385871"
     gene            209170..209242
                     /locus_tag="LDBPK_31_tRNA1"
                     /db_xref="GeneID:13389989"
     tRNA            209170..209242
                     /locus_tag="LDBPK_31_tRNA1"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:13389989"
     gap             209869..209967
                     /estimated_length=99
     gap             214066..214164
                     /estimated_length=99
     gene            complement(<214477..>216006)
                     /locus_tag="LDBPK_310600"
                     /db_xref="GeneID:13389990"
     mRNA            complement(<214477..>216006)
                     /locus_tag="LDBPK_310600"
                     /product="amino acid transporter aATP11, putative"
                     /transcript_id="XM_003863102.1"
                     /db_xref="GeneID:13389990"
     CDS             complement(214477..216006)
                     /locus_tag="LDBPK_310600"
                     /codon_start=1
                     /product="amino acid transporter aATP11, putative"
                     /protein_id="XP_003863150.1"
                     /db_xref="GeneID:13389990"
                     /db_xref="GOA:E9BMI3"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMI3"
                     /translation="MPGNRVPLSHTLGKDEVELKGHCRSDCHEAPAAALGDMDPKWVD
                     VDDEFSCGGGRKLLYECPDLPMQNGVDRDTEGQPLPSSQAPDEVRGAKRWARRNIFSR
                     IFNAIIPHGGLLSGAVNLACVTLGAGIMSIPSAFNTSGIIMAVFYLVIITSLTVLSIT
                     LLSNAMEKTGIYSFEGLARALFGRGGDIVAAVLMWILCFGASVGFVIAIGDILKPIFA
                     HPKVPPFLQEKSGRRCIMSGVWLLFMLPLVLPKKINSLRYMSAVGVFLIVFFVICAIY
                     HSIVYGLKDGIRKDLVMVRPGNEAVSGLSIFCFSYLCQVNVGRIIVENTERTTRMITL
                     QAILSCSICATLYFLTGFFGYADFGPSLKGNILERYSPYQSPIFFVVFPGIIVKLCAS
                     FSLDMLACRTALFQVMHWDVETMPYWKHTLVSVPMAIGALILGLFVPDINIVFGLAGA
                     LSGGFIGFVFPALFVMYAGSWNLKKVGIWYYLATYFLLICGVVSIVFGTVSTVYFSFF
                     V"
     gene            complement(<218627..>220252)
                     /locus_tag="LDBPK_310610"
                     /db_xref="GeneID:13385872"
     mRNA            complement(<218627..>220252)
                     /locus_tag="LDBPK_310610"
                     /product="amino acid transporter aATP11, putative"
                     /transcript_id="XM_003863103.1"
                     /db_xref="GeneID:13385872"
     CDS             complement(218627..220252)
                     /locus_tag="LDBPK_310610"
                     /codon_start=1
                     /product="amino acid transporter aATP11, putative"
                     /protein_id="XP_003863151.1"
                     /db_xref="GeneID:13385872"
                     /db_xref="GOA:E9BMI4"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMI4"
                     /translation="MSTPNPPDRAPLVSNAQGLHQREDDQQQETAPRSVSVFSQPRSM
                     HDNGENLKEDDYSRRMSINLSNIDMEPLGVSEVLLDGHRLHKNDDTHGGSHLKRVLES
                     GEEGDEADQHPPKPPGTLRKAIHVLRFYFNVVVPFGGFLATTFNLASATLGAGIISIP
                     SGFNLSGVIMSCVYLILAAAGTIYSMNLLAKVMVKTGLRTYAQSARVLLGRGADYFLA
                     VLIIIQCFGGSVAYIIATSTLLSPILNAPSAPAFLKTKQGNRIITSVVWLTFMLPLVF
                     PKKVNSLRYVSTFGVLFIVYFVACMIGHSATHGLHNPSIRSEMRMMRTGNEALEGLGV
                     FLFSLMVQLNAYDIFFEMQHKTVLHFTLYTTIATGMCVLLYILSGIFGYADFGSKVRD
                     SVLSLYDPIKEPYMAVGYIGIVIKICVAFALHMIPFRDALYHFFRWTPEEVPYWKHCL
                     VMAVPATAALLCGLFIPTVNTVLGLLGSFCGGIIGMIMPALFYMYTGDFNLREVGLLN
                     YVATHLLLVGGVVSVVFGTVTTIYSTSQRSFVS"
     gene            complement(<221400..>222224)
                     /locus_tag="LDBPK_310620"
                     /db_xref="GeneID:13385873"
     mRNA            complement(<221400..>222224)
                     /locus_tag="LDBPK_310620"
                     /product="C-5 sterol desaturase, putative"
                     /transcript_id="XM_003863104.1"
                     /db_xref="GeneID:13385873"
     CDS             complement(221400..222224)
                     /locus_tag="LDBPK_310620"
                     /codon_start=1
                     /product="C-5 sterol desaturase, putative"
                     /protein_id="XP_003863152.1"
                     /db_xref="GeneID:13385873"
                     /db_xref="GOA:E9BMI5"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:E9BMI5"
                     /translation="MEPLYAKMASFDMEALTPAQKYGIQAAFLGIIFVSFGVYSSVVI
                     PVIAAVVKGRIPERVKPLEKLTVKDKLYVGFAKAVTAVFVYHTYQFIRNTEVSRMSPD
                     FLDGPAVVRSVLWLPVHLPALFILYDFFYTLFHWTLHWPPIYSLIHKHHHRQMSPFRG
                     NTDAINDNPIEYVSGEYLHLLALYLLTRLTPVGQVHALTAIIFIFLGGTLASLNHTRV
                     DLHIPYLFNVKAHDYHHRQPRVNFGQYIMLWDWVFGTFQAEGLPSEVSAKSLKKAV"
     gene            complement(<222794..>224170)
                     /locus_tag="LDBPK_310630"
                     /db_xref="GeneID:13385874"
     mRNA            complement(<222794..>224170)
                     /locus_tag="LDBPK_310630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863105.1"
                     /db_xref="GeneID:13385874"
     CDS             complement(222794..224170)
                     /locus_tag="LDBPK_310630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863153.1"
                     /db_xref="GeneID:13385874"
                     /db_xref="UniProtKB/TrEMBL:E9BMI6"
                     /translation="MGFTASEASAPPHLLSDNAEKHFAADIYALHHRLGRCVKQVELL
                     MSSSTGGSSPSHHKGGRASTSCVRRLGELLREARRLEKRVAEASLTKTGNTQETAEPA
                     DDDVTSPLRAYYRQELPGRLTHLLQDADAAQRLLAQYLSQTPTLAHLPVSCVGTAPRT
                     LECGLTAVAATSFSRKCHIYVDVVPPHAACIPPAAVHFIEGASPAGADVQDSSLVRGS
                     VAQTKEEPGFRERRTSAAASFAGYPFGTSSAVGAAITAEDRIMEDIQQAIHQMKDGAL
                     QMSALMEQEKAKMKSAADLLSDGVAKGQAHMHELDRVSYVAEAARVPWTLRFVPGMPI
                     LWRTVLQPMWAFLKQVLVMASIIAVTGCVLLLISVVPKPTVYRRHRLCTHDSRASPPQ
                     STVASATGPVTTAAPPLSEVHVSPPAPYEAEEPVAMDSPAPAETVQEVSPPSSHEENL
                     TAEFRDDL"
     gene            complement(<224658..>226337)
                     /locus_tag="LDBPK_310640"
                     /db_xref="GeneID:13385875"
     mRNA            complement(<224658..>226337)
                     /locus_tag="LDBPK_310640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863106.1"
                     /db_xref="GeneID:13385875"
     CDS             complement(224658..226337)
                     /locus_tag="LDBPK_310640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863154.1"
                     /db_xref="GeneID:13385875"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9BMI7"
                     /translation="MPRPQKASLERSRQQEQLIHKKTMKAPPLTSTPATAQPLQTCSS
                     LLHKASMSQPRHTAARSGGKVHQLRIKNKKSNPNAVTPFNHRARFTKLKRGIHAQRQW
                     VLDCLPAAESHISAGAVPQLEHFEASPVLSSPSSSTKEWASDGESDGDPCAHVGTRRE
                     CLYSQAAVKCAVAAMNSLYASLDAAMKGRRYRQAGRLKRRIHACQLRLRRELKARALQ
                     GPLRSDVGRVSRALSDTTGTDVQETRTTVSSGDAALPYTYRSFHPPSTWLGVGQHPRS
                     AWVDQRTGRYPQLRAEAHLQAVVRHFMNGDVADLDTLPDACKTMIPAPSSSPPSTALS
                     RSQRAMKSSLFAAAYCTNVLTDALDDLCFTLLQGLYKEQRDLKQKQPLQFKARQRYVV
                     GFQEVLKCLKAGRVRLVLLATDVEAVEVPVSAPPPPPPQPSVTAPGVHRTASPSARPA
                     SKSTRKKAFQTLHEAVQLVQQLCGVTGPAERDTVARFNGHSTRAPPLCVSCLSRQRLS
                     YALYAKGSKVGCVAVLQAEKNREALKAVMSYARYLTTAYTAEMETTMVEER"
     gene            complement(<226784..>229234)
                     /locus_tag="LDBPK_310650"
                     /db_xref="GeneID:13385876"
     mRNA            complement(<226784..>229234)
                     /locus_tag="LDBPK_310650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863107.1"
                     /db_xref="GeneID:13385876"
     CDS             complement(226784..229234)
                     /locus_tag="LDBPK_310650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863155.1"
                     /db_xref="GeneID:13385876"
                     /db_xref="UniProtKB/TrEMBL:E9BMI8"
                     /translation="MDAAGAQEDSGTIPLQLDIGYVDVPRDACFSWLQRKYANIKPVV
                     ETSSAGSKGKQLRIDSALLQRLENDVVACDELRWRAFSFPSHPIHPLNASYRHDPGRN
                     AGTPATAVEMHRAKQYSSNGAEHTTNGAKGPCTLVISTRADSEARRRAKKETRKAKDS
                     SAAAIVATSGGPTPKVEDLLENAVRKEKQAYWCRVLGEENVDHETPSSSAGAERWIPR
                     SWRPLLGGYVSAPSRIDQARFLIFPQSGHPVVDTRDPKALSSAPGKSLESPQSVPYYV
                     RGSASWEVEENNPAAGAAGPARATCDEPSDESATRGGLHHSLTYALINPATAPEHCNW
                     ADTVEVSVAHQQARTERQYAPERAKVQRVTLLEDLVSVKTSQGNPRHSTLISATRATV
                     LHSGMKHQRAVSAPSSISKKYSKKAMASAGPDDALFQLRIEDVYDSSVQHFALPGIWQ
                     RWVRPAAARVFTSESDGATGSHSLDDAPRGLYRMRWSGGPGVELCHMGGCTNGAESAK
                     SASAQSSLLTIFGKLCSESWVQVPLSSRWTLTLRNQSAAVVPLEAGAVVAPPSVATEG
                     TGLELANTTPSSAEASGSWMERVCTHPYFWATQGPRWDAALVRGFKNDYNGLHHARRW
                     YSLVSAELTLNGGMQTGNNARVKRSRGAAAPPLQENDSSGGAKENRTGMDEGNAEDST
                     PTAGSRWRGTSLTAFANACMVDSVSDYPRASVGFSFASQIPRLAVTPFNEIVPRKFEC
                     SLSWFAAFQPRAGEAASGKGVNGSAGFGWGLQSGFSNADSSAAEPATAAGGMPFLRVS
                     PVETFQHLRCGLTWRFDD"
     gene            complement(<232450..>232797)
                     /locus_tag="LDBPK_310660"
                     /db_xref="GeneID:13385877"
     mRNA            complement(<232450..>232797)
                     /locus_tag="LDBPK_310660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863108.1"
                     /db_xref="GeneID:13385877"
     CDS             complement(232450..232797)
                     /locus_tag="LDBPK_310660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863156.1"
                     /db_xref="GeneID:13385877"
                     /db_xref="UniProtKB/TrEMBL:E9BMI9"
                     /translation="MCCAANRVSVARRRLECVLSLSLDAHVALSPERCHPPIDMVILR
                     LLSSLLAHLLSPDLHFYRFLDSDEAVFNGAGAAGCRTAVSRRLRMPFRIVRLRLSLPE
                     AVGRDAATRHPAH"
     gene            complement(<233265..>236039)
                     /locus_tag="LDBPK_310670"
                     /db_xref="GeneID:13385878"
     mRNA            complement(<233265..>236039)
                     /locus_tag="LDBPK_310670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863109.1"
                     /db_xref="GeneID:13385878"
     CDS             complement(233265..236039)
                     /locus_tag="LDBPK_310670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863157.1"
                     /db_xref="GeneID:13385878"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ0"
                     /translation="MRTQRLYSQLVTALRSSCVRGSAAAAAAAVCTALRHASAEAVLA
                     QQEHANVHVDSDDAPPAADQEHVQEAGDKEPHQASLVSQLLPYVYGSSGVAGDAHLSL
                     PIDHVALRRIKNIMNVKSKHDLAKALDNVHLLETPEDCTRYVNLTASYIRQQARMEEQ
                     AQSPSLATRQRAAYLQRQLRGVRLSGLEKSALLRKACTLVEERRVPLVVASRLLRFRW
                     PGDLATVACGVRQSYVMDLIRSWATEALQQNELEPRDARALLNNCAFALKSAVRRHAK
                     GQAAEPLSDISSFIGALVMRASQDAHSPAKAEGLIGLMWSVHLTGCPAPASFWDTMVQ
                     RVVSMNEALEGELASSADAAASEDGTPTSARAISTSPASSPSSAKVPRAGHFFSTLST
                     RQLYRFLTVLKLAKWDGNPTVLHRLADQTLRNVAFELEAANFDRHVSSDSECKRAVAA
                     AAKPSIKPFSVMNAAEVHLGTAQQKPVRLPKSVVARRIRQVADLHPDEFLELLHLAGD
                     LGVPFSISATRMVDELLIPLVPHLNAKQLIVLLQVVRHTRSQSSTLLQVVMDRLVERG
                     AAGAYALPLAKAAVKAAAKAPAVFQSLRTDDFVELFTTTCEAQHTLVRAAEVAAMGDI
                     LYALSRRYEETSLQGQRIREVMNLLCAQVDRLVQLQVASSSIADRLLECTVLLRMRAN
                     KVQYPAVQELLASRAVAVDREERCREARQEWALKWAETLAAGAVEGAISSPRRESLKW
                     EGLSEGNLPQVAKAALSVYGEFVYIFERMVTVKAVLTAKDFELFAFSIKKAGLYSILQ
                     GAQLFQQGHFEADVPYTTPASQAAAQGLSRTMPAWMEKTVTNAVLTKLSNSRISSSDT
                     DDDFLKVLGHVHCDAAKVDAVIEMMARSPLRRLQRQRPVWLYIAELARRFGSEETKEA
                     MSAYLKKALY"
     gene            complement(<236700..>237707)
                     /locus_tag="LDBPK_310680"
                     /db_xref="GeneID:13385879"
     mRNA            complement(<236700..>237707)
                     /locus_tag="LDBPK_310680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863110.1"
                     /db_xref="GeneID:13385879"
     CDS             complement(236700..237707)
                     /locus_tag="LDBPK_310680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863158.1"
                     /db_xref="GeneID:13385879"
                     /db_xref="GOA:E9BMJ1"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ1"
                     /translation="MYRCQSALKLLEINDRYRIFHRLRPSTVVDLAAAPGGFAQVALE
                     LMHLPENAPQSVLPPMVVAVDQRSIDPMPGLVAVRGNILQHQRILQTVQGALSLMRAP
                     TTSPPRVLSSAHTAPQTRCVDMVLHDGVSVVKGQRAFSVTYAQNHMALSTLLLASKLF
                     QRRGLMPDLLTDAAPHRSSKPEGRISRSISAPRSSSAVLPVCFVSKVLQCDHSAQVLE
                     ATQALFRYVRIFKPVASRPESLERYVVATDFQLAAWQRLTAPHAPTVPRNWQWRHKHP
                     RSTASVSLFSMPPALEDCGDAHHIAWNCLGCGRTCMGCQPCLQCGPYRPAVGAGARSA
                     H"
     gene            complement(<238913..>244681)
                     /locus_tag="LDBPK_310690"
                     /db_xref="GeneID:13385880"
     mRNA            complement(<238913..>244681)
                     /locus_tag="LDBPK_310690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863111.1"
                     /db_xref="GeneID:13385880"
     CDS             complement(238913..244681)
                     /locus_tag="LDBPK_310690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863159.1"
                     /db_xref="GeneID:13385880"
                     /db_xref="GOA:E9BMJ2"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ2"
                     /translation="MQPPSPSSCDSPIRPAVVPHQPNTTSRTQEDSPLGKASAATLAH
                     ATTTLGLKTEAFTATNATGSVLSATLPPLQADNSFLSSIASGGPSPRSEWSSKTRQYV
                     LPLSSSSYLSHHHPSADSEVQEGGASPSVSRSAQAIVASRSSIARLVESQTTDCDSSY
                     ALSRASDTVPTECLASPPPLRGIVRSAEVSVNLEEAFSAAAGPKVMQPASTATLCTPP
                     KLTGANGHRSSQAVTPFAIAPVATAATPAAFKDRANCNDASVCPKDAMQHSAERGGAY
                     ARHSHVSPPSTSSSASGASELSNDDGGASEGNRLGTPAHRSLLRRSLFGKPSPASHTT
                     SPPPSPTADAAASNGFRGEYSLSQPAAHFPSRCSSRSDTAFVSPSQTALLTGISDVAD
                     TRQCQQNRQQTQQRPLSLVKQTKGNPTPPRTAVSDHESLGSPIHPLQPNSTTAFDEEQ
                     ATAPAAATTEFCSNTTPFRSLVACAAAAAKGPTTDMETRMFPVALLITAPVRLQTAQV
                     SLSTESSPALGAKASREDLSDAEGMLWCGLSHPAQCTACPPQKIEATVDEVLQHLHED
                     SGGVAAHPCRNPYNSPHTPRGLSSVSCASRSLSVSSSGLARSYAASFAGGRSVFVSEQ
                     DGTATAISVSEVQPEELDRCNTPASPHTPLGNRTPGPVGLHDNSTTQYSLGHSHSRYR
                     SQLLSQSITPQRSARRAFSRQTTPSQSFRSKVQSLSFESQQQQYISNHVIDPIKGDSQ
                     LNMCRFLINGEPASTAERDYLAPSRNPFSRYRTLEPYATNLSVLTLGAAPDSASPDFV
                     LSEHDLSENQAAFAAALQRTAVRPDAAVVLYEQLVPPPSNPPGASHRARMEESTAHGP
                     PAALLIPDVDTEERLSLANPFLSASGRSGKHGRTWSVLLEQYKATKPPGAAVVVNGCG
                     RHTTRITAQMRDVQSTAGVIRTDPQTNAAATSSSSSPAVHPGVSVSFALPEIEPLSVQ
                     SLFCHGAQPTMPLVAAVGAASGSIPLHGPLATGASPASSGELLDVSTSTSSLKQPQRG
                     KCATSDSASPLPQRPTQNPINMESHSESSTGCGTVSAGRQLHFEYDEGDEEAAWSDCD
                     EASCPYRPTSVEEGGAQKVLHARSPLDLRAGGSGSTWSSHGSPNCLCHTVANAGFSAT
                     AQPSPVKELKVLRVTSAPPAQPAPEWEAALAPYDREARAAAWPLPSLSLTRLANHSPR
                     LQFLPPALQRRPSSSREVAELCISSESSWARGAQAPVVAGASASAPSSEHADTSATAQ
                     IGCRLAESFSDPLEANDTSEEDVPGDRFQAHHVFQFLHRITTTCGGSDVREAKQEDGR
                     RAIPLCVEVNGVTWLAMHRLNGLPYAVKEVPAAAFNLAELRCLTLSVNPPSCRETTNR
                     ESPLEPRDQYSAVLTADDRLEAEDCIVRYYSVSTPPQNSINPEVHLLQLEYFPRGSLS
                     ELARRCSRTHGAFSAHELSSFSVGAGVLSSRFWLEAVTQGLRGLRVLHHADLIHGCPL
                     PLSLFLCGNTPSAVRFKWSCFGNARSDADIYPTESLPAWVSEAVSRLYRRAISGGSSV
                     TPDVMEVAVFCLGILEVLVNCLPAQVLSVRPSRASQRLSELDWIEVVVMEKHLELYAA
                     EKENGEDMHALVRLMRFLWDVSNSYSTAAQALAQLSVRVDPAARVVEQLYECELARLT
                     RQLEERRRRLHRRQQQGQSQALHSASTAFSLPTDTFFLRSPAMKTVVAGASSRCPGEV
                     GELSSPLLRPAHDLAVTRASISSLGAAPSPPKSRNGTPQLVCSAQLPLHHTLLTRPLT
                     VTGSLFLPSSTAVAPAAAAAPAPPATLRVERTLSDMSGRRGGGGMVGQRTRSELHPGI
                     LKAVNHMLENAVKSGEDGARDAIAALLRPAVESMCQRGWTTLYAGVPLAVAGVVSVDA
                     RAGTSEAAEALMKSLRPMTSFE"
     gene            complement(<246947..>250540)
                     /locus_tag="LDBPK_310700"
                     /db_xref="GeneID:13385881"
     mRNA            complement(<246947..>250540)
                     /locus_tag="LDBPK_310700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863112.1"
                     /db_xref="GeneID:13385881"
     CDS             complement(246947..250540)
                     /locus_tag="LDBPK_310700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863160.1"
                     /db_xref="GeneID:13385881"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ3"
                     /translation="MLSDTESLGFVEEDSSPPLSRQPTKAPVVVPKRPRINTMPRLHS
                     PSLQNAKAAGAKPPLHSSASGAAAGGTAAHPSQSAAASKPAKVDVMSDSDTDSILFAV
                     EDGSAAGMPARSSTSSMALPAARQNLISAAPAGLAKRLSHTGSIGSIQFNSEPGSRRA
                     SPGPKARLNPRASTPVEKAEARAPLLSSVRCCAPTDTSISFIEHGSESIEFGFSPLAQ
                     PETEKCTAPVTNSALPLPPLSPVSGEAAPAGTAGRHSTFNEDSIAFQTEDESDFMQSI
                     DTPALPQNRSLVAMNSGSIPARRDGRSISVLESCAGDSVDNDSIAFMLEDDTNDKNRQ
                     LGATVAYPLKRDTGTPKLSSSHHSHSLHSRPPSRPLSPSIRFDIENTGNESAVERSDP
                     LFGGRGTQPLAADSLPVFGRCSTPTSSPIPDALPSSSNAALGSTAGVGALDAAGEAGT
                     TATPSPTASQPTKKTIVTNRLQQPKNQHSRLPQPRKRAPTPVVRDAELSPARSATHPP
                     LYQRAAVSTPLDAQASGAPSVSPTGGSKSRSASLSDRNVSRKKGARVPLPPRLTHEEQ
                     RGRLKRRSKESSACWTTSESPNHRLVTEEGSTGSMDSPPEALVTGARSHTSTAAASAT
                     ASPTQEIQMAFPAPAGQRAPHSSVQVYSANREVENQYYRHHQQLNRDSNPLTADDHAY
                     PLEMRGELVTGAFEEAEQWRQFNERQRAELVELRKRIAIARRQDRTLLESSPSHEREA
                     LMPTPSSLRFVPQPTPMGGGYSSRRSRSQRALHQAEARDKDAKRGGVQGKPFREARGT
                     SPPTGSARRLQASIKGAHAPAAAAKPSPCPAHRTGPAVSPPSPYPRATSAMHGVPSDI
                     IAQSAAAASVADLLGILWPPRTSAADPSLRRSQAIGAFVLESGTPAVDLYFLNGSRLT
                     PEQVARFLDLVRVQRDAEPHTGAAAPTRASVVGAMETLSPTTLRPQATPSSLTVSAKR
                     GGNVVYVDPADLYAFGRSIPLSLSPARDSRAAPLSAKLTALLPKKAIRRSRVLREVFD
                     AMDLKRQGSIALHHLPSLARLFEVELASIEHTRESLLQGNAVPLRSLLESAVASRQLH
                     ATSWRGARENVADGVQKGLGAVNGVALDYAGLTRDEQASLTHLTHRLLLLSFAVNVVI
                     PIASASRIPLLDFSTLSMIVYAAVDNVDQPMGSPKGEWRQVVQQYFIALAA"
     gene            complement(<252118..>252966)
                     /locus_tag="LDBPK_310710"
                     /db_xref="GeneID:13385882"
     mRNA            complement(<252118..>252966)
                     /locus_tag="LDBPK_310710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863113.1"
                     /db_xref="GeneID:13385882"
     CDS             complement(252118..252966)
                     /locus_tag="LDBPK_310710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863161.1"
                     /db_xref="GeneID:13385882"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ4"
                     /translation="MGKIEVTVCAARKLHDCQLIGLPDPFVRLVMGDKKYKTQVVKNS
                     LNPEWGETFRFHIPDEMSTQLRLEVWNKCTYSDDLMGYYTLSLGGLTKGIVKDQWYIL
                     EKSKTQAELHVRLLAVDFGALPKQEELWMVTTDINRDPVKRAIEDGTWRPGQKTAPPQ
                     PQQQAYALPAPVPQQQQQNLGVQCVAVSPQQVPYVPLLPVQYVPLPQAQYTPQPQPVQ
                     YVQQQPPQGYYQPRPPLPQPSYYPPGPPSPLQSGYHQQPPVPSQQVYYTQLPSQCYAP
                     QPQYQY"
     gene            complement(<253767..>255215)
                     /locus_tag="LDBPK_310720"
                     /db_xref="GeneID:13385883"
     mRNA            complement(<253767..>255215)
                     /locus_tag="LDBPK_310720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863114.1"
                     /db_xref="GeneID:13385883"
     CDS             complement(253767..255215)
                     /locus_tag="LDBPK_310720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863162.1"
                     /db_xref="GeneID:13385883"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ5"
                     /translation="MSQPYSAVADATGKAYVDIRVCDLLVQQGSMPKGLDSDFQIDGL
                     YVVLRCQGDVRRTSCLWSSASGASPAALRGSATQRGAAAGACEAQSDDALVWNEMFRV
                     VVPPALPLSTPATSPRGPHSPSSADGGDPQGGFSAPYTPPLHRSGSASGAGGGLRDMS
                     GGIALPMSTAASGGMRATGSSGFPVSYAPQPSSLVISTPSLHSAAAQQQSSGDGNGAR
                     ATEVGASHAPLFYPAIELELWRSAPLSENLLGRYTYHVPMELMQGGYALSNLDAVVER
                     VVLLRTKEAPSIMGNLYGWSGHRLSLRLRVQAVGLAPLMAAWSPQQGSEATMTAASTI
                     GSAAYPVPFPTGMLGNTVTGGPPYVAAGVYGAPLGTLNPVLVNLLAPLGVPTGGSGAG
                     QLAPTMMMSMPGGMGGDNLHKPGQPPFFSMFPPASEAAANVGGRMFHPDVPGVLPATP
                     QSSGQGILGDGDLTWQSGTTQPTVYPSYRLPR"
     gene            complement(<255866..>258523)
                     /locus_tag="LDBPK_310730"
                     /db_xref="GeneID:13385884"
     mRNA            complement(<255866..>258523)
                     /locus_tag="LDBPK_310730"
                     /product="ATP-dependent zinc metallopeptidase, putative"
                     /transcript_id="XM_003863115.1"
                     /db_xref="GeneID:13385884"
     CDS             complement(255866..258523)
                     /locus_tag="LDBPK_310730"
                     /codon_start=1
                     /product="ATP-dependent zinc metallopeptidase, putative"
                     /protein_id="XP_003863163.1"
                     /db_xref="GeneID:13385884"
                     /db_xref="GOA:E9BMJ6"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ6"
                     /translation="MQSLAAVTPSYFSAALQSRYTRVPATGTQPAQTPSTPTSLSDVM
                     TTIRCLSYADRLHRHLGTPRHVEDVCASVKSSQKLSALFETLRQRPIGSASSTAFHTK
                     GVLLSKDGGHRGGENGKGEEEGAADEGEDKPEDWIVPRTCLFVLIMIAITVVLYQLAR
                     PSGTHTGWASLNKHAGEIKEAVLYENYLQVYMDDAKVYLGLVNDHDTQRHMDELADNY
                     RAARKQTLKAQQQQSGETAPADGGKHEHGSKLPMAADTPAELELTMKGRPFAETALIG
                     VGAFAWVVPFIFFPVFVMFLSQYIGKSMSYAVEATKGKTKAKEMIFRVETASNTRFRD
                     IAGMKEPKKEITEIVDFLRHPERYTKLGAKIPTGAILLGPPGTGKTLLAKAVAGESGV
                     GFIPAIGSDFVELYVGMGALRVRQLFKEARKQRCIIYIDEIDAIGLKRQGAGHGEKQE
                     QEQTLNELLTQLDGFSTGRRGDVMVLASSNVAQEALDPALIRPGRFDRIIHVDTPVIS
                     ERIDIFKVHLSKLKLTSDDTRGDSAAATTATAGAADGAAGGADAPTAPPLAAPVSTET
                     SLVLSQVKTEERETAEERQRKDDASAAVSADAKGISSDNPSSNSSAYEFDIRSLLMQK
                     SERERALIDAYAQRMSNLCPGFVGADIANVCNEGAILAAREGADHVSISHLERSIDRV
                     LAGIEHRSRALSDFEKNVVAHHEAGHAVAGWFLHRADPLMKVSIVPRGGSALGYAQYL
                     PNENFTRTAKEIRDSISVTLGGRAAEQIFFNHLSTGASDDLRKVAKMAYQYVSSFAPG
                     SVYPPPGSNSTRLVKPFGVDKANDFDRRAKTLVDEVYADTLALLTKHKDDMKKLADHL
                     LKHELLTYADVVHYLGERTTRQTDRKKGV"
     gene            complement(<264454..>264843)
                     /locus_tag="LDBPK_310740"
                     /db_xref="GeneID:13385885"
     mRNA            complement(<264454..>264843)
                     /locus_tag="LDBPK_310740"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863116.1"
                     /db_xref="GeneID:13385885"
     CDS             complement(264454..264843)
                     /locus_tag="LDBPK_310740"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863164.1"
                     /db_xref="GeneID:13385885"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ7"
                     /translation="MMEGNASEAHVHSGMAMGLQERPPLELASHASEVSCLTLNDNYD
                     MWNASMYPNLNSGFDASLTSATTPDATAAWFAPAMRPQRKQQLSHQMMPLPARSEQTT
                     SDIDSEVVLWDRPPTQEVLTPPAASGL"
     gene            complement(<269438..>272377)
                     /locus_tag="LDBPK_310750"
                     /db_xref="GeneID:13385886"
     mRNA            complement(<269438..>272377)
                     /locus_tag="LDBPK_310750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863117.1"
                     /db_xref="GeneID:13385886"
     CDS             complement(269438..272377)
                     /locus_tag="LDBPK_310750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863165.1"
                     /db_xref="GeneID:13385886"
                     /db_xref="GOA:E9BMJ8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ8"
                     /translation="MSHAHPRTHPGTKRDVAQTSPCPPGTLSLRVSFAASKPEDRKRA
                     NNNRTASQQYELSFISTEMLLGEPLERLVVPRSPLYPPNIISLANRDTDTTGGEDSTS
                     SAENEPITVGISDHNGKTTAKHGECRKRTERDAARGALLIYPTKIDNLRRFRILFAGV
                     ILSISSSTQGIHSIFGVLLLQQAYQFSVREMTVVYLSGISAGLFALPFGALYDWFGPR
                     VVVALGSIIAALGHLLFALTFGGHIPHTVVNCAVFYAVMCWGCYALHVATLPAVLTHM
                     PRDRGQPTGLLQTFSGLGASLFACLFRGFFKDNFENLMWFMFAVTLAAGAGGAWYLED
                     APYVVNRWRQRGITPREQLRAYLIRNRYMSQLVPKRRYAIMAVILVLLNFYLTIQTVC
                     VAYLATDITPGKLRGIAIGAIAITLLILVLVVPLDSIDGLSEQDKQVIAAAKAKEEAL
                     RVMQEERYRQRHLKARQAQRYRSKTRQEECVKPCHCPDEVGEGERSADQELPVGGPLN
                     DDRDSGIGAPEHGAQRLARPLLRLDDESDADSNVETSSPIDVAVPAGPVSAGPPQAPH
                     HRGGLLSESLGLPLYELTGTERPLITVYMHEEKDLDGEPPHSHSSHPQEQIQLQASND
                     STGVTNKDRRSESQQSSLENSFTVHLEGNYNRLQTSDAHTPSARSDPAHVELRRTASS
                     TYSNPRVETITLCGEVYVVPVYQTTFLESLTYLDLWLIFYTTLCVWGVGLVMTSNWNI
                     QIMVKARYGAMEPKHYVLFAAMAGVSVAGGRVFLGIYERVLQVLRERAGTVVVPTLIY
                     PIASVGLFVGMLFWIALPGEQVLILAYILGAFFYGMSTSATFYVLGTVFDRDMGMHYG
                     FCYVGGGVGFALCYWCAWHLTYEREASPQTLGYCVGARRCMNRAVGVYLALAFSSIAS
                     SYLVHRRYSKLVRGKLVQRRVIVPRIKQFLVACGCCENGGQVKESGNTCIIGAVETKE
                     KGVQLQD"
     gene            complement(<274346..>274678)
                     /locus_tag="LDBPK_310760"
                     /db_xref="GeneID:13385887"
     mRNA            complement(<274346..>274678)
                     /locus_tag="LDBPK_310760"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863118.1"
                     /db_xref="GeneID:13385887"
     CDS             complement(274346..274678)
                     /locus_tag="LDBPK_310760"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863166.1"
                     /db_xref="GeneID:13385887"
                     /db_xref="UniProtKB/TrEMBL:E9BMJ9"
                     /translation="MSSIAFCLPAALQLVMPSYREVSQSVPSADSSSNYPSERGVFTE
                     VKKAPLVCLHEPLTLQQCILAHEADKEPENDETEFLDAACVYVARRHHLDQVEAAYSS
                     GERAQVSN"
     gene            complement(<275782..>276735)
                     /locus_tag="LDBPK_310770"
                     /db_xref="GeneID:13385888"
     mRNA            complement(<275782..>276735)
                     /locus_tag="LDBPK_310770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863119.1"
                     /db_xref="GeneID:13385888"
     CDS             complement(275782..276735)
                     /locus_tag="LDBPK_310770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863167.1"
                     /db_xref="GeneID:13385888"
                     /db_xref="GOA:E9BMK0"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="UniProtKB/TrEMBL:E9BMK0"
                     /translation="MEEKQAFFVESTDGRKFKMVIRGDLGKLSVAKIRRYLKSYGVPE
                     NQLLLAGNRVLEDSMLGEQFGLENEGVLHLQEPTTMRPLAPAAVPPTTHSRAQLEQKP
                     QLSYGPQSARRETQYEPATNDARQMEREIERLQRQVEAAEARNADLEHQLAQVAKPSA
                     AYPPRGGADGARRMSESSDLDGLQVAKESLKILAQKLGVSLQFDKNLTCVVGTDADFS
                     LLLTYDPATERLYIYSSLLTELPDHPPLRMKLYEVLLEGSLLGREVCGGGVGLSTQNN
                     VVVLTTSLPVRHCSPEALCEVMPLFVETLVRWRSLIDELLR"
     gene            complement(<279643..>280536)
                     /locus_tag="LDBPK_310780"
                     /db_xref="GeneID:13385889"
     mRNA            complement(<279643..>280536)
                     /locus_tag="LDBPK_310780"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863120.1"
                     /db_xref="GeneID:13385889"
     CDS             complement(279643..280536)
                     /locus_tag="LDBPK_310780"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863168.1"
                     /db_xref="GeneID:13385889"
                     /db_xref="UniProtKB/TrEMBL:E9BMK1"
                     /translation="MTKSYLSPDQQLRAQQVYTTHKHLKELSMATKEALIYHDKYIAA
                     MEKVISCLLNNSDTMEDARKHLAQEAAVDIQPTSPTAGRLAAAYSNWRVSAELHMMRT
                     ELEFLKEVSTTGREAVKKTKNAVHGLEKVAKKCAHVNSPEFEAKISNKSAKALEKLLH
                     EQRETNTMMMSMENAIKNDMMSLATSWSAKLVTRGDALYTAFRSLGCRTVACFPTTAL
                     TLPQRMPPPTAGYVLPPPSSASTSASYSGGNAVGYGTPSAYPAAQGAECAAVPLGSAG
                     EGAAEGVTLEFNLNEGKPVSR"
     gene            complement(<284945..>285847)
                     /locus_tag="LDBPK_310790"
                     /db_xref="GeneID:13385890"
     mRNA            complement(<284945..>285847)
                     /locus_tag="LDBPK_310790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863121.1"
                     /db_xref="GeneID:13385890"
     CDS             complement(284945..285847)
                     /locus_tag="LDBPK_310790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863169.1"
                     /db_xref="GeneID:13385890"
                     /db_xref="UniProtKB/TrEMBL:E9BMK2"
                     /translation="MATVPQQVPLSNTNRRAQREWVLKIKETSNMLYRSAAQAQRNFD
                     QYLTAMEYVGALYKDYGELLSAAQNSFLNVQPDVEGVDDVKNICSRLHISIHRWEHSE
                     ELYAVRNQLHQQTQMLKARSDHSSRVLQECVQRDELIKMHTEKSALLATNLRKQSSEV
                     DKLQKECDKLHRKIAKRSEVAQKDLDSMAVKSTAAILSLTSQFFKVMHKNGAFIADRF
                     SPDRAGVGEHDLDTASDDPVTGTLRRLHSVRSEMSSVAPSAVYGQNYNTFHPSEADTR
                     VSDGARNSGIPLRYETNVPPAMSA"
     gap             289576..289674
                     /estimated_length=99
     gap             291693..291791
                     /estimated_length=99
     gene            complement(<291861..>292796)
                     /locus_tag="LDBPK_310800"
                     /db_xref="GeneID:13385891"
     mRNA            complement(<291861..>292796)
                     /locus_tag="LDBPK_310800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863122.1"
                     /db_xref="GeneID:13385891"
     CDS             complement(291861..292796)
                     /locus_tag="LDBPK_310800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863170.1"
                     /db_xref="GeneID:13385891"
                     /db_xref="UniProtKB/TrEMBL:E9BMK3"
                     /translation="MSMQQDFVHPRQMDDMRAIHAAINSFSGVMTKMMMLMKELGTTL
                     GHVSHAFDALTSLSFTDDEVKQYVHHFGEEVISMKEGIAFCQYNKLVHEDVQLPVEQL
                     KKSLKEAEKAAKAEKSAFEKYRKAKQCVDKQEKAFAERSKPLDTSKSYPTHVQARNKA
                     LVSLQNCNKEFEDRFAMLVNDVKNVTATALKRYLELNAGYMTSVVDALTKTDPTIEEA
                     AVLHCQEQQEHRQSVVEQRCLQANSELSIVHASQGYRLDPSKMNGGLHDGIIFKSLPS
                     RFRQQHRVSSTVSRGQPPRGRMPSPAMTAMNGGLK"
     gap             292972..293515
                     /estimated_length=544
     gene            complement(<293827..>294564)
                     /locus_tag="LDBPK_310810"
                     /db_xref="GeneID:13385892"
     mRNA            complement(<293827..>294564)
                     /locus_tag="LDBPK_310810"
                     /product="c2 domain protein, putative"
                     /transcript_id="XM_003863123.1"
                     /db_xref="GeneID:13385892"
     CDS             complement(293827..294564)
                     /locus_tag="LDBPK_310810"
                     /codon_start=1
                     /product="c2 domain protein, putative"
                     /protein_id="XP_003863171.1"
                     /db_xref="GeneID:13385892"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BMK4"
                     /translation="MGRLEVCICGARNIGDTRKAGAPDPYVKVVMGDRKKTQSKYKTK
                     VASSSLHPVWNEVVKFQVADYDSEQIVFELWNNNVIVDDLMGAYALSLNGLTRGVVSD
                     LWVILKGTGLSSAELHLQALAVDFGADPQPSSMVVRSIEEYNAAAATKHATGTTEMKQ
                     VACADDLDCVQKPSSSEPAIGIPLQAQVALPPKLQPQPFYTQQPTYAQQAQPPPHPIY
                     YQQAPLQGSYYGAPPQPPQCMYGPSPI"
     gene            complement(<295604..>296470)
                     /locus_tag="LDBPK_310820"
                     /db_xref="GeneID:13385893"
     mRNA            complement(<295604..>296470)
                     /locus_tag="LDBPK_310820"
                     /product="c2 domain protein, putative"
                     /transcript_id="XM_003863124.1"
                     /db_xref="GeneID:13385893"
     CDS             complement(295604..296470)
                     /locus_tag="LDBPK_310820"
                     /codon_start=1
                     /product="c2 domain protein, putative"
                     /protein_id="XP_003863172.1"
                     /db_xref="GeneID:13385893"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BMK5"
                     /translation="MGRLEIRVCGARNVANVQKVGKPDPYVKVKLGSNKKSQIKYKTH
                     VAENCLNPVWNELFKFQVADYDSMQVVFELWNDNVIVDDLLGSYSLSLNGLTRGVVVD
                     TWVLLEGTKGSPSELHLRVLAVDFGRDPGPGDRLTLSLEGDTMVPSTGQTYRPPKNYV
                     PPAQGIVLQSYPPAPLGPPPPVVYSASAAPMPQVQYGYMAPPQPQGYAYGAPPPLPQQ
                     PPSQGYGYGAAPAPQNYSYGAPPPPQPMYGAPQPPQSLPYAAGPPPPQMYGPPPPQRR
                     PVQMAYGIPPDM"
     gap             301635..301733
                     /estimated_length=99
     gap             302587..302685
                     /estimated_length=99
     gene            complement(<302686..>303417)
                     /locus_tag="LDBPK_310830"
                     /db_xref="GeneID:13385894"
     mRNA            complement(<302686..>303417)
                     /locus_tag="LDBPK_310830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863125.1"
                     /db_xref="GeneID:13385894"
     CDS             complement(<302686..303417)
                     /locus_tag="LDBPK_310830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863173.1"
                     /db_xref="GeneID:13385894"
                     /db_xref="UniProtKB/TrEMBL:E9BMK6"
                     /translation="MPTHRENEDHLAFTNPSMASVSLSRDNSAQGRAAREPISTREAP
                     EEDIFPAPHQSAACMNTSRKDSIDEMVSRIAIPDNIPIQNLPVLNAPELKLIGRCVSF
                     CVKLPPNGPTSVSYYYTGLVSMVTGTSVGLIYVNRYTCEDFEAYKAHEKCLANSENPA
                     PDEQNTVKSAPHRIQKAMKVLRHLHSVPTAANVEASATQSGPSVFDGLPVHPNSKEGE
                     AGADDERALSITADSCVLCAADAAGS"
     gene            complement(<304760..>306649)
                     /locus_tag="LDBPK_310840"
                     /db_xref="GeneID:13385895"
     mRNA            complement(<304760..>306649)
                     /locus_tag="LDBPK_310840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863126.1"
                     /db_xref="GeneID:13385895"
     CDS             complement(304760..306649)
                     /locus_tag="LDBPK_310840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863174.1"
                     /db_xref="GeneID:13385895"
                     /db_xref="UniProtKB/TrEMBL:E9BMK7"
                     /translation="MEEHPAFGGREPTSINGFHDDAQRERARREPASRQDMGLEEDLD
                     HRIGRERPSRSPTYDPTASTEDLVPRIVLCEDRPIENLPVMVSPELKLIGRCVTFLVK
                     QTLNGAAATSYYYIGLVSTVTASTATLMHVDRYTPADFKAYKSREQRLANGLAVPVNT
                     GSSIGNNRGREFNEVSMSANNRPPSSLPDGELRSYSRANEDEVAAAEDGSLTRARGAG
                     QLIDLYASGSLAHSAPLTTETELATAISTQRDKEQLRAPYASLEENQEQPEAGGAARY
                     RHFRRFSGSIGPIPYVTFLRKNIQDVEFGRDPNAIFYSLFQDPAKHIDDMQCLRMFVR
                     RYLVHTSEGNNPRQVPLYAFLSVRCAWPDVDRELVNRLVHEELTALVKADRAIKSEKE
                     RKRAREERQLQRYRTPAGLFSSTGILYLTKIPQRSFFSGIVTLLFSLLFAVYLGVVLS
                     ITSDALIVSFVSKFMFSFVASVVVWPTAGVAIMLHASQGHIPLLVDHFRLGVRIAFTL
                     AAIGCCMMTLLVVLWKMTNQAMYDLMLVHQRDQLCAFYQQHTCTGFSDACGSGRIDPN
                     LCSLCSNMPVTNTSCYAYLWVEVEKALVPLVCFTCIILMATVYAVYLVVKLFLFVEAM
                     MGRIV"
     gap             309392..309490
                     /estimated_length=99
     gene            complement(<309493..>309855)
                     /locus_tag="LDBPK_310850"
                     /db_xref="GeneID:13385896"
     mRNA            complement(<309493..>309855)
                     /locus_tag="LDBPK_310850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863127.1"
                     /db_xref="GeneID:13385896"
     CDS             complement(<309493..309855)
                     /locus_tag="LDBPK_310850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863175.1"
                     /db_xref="GeneID:13385896"
                     /db_xref="UniProtKB/TrEMBL:E9BMK8"
                     /translation="MRSNGAGIFASAAGIEASATQSGPSVFDGLPVHPNSKEGEAGAD
                     DERALSITADSCVLCAADAAGSLAPAVPLKTVAELETAEVRDGDGRECVLGAARLLLE
                     EGAGGAGAVNRGLRVRAFR"
     gene            complement(<312574..>313500)
                     /locus_tag="LDBPK_310860"
                     /db_xref="GeneID:13385897"
     mRNA            complement(<312574..>313500)
                     /locus_tag="LDBPK_310860"
                     /product="triacylglycerol lipase-like protein"
                     /transcript_id="XM_003863128.1"
                     /db_xref="GeneID:13385897"
     CDS             complement(312574..313500)
                     /locus_tag="LDBPK_310860"
                     /codon_start=1
                     /product="triacylglycerol lipase-like protein"
                     /protein_id="XP_003863176.1"
                     /db_xref="GeneID:13385897"
                     /db_xref="GOA:E9BMK9"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BMK9"
                     /translation="MPHSSCSRIVVVAALLLLCGSARAVVLSREYSQTDARRSLQYAN
                     VTYADIDAIESWKCGGSCNANPSFKVTSIVKGDDAHSLLAYVGVDDGSAQVVVALRGS
                     ATQQEKLMRRPAEPVLYDITSGCGLECRVHTGFQRSYLAVRRTVRAAVVRDLTMHPGY
                     NVLVTGHSVGAAVALLAAVDVQAHVNRMFFVSRPIVSLYTFGMPRVGNQAFAVWAAGM
                     LSRGSHFRITSRHDPVPRMPSSGSADFQHVPYEVYCAAAAGTNCRVCEDSADGDDPTC
                     IVQASKVDMRDHFFYFGERISGGAAGDAMLYL"
     gene            complement(<315163..>315867)
                     /locus_tag="LDBPK_310870"
                     /db_xref="GeneID:13385898"
     mRNA            complement(<315163..>315867)
                     /locus_tag="LDBPK_310870"
                     /product="lipase precursor-like protein"
                     /transcript_id="XM_003863129.1"
                     /db_xref="GeneID:13385898"
     CDS             complement(315163..315867)
                     /locus_tag="LDBPK_310870"
                     /codon_start=1
                     /product="lipase precursor-like protein"
                     /protein_id="XP_003863177.1"
                     /db_xref="GeneID:13385898"
                     /db_xref="GOA:E9BML0"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BML0"
                     /translation="MRRVQSWTCSSACGSVAAFELTAVMNHIITGAGGFVGVDHATQQ
                     IAVAFRGTGNIQSILAGINVLLAKYDKSSSCGSRCEVHNGFYASYMSLRQQTRDAVLK
                     LIRKGPTYEILATGHSLGGAMALLAAADLQERLNNLESSSDLKPVPVYTFGAPRVGNA
                     AFAEWVDSLLAKGAKYRITHAGDPVVLVPARTWGYVHSTSEVFYKTRSNHSCDVQRLA
                     RSGGLKVHPRNVLSWA"
     gap             318459..318782
                     /estimated_length=324
     gap             318909..320179
                     /estimated_length=1271
     gene            complement(<320180..>321175)
                     /locus_tag="LDBPK_310880"
                     /db_xref="GeneID:13385899"
     mRNA            complement(<320180..>321175)
                     /locus_tag="LDBPK_310880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003863130.1"
                     /db_xref="GeneID:13385899"
     CDS             complement(<320180..321175)
                     /locus_tag="LDBPK_310880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003863178.1"
                     /db_xref="GeneID:13385899"
                     /db_xref="UniProtKB/TrEMBL:E9BML1"
                     /translation="MSMQQDFVHPRQMDDMRAIHAAINSFSGVMTKMMMLMKELGTTL
                     EQVSHAFDALTSLSFTDDEVKQYVHHFGEEVISMKEGIAFCQYNKLVHEDVLHPVEQL
                     KKSLKEAEKAAKAEKSAFEKYRKAKQCVDKQEKAFAERSKPLDTSKSYPTHVQARNKA
                     LVSLQNCRNEFEDRFAMLVNEVENVTATALKRYLELNAGYMTSVVDALTKTDPTIEEA
                     AVLHCQEQQEHRQSVVEQRCLQVNSELSIVHAPQGYRLDPNGMNGGLHDSIKKSSNSF
                     QDQHRVSSTVSRGQPPRGRMPSPAMTAVEGGAPSPHRGASAVVSLRTLKPTAEAAT"
     gap             322398..322496
                     /estimated_length=99
     gap             323761..323859
                     /estimated_length=99
     gene            complement(<329426..>331255)
                     /locus_tag="LDBPK_310890"
                     /db_xref="GeneID:13385900"
     mRNA            complement(<329426..>331255)
                     /locus_tag="LDBPK_310890"
                     /product="ras-like small GTPases, putative"
                     /transcript_id="XM_003863131.1"
                     /db_xref="GeneID:13385900"
     CDS             complement(329426..331255)
                     /locus_tag="LDBPK_310890"
                     /codon_start=1
                     /product="ras-like small GTPases, putative"
                     /protein_id="XP_003863179.1"
                     /db_xref="GeneID:13385900"
                     /db_xref="GOA:E9BML2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BML2"
                     /translation="MSSIGQHVNIGDADDYTYTEDPAGQRVKVPVSKEYVFKVVILGD
                     YSVGKTSLIKRLLSIPASCASPRRHEDCSDMDDSVGDSDADDLLATVTPTVGTDFYSL
                     TLPDVVPGASVRLQIWDTAGLEKYAASYESTLRNASFVICVFDVTNPSSLHSVVDRHL
                     SIVADHMPHLDQSDIMVVANKIDIIADVSTNSEALRSARKRARLPENAFVIAIDEDAS
                     VDTNDSSPDVFTSAEGASDNAIVTARKVQEEVFDIFTDVHYAEVSAKTKQHLREMLHA
                     VCYALLRNSVGDNPNIRVPDGAPPSEVFAHTVLPPHSGAKCSTGASAGTFSVPQLDPA
                     TKTPPAAVPRDSPTTGSLQPPPRTTPAPPAASWRSNEATSFDLAPTHFSSKAVFSPAE
                     GSEGAIGKSGGDDSAPRHVGSAGDSPVDGSSTRLPTPRGDLAKAVDAGGVHLDLTAGS
                     TEPRTGPDPKEDPKARKEREQAEMKAVLSRAGGRKGNPNGGGADTDSLAAWLQSDADR
                     MENDVALGLKKAGDAPSAARPAPVSSILGSHGVQDHCKGNQGTRGRDSDDDDDGARMQ
                     VQLKERFAQIEHDIRQNAAAANQRAKKAKKKTKAKGKCNCCVL"
     gene            <332223..>332492
                     /locus_tag="LDBPK_030820"
                     /db_xref="GeneID:13385901"
     mRNA            <332223..>332492
                     /locus_tag="LDBPK_030820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863132.1"
                     /db_xref="GeneID:13385901"
     CDS             332223..>332492
                     /locus_tag="LDBPK_030820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863180.1"
                     /db_xref="GeneID:13385901"
                     /db_xref="UniProtKB/TrEMBL:E9BML3"
                     /translation="MNDCEESERGTGRANHGRASFKSDTLSFFGLLPLTSRSAEKKKS
                     DGRVESESRCVCCKTTQPHLRFCGCREERQVSDRILHCAVVPQTIE"
     gap             332494..336849
                     /estimated_length=4356
     gene            complement(<336850..>336993)
                     /locus_tag="LDBPK_310900"
                     /db_xref="GeneID:13385810"
     mRNA            complement(<336850..>336993)
                     /locus_tag="LDBPK_310900"
                     /product="amino acid permease 3"
                     /transcript_id="XM_003863133.1"
                     /db_xref="GeneID:13385810"
     CDS             complement(<336850..336993)
                     /locus_tag="LDBPK_310900"
                     /codon_start=1
                     /product="amino acid permease 3"
                     /protein_id="XP_003863181.1"
                     /db_xref="GeneID:13385810"
                     /db_xref="UniProtKB/TrEMBL:E9BML4"
                     /translation="MSKPSESIPAQAEGEVLSDSLIDGNPGNAVDKHPSGEQGNHLHK
                     NGSL"
     gap             342575..342673
                     /estimated_length=99
     gene            complement(<342925..>344367)
                     /locus_tag="LDBPK_310910"
                     /db_xref="GeneID:13385902"
     mRNA            complement(<342925..>344367)
                     /locus_tag="LDBPK_310910"
                     /product="amino acid permease 3"
                     /transcript_id="XM_003863134.1"
                     /db_xref="GeneID:13385902"
     CDS             complement(342925..344367)
                     /locus_tag="LDBPK_310910"
                     /codon_start=1
                     /product="amino acid permease 3"
                     /protein_id="XP_003863182.1"
                     /db_xref="GeneID:13385902"
                     /db_xref="GOA:E9BML5"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BML5"
                     /translation="MSKPSESIPAQAEGEVLSDSLIDGNPGNAVDKHPSGEQGNHLHK
                     NGSLTASSSHNDNGADAAKPGRNIIFRFTGWLIPYGGVISNCFSLGSVTLGGGIISMP
                     SSFAMSGIIMSVIYLVVITAATVYTMTLLGYAMKATGCKTFEELSLVLFGRGWDYFVG
                     FVLWLSCFGTAVAYISAVSSLITPILEKSPGTPAYLLTTSGNRLITSLIWLVFMVPVV
                     IPKRVNSIRYVSAIGVFMVLYFAVTIVVHSSMNGLKEGMRGDMKYFTSGNEAVYGLSI
                     FIFSFLCQAVTGSVYFEQRPRPSVRQLTIASAISMTVCMVLYIFTGVFGYFDFADDTQ
                     DSILYNFDPVHQPYMMIAYIGMLIKICAAFAMNMLPCRNFAYHCLNWDLETVPYWKHT
                     IAILTMAVATLVCGLFIPSINTAFGLVGSLCGGFIGFIFPAYFWMYSGNWSLSSVGIW
                     HWLATYFLVVAGVIAVVFGTISTVYFSFFV"
     gap             344719..344817
                     /estimated_length=99
     gene            complement(<346464..>346940)
                     /locus_tag="LDBPK_310920"
                     /db_xref="GeneID:13385903"
     mRNA            complement(<346464..>346940)
                     /locus_tag="LDBPK_310920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863135.1"
                     /db_xref="GeneID:13385903"
     CDS             complement(346464..346940)
                     /locus_tag="LDBPK_310920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863183.1"
                     /db_xref="GeneID:13385903"
                     /db_xref="InterPro:IPR029488"
                     /db_xref="UniProtKB/TrEMBL:E9BML6"
                     /translation="MEPKRSGNMACVERERERNYRRHLERLNNQRCRIDNTMPDSYAY
                     VRPIGSMRGNPARVEQVNRDNQKLVEKMVHIMNTRGGVDTSEPWRDCNKAINSQRRRN
                     QEQAKIALENAKLLERLERAQPTYRSEKFEADRRRNEEFAARASRYPYQPMDRTSY"
     gene            complement(<348567..>348797)
                     /locus_tag="LDBPK_310930"
                     /db_xref="GeneID:13385904"
     mRNA            complement(<348567..>348797)
                     /locus_tag="LDBPK_310930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863136.1"
                     /db_xref="GeneID:13385904"
     CDS             complement(348567..348797)
                     /locus_tag="LDBPK_310930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863184.1"
                     /db_xref="GeneID:13385904"
                     /db_xref="UniProtKB/TrEMBL:E9BML7"
                     /translation="MQLLIVALAACLSVAAAKSKEEFPLVWVCLGITVVGVIAALYVA
                     YKRPDELHLPGSVVMTAVESDPGNGKSVAENV"
     gene            complement(<352856..>353215)
                     /locus_tag="LDBPK_310940"
                     /db_xref="GeneID:13385905"
     mRNA            complement(<352856..>353215)
                     /locus_tag="LDBPK_310940"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863137.1"
                     /db_xref="GeneID:13385905"
     CDS             complement(352856..353215)
                     /locus_tag="LDBPK_310940"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863185.1"
                     /db_xref="GeneID:13385905"
                     /db_xref="UniProtKB/TrEMBL:E9BML8"
                     /translation="MGGLLEKSENRQSRNASKRLRSSSVPRGNDSNDGEPSSSAERLV
                     APPAGLLTSTVRRYLCLPTTHSRSSKGEKATSLAAQFYLMTVSQAQIPLLCLTLWKEA
                     KLCDGGGFIQRAKVCRF"
     gene            complement(<354449..>359110)
                     /locus_tag="LDBPK_310950"
                     /db_xref="GeneID:13385906"
     mRNA            complement(<354449..>359110)
                     /locus_tag="LDBPK_310950"
                     /product="sodium stibogluconate resistance protein,
                     putative"
                     /transcript_id="XM_003863138.1"
                     /db_xref="GeneID:13385906"
     CDS             complement(354449..359110)
                     /locus_tag="LDBPK_310950"
                     /codon_start=1
                     /product="sodium stibogluconate resistance protein,
                     putative"
                     /protein_id="XP_003863186.1"
                     /db_xref="GeneID:13385906"
                     /db_xref="UniProtKB/TrEMBL:E9BML9"
                     /translation="MGNRQSSVPLEGEGHPEVFYRGVKAAQEGRFTVSEVYFVQALTR
                     HPGRHFWDTFTKAVLQKERSAGFEGGGASLPKDGVQEDVDAGPAADGPLGPCNDVQPQ
                     TVLGGSVPDKADELPGSGDRGDGGDSAEQADARTNGAQSVHDTKVVDVFLPLDGGLTD
                     VMDYYRLLADIGHTYLQLIPSTAHMEKVTGLAARYCIFTITHTQMLLHCLTLWKEAKL
                     GDGGGFIDYAKVRNLKICSGVAELSAELNPDSHSSNKGKQKWRTIDRTASLLFTLQLL
                     EANCRYYCLVFLADYCGLLLRSYSRLTDQRKVNRVHANIVEHLDMVSRLVLGLAGEYP
                     NEYLSRLIMASLPKPSNFDRECLSSMGASSHMSSQKILSFGNDQHRHLYASGYPWSPT
                     ESALIPLILARNVRLNVQENVSRHSQAQLRSPAERMSYHYTKWNFASDLVILPGCSLY
                     MLKKSLPEFVPGKSTFAHYATMAEHEELHLPGAAADAHWQRGSAAVHVPGDGGGAAPG
                     SHRNPPISEGSAGAEKREALTKKCEERLIKKRRYINADLHLSDERTCVALCLEEACAI
                     ALPAVFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
                     XXXXXXXLVAEREWRDMSGCCHGPHRLPSHAMADRTKGEVFLFSSAGGWGCFFGYCRV
                     AGTCGSVSFAKSSVSVCARCRGLYCVRLLELSASNVFGFDDARADEPPCVFSIAQGYC
                     LSFCDGGCSASAHSVSVVVSMSIAMRHMHELTCKQANWLDDNTPTHTHDSLALCAVRV
                     FLSLASFFFFVGSWKSIIFHLTSTCWNGYKWFLLPSSLNYLSPSSPCNPPSPLLSLTG
                     V"
     gap             355132..357390
                     /estimated_length=2259
     gene            complement(<364768..>365007)
                     /locus_tag="LDBPK_310960"
                     /db_xref="GeneID:13385907"
     mRNA            complement(<364768..>365007)
                     /locus_tag="LDBPK_310960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863139.1"
                     /db_xref="GeneID:13385907"
     CDS             complement(364768..365007)
                     /locus_tag="LDBPK_310960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863187.1"
                     /db_xref="GeneID:13385907"
                     /db_xref="UniProtKB/TrEMBL:E9BMM0"
                     /translation="MSAMQLLIVALAACLSVAAAKSKEEFPLVWVCLGITVVGVIAAL
                     YVAYKRPDELHLPGSVVMTAVESDPGNGKSAAEPI"
     gene            complement(<365588..>368269)
                     /locus_tag="LDBPK_310970"
                     /db_xref="GeneID:13385908"
     mRNA            complement(<365588..>368269)
                     /locus_tag="LDBPK_310970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863140.1"
                     /db_xref="GeneID:13385908"
     CDS             complement(365588..368269)
                     /locus_tag="LDBPK_310970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863188.1"
                     /db_xref="GeneID:13385908"
                     /db_xref="UniProtKB/TrEMBL:E9BMM1"
                     /translation="MRPSKVHFCTASLRPWVSEYLARMGVAPADTAPAHPHRGSPAFK
                     AQPVERGDSAESELAAVEEQYREARKQLLGALHVQPFSYANVVSHARGFSQTKPEDIF
                     DLRGICSADYDSLDENCILEPAVRQSASCAREADAPPSAPAPASAVSADAGPTQALSS
                     PATSAASAAGAPAAAVTPWPTVSQMTRAIERRIMDHQRLWRAANRLASDRLGPGEMWC
                     ALDPSTSTAQPPSTSFVIGGSLPFLLATIPHTLVSAIAEHAILHAWYGGPHVYPDAKL
                     PCPTAAFVFKDSPLLRVDDVTSLQWDRAQAANFLVTVLRQPAVQKELRQRLWAAAQNC
                     HRGVLRKLESLAVKKEMEGASREAAADRRILLDQEPGVPSPLSLSLREVRDDLFSFDE
                     LLYFVRVPPSTYSNSRQQRVECESLRSTHLFRFVTGRADVAAALSDRPRSNVSGSPFR
                     VSLRDGDRSAKVSSAPVPLSTRDKLWLLLSEMVRLRYLVAYLLNFEGMLHRVRSSTRH
                     SQRGQPKSKEVDSAGFPGSSGSEQADAQDAENAKCIAAVFRFLDIRLHTRLALTPHHR
                     RFLRHARVRHCKRSATPEPPERATAAHEATDADMSVRRETRRYSTVQELFSAFSKALD
                     ESTTPLSQQPATAAFYTSSAKSAGKGQGAAENGIEAMSEMPDHMCGRSPRQNVAQARA
                     TSDGPSSLSDADGEFLKAIVSATRHDQPPDSTMQGTPMRATRRGGVRSSSANLGELPC
                     SRGPPGRRCFTAEGSKTSLPHWRRTAGDPHSFVVVVFERKSNRAKWPFQALRARTNAS
                     NFKVCFRGSHDASSHAAVICFQLTCTREEGEKTERAPLSRKSAADLLQQYPYVTHVNG
                     TSVRKADLAVRLFRSAHVLKLRLGRRPPDPCEDAAVR"
     gene            complement(<369224..>369463)
                     /locus_tag="LDBPK_090950"
                     /db_xref="GeneID:13385909"
     mRNA            complement(<369224..>369463)
                     /locus_tag="LDBPK_090950"
                     /product="polyubiquitin"
                     /transcript_id="XM_003863141.1"
                     /db_xref="GeneID:13385909"
     CDS             complement(369224..>369463)
                     /locus_tag="LDBPK_090950"
                     /codon_start=1
                     /product="polyubiquitin"
                     /protein_id="XP_003863189.1"
                     /db_xref="GeneID:13385909"
                     /db_xref="UniProtKB/TrEMBL:E9BMM2"
                     /translation="CTLLAEYAGSVQVWCCATADVFELRRREPPDVSMGFRAFAIGYA
                     PSFSCLVPFSRRHASSLLSVAAIACGHVPSTVTSP"
     gene            complement(<369493..>371805)
                     /locus_tag="LDBPK_310980"
                     /db_xref="GeneID:13385811"
     mRNA            complement(<369493..>371805)
                     /locus_tag="LDBPK_310980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863142.1"
                     /db_xref="GeneID:13385811"
     CDS             complement(369493..371805)
                     /locus_tag="LDBPK_310980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863190.1"
                     /db_xref="GeneID:13385811"
                     /db_xref="UniProtKB/TrEMBL:E9BMM3"
                     /translation="MSSSTLAEALNRLSRCREPADLIYSGDAARLLGSAAPPQSAAPT
                     VSPPRGTSPVDDYSVLLARRIGTMVARLNELSGPTSQLVLTPRMVLWELMDIVRQALC
                     DALPADMRKGASPTDKAAVAKQFNSYASSRQVPIDSAVEGLYAVSYVSVKLRVELVAL
                     QLQRRIQEELAKKHTKTAAESVAALVVTQTLLEDFVAVYNNIMLTVPIVKAAVRESNA
                     EEAARRLAPVYPQYYYQLCDWVLVLESTMSSPPMSYTQVTRVKINEQDGTAVVDLHRP
                     TPETPWGLLLNEQGALVDIDVSLRVFEKARKLHDLLQSTPQGASIVMIKGRSVEPVAH
                     GDYAAYTRHLLQTLQSATEGRKNVQLVLKSSSFRAEARSLPTEVAFLTPPQGGEGTSG
                     QRVTLILRRQSTAAEWGFTVDEQLYWRAPSTHILSKPAKEFVREYGMQLRLLAVNGVE
                     ALHMTQVQLLIEAAETVVLELLVMPKSAQDRLTASRSTTTTTAVAATTHSREMLSAEA
                     AEPRNRISGDGLDRGRMEAAVSKFLQERAADPTAPAVPSAVDPPIAMETPLVESVTLP
                     PSPAAAAAVIAAEGVRKGKKRGRKPKALKQQLAESTVPQSAAVSRSAADAEPTAVPSA
                     EAIAQNRDGIEAEKTANDASEPPGACPQKPEGELVEPCTFDNQVKLTHLSEDEMVLER
                     PSVDTPWGLPIGRLTDPSEAPQQLPLRLMSLPKSRKARVRQHPFFSNFRKQPTTWYIA
                     AVNGTPASDAEATLKHISQLTRMTLRFLRK"
     gene            complement(<372754..>374013)
                     /locus_tag="LDBPK_310990"
                     /db_xref="GeneID:13385910"
     mRNA            complement(<372754..>374013)
                     /locus_tag="LDBPK_310990"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863143.1"
                     /db_xref="GeneID:13385910"
     CDS             complement(372754..374013)
                     /locus_tag="LDBPK_310990"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863191.1"
                     /db_xref="GeneID:13385910"
                     /db_xref="GOA:E9BMM4"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:E9BMM4"
                     /translation="MLLRSLPLYAVRVVSASLIESMPSPGMGCPTTGSHATLTFHLHR
                     LHNSESFGVDCDFQSVGGCDEQCFVRGMSADLVASSAALKSVLGDGKAARTSSVRVTS
                     INGIARLTKAAVRELFDSGRDVVVQCAVSAVAGSPSDPRQFDTGLEREEDGAEATRTP
                     KKRGRKPKAPVTGALGSDDTEIVGTSSKNAVKRPGRRARGLSLKKPKVSKKRLRYSGA
                     RSAVRQMTSKETDMPADDSVSADAEAVDPASASAADDIDAAALETLHKLAPVKPVRTR
                     GRRSTKREALLDAKWRSTAAGETSDDVWFAYAEATPAEGGEDDEARPEDAAVPTRRRR
                     GRPAKMAAADAPTEAETVAAAKRGRRRPASRTFEPEKQKKTSGRRGRPRKMDKAVEIL
                     DTTQAAEVSSKEKPAEQSEAADAELEF"
     gene            complement(<375163..>378528)
                     /locus_tag="LDBPK_311000"
                     /db_xref="GeneID:13385911"
     mRNA            complement(<375163..>378528)
                     /locus_tag="LDBPK_311000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863144.1"
                     /db_xref="GeneID:13385911"
     CDS             complement(375163..378528)
                     /locus_tag="LDBPK_311000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863192.1"
                     /db_xref="GeneID:13385911"
                     /db_xref="UniProtKB/TrEMBL:E9BMM5"
                     /translation="MYRGRRLSKMPQKEAPESAAHAPEPAPAPSVYPMPATPKTSIHA
                     ETVRMKEKYTAPFMLYDSQARRIVANRQYDRALVAEMHRVQSIIVTQLRTPIHAHLSY
                     TPKELLYELEAALYHVCASLAVQDNVSSLRHVLNDAEADPLMPQLESFLAHHNAPAKT
                     VVALAHCLSEGTSHDVLTSFLQMLEQRVQQERDPAVDCKRSADERRALLATKNNLQDI
                     AQLVRDVQTAYRSIDTASQALRRQPQSDPTEVDTPRSLAANAVPARIVEEAFYKVLRW
                     VVAVDADRRALRAVATSTAAATAAESPPATTPMPETAVTPSTANVKAFAKVIEYDPYT
                     GHLTLERADVAQRWGLLLNDKGLLVGVENELRNSSEAGERLYDAVQQQSGEAGGLAIF
                     EVNRRRVRAVHMSSEEVASSRDDIMQKLRASLTQTTKTLSLTLERRKQADLTVPREVL
                     FEVSYQGGEGGIGQRCLLMVERASTSISWGLKLQYLKGAAAVLSDFAPNMKLSNAAKN
                     LLFDMRGRLRVLKVNNHDMAQLSVAEMKSLISGSLLLTLHLQVTDAKADLPPEAEATL
                     SSQVERPLSSEEVAHAQETPAVDAAPSEAQKEAAAVAEAEAAADEPAEAKKMVSSVQG
                     EIDDLADSIADEFLKQHFQEAKLEATASDKADAPAAEEGGAEAFEALEELHWARPTTT
                     IGAPEAADDHSGDMDAEKDASLEQLSLQQHYKDDDGIKGAATGFADEETADHALMDGF
                     KDVADGEDVPKAEESDKPIAEGEENAAEHGVAADVDAAEQEAKDGIEAAEDEAEAELP
                     KKTRERKKAPAKTAKARAKKGEKNARGGGRGKKGGKCAADDGQGADDNEDASAQEAVE
                     EDDTQLENFKDKEAAEVSLGRAALAEEAEPLQSEAAAGDAAIEGAEAKQRRGVGSKAS
                     AVAAATSEEDGRGAGAEEDTGAIEPDDSGKGSASAPVDMPLVDLPPTAAEVAIEHGRE
                     NTKKKQSAKADATEAALAAEDGVDDVPRISLSRLLEAQPLTFDNDVRLEKFDGSTLEL
                     ERSSTKRPWNIKVAFAGDDIIMTKLPPFASKQQAHPFLRSLRAGPQGEVKWVVDGLNG
                     QDLSVMTKSNKTKALDAIKGSTKLSFVLRALRK"
     gene            complement(<379391..>381646)
                     /locus_tag="LDBPK_311010"
                     /db_xref="GeneID:13385912"
     mRNA            complement(<379391..>381646)
                     /locus_tag="LDBPK_311010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863145.1"
                     /db_xref="GeneID:13385912"
     CDS             complement(379391..381646)
                     /locus_tag="LDBPK_311010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863193.1"
                     /db_xref="GeneID:13385912"
                     /db_xref="UniProtKB/TrEMBL:E9BMM6"
                     /translation="MDTRGLRHLKRYLGEEGEQLARAKRASDVVPVLAARQAAAAAAA
                     RATAADVTTVSNTVPAPLSPSVMKYLEGRLSSGATHKLSRTQMALAAALAAPGAPSMR
                     SRAEGSENGEIALAVTRAKVADMAAAVDTLAVSALELAARRAAEDKEARRTTAESSSL
                     FVLVDTSSEAAEVAGQLEERYGLTVLLLRDDNACRHPTFPSPASGAGANTLRDTPSKT
                     PAAERRKTKSSSLMVDEVARKDEATESTLALAGAVVLVVATPAAFLAVDRRSAIWKFI
                     GSCALLLRRAPTHTGSLLHTLKGSKAAASSSPTKTTPHALNAQRWDCLGHVPAIAVLA
                     AEQKWLTEPELDLLTTLRVERRVGSGVGVVSKPTEASVSSAVAALRAPVTVHYAVAQG
                     THRFQFLFGLLKGLAPNRGIVVHVATRECVTFLCDTLYSLLGELPSYVQLLSDYEGAS
                     AYTNMHTAADRQRLCVAFDSTVESGQNGKTAAVLLSCHGLVPRRGSVFLQYDIIPDLL
                     NYNQFIAEVLSPGAVAADAGNDAGGTASSAAAKVAVRRERTARQRKRSTSPTPAPVAA
                     RRVGAEATNSAEDASSGNKATIPAAVNYTHILLLFRPNEVAGALRHLRRDGASRYRLE
                     FRELGTRASGRYFLIGEKLKSMNKKLFPVQNAAYYAYKATMRTYSTIGPRDVYDETKV
                     SLEKVAEEFGYTELPLLDLRLKDTVFRPKEDYYRAARRKQDAERRAYKAFAQGNIVGE
                     SPEEHIADSVA"
     gene            complement(<385888..>388743)
                     /locus_tag="LDBPK_311020"
                     /db_xref="GeneID:13385913"
     mRNA            complement(<385888..>388743)
                     /locus_tag="LDBPK_311020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863146.1"
                     /db_xref="GeneID:13385913"
     CDS             complement(385888..388743)
                     /locus_tag="LDBPK_311020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863194.1"
                     /db_xref="GeneID:13385913"
                     /db_xref="UniProtKB/TrEMBL:E9BMM7"
                     /translation="MGFFSLLSGGVVKATEGKDARAHRERTNMSASSAQADGDDSHTK
                     VVLSTPVRRVPAMNTQCKEEPKRSRLHTVAVPVKRDRLSLWSRLLCRPEVYDPHVEAA
                     PMTYLLDVNEPHAMVNDVERADVQNEEHAAVCTESEGDLPQRRYSVRASIGEGCRPRT
                     PLPKDDVEHLDDPEDTVMSCCRANASSDVEEFEDAEVQSDVAEANAGAPLLHRQVFHV
                     FDTRRCRVRTPTLLWSPTLADNFSVTAPIPAGGNAPPTDTTESGAASSRGSGLSTERR
                     LISREELTKKRLQRRQQLKEAAKREREYKEAWAALVASAGPHASSPEEDEMGRRTEVH
                     NAEERGLQSTAAAGAAATPAVISSSLTNEALESLREGTQPLSYDLPETFLARLGHYTQ
                     LPKKAKGGAGEAAALAQDSDRAGSCSSRSSNGSSQIALDDEHVNVETGLPLMYGSILR
                     CRNSTSKTRDVSGEAAASRTPRGATAVRGGSQRLPAGKYLLGSRAYVERVLFAQRRQQ
                     ECALFALITEAHRQAREAHRRLAQLYYYYIIPILAQYSTENEIRGLERSLLQCGSGAL
                     RAYHSEFCRTVGCSRSESQSSVSGGTSGSITCCFQVQPVDYQLAEYRFESVWRELFTD
                     VKAYLGMQACEDDGFSTLPSLSELEDGAAASSGTTSAGHGSVCVAATVLHSMELFERQ
                     RHTYSAARDAEEWLAWYYYYFTPHVQRADSAEERAAIQRSLLPPPPSPSSTSVCQTEP
                     KYGDGRSQIRANDPEPLQPHPLENEYLPLCWTLACNTAQREKVLSYRRDLKLRAIESS
                     LKQRSVAVGDSAAARATDCTGTASETDSASATTVNTVKPTCETVGANVATASSECHLL
                     KHVPENGDLVDSAHKTEASGLIEKDVEADLEEASLLKPSLQLLSDGAISRQNHGVVEV
                     EDVDSEETEDDDGAIPAGTHHTVNVGCFGLSFFSIFE"
     gene            complement(<396910..>399618)
                     /locus_tag="LDBPK_311030"
                     /db_xref="GeneID:13385914"
     mRNA            complement(<396910..>399618)
                     /locus_tag="LDBPK_311030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863147.1"
                     /db_xref="GeneID:13385914"
     CDS             complement(396910..399618)
                     /locus_tag="LDBPK_311030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863195.1"
                     /db_xref="GeneID:13385914"
                     /db_xref="GOA:E9BMM8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BMM8"
                     /translation="MTSYFSTSPNAKPDELASPRAAAPPASDTDAYSFEVVASDYVPS
                     AHMERSYRPGPYSPKPLYSDCNAGTRLPPFHHAEDWAPLASVQAASGGALGSQGRCHM
                     YGFSPVSDAPSYDVLPLNNHSPPLPPPPINAGKDVLLHSHRDGGMNPYTYRGPNADYT
                     SRKQNRLHQDFKALPKEERQRLVEREAATSDLLARTVHLRFLPLTMLQSELGAICSEC
                     GEYLRVRICGNSTNNQNWIYGFVEFATTAGAEAMMRRSGMELNNGPGRPPLRLKCNSA
                     KQPIVDRVFHDADPTTGNPCIFGLGNFAKRTLGDALESYYNLKEKEAQQLQDPTATPF
                     SASVSPGLTAAAVRQPVRLSPHARAFQPSSSPLLGAEYLPGVHHAASGTATAASNGDH
                     WTSPLLPVAAAARKADSDAASTDSATGMTSAVTKHHTTGAQGAVTFAGTPPCATHSPS
                     QDYSTFNTATYSSGAASHATPGQPATNDSVAARRCASSASNAAAAPLETVAAALSVLS
                     DRVGSALPDFLLPPSNAVAFPTHSDLAGNQLSLALQNMMLTGSATDGDEVLERGRELT
                     LRAIGQAHCFLNSQQGFYDAMGTLRSLVELLDFHAAVTGGAGATGSGDHTAELPQRAT
                     QLRLLANLMMALLYMMKRNLSDALPHIHAVVMSCNDIPVVCLWKTQQQQQQHSAQQKV
                     TGGKSERLNDTHRWQGLAVGDSVYDKTEEAGDYGCFGAPASFLEAVLESIHEEDNVHE
                     EEAKSASASNSNNGDTASTSSAEAQALLRRDQNFHRYVLNVLVAIGLSMEEAHPVITR
                     SAYALAAGRARDVLGTASADLDECLESTAPNPNLCDRLYGPMPNTSNGNGGSSSGGRS
                     KRDITFFPRVFFTTAEAMRQDVLRMADTELFWQRLPPKQCVQCYTE"
     gene            complement(<407576..>409894)
                     /locus_tag="LDBPK_311040"
                     /db_xref="GeneID:13385915"
     mRNA            complement(<407576..>409894)
                     /locus_tag="LDBPK_311040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863148.1"
                     /db_xref="GeneID:13385915"
     CDS             complement(407576..409894)
                     /locus_tag="LDBPK_311040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863196.1"
                     /db_xref="GeneID:13385915"
                     /db_xref="GOA:E9BMM9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BMM9"
                     /translation="MSSARSEGSERSPDEVPSPMPNTAPLATVALADSIGVDAPPAAS
                     LLTAICNSTQIISNVSVSSSHTSMMRLSRAEVLARTVHLRCLPPFMKQRILADVFEDC
                     GEYLRVRICGNAATHQKWVYGFVEFATKDAAAKMTTYCGMELPNGPDKPPLRLKCSPS
                     KQPILDCMAYDADVANGTPCGFGRGHLAECTLNDVLLVVGSGSGTPKPSTAGGASSSG
                     GGRGGGGVGDRRMKAANSALTALAVQSIRKVAATGCGCGCSGVNCCGCCSCWKGLPES
                     TECASCAGGEVSSDISAKGTAGAVGAPVAARGCADCATCDGGSAMATHPSDCCGDAAA
                     TLPQLKATCSGLLDLQMPFVFPGGGSPLDFMQQLAAAFQGLRDSAATHESQLDGPSIA
                     RRAEAMALDAMHRSGRFTSDACIQDTLSELTQLLAFLDSNRAVTGGAAQTASGDCTAT
                     VPQRVTQLWMLAHLVSALLCVLRRRVGDAIPHVEAVLVTFAQTPPSTLLLRARQRGKA
                     VAVQEQRHAEKLTHSQVLGALHEGRGPGAVAGAATAIGAPAACSLVKRRFAPSLPLGS
                     FVDEDVAGSLLEMVNEDGDYDGSHCEDANIHRMSSRDDPLDNDDIEDKDDDAAQLKDS
                     SGSASSCTYASEAFWNSADTAALCRRDESFSRYVLNVLVSVGLAMEEVHPGIARSAYM
                     LANGRATEVLGEPSKLLADRLAAAPTGNPHLCAALFAETDRNGSARNVTFFPHQFFES
                     VNVVSQRLLDIRETEGFWRQLPPNHIVTLFNA"
     gene            complement(<412881..>414035)
                     /locus_tag="LDBPK_311050"
                     /db_xref="GeneID:13385916"
     mRNA            complement(<412881..>414035)
                     /locus_tag="LDBPK_311050"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863149.1"
                     /db_xref="GeneID:13385916"
     CDS             complement(412881..414035)
                     /locus_tag="LDBPK_311050"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863197.1"
                     /db_xref="GeneID:13385916"
                     /db_xref="UniProtKB/TrEMBL:E9BMN0"
                     /translation="MSAVAHEFETPAEVSPAGQNGINMTAGPPAREDGFSVSATELAS
                     KAHPNRAIQSTVSVPHTRILSRPSAGGLHFSDAGRTAAAGSANGGKSHAVPYEGTVVH
                     PSSRGRVSRSGAGAGAAASAAEAKAVMQLAAEKAKAAEAQSPQETTAADHTVMAARGK
                     KRVPGPHLKHARLQKAHESYATVAAASDSGAGAVKTASRRRRRNGNTAGAEGRRPPHS
                     QTAGQGTVKATNPKKTVRVSKKTQDENGRSHCMEPAASSQGSAKRKTAAATTAEAAAA
                     AKGSPKQKPAKKAIPAAAAATTNAKSAEHGAAAQSQTEKSAAAAEAPADQACADKKNI
                     VEEATAEVDGVLSAPAGEKEAAAAAKHADPEATDAKEEPAEQPEEDATEL"
     gene            complement(<415622..>417250)
                     /locus_tag="LDBPK_311060"
                     /db_xref="GeneID:13385917"
     mRNA            complement(<415622..>417250)
                     /locus_tag="LDBPK_311060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863150.1"
                     /db_xref="GeneID:13385917"
     CDS             complement(415622..417250)
                     /locus_tag="LDBPK_311060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863198.1"
                     /db_xref="GeneID:13385917"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BMN1"
                     /translation="MWASSLTSPALGKVRLTEESWISLDARGVLGEDVTAQFVRWLHE
                     SVLPANSVLREQLERNVLLDLRLATARGVYAKKAFKRGDVVLTIPLLSATPSDAPSCT
                     AWLCLNSETLAKYSTAAQQRVGLPSYDTVKQVLSVRQSSFDPIPHPLFLDQVCAALLL
                     ACEKADGAASPLYPYLRLLDSAELFEDETIKELHLGVLEPTTHMEYDEHVKRFRHYMR
                     KLHAVWWAAYESATGRGPGADVAGAAGDRADTTDALASSVPILRIDGEDSAASVTVDT
                     EGRRYQDVGNMTVVPADAKVSGADASAARMAWKPPPSLEDMAWALRVLLSRQKTLPHL
                     RVDRAAFERVQEESIEGEVLDAFGRAVMKGKYAFYQHVLRAIDEDRLHVNEVDPTAIP
                     TIVPLLDMVSHPPGGVPNVSFTVERVERTGGRSGSTTEVGTSPHRGDLASGKPNSASP
                     SYQVVVRATDDIEEDEELTVSYVKCYSVAYTLYRYGFLPLSRREDDVATLLQANNVDG
                     NLRPAPKSGSSPSSLSKEGVMWALRRWWPSMFAT"
     gene            complement(<419124..>419915)
                     /locus_tag="LDBPK_311070"
                     /db_xref="GeneID:13385918"
     mRNA            complement(<419124..>419915)
                     /locus_tag="LDBPK_311070"
                     /product="biotin/lipoate protein ligase-like protein"
                     /transcript_id="XM_003863151.1"
                     /db_xref="GeneID:13385918"
     CDS             complement(419124..419915)
                     /locus_tag="LDBPK_311070"
                     /codon_start=1
                     /product="biotin/lipoate protein ligase-like protein"
                     /protein_id="XP_003863199.1"
                     /db_xref="GeneID:13385918"
                     /db_xref="GOA:E9BMN2"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="UniProtKB/TrEMBL:E9BMN2"
                     /translation="MPAHFPPNIHFLEEVTSTMDVARTMRATAGGKAFAVVAAEQTAG
                     RGTGGRTWTSPKGNLYMTFGVPQLGQPPCLKEELVPVLPLICGLACRRAVLEVLHLDR
                     VSAKASVAADAAKAVSTKWPNDIIYNHKKIGGTLIENDGDYFIIGIGMNIAVAPQMTD
                     AGREATMINAIAEDFGVKSCTPRDLANAIWCHFFDICTSPEWTRESVIESFDKVMDKS
                     LKLYKRLPDGRDPEELTAVSLNSWGHLKVRHTDGALEDLSAEYLF"
     gene            complement(<421029..>423965)
                     /locus_tag="LDBPK_311080"
                     /db_xref="GeneID:13385919"
     mRNA            complement(<421029..>423965)
                     /locus_tag="LDBPK_311080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863152.1"
                     /db_xref="GeneID:13385919"
     CDS             complement(421029..423965)
                     /locus_tag="LDBPK_311080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863200.1"
                     /db_xref="GeneID:13385919"
                     /db_xref="UniProtKB/TrEMBL:E9BMN3"
                     /translation="MSRSQLSIDLEDFLGYEAPIPTDAFVVGIRPRAPLSRRSAHAYD
                     GNGSDLSDRSSWPNSVVASTDVRSRRRPREMSYELHENLEAQRRTLVGQSRRPNSPRS
                     RVTVIEEEEAMNSETTVGTNDDEAEQQRRGGPRRRLESNRAQLSREFSEARDLERRQQ
                     QLIAMLTSRLDDMDARFQAQVTELSAKLEKMNVSVGEKYDSIYSKMSDTISARAEEVS
                     RLEQELRALKISNAEEFKSCRDSIVACRADFSKLEGRLEGVLSRPSPSSVAAAPSPSS
                     TSVSPAPPAQPCSSSTAFKPGGNACGGFLSSLPSAAALSANAPASSHPSPSASTAGTG
                     FGLGTSTAALGGIGTSSLGEKPAEKAGAAAAATGAGHTRAETVNASSASTSPKAPTFE
                     NPFPTPPADASTSANPFSFGGSANANAVAATKPQDTSSDKPTTSASTSTFGGASSSFP
                     AVASAAPRTAEAKPSVFGGGVTDALQGAAAAPVSSGAASTSFSFLAKPSTPPAQGSSA
                     VTNGFKVAAAPSDTASASPFSFTSGGATPASSAAAGNPFMPATVDSSSPKPSAFGGAV
                     TPQQAPPPANGGTSAASAPATTTSSSLDMSNPSARAPGSGGNSSGGSRSGGFGGVAFP
                     ASTTPSSGAQAEPAGAFSFGTSHAQGPNVSPAAFASAAGVSSVSSTAPASGSSGSGTA
                     SAFGISTANSGGSNGSTPFGSSNTGNTAGGGPGAFGSSTFPSTGAFSSSAAASASTPF
                     SGPFNGGGSAPAASASAPPTFGGCSNGAPSSVFNFGGAPFTAEQGTTGAQGANMNPPK
                     PAGTTFGGGGFTAHTNANAFGASAGPNVVPTNAFSGASNTAGTGGSSSMLGGSGGGAG
                     SNPVNGSAASAAFGSKASNNNAGNSLFGSGGGGPAAVAAGAFGAVPAGGPVPVFGSSP
                     AGGNGPSRSVFGAAPPAFSQPLGTSPAFGGGGGGAATMGAMGGSSQGTSILGSSSSRK
                     KAPRRY"
     gene            complement(<428828..>429013)
                     /locus_tag="LDBPK_311090"
                     /db_xref="GeneID:13385920"
     mRNA            complement(<428828..>429013)
                     /locus_tag="LDBPK_311090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863153.1"
                     /db_xref="GeneID:13385920"
     CDS             complement(428828..429013)
                     /locus_tag="LDBPK_311090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863201.1"
                     /db_xref="GeneID:13385920"
                     /db_xref="UniProtKB/TrEMBL:E9BMN4"
                     /translation="MAVYVFSLFFFFTALFSLLVSFPGHHRVCLRALSSSPKDIDALR
                     DGVRLLSGCVGGDPPTR"
     gene            complement(<434699..>435844)
                     /locus_tag="LDBPK_311100"
                     /db_xref="GeneID:13385921"
     mRNA            complement(<434699..>435844)
                     /locus_tag="LDBPK_311100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863154.1"
                     /db_xref="GeneID:13385921"
     CDS             complement(434699..435844)
                     /locus_tag="LDBPK_311100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863202.1"
                     /db_xref="GeneID:13385921"
                     /db_xref="InterPro:IPR029416"
                     /db_xref="UniProtKB/TrEMBL:E9BMN5"
                     /translation="MFVFEQAAPSSAAADVSACASFSDAEPYKSLFMKWGLLRLGEWN
                     MHTYRYRCPSEVPSFTEGTLSAQPVASPSSCRAANAAAATVSAVALRFHDGVAADFLR
                     SLFAAPCVRSDLVGDDAHHAQSVLGANELQFRPLTCRWTTLEPLRHGLVDAKVVRQVL
                     RDVDGATVRDANQPVYFLPTVKRAEELLPHGEVISDELRALFLRAHSRPVAQAKGECG
                     ELYDASSREDTDTDDDDMWGSMSGARLPMRQLRGVFGKESREEFLYHVVWRLVAGSGP
                     LNQFDDDAAVYLDAARELYRRLVKSLHVVEATEQEADGDVAALEEPNSASVRYHAVVG
                     TSVYQVITAPGMTLFPRSDGVHPSNLNYCYVAVNPSEQTATVWYHRC"
     gene            complement(<436600..>437247)
                     /locus_tag="LDBPK_311110"
                     /db_xref="GeneID:13385922"
     mRNA            complement(<436600..>437247)
                     /locus_tag="LDBPK_311110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863155.1"
                     /db_xref="GeneID:13385922"
     CDS             complement(436600..437247)
                     /locus_tag="LDBPK_311110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863203.1"
                     /db_xref="GeneID:13385922"
                     /db_xref="GOA:E9BMN6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:E9BMN6"
                     /translation="MKSTRVAAALLRDGGVSRLLVALVLSACFSAVLSVALITEINAG
                     EIFVITESLGAGRELHFQFALHPEYLLPVSIKDRGTNEELMHWKDLAFGAFSVPASDK
                     PRNIIISFDNSNTLFTSKNVNFDLRTSVNVNYAVDASKLDPIEQKIRALSGSMQQLKT
                     LQVSIRNQQKDHRDTVESANERVLWWSIFQVLAFLIMLSFQLFMLRRLLEKKTYV"
     gene            complement(<438210..>438839)
                     /locus_tag="LDBPK_311120"
                     /db_xref="GeneID:13385923"
     mRNA            complement(<438210..>438839)
                     /locus_tag="LDBPK_311120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863156.1"
                     /db_xref="GeneID:13385923"
     CDS             complement(438210..438839)
                     /locus_tag="LDBPK_311120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863204.1"
                     /db_xref="GeneID:13385923"
                     /db_xref="GOA:E9BMN7"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:E9BMN7"
                     /translation="MKRRGALLSVSVLVLLVGALVATAAAPASAIAVGVEATEVFSVT
                     DIVPPGNNLVFAFYMNPDFVFPVRIRCRETGDVLQAWKDSPQGYLNLPSTDKTRHLVF
                     EFDNSQSLLALSSVSFEIRVIPDPTRGVREEEIDPIEKKVQTLFEKMQTLRKLQELIR
                     YNQKDHRALVEHANERVHWWSIMQVVSFFVAAGGQLWLLRSFVEKRRTI"
     gene            complement(<440753..>441970)
                     /locus_tag="LDBPK_311130"
                     /db_xref="GeneID:13385924"
     mRNA            complement(<440753..>441970)
                     /locus_tag="LDBPK_311130"
                     /product="N-acyl-L-amino acid amidohydrolase, putative"
                     /transcript_id="XM_003863157.1"
                     /db_xref="GeneID:13385924"
     CDS             complement(440753..441970)
                     /locus_tag="LDBPK_311130"
                     /codon_start=1
                     /product="N-acyl-L-amino acid amidohydrolase, putative"
                     /protein_id="XP_003863205.1"
                     /db_xref="GeneID:13385924"
                     /db_xref="GOA:E9BMN8"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:E9BMN8"
                     /translation="MPAINREELDRRVEQIYDQVVAWRRYIHENPDLSFEEQPTAAYI
                     MGELQKMDAEGEWLHISQPESNCVVADLKGGGGDGPIIALRADIDALPVEELTDVPFA
                     SKKQGVMHACGHDTHAAMLLGATRLLLEDAGRIKGTVRLLFQPAEEVPPGGAQMMIEK
                     GCMEGVAMVFAEHIVPMKEGPTGTVLVRKGPVLSSSDTLHAEIIGRGGHASMPESSID
                     PIAIACLAVTALQQVVSRRMPPSKCPIFTITTITSSSDSYNVIPDRVTLKGTLRTQDR
                     EVREDAKKAVAEVLHGICRSYGATCNLSWLPGYDVTVNTDSAYDVGMRVLAQVLPSKD
                     QVVELSACMSPSEDFSEFAKVAPANYVGIGCYNPEKGCTAVNHNAKFRVDEEAMKVGV
                     KVHYGTIHELLMQ"
     gap             442986..446196
                     /estimated_length=3211
     gap             446833..446931
                     /estimated_length=99
     gene            complement(<447388..>448323)
                     /locus_tag="LDBPK_311150"
                     /db_xref="GeneID:13385925"
     mRNA            complement(<447388..>448323)
                     /locus_tag="LDBPK_311150"
                     /product="monoglyceride lipase, putative"
                     /transcript_id="XM_003863158.1"
                     /db_xref="GeneID:13385925"
     CDS             complement(447388..448323)
                     /locus_tag="LDBPK_311150"
                     /codon_start=1
                     /product="monoglyceride lipase, putative"
                     /protein_id="XP_003863206.1"
                     /db_xref="GeneID:13385925"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BMN9"
                     /translation="MPCCCSGGHCLKYATPGRAPPDPQLFPHYMQNAQNLWLHFSEWW
                     PHGDGGSCPAPPTKGVVFIVPGLGEHTGRYDSVALRLNQEGYVVFSMDNQGTGGSEGE
                     RLYVERFTHFVDDVCAFVVFIQTRYAALKSQPTFLMGHSMGGLIATLVAQRDASGFRG
                     VVLSGPALGLSKPVPRFMRSLAHFLSQWFPKLPVRKLNPELVSYNTPVVQLVKQDPFY
                     SNVTLRARFVDEMLIAQDRAAEAAATSKFPFLIVHGEEDQLCSLETSKSFFKNALSED
                     KFLASYRRAGHEVLTELCRAEVMAEVMKFINERAR"
     gene            complement(<448992..>452315)
                     /locus_tag="LDBPK_311160"
                     /db_xref="GeneID:13385926"
     mRNA            complement(<448992..>452315)
                     /locus_tag="LDBPK_311160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863159.1"
                     /db_xref="GeneID:13385926"
     CDS             complement(448992..452315)
                     /locus_tag="LDBPK_311160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863207.1"
                     /db_xref="GeneID:13385926"
                     /db_xref="UniProtKB/TrEMBL:E9BMP0"
                     /translation="MSFPLPLLRPVLEDLPAVPSMAGVVASAEQGAEGDSQPSGGEAA
                     RVLEAPKPVHASAPTSSFSNGETPVHASDNCGGVTVDASEIGESHRLQRRQDYGKTPI
                     ALSALPERPVLRVVAGDGSGRASSAAGSVHPEEGDGSETGSPTTSPVQGVWTQHVYSQ
                     PTSAGRDNSVVVLSDAAARMIAHAVHRSSLLQQCFMQWQVQQARHAQQRLRRECFAEG
                     YYQRNLLYLFFRAWQWRYDRRVTCAEQRRMLVALRARHLRRRAFVAWQGWKDARRRLR
                     GILDEVQVRTGAALTRQCFERWHRTSAHRALARAAAQASADNLRDARFRDWRHFALQR
                     QKGRLLASVLMLHTPVAWTAAQQSRCDELHLLYAWVQWLRVAMQRRACQLRKCESALS
                     TVAMRAEKALRRRWYVWWLQVTCASLQSRHTRRGLLQRYYKSWTLLGRLCLIRLQWER
                     ETHSPHVQRRCLAHWRGRLGGRRTRREHLRMAELFFESVVQAHAARAAFCCWRALHLS
                     RAKAQRMRRVAEGYARPALLRHLFLRHITDGVLASPTGLADALEYEAWHRGADAKVVK
                     PKSITIASNEKSTLDVSTKTSGTSSTRLRPPIPLHHPRHAPTRGLSVPAAPPEAPLGP
                     EWTSNPSEAAGTTRPITASAAEHLADMEVLLPPPPSYEEVTSSWRSTDASGRMGACAL
                     PVRADVGVGTSCEAPTPLQCATPRISSAGDRSAARPDAVHQREEAAPPPVCTVPGRGM
                     PPAGAPNVWPAAVPCYAVPNGAPGSWAFGFVATRSGWQTLDTLVPPSASVTPLASTMP
                     SYCSLHCAPPTGDAVSAAVESPSCAAFSRFCAEGAAQLSAGEYGPGAPAALPSPAVPL
                     LSEGLFPAPPSPRTHYGFGIHRHIDPLAPLTYSSSSAPRAEDPGCADSPDPRGHGGHR
                     AQRRCVGPPAVTLGDAILSQGRVPLSFAGRCARSKKYTGVPSPDRKAPRDVQSAHTTL
                     LSSLTSSSSRSSSTSAAPRASDAAPFPLCSPSSTSDSSTLRARARDALGDYKRRTRLI
                     AAEKAELATIESQLALAPHTKDMAHKKALSKRRRYLQRRLLEWEQRRAQIAQLAVWLE
                     GCVSAATSAAVSQRGAGEL"
     gene            complement(<455292..>457181)
                     /locus_tag="LDBPK_311170"
                     /db_xref="GeneID:13385927"
     mRNA            complement(<455292..>457181)
                     /locus_tag="LDBPK_311170"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863160.1"
                     /db_xref="GeneID:13385927"
     CDS             complement(455292..457181)
                     /locus_tag="LDBPK_311170"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863208.1"
                     /db_xref="GeneID:13385927"
                     /db_xref="UniProtKB/TrEMBL:E9BMP1"
                     /translation="MAKGSAGMSAAATSAVGVGGSRRSIEQLSRAAVTDMLQYTPHIP
                     SICCAAAHPYLRYAREAVAGTRVAEGSAHHRSDLYVCWDWTTNYEYHSLSGAEEELEA
                     DLRQLGWWLTRPFTEDGKPMTMEVNVKREASYHPPLPSTPSATATATKAPPAGFESIL
                     RILTQPPFQRTDVGISCLRSLIVTPNRKEVSKTAIELIGQLTHLEKLESFTQFLALPL
                     PSLTSVSVLRLHNVRALTSLEPLVPLSGLKRISLCRCASLHSLAALSQLRELNELRLS
                     DCRVLDARGNYSACRRLTSVSMRWCGAVLHVGDLATLPNLRDLDCSYSGVRDLESLKQ
                     CLQLRRLCLRGCHSIHELFHAMDTSAALLKPPGGVAATEISRAFLDRVAAPAIVDEHV
                     SLSAANKLTLTGDASTPPAGTVLYPVLSITMPSPASSFSQLEELDVGESSLVSLSGLP
                     QCAPELRHLTVRECQQLHSLSPLGELLKLTSVDASFSGVDDLEGLSESVSLQYVNLRN
                     CVRLRTAASLARVRSLREIDLSAANQNCIICVCNRELDTRNESTGGHCVRRRRSEPLR
                     QRLLMLSGPVGGVGDMHIDTAVTQRSSLRLLQHRVLRQEAEALLRQPLEQVLATEARP
                     QEAMW"
     gene            complement(<458305..>458670)
                     /locus_tag="LDBPK_311180"
                     /db_xref="GeneID:13385928"
     mRNA            complement(<458305..>458670)
                     /locus_tag="LDBPK_311180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003863161.1"
                     /db_xref="GeneID:13385928"
     CDS             complement(458305..458670)
                     /locus_tag="LDBPK_311180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003863209.1"
                     /db_xref="GeneID:13385928"
                     /db_xref="GOA:E9BMP2"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BMP2"
                     /translation="MPPTDEPCVRVSYKNSHYLVPVEFILRVHPGGQQLILQYVNQDI
                     TQAFVDARHSDTAVQLLEQWMEGAPAGPRRIMPSSAAATEAPLNGHGGDGRYAQMIWN
                     ALVFGIAGASATAAVLCRR"
     gene            complement(<461236..>461574)
                     /locus_tag="LDBPK_311190"
                     /db_xref="GeneID:13385929"
     mRNA            complement(<461236..>461574)
                     /locus_tag="LDBPK_311190"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863162.1"
                     /db_xref="GeneID:13385929"
     CDS             complement(461236..461574)
                     /locus_tag="LDBPK_311190"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863210.1"
                     /db_xref="GeneID:13385929"
                     /db_xref="GOA:E9BMP3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BMP3"
                     /translation="MSAISSLHFIFKGKNYMVPESFVTKEHPGGKAVLMALADKDITE
                     AFEEAGHSNDAMEMLEEWCADVSATEKADLLKRAEARHAEEDEWRWRSTAIAFSVAAV
                     VAAVVLRKSS"
     gene            complement(<462424..>462912)
                     /locus_tag="LDBPK_311200"
                     /db_xref="GeneID:13385930"
     mRNA            complement(<462424..>462912)
                     /locus_tag="LDBPK_311200"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863163.1"
                     /db_xref="GeneID:13385930"
     CDS             complement(462424..462912)
                     /locus_tag="LDBPK_311200"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863211.1"
                     /db_xref="GeneID:13385930"
                     /db_xref="GOA:E9BMP4"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BMP4"
                     /translation="MPENIRYRFFFKGKSYLIPKDYIDNEHPGGSDEIMPYVDKDMTD
                     AFEDADHSLNAVDMLEEWLDEEYDLGIQPDPTAVASPAQEGAKTAGPATEASPPAAAA
                     TPAVRIATPTVSTAPAATAPTTASEPSKSKLFVPVAATAAAVAVLMASATLVYVRVPK
                     RR"
     gene            complement(<464055..>464447)
                     /locus_tag="LDBPK_311210"
                     /db_xref="GeneID:13385931"
     mRNA            complement(<464055..>464447)
                     /locus_tag="LDBPK_311210"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863164.1"
                     /db_xref="GeneID:13385931"
     CDS             complement(464055..464447)
                     /locus_tag="LDBPK_311210"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863212.1"
                     /db_xref="GeneID:13385931"
                     /db_xref="GOA:E9BMP5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BMP5"
                     /translation="MTSIATHTVTPRTVTDGAGESIWHIYEGRTYRVPMSFVRRHPNG
                     QKLLLPYANRDITQAYNEAGHSKKAMRTLLKFLDESISIEELQSLCEKACEGPDQYTW
                     NWCVRAGSLLSVIAVMVAVYMRCKQRSA"
     gene            complement(<467070..>467474)
                     /locus_tag="LDBPK_311220"
                     /db_xref="GeneID:13385932"
     mRNA            complement(<467070..>467474)
                     /locus_tag="LDBPK_311220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863165.1"
                     /db_xref="GeneID:13385932"
     CDS             complement(467070..467474)
                     /locus_tag="LDBPK_311220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863213.1"
                     /db_xref="GeneID:13385932"
                     /db_xref="GOA:E9BMP6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BMP6"
                     /translation="MSDKETYVRLFYKGTSLVVPMSFVLNEHPGGAEYILQYANQDIT
                     SAFKDMNHSTDAHALLNTFEEVEAKEGFRDIYNPAEYQLKIKLSHSYDEERRCTTEVR
                     RWRQRTTLITVMTTLAAMGVAAYALRRHLQRA"
     gene            complement(<468818..>483658)
                     /locus_tag="LDBPK_311230"
                     /db_xref="GeneID:13385933"
     mRNA            complement(<468818..>483658)
                     /locus_tag="LDBPK_311230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863166.1"
                     /db_xref="GeneID:13385933"
     CDS             complement(468818..483658)
                     /locus_tag="LDBPK_311230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863214.1"
                     /db_xref="GeneID:13385933"
                     /db_xref="GOA:E9BMP7"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR022099"
                     /db_xref="InterPro:IPR022105"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BMP7"
                     /translation="MRIEVKFGSAKHDIEVAEDATLGTLKAAIYDATNVLPPLQKLLG
                     KPNLQAKPDDTLLSALGIKEKTKLMLIGSAAAEVVKANAPSAEEKKKEEERERRLRNL
                     PYRFWRLPAYGGFLADPYVAGRGEPLEGGTTLLTLLCMDVILCRLNTLGAGSRPNPSA
                     ASTKLLQALGQRGAAEVSHPFLQDISVDLRTAIQRAHGAIRSCYDFTVEASKAVQPAT
                     VLGVVDRCVHRITSLPTGEWTMIPSGWIGTHSYTIMFLLVHRRAAEVFDFVVVNRGSE
                     GQGYHPRWQTAEKILSCPILKFQDVSSTRLQDKTFWLLLLSLWMRRNDPQNQSEFIRA
                     EVFYDVLLPWLVEKLPEGRRHEDDVNSNRSGQAGSLHLTTTRFTTEMILQMTGGAADS
                     EQQMSPSPASSTDSPFTPFIHRNAASPICSSSSGIKSVITAFCYILEQYYPALTALEK
                     KRIKYVLKYEFFARAAEDLSRYSRRFLTDSTSLTCADSVQAAPTASRSPAPSTKDAQL
                     RAALGRLKAAGINDTAANLSLGAVWLRLTDNRVYIKDKQNKILPDTDFRDKMVLLFVG
                     SLRVPSGKETSTLLAEAVTVMKQKCGPDAVEVIFLSCDETQDDYEEHCALFDFPRATY
                     PCVEVLNAMELVKVPELLVFQRDGELLHRQGISALQSDPEAAQFPDGPWKGAVPLSAT
                     DVQLLRVGASQLAHHTKKRLDRGQPPVADSDAVVQHVVELVHAVEAVVDALPQDDVQE
                     LIQAASEVRTSTTASAASVTGGASTASSCPQRTVDAMVQEPIDVAREGVFQNAELLPK
                     VSVAAYYGPAFQSSVPSLPDVHGLTKATNYAELFALLPRVRSVVETLWRRAGNSGTAS
                     RVAVQLQIIEFITWIFSTLIPVPLPASYTIDAVPQEERWCVSSFYTEDIIPPALQSPV
                     GEGGVVPHPHAADPQLTMLECVYYLMLSLVNAWQAVETPTRSFDAERCLISMDMLLVF
                     DAILRQVKGSDKCRMISMLLNTGGGCGYFLSTTQGKQNIAFASVAAALQLTRPRLLPI
                     RSAMLRYIEEQQRMRPGHELFDLRMPDKLELFKGSHTVDFLKSVLANAGYSLEQSGGL
                     FGGGSSEMEKLMEWLCSNRSPLAKEHPAFGMMRDMTLLAKFMGTMEMRDAQLLHRRKE
                     LDALASWRISFEEDAPGRQMSAGWRTRPAPPRWECLMVRGRDMDIADIAVKGFGDREV
                     MYGEGLALHSPIDVSRMIEVDHPTEDDVLHAKVLPTFAGTMNVEESEVLLSCLTAPYV
                     RIPLVLDFFASQDRHTYLFVYEVQEVLRAVLFEPAAYASPAVLSHADPRSVPMRLSKE
                     QREMVELRRLRGDLSQQNYEDCLGTTYGLLMSELTHAPTSVLRPLRSLLESITELGPS
                     SVYSSNASYVLFVVGLLCDVLSFCRFIAHQQRERQAEAPRTAPAASPKTEESEEAAES
                     RRSEGALGVIEEYHRHFLQFFVATVQPLLWAWLEESEENTDTPTQCVIHAHMSRVDRA
                     LWKGYDSLSASAAAASSGAGGGQHGSFRSGATSAAPAEDPHAHLIRMLRSYAFVRARH
                     GFGMGMQRSQLAAQEGDSLLTPEEKMLRFLQAQGLNTSRVSKELLEQGKQLMMSGGRR
                     RAVFVQIRSRNYNDTVRVPNLIHSDPSSTTESKLLKLPPADVPENVLFCDLLEDHHLI
                     TSFLDEMTPQRRGAVLLSIVQSVLRDHTESAGDATASGTLQDRRRLRRSRSTSLSARA
                     SAVNLDAMMDDDDEDHAPHERCSQREETPLWSISAPGVYKGPASSGLFFHAQTCELFW
                     RNDELKPVPDSMSHFTDFENILGKDTLQCGLVSRHEHRHWVHLVGTPYDVIEWTAPPD
                     LSDQGVHHPFVIAGNWPAESVESALFENVTYDRVIAVDDDNPWPHKEERWAVNMLRDI
                     LRAAFPNGMRFYPLAPALSTVAASDVGNEEEGERLMVPALHHYEMRFLMNDAPQYESD
                     TDRATWKEAVAYRYPQPRIEIYNLVPHARKLYRSLVYSTNQHYCLHSMALLTGTRTRE
                     SLAVTAFQAGELKRRIFNESTLEIHRYNEAIRGREVYIPARLLQGLIPSVLLESFFMW
                     QGEDDVLRGYPLSEENETASVLPDAAASGAGKRKPARGEVMDHWFNYSIEVHLHLGRR
                     GSGAIGEAASSPATSSACVVVRRNDKGHSAIVEEKRAASSADAAADAARTKTMAEAQG
                     AAHRLMLERATSGDGSMDLSTDALHANEEDESGGDPIRIADADVALLHEALSHLPKGV
                     CMQLLRQARGDIASALTWASSAANADALLAMVKKDAKASGEEGSSKRHQLAQMVAKTQ
                     RAVETCDYVLVNLLHCRNLSYLLQMLTRIEDCSHILAWGRRCSAAGKAKCDAASADEG
                     AAHSLRVEDTTDTGTYVQIELIEMPRLRVRFYTSTDGSSSRARLFLADQPGWRLAEWD
                     DFHTARWRQLRALQAPFQQCLLLCNSTREVAFLCPNHDFAPMKISDDPFNPMLLFDRS
                     SYTWREAVPSPFYVYVVHSSSSFVMPPSLSASLYYAVMQCATQHYAGAMRTLESCYTD
                     SSFSTEEGFMFALFERTMADRFPDACAVRLKLAHAVQYSLNTYQWPLATELSDYLMTK
                     HHVAEDCRLSRGEVLDLLKRCAQATPMVRSQLELYAGLMKLEHKQSGRPATVPVVVQT
                     PALERCRFPWERLLLYPWERIAPQKLKRVCYQLQSPEMVKDEKLVEFLWTDQLLMDEE
                     GGANTKKGFYFLYCMKRNTVVPTIGEEHVGVTLSQLLARWFQLRHSRWGREEQQGSET
                     EMAPSWCSTVLQMMEMFPHTDWPAPADNAERYILARGVSLTEEYEASEHSHGLIIGDQ
                     ETAVRRRRGTIPELFNAIHRVAQKHFKTDHITEAVREARQMSRLRTPASQKVTLLMRD
                     HLRGRVVPGDTGRDQVELNEADISVDYFQNDNAEGDSAAAALRRSSLQALCTEPLSSL
                     QLAQSVIAEGEPAAPPVSPSVSVLPFDLRTHPLSRTPLAQNMLDRLEEDSMRFRSQQQ
                     AQRPRYFQCLSKDIVRELLTTPDVAVMTASLATAVTVLGDCVRQLRALGEQDADRVMR
                     LRSSLLSLANDVHPRSSTEPSHSNNGVSAAGAQSLDRGRLVHYLQRAERSRVAVPLEW
                     LCAGLLSTTLQSDLKAENLFHGSLQQIQAELILLMLLSNRMYFAEQAAQAVQQLLLFL
                     ELCGHLRGVVPPHAEMTACGSKSTVQARAARIRELVQHFSLEIDPSVLQQLTTAAPTI
                     TNASTGTSDAEATGASDTCVPLSEDTRRTVTSRLQQLANAALDTLTARRTYVHIHPDF
                     SSSAASSSAGGAAGKASNSSFRATLDPRFLVFEFLFNILLRARQVEMVEWFVRNIREG
                     QSRVQQMIMGQGKTTVVGPLLALILADGQQLITQVMPTALLEQTRGILRRCFGVVVTK
                     HIYTVQFDRSNEEGTSDGVELLYQKLKSAEEDRSVVIAAPECVKSLFLKGIEQLHMME
                     SVPTEDMELDEAADDRYASHIKALRRKMMERSALADAITPILELWKRGVLIMDEVDVL
                     LHPLRSELNFPIGLKHPIDMSGPRWLLPIHLLDGIFASQQGRACEDVQRQLECGSSSQ
                     TANSARLGGSSLAEMRGVQEEKRRYALSAIRSVILTGFRQRALQREPHLVLLDPGHYY
                     VEQLLPVLVPWLQLWLHEHLMDHLPEQERQNWAYVSSDAFAEKTKPFLLSPVKLDDAE
                     SRVSRELNAYMPHYGLQLLNLAHDWLHRLLPHVLAKIDRVSFGVLQPNDLALSGDSAR
                     IPYSRKMTAVPFVAKDVPSRSSEFAHPDVVIGLTILAFRYEGLRLQDVKELVTQLKRD
                     FARQAGPKEHRPAAKLYKHWLRLSSSDRAAAAAATEKTVADDNEDVLRSFERAGVPLS
                     QLQVTDKAQMQSLYHLLHGVPEVIHYYLCSTIFPRTMNFQRLKISACGHELGSSMLFT
                     KRIGFSGTPSNILPLDLGECFYEPGSDGRVLSVLTNPEVVHAEVLPDSWTPLRLLDRI
                     AAAQPPYSALIDAGALITNMDNEEVARYLLARLPAALFDGVVFLDRRDRQMILQRDNG
                     LVIPVSQCGVPLARRFTFFDQVHTTGTDVKQSSTAVAVITFGKDLVLRDYAQGAYRMR
                     GIGKGQRLCLYLIPEVVSRIQEALGSRYRTGDMLKDVPAWLLLNSMKVESLQFFKLSL
                     QELANVWRKKAVAHLLHDARHANAHPELFTGWMRCRRFHLPRPAAGNGAAEAGKHASS
                     EEDASAAIADAALKLPSVDVLRAAIAEFREVIEYPVAGKIAQAPSFSEHLQEILQARS
                     QELIEGDALSQGLVEQLLDRMRRSIQGSRAAAEGGSSASAKEASGKGATGAGQEGVHN
                     TMNLNAEIVHEQEAEQEQEQEAEQEEQRISAFSRDDESQIGWAVDTLRTCGTIAADTV
                     RPTHGCCFYQMNTFQIRPSQPKLQVPSQYLVSDNYFRLDWHGVGERRLKNVFLFLEWV
                     PIPAALSASPPQAATGGSSSEAATMVCSGLLTLAEGESMRWLIHHSRYVQRNFRLALR
                     FASSGAYMDATGPFSAVVHRQGVQALRHMQLSSTSSCGGGYDVSTCDAVADRAVLLYR
                     FLNSDMFYSTKQLAVLEEVLEAMSPSDRLHFFTECLRVRRRSRNHWEDAPIAMLFVSE
                     AEKPYLRQLAVGKRMQQGMEDMAEVVVRAARPKASERVRREAEPVQRGFESFTVALSQ
                     ALSACGASAAFSAERVAEMLTESFPAVFKTLSVQEVAQSLFFLVQQKRGAVGCSAASA
                     PPAAAASADPANYISAEELFAVIPPLNAEVLRERVEAAHAPRPAAAAAQPASIAVWSC
                     DACTFQNPIASNMCSMCMAPKPKSVRVAEDAAMAAAVDAAAGGTGEEDEGDDDGADAP
                     WQCGVCTFINESRAKPMCEICMAPNPRPLKASGGGRAERSPFGGGFECPEGYWVCSVE
                     HGGCSKFNPNALFYCQVCEKARPNLASVRF"
     gap             484262..484360
                     /estimated_length=99
     gap             485952..486050
                     /estimated_length=99
     gap             486851..486949
                     /estimated_length=99
     gene            complement(<489110..>491515)
                     /locus_tag="LDBPK_311240"
                     /db_xref="GeneID:13385934"
     mRNA            complement(<489110..>491515)
                     /locus_tag="LDBPK_311240"
                     /product="vacuolar-type proton translocating
                     pyrophosphatase 1, putative"
                     /transcript_id="XM_003863167.1"
                     /db_xref="GeneID:13385934"
     CDS             complement(489110..491515)
                     /locus_tag="LDBPK_311240"
                     /codon_start=1
                     /product="vacuolar-type proton translocating
                     pyrophosphatase 1, putative"
                     /protein_id="XP_003863215.1"
                     /db_xref="GeneID:13385934"
                     /db_xref="GOA:E9BMP8"
                     /db_xref="InterPro:IPR004131"
                     /db_xref="UniProtKB/TrEMBL:E9BMP8"
                     /translation="MAGRILIVPLAVALLAVAVAAKEPLNPIATPANTNVDKAVAQNA
                     GDINAVPLARPLMSAETASVVIVLAAAVGFSFAMYWWYALSFIKITPGKDQGLRNAHL
                     TDEVMRNVYVIYTRISEGATAFLMSEYKYMAVFMSGFGTLIFFLLGIALSSPQEGHVP
                     PQSPWMNASLSLFAFLVGAVTSVGAGWIGMRIAVYTNARTAVMATSGGDDGDQASGFR
                     LGFQTALRGGITMGFGLTSMGLFALFATVKVVAAYFGSGVETIPELYECVAAFGLGGS
                     AIACFGRVGGGIYTKAADVGADLVGKVENNIPEDDPRNPGVIADCIGDNVGDIAGMGS
                     DLFGSFGEASCAALVVAAGSAELTASFTSMMYPLLITAVGVIVCIVVATMGATNSGVH
                     RSHDIEPALKRQLLLSTIGATIVLIFLTEVALPPTFSVGGMESSRWGALICVLCGLWS
                     GLIIGYTTEYYTSNAYRPVQEIAEACETGAATNIIYGLALGYLSVVPPILAMCTTIYV
                     SYRMCGVYGFALAALGILSTMSVALTIDAYGPISDNAGGIAEMSHMGHEIREITDALD
                     AAGNTTAAIGKGFAIGSAALVALALYGAYVSRVAIPVVNILDSRVMPGLLFGAMLPYW
                     FSAMTMKSVGVAAMDMVNEIRRQFQDPEVAEGRKEPDYESCVAIATKAALNQMIPPAA
                     LVMLSPIVVGILFGKYTLAGLLPGAIVSGVQMAISASNTGGAWDNAKKYIEQGGLRDK
                     NKGKGSPQHGAAVIGDTVGDPLKDTSGPALNILIKLMAIISVVFAPVFQSKMGGIVLN
                     LIE"
     gene            complement(<492123..>494816)
                     /locus_tag="LDBPK_311250"
                     /db_xref="GeneID:13385935"
     mRNA            complement(<492123..>494816)
                     /locus_tag="LDBPK_311250"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863168.1"
                     /db_xref="GeneID:13385935"
     CDS             complement(492123..494816)
                     /locus_tag="LDBPK_311250"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863216.1"
                     /db_xref="GeneID:13385935"
                     /db_xref="UniProtKB/TrEMBL:E9BMP9"
                     /translation="MEAETLLRLTVLSFGAAAPQPTHAKHHKDNVAPPTPHIAASQDI
                     RMTFINLWAGQLGQFISVNAFLRETLLFFLPGHWCCGPCETHNLELPTDTAIDTRSFA
                     SRLEQYRTQRTVKKWAANPFLQQLDTLVTLLQPKPRHAQPSFQEWLKVVDHLLTALRT
                     LFMTTYSAFFNSFCAVHKTLIDSFRRPVWEDVQTSYALAVCDLSRSIESKLITIVSHA
                     ISSNIDACTANTTLQLFRTPANLTPNEISDYVASALLTRLGDVASSVALNARFAKQFP
                     QAAASLDVSDDRHEESLAFLRSSISSYVEKLSAVATTTNQGAPSITEPSAFPSDELVT
                     SCASKATSTLPVSVEAKTIAQAAQVSPYTPRSVSVEDALALTIMSEGVDVFSSIAAVA
                     ASVGDVEERVRILVAQQAEEQQAVLGWIPNNKGRQRESCCGAVKTPEDIIPDIDDTPA
                     LAKKSPAIREKQVECYRSDPGETVLFWNRLREKLGLDEALLMQAMTQCGFRCESPYPN
                     VFLKDLDVRNNDRITRFFVEEVRPLLSVESSPILKARNVRLFREACTSYGKQLWEKTL
                     EIRETLPCLPVRVRGVLLGTMYSAMRADKQFESLKQIRVQLCQVAAKIGATAKDAATL
                     ADTEEQLLKRAEIIAQAVNAIEYEAVEERRSQAQPTEVASTPKPEYRAKSALASISNK
                     TPLFKGFCGSISRYARAIGSLAPLQTTSTSSTDAAWRRSSVMDVLAQSRKSMAELPAK
                     EFSPGTPVAEVYRQACRCHGVSPNPSVVCELSGNDADYFATLDLSSNYVGVEGLRPVL
                     DLLQYNGEHLVSLSLCNNDLESDDVSDLCGALRGPAGTNLVHLDLSYNPFTNATFPVL
                     KELVSSLDCMETLVIKGTLLSSSASRQLQGILERKMIQRCS"
     gene            495813..495883
                     /locus_tag="LDBPK_31_tRNA2"
                     /db_xref="GeneID:13385936"
     tRNA            495813..495883
                     /locus_tag="LDBPK_31_tRNA2"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:13385936"
     gene            complement(495935..496006)
                     /locus_tag="LDBPK_31_tRNA3"
                     /db_xref="GeneID:13389991"
     tRNA            complement(495935..496006)
                     /locus_tag="LDBPK_31_tRNA3"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:13389991"
     gene            complement(<498042..>501923)
                     /locus_tag="LDBPK_311260"
                     /db_xref="GeneID:13389992"
     mRNA            complement(<498042..>501923)
                     /locus_tag="LDBPK_311260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863169.1"
                     /db_xref="GeneID:13389992"
     CDS             complement(498042..501923)
                     /locus_tag="LDBPK_311260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863217.1"
                     /db_xref="GeneID:13389992"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ0"
                     /translation="MQLFSFSKQKKNAASPKKATRGLPGPNNSHKNAFFQDDETADTL
                     NLHHSPSSHSRNRQGCANNRTSTGDRASPLSLPSLQSPSTNSRSHVDSVSSSSQQQQA
                     QRQASECEKASEVSMPRLQRASGALTGTPNARTSSSTGFPVHGATAALPARRSAATDP
                     PASKSATINSTPATPRQDLTSPIRQPPVARLLPSKVCTVRKPSVHFVSPLPEDCGKKP
                     PIGFPDRMAVPSPPSVTATSAQKGQPPALPKSRHVVPAVVPPAPQPLPPRTISLPVFT
                     AMESVPKQPGSSFRALKRHKNSYEGANNLPGGPIYTRTNGNLSNGTVAAPIEGNAAAG
                     LGRSNNSASGVTLTPFCKERQSNGSCTGSSAHDTEREPVARFADGVDGSQRNPQSNIP
                     AIAHVVPIPPPMNVDKLGSFRGTVGSLLKSTRRTSSMYSNHSTQSSIEVVVSENPTSV
                     RRSQCTNVRLSTPRTMVKVVSSCSLSLDDVPRPLNRHASTLSTEQQEALRRTPSFLTR
                     AHTPPPSNLRDLVQVRKGRRLLQVRCNTPDVHSAAPGVRSASEQSLSSSPTVMLSGLP
                     PSGSDDGKSTAHSLARSTEHASPLLGHGKKGDASGQPLKDPVATCSGAVSPNGPSDSG
                     SHCSFRNGGRTAEWRANDARLLSEAGASSEAPRPSSCETIKPRPRAPHIPSPPPLHHH
                     HTSEPGLAEVSPPPLSSSPDPVATSAAVSQDLHKNTSSSMSLLLDEAAEFDFYGSCVL
                     STLQFNTKPPQRTTATPTPADESDSAASVDEVVQGQQRSSQQEQKPQKPEMSRNGTAG
                     SAAVKAKGQNDVSISVSECVRLNVTDLLGAASGKTAAKATDTRTDDGATSAETPNQSK
                     SSAKHVRTVRPASRQRVVSAYVDDDEDEDEDGFYQVSRTILKPASASAKQQGTSYGGP
                     SLVPPSPRENGHHYLAAIPGSAKPSQPLRETPPTPAAAKPAAVAAPLRAQLDLSWNDD
                     SDDDDNEEEYDNLLEGFHPAGFDARRGARSSNSIVFYLDKEDSVSSTDVVVRAASIPR
                     GSWAIPFSLADTKLLPLDQKPQSEYSMLKLSTTVKTGGGGARPHITFDPYIAENTHPA
                     AQLTSSEPSSTLPDSHVNKSLSLHGNLDQYDFVIDSSYSSLLLNANVRGSRTALSRNS
                     ASGVQSKASTPSAPVSIFLGTTLRFAPDKSKMHRPLANTFGYTNAQRRARAAAMAAGV
                     SAEEWARAACIDEDDVDSEDGVYGEVYTDENGDEWYWEEVEDEECEEDEDEDEGNARD
                     SACALEKGGAGVRRSPAPTSSVSGVTATATR"
     gene            complement(<503387..>506659)
                     /locus_tag="LDBPK_311270"
                     /db_xref="GeneID:13385937"
     mRNA            complement(<503387..>506659)
                     /locus_tag="LDBPK_311270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863170.1"
                     /db_xref="GeneID:13385937"
     CDS             complement(503387..506659)
                     /locus_tag="LDBPK_311270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863218.1"
                     /db_xref="GeneID:13385937"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ1"
                     /translation="MSSPSATDAPAKAPIKPHRVVAFFTSADRSHCLVGVVASTPTVA
                     QSDGTVAVLVQPRPLILLAPQTLQDASKSGGLVAGHLVDASDPSVSGLLTASISSPKW
                     ANSSGSATLPLNADDVGTVMTAEELREMQEHRDSLKADLGSSRDRVREIDELIRQHTQ
                     EKNSSATLATTPNPLRAPSPLKEHLDAARKTVDDAAKAADAAEKELLLARAGLRTVKP
                     FAWADLQRRHSGSSSQPLVSLIETAVAPLHDRTCASFDDAIVQAVSLPKRLAAVKSMS
                     VTVDDTQRALRFLKAWPTVAAVAKEHKTAAALYRWVDALAKATEAQRRLKATQQALAA
                     TPSQSPDAAWQSKEMARGPEAASQPTKKLDSVAEAALRKERKDQMEYVQMAEEELAAV
                     DALIAEAEALAISSPHGAQDSPKGAKTIVPALAVPTSWVACALPEDEAPRIGVYAHQP
                     RGKQIEFSSSASLILSTVAKELVPSAVVSTATPQDRTVSALDLAEPRKALSGSDNNSG
                     SSYHGTGVHRSTNSPQLSPRAAAAASTGVSNAALVPVTEVTAARQRAEDAEEKTRLLE
                     ARLSAALQQNPKEAEVQLLRDELDAKRTELRRVTEERDRLLQERCDRSSRYAAVSRRA
                     TADGAQNDGVSQAASGRYARRSSTPRDTVDRSVVEELEDQLTAAHQRISELLIEASEW
                     RRRSPSLTAVSIAPRAAKSSRVAISHGDCSHASALQSPSTEEMDTAPHSASDTPRQRS
                     LRGAAVSPCRTSSSPMITQEMYDDLQARLCAVSDELETQRQGTRHLEEQLNDALHRRS
                     EAEHMVLAQKHELEEVWERLEAAEARAEEQELLTQQRLLLTHTQLFPSQSQLPQLNVS
                     TPLPSVSPIVNSNLSQTLQPTVASTGAPLQHAQHTLSVQDVFGGDSAPGAADAEVRSQ
                     TNEDAMTIATNANTAYGSASRLSADVYPHSPGTSGFPSFGGGGGVATSAAAANAAERS
                     IVSQYSRAPSALQSRPVEQLSTIELRHEVHRLREEVERCQSGELRMVMELQTLREKQK
                     AERKRRRDARAARIQMLARMQGNIADVIEKSTKELEAIPALLERSRSEAEALMARRRL
                     GG"
     gene            complement(<508599..>510482)
                     /locus_tag="LDBPK_311280"
                     /db_xref="GeneID:13385938"
     mRNA            complement(<508599..>510482)
                     /locus_tag="LDBPK_311280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863171.1"
                     /db_xref="GeneID:13385938"
     CDS             complement(508599..510482)
                     /locus_tag="LDBPK_311280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863219.1"
                     /db_xref="GeneID:13385938"
                     /db_xref="GOA:E9BMQ2"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ2"
                     /translation="MPFKKNGFSPRKPSSPTKVLPSSTDTHHSVLAKISSVAHVRVSV
                     NDLVAFEYVCEETKGWKWGLGTVAGIPGPRLVQLMLWAGSGGAMPPEGLPVSEADRAA
                     AVKRLKELQRMRQEAEEEMEDLNKTLTAKHAHYKEGRAAYEADAARAQEAAAEAREEV
                     KNMDEADWREIRSYVKPPDIVKLVTEAMVLTLGERTLDWNYILKVIRQRTFLKRLEEF
                     DSQSISLATRRRLRKEYLLNPRFTHRDSMEGSRALGIVQRWVAAQLATSEANVDICLY
                     DQARARERKHIEKMEDTLRQRRDEAEKFKAEETRLKRQLGDSPVHIDHGKHVNGTAKA
                     SPAPSPRGSSAKNAWSPRGGKPDNGADGATPRGRPGAPPLHENVYSTANTWVFTDESK
                     IVLHSSILVNYDEPASTVVTLTPEQVEKLKKALRDRAALFAEQQKADGKIKNLEEDLE
                     NVRGVLADSLQDLADAKAALAAQDAALAAKDREIDEAKEAAAAAARLAGTNKVGLLPA
                     VEPPKEPAGQCKELNELIAALDSEKEKKKPNDKKGKRQGGRAEVELEKEVMANGIALN
                     GSMPALFHARDDRELAKIIDRLEKEIRILRNESETATFVLDGVHATINGRPELKQYFE
                     GDT"
     gap             512588..512651
                     /estimated_length=64
     gene            complement(<512652..>517226)
                     /locus_tag="LDBPK_311290"
                     /db_xref="GeneID:13385939"
     mRNA            complement(<512652..>517226)
                     /locus_tag="LDBPK_311290"
                     /product="p-glycoprotein e"
                     /transcript_id="XM_003863172.1"
                     /db_xref="GeneID:13385939"
     CDS             complement(<512652..517226)
                     /locus_tag="LDBPK_311290"
                     /codon_start=1
                     /product="p-glycoprotein e"
                     /protein_id="XP_003863220.1"
                     /db_xref="GeneID:13385939"
                     /db_xref="GOA:E9BMQ3"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ3"
                     /translation="MVESSSASPSSLLAGAAEAIAFPPSAAERDLEEFEERNREQQIS
                     RSLWAQRVSDLWGTEPPYEEQPEDRSGWIFGSLFYQWIGHYIREASREQLTESGLPKP
                     TRQYRAYNAGVALSAELQRQRARRHAWDGYVGARVGVRWDDASDGVLRWVGAVQQYGT
                     PGRLYAGVEWRVAPSRRRGCCVRRCMGWLLCRGCSAPVPEQGPGAYHRGEVDGEHLFD
                     PVEDDTVLTCERVEDVVFRLGLRDDASQVSSTRALLKELPESAQQCPHPIQVWWAVWT
                     LFRQSIMHVVVLGIIRNGCQLMTPLLLKWFVAYLGGVGERKGRSEAGLTATITSPVSS
                     LDLSFAWVHRVSSAGSPGIGWQRGVWLAALMFVTMVGETLAGNKQYHVRRRSSLQVRN
                     ALSAALFEKVFTMSPKATHHPAFNAGRLTNLMSTDVEVMGRFIMMFWTLASTPFMLAI
                     VFYQLYVLLGASVCVGGVVALVFMPLQAYMVRKMSSSYRRKAQATDHRVKATTEFFSG
                     IRVAKFMSWEPFFIRRIEKLRSVELSHLKKLQQTIMMVFFQFNATPGFVIASVFFTFS
                     VTGHTLTPTIVFPAIALFNLLMGLVSMLPFALQLMTKLFVSLRRLNMFFDADDELVPA
                     VEDIPLAASRAMPTDVSRAAGAGDAQQQTPSFILIHDVAAEFVHADISTYVAQELKKT
                     DGALEANSAGDGAADRAPLPEAEAFLPDRQPSSSSAAPAPAGPVTEPLNAKGSHTGHG
                     DAAASSEPLSSSAQKSTAEITFNEDSIYVLKTKTLLADVDLRVPRGRLTVVLGPTGSG
                     KSTLLDALIGALAVTRGRVACSRSVAYVPQQPWIMNATLRDNVIFFGAPDAAAFERAV
                     RSSQLASDLALLADGAETEIGENGINLSGGQKARVSLARAVYADRDVYLLDDPLSALD
                     AQVGERVMRECVCGALAGKTRVLATHQVSAAAYADYVVVLAADGRVAFQGSGEAYYKD
                     HLARQVSQRGAASSDVTEGAAEKEAPVANITAEKKLSDLMEEEPPAADTTLTAVSEVE
                     GRAIENKGKLLTEEERFRGGVGWDVYVRYMKACGGVGACVSIMALYLATEVVMMSTSI
                     WLALWSTKWLPLSATQYSFIYVGLSFASALATPLRYWLSMSMMRRASREVHQELLRSV
                     ACATLQFFDTTPLGRIVNRFTNDMSNIDSDLQGSYSYLLSTISTFFSTVAMMVATQVF
                     VLGILIPCMVAYYYLLKFYARANREIKRLVNRVNSPMLSVLQEAIGGRWTVQAYGAAP
                     AVIQKALQCADVVYTCSYLQLGAELWLSVRIQMLSASITVAVALGAVAAMHLSFLPSH
                     IGLLSLSLTLALEISSLLDGIVTVLASVEADMNSIERVFYMTDHIEHEDLQEAVAAEV
                     QRITEGAHGPERRCAETLAESEEPSGLDNWSSPLLIRQSGNTQFGALVLEHVDMRYRP
                     GLPLVLRDVCFAVAPGQKVGVVGRTGSGKSTLLLAFLRLVEVCGGRMLVCGRDARDYG
                     VRELRRLFSMIPQDPLLFDGTVRSNVDPFGC"
     gap             519774..519872
                     /estimated_length=99
     gap             521757..521855
                     /estimated_length=99
     gap             522837..522935
                     /estimated_length=99
     gene            complement(<522936..>524792)
                     /locus_tag="LDBPK_311300"
                     /db_xref="GeneID:13385940"
     mRNA            complement(<522936..>524792)
                     /locus_tag="LDBPK_311300"
                     /product="ATP-binding cassette protein subfamily C, member
                     5, putative"
                     /transcript_id="XM_003863173.1"
                     /db_xref="GeneID:13385940"
     CDS             complement(<522936..524792)
                     /locus_tag="LDBPK_311300"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily C, member
                     5, putative"
                     /protein_id="XP_003863221.1"
                     /db_xref="GeneID:13385940"
                     /db_xref="GOA:E9BMQ4"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ4"
                     /translation="MHALYGAEPAYEKQPEDRAGWLLGAFFHTWLGDLMQRAAREELT
                     MDGLPRPMREYRAYNAGVALSAELQRQRARRHAWDGYVGARVGVRWDDASDGVLRWVG
                     AVQQYGTPGRLYAGVEWRVAPSRRRGCCVRRCMGWLLCRGCSAPVPEQGPGAYHRGEV
                     DGEHLFDPVEDDTVLTCERVEDVIFWRDEPGGETHDATTTEEDFVDDAGISSQRQSEE
                     SCAEVAAPPTRMSVTVALFSVLRWQLLLLGPLRLTVDVTALLTPMALSWYIRLLQGST
                     DTTSSESASSGTSSAAASSWQSSSVVDSGSMRDASWQPVASVVLLFAISLVRSLALQK
                     YAQLAYRSAYAVRSGLSSCITAKCLRIASRELRRPELNPGRILNLITTDVASMEGTMY
                     VLWMAVTVPLQVCATVCMLYRSIGWAAGISILMLLLFLPIQILLTKMTYTCTVGLAKS
                     SDARLRTTNEFLSGIRAIKFMSLEDTFEEEINARRAAELRAVRRFQLISTANSLISQC
                     VPSCTTAAVMVAYYCKGYPMSPEIIYPALSLLSLMDTPFELVRTLVGEFSQFFVSMKR
                     LTSFLAADDAQARDILEAALASKEGDDAAAVLRNATVSSYKAVPLPPASSREG"
     gap             526105..526203
                     /estimated_length=99
     gap             527121..527219
                     /estimated_length=99
     gap             528219..528317
                     /estimated_length=99
     gap             530365..530494
                     /estimated_length=130
     gap             532164..532262
                     /estimated_length=99
     gene            complement(<532263..>533153)
                     /locus_tag="LDBPK_311310"
                     /db_xref="GeneID:13385941"
     mRNA            complement(<532263..>533153)
                     /locus_tag="LDBPK_311310"
                     /product="ATP-binding cassette protein subfamily C, member
                     6, putative"
                     /transcript_id="XM_003863174.1"
                     /db_xref="GeneID:13385941"
     CDS             complement(<532263..533153)
                     /locus_tag="LDBPK_311310"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily C, member
                     6, putative"
                     /protein_id="XP_003863222.1"
                     /db_xref="GeneID:13385941"
                     /db_xref="GOA:E9BMQ5"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ5"
                     /translation="MPAYSVSGQLARASATPHPPVHPTVLTPVYHQSSHPRPPPRGLR
                     DLFGEEPAYEKQPEDRAGWLLGAFFHTWLGDLMQRAAREELTMDGLPRPMREYRAYNA
                     GVALSAELQRQRARRHAWDGYVGARVGVRWDDASDGVLRWVGAVQQYGTPGRLYAGVE
                     WRVAPSRRRGCCVRRCMGWLLCRGCSAPVPEQGPGAYHRGEVDGEHLFDPVEDDTVLT
                     CERVEDVVFRLGLRDDASQVSSTRALLKELPESAQQCPHPIQVWWAVWTLFRQSIMHV
                     VVLGIIRNGCQLMTPLLLKWF"
     gap             533305..533403
                     /estimated_length=99
     gene            complement(<535983..>539066)
                     /locus_tag="LDBPK_311320"
                     /db_xref="GeneID:13385942"
     mRNA            complement(<535983..>539066)
                     /locus_tag="LDBPK_311320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863175.1"
                     /db_xref="GeneID:13385942"
     CDS             complement(535983..539066)
                     /locus_tag="LDBPK_311320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863223.1"
                     /db_xref="GeneID:13385942"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ6"
                     /translation="MSATPSRAPSSRTTRRVSFFHVSSDLKTPLSIARSKTMSDTSSH
                     KSTKDAEGERARRCANALRQEGTTTTAAASAALDSPSAAVETHASQPTTASRCTRGAS
                     SSRLSCQPLSEEYQRWKIESPSASRVTMELEFSLENTPLAGARPPPVWCESSPCTAPR
                     GSRNSLANSSTPSRRITTLSDARNSVSTPGSNPYTDVEREISNQRRRHAVVRYFFVSH
                     EGAIRLNIRLQQLLKYRDLCEAEMHERLQVLPPEEASVAARSTARCGRATETEREIER
                     VQAALAHLAASSLELAGTLEGMGGLFTPLQSAPRSHQTATAIHSNHTPSAADVERAGE
                     RGAKSGGRSVNEGIPAATKKAGEKKPPVQQPLDTSESSITTSVSTAFEAGGSYSLVES
                     PRTSTVDEAAKQRPPSKSHIAVAAGRNSRKSDLPSVERTARSAEPSQTESAGVTGSHG
                     ITPRNSTVASDFMRASIVATPKVAVETAAATDTKTRPGQPPLSSPRRKASSTTDNEGK
                     EVAAAKATPPRCMVIDCTSVSTPGRDHRTTESWLRQAAASHHLASAPPQQPPSSLCST
                     KAAVPSAASVKPQYPSGITAPRAKAFAVTPDRRTPARTQGQPASSSLTDSPLTRYRAK
                     QGYRNPESHFCSQLADAPRQGASATHNPLPRAATTGEPSGAQDREKSKGPVTATRASG
                     ATRHATLHEDQATLTQERRRLGPVKNEGSPDTSQDRSAAESQDKTPTSTGRWPGTPCA
                     RAAKSSSTPSPSPSESKVPAHKPLFESFRSRAASAGSSPPPHSRASDVPTLGQSTKST
                     AVASSTIPSHPPTSTSHPSTSDARQQSSKPPTASASALGGGSVTPSTNASAAHALTGS
                     AMSVMDWNVPSRAPGVAGSPPPSASSASVPPNKELPSDEMASWSPADSAVAPAGGAVS
                     LSDVESWPAGEQQEAEKNAEVSAGALLRGSTRERSAEPRMDGCHSIWGNIRALESRVG
                     DLESRTTALEKNAEKRAVLEVIGHLKARVGVLEQRTTLLEQQSSASHLRIHWEKP"
     gene            complement(<541284..>545876)
                     /locus_tag="LDBPK_311330"
                     /db_xref="GeneID:13389398"
     mRNA            complement(<541284..>545876)
                     /locus_tag="LDBPK_311330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863176.1"
                     /db_xref="GeneID:13389398"
     CDS             complement(541284..545876)
                     /locus_tag="LDBPK_311330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863224.1"
                     /db_xref="GeneID:13389398"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ7"
                     /translation="MSTRGSRRHDMAHSGAPPPRRTSVVVAAETRQKMDAETEEKDAP
                     ALSLACGGSSASSIDGWRTSMSPAPFVTIGAASAAASSTDSTSTPTALANGCADPSLS
                     RVGAALARASAAREFYKGDASSGSGNAVPRRKTVHDPSSGSSFAPSLTVKGRHHQHRC
                     GKVDKEEHSSGSSAGPRDKSQKARLAADVCADPPKLSRHPYQLGVENFSELAAEPAAP
                     RCRVSADAVPCGPSSWSAFAGDRAEASSPTAAPSAVEVSHSPVTSSSRPNVTFRAKCT
                     GHLKPSLSATPGSPKAISVTMPSMCFIYTRTSGRSKDRSREKSKYRSLSAAKNALGDG
                     VCAVVAASTESSATAMKVRDLTDERAAATTHIASEPVSLPTQLPLRRGTLPQANTKRT
                     PGQPSARSPFTRSVTYTCARVQEPRPAAQSPSDGRGRPADEKRNDASRKDVGHAADGV
                     LRHTSARDFEEASHSHLQRWRQRQEENRSRAKDVTSISASTPPAVESATTLRDAPMKS
                     KVGAAPKEQELKPLLSEPATDASRQRQGKREKPSTQAASTANTDLAVAPQPPTEEPER
                     QRRISVGVEARNAASPPTVSGFFLLSEVRYCGNVPDSPEAVLASAASKRNSKASTPPP
                     PPKPPSTAQSRSVIDGSAAAAARNHEAQAESTANVSTHPPPSMSSPSCCLTEDPRHRV
                     AAKDGIPVDRKAQPPPLPSAQHTSHSGFVSVAAEGVTPASRWLLDRTSAHQSAPCQTT
                     KGPTATAKEDAAPFLSASAADTRGLFRAVLGRREQRLQLQEYSRNAGRVFPQQPTSIE
                     TPAGGSGGVEVPPVFSSVEQPSTRRTAVTSSPCPSPRALTQDTNVSAPLKVEPTRSAA
                     RAARTVTLEGVEALRMRSAVSSPTGPETGKNASRSGGGVAAQIHTEPALSAQHMGGDF
                     RSSSSSTEASAEQASPHLKSLQRSKDGELAERPPSSRTPGAYTPLLHWIRQNRTQMPH
                     PSGGAPTPLPVVDVAAGHAAISETTKIEQNPHLVERCALVNKYHRPSRTASDTEVDNN
                     EAQLPEAGASRQAPNELLLRKLADARGSHRRSSTNSSVCVSSLDKAVTSVRHPTPAPA
                     HPSCQGAAEGHSTPVAEGELLPHAPTSSVVDNAKGASTCTVASLGDIQLDELDKLEQS
                     INALLKNYGPRKAADEGSAPAKLTAAAALMCETSPPVKTSTSTNARHREAMEAVNKYN
                     RNDPKDDTLAPSNSQDSSRAWPHHSCAVETDDDDSQLEGSGLWCGDEDAHEANPPPVF
                     VPPLDLTLLLLPTGDSEELKPYRIPLPSAVPAPEEAHRRFLCSIGAYAAAFGEEGSTA
                     TAGDSLGAGAVADAPSAPASMTGVEDAALPPGNSASLNDSCPPPSRRASKSCTSLTPV
                     SPFVNERARRMRASRQPFSTTGPSTVNVRSPRASRHAAGAVKDGADKAVSEEGEAGKA
                     LLMEKAADAIPTEENEMLRSSGGADHVRSRVAPMVLFTDDSDALDGGRGAERDRRVNL
                     QRGRAQRILLDCQEQRERKDTVLEELNALKTLTKRF"
     gene            complement(<548178..>555881)
                     /locus_tag="LDBPK_311340"
                     /db_xref="GeneID:13389399"
     mRNA            complement(<548178..>555881)
                     /locus_tag="LDBPK_311340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863177.1"
                     /db_xref="GeneID:13389399"
     CDS             complement(548178..555881)
                     /locus_tag="LDBPK_311340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863225.1"
                     /db_xref="GeneID:13389399"
                     /db_xref="GOA:E9BMQ8"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ8"
                     /translation="MSSDIEAKITEAGSAAVDTSAASSPGTTGAHGPGSGHTSLSLLR
                     TDATPSSATLSPLVENPSDATQADAVSLSGRKRRLSFKDRQRQRAGASGSTDLELRAI
                     NSRLAHSPMSTASSSSPLTLDLSPARERPLPHSALKRTTAAASPPLTACIFTEMGPSH
                     RGGRAGAPRAPSQTPIALAGPDALTATAAVEEGPSVPDSLVLRATSSNFSFASKPTGS
                     PHEHSGSLASASQLQSPLSLLPQDTASAAAAPPPHLPSSLMLCTPASSTSGNAAAQIN
                     ADDTKAPLPKLQTPTAIGSATTSPNGFGSRTTLEELPTLSPVSSTSTSSPRMSFKDRQ
                     RAAVASRKPIIAAGASVLARSPPRAVVASSSFTAPPESSLATPSSLPAVSTAQFTPQS
                     PAAALRERAAFSAMTPVTQVPSPLPGYPSLSTSPPSQKLDPVEQVDPTELVSADRDRN
                     TSTEDTSELPATRPPPRLPLAKLTTTESVRPFPLPPATVHPALASHLKRCTSSGPSAS
                     ASTKPQFRFFAQGCQAEKEEDQSPGATCRGHSGQPRWLRDRSGSAGTASTNPADADVG
                     EKSYVDDEEESLLACTQNEARLHFYDPSIESTPMEFNMASPYARYNMNSSASASRESG
                     IAETRNSTERSETMCEGPGWSQTMPSMLTGESGPDVVKAACLSKPLRCCTRARTESLE
                     AAPQSTGSSTASRLVCAEGPQTSSSTDSRQTNVKFEQHHYSDNAFGTAPLPAVIRKMR
                     ARASGSIVGRWRQYQHPHTSQRDAHVTRGLSSTHSTLAPALSDNSVSLSSTQLSCTAL
                     PRRRHRSKMLAPDSALIATSSAGRLGGAESSHVFSPSSLGHHRRSHTLDDFALMALAS
                     GNRGGATPSSVTPEPLSPSSRPTAALRSTVNARFPLLPTHTAVAASQGVSAGLADVRS
                     TRDDLPIPLGPIPAGALLLTETSGGSSASGSAEQSFNAGVVSIFSSGASPLPAVHQQA
                     SRHANSLGKVSSALASALIAPAPSAEDLSATAPTVNVDTPAGCSSVDELSTHTMRRRS
                     SVVDPGACSSTGGGAVAATANADDAEDSDGDYQQRTVYSYYGGDSIMSATTAELRKLR
                     RRSNYSSLHYGTMTSYYHKRNEQRQGGRAASQHGRRRSGGGRRRRHRAGAGVDGKEST
                     ALFSQAAVFARDSASSKPDNANTDDDIETVWEQKGSDEAAASKEEEGRIREAAAGQWR
                     HHRGNRAKDDAFAAAAAAAAAADDDEDAAQRRTVGMWTSVEHVFLPRYEVVPEAASST
                     PLTVLASPKSNTNASTSAVTSDPEAKQRHGSSLGSIPDKKKNATPNLTPASDQQPPHP
                     LPPADASPVSIPAGSPSLGAAGSHLMTPAPLTPKGSPSTYPSGNAAGSRPSGLVVLPD
                     ADFSVDARASVSLSCSQFRRTPAQASGTMRLEPQDFTFGTVAAEYNMDPADEEGLPQG
                     SCDAKVAARLIFDAAAGVMLMDPEDEVGRYERHGHMPQDDRGSLTAPLEHTEEGSEAK
                     GDHDACDDEANDGACHCDAAFIAKDFKGPDCSRYDANDLYDHCSRCHRRPAAFLCLHC
                     LEAVCPSHVRRHHLQNPSVCTLFLNLLDIMNSFDRIFWCEKCQQFTWKHTEVYDALVD
                     QIAFTRGTYLKHPARDIHCVGYEVRLKDVTASAAVRHASGSAIGAEAHARAHSIDNVL
                     PAAILNQTLSDLWIPAALQNVTSSPATEAFTASEMLPAFANTLQRASNASALPNGGAQ
                     LSMGIDAGALGLSPKSPPSGGALVRQRPTTVASNSLSQLPVRSPMQQFLSRDPLDFSA
                     GNTVTVGEPVTKLCALAASVQGWRTTQEDAEAVFLVDIPAISEEVVNRKELREVAAAA
                     AAAEAAAKKPLETLDRGDTHRLDSSLLVHGSYELSASSASESSPEFNSAVRPSDSGAY
                     ERPNTGDEEAAATAAGAAKEEAEAVPKETMPMAVFCMFDGHGGDAVAKLAARHFEAHL
                     RRAIEETRPDDVRARALLFFLKAETDSAASAGATAPWLPQSVSAVPAGDGILNYAAPL
                     ADSLNTPAGPAASSPPPSLDAASGRMPHSHLSSPFQRPSGSATVSVPFDRFSAKRSEA
                     NGDETASPPKTADVPFTLADELRSVSFAGSFSVLVPVTAESLRLHAAGATLGMGDAGM
                     KETSPAFEGATGAVGGKNRHPASTQADTSLTANKRVSNSHSSNRNRKSGVTLDAWEAV
                     EEPLPDMVSVAAGVGSPRTGVLLPRSIAAAEELRHGSGLSHNPNPPAGNVAICPSPAA
                     VVSIPEMEMLRQYFASIMEDALMSLDDYLRSTPEGVRGDYDCVGCTACVVGITANFVL
                     CANVGDSGAAFYTKDRMKVISVKHRVSDEAEQARIHAAGYNIISGRIEGMSAVPRALG
                     DFDFKQCGGRGPRKQAVSAVPDVTIMPVPSDTDQWGIVLACDGVWDTATLHQVHVALT
                     NTVNDLAVSGSAMDAVLRGAELYQNRLRGPSVVAGGSPWSSSPVSPPRAGGPLHSSEA
                     LGNSRKTPSPTKGGSFTSRAVTEESMIRYYDDDDDDGAAPRLSQVDAILLTAAAGVFA
                     QCVAPEDNDEGVGLDNCSLIIVERRNVQE"
     gene            complement(<565405..>571113)
                     /locus_tag="LDBPK_311350"
                     /db_xref="GeneID:13389400"
     mRNA            complement(<565405..>571113)
                     /locus_tag="LDBPK_311350"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863178.1"
                     /db_xref="GeneID:13389400"
     CDS             complement(565405..571113)
                     /locus_tag="LDBPK_311350"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863226.1"
                     /db_xref="GeneID:13389400"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9BMQ9"
                     /translation="MSSAGRHTRISGHRGHKHSRAAGNGAGMESSAHFDPHCSEDFND
                     LSLLPLCMQISHMRFDDPSSSETSISAGRGSDFPHAPGAATSLTSFNTDKNQPKQPLQ
                     MLPTLSFQNVHNASAGAADTSPTDHANDHKDCLQRKEKPECSQQDCHASGDIRSPPWS
                     TMNYPLSSVGSHNAALAPSSSSLTASCFSVGPNGVSGGYSDFTGGVSGAAGCGDGALA
                     AAAVWPDCGGGGSASSPLQRAHPSSNVGTASTGDDGGGNVAIADGNGYAMLQPQLMQM
                     LLQQQQGTAPPNTFMPSSSPRTNTLRGLRESSTAGSAPTMPAISACLMQLMSGNGGNE
                     AEQTTPNAPLQQLFVLNPLPPPSPSTEPAPRAPQSNSIIDADSVPTVLSLGNPGTRIF
                     YADAQIRGNTTAKCLASTRARGCGSNNPPAAPPGSLGQTSLHPNHFGSSPTPAASRKD
                     SDGGAHINTLVPAALLTAMNPLHHAFSPPSPSSAATLPMLSTGMYSPFTGAVPHCQAG
                     FPPPPPPTAAQSQPPLKPTNRAGNRHGSRGHGTAPATGNHNTSAGGNGRNRSRRQQVG
                     EDGHASSRKGAAAHAAGDAHAEPKNGANFVVGAWYEGVVKRYNPLRGFGFLTCTHQLH
                     LDLHACERACTRHADAVHEKQQQRDLEKAAAAATSGTSATLQSVNEGEREQAEQQLRS
                     LSSKSVSPADDTGAAPLLASMGSVKESNICLPQNSVATEAHREGDTDAAAPAATTDTT
                     NAEVADAADATLSPATAMTSTGKAHGTVVYSTMQWYLHMVGAAGKQTFAQGAVAAREA
                     EDDADEGKHSYRASFEDFGKLEREPAQLGDIFVHHSCISMDGFRVFVQGTAVRFSVAV
                     LMDTVQAVDVIPLGPEWEKPLSPEALAQPPLYKVTPTAATVLRYHHLDEQRDDDTGKK
                     SGGGPQSRVGGMSVQWTDMAVIPSPAIPNSVEGQSELLIVRVPPKMGPISSQTTVTST
                     RSGATPGLAAMKSASATITATRGGVDTSQSTNATEYGGAMPNTVGATGAQVSDASTKE
                     PMCTGAQEALRGGPQLLDVVHPDSIAATFLAMDRDDQRALQGKPGAAAITPATPAPSR
                     KCNAFRETTMKATEPSAPATEEVESLTNGTSLENAPKNQLNRDPSAFSGGWLTSSKND
                     LTSGHGNTGGTGTQTSGRDSRSATMTTMTATNPAQSSDHNAGSQSQALPNSIHDLKDS
                     RSRGSSTIPTDMFGDCKDLVLSGNMDEQAISSFNGCGAGHKADKDHCEGSERAAGGAA
                     AAADGGSNVAVLAHPKTAARSAAAAAQGAALLPANGDFSEPRSHDDAELSEVLVRSHS
                     GRDSDEEEKNSIMTSPSGNTIPESNLGPAPDWTEVFNLKIANERVKDIMKHKTDFKLL
                     PHHSVKIIAAVATPNQMSGGGSCFDAAALVPKVVPLSAVCELDSSSSRGVEEDEGAAE
                     ASGCRSAPGNCSNRGDPVGREANPSSSQPPMRGDDSGQTGTTQLTQDKSSCNGHEARP
                     RTGKPKKSSSAEGQQKRLKDKTVPAFVMVDVANLPPKLAAQVPRGVTIIALPRETVKD
                     LKVKSISVLRDASSDPASPCLAEAQSAVPVAEGPRTSGSKAYVPFHGPAQAAGGRHAS
                     SSSAARRPGGNVPAHGHAESTDSEFYRKLVVSLDKKTTSICSAPALGGRKCGDSCSPE
                     NDRNVFPFTLAPPQSQQVCQRLPRTSMGRKPDSMNKSSRGSINTFKTSSHSVPMPQSL
                     VNVLSSPWIQDSAASSQSLPYPKQQQPPQHPFALQQQLQRSTPSGSQPTSIRTTLGHA
                     SNNSLSQQQCEPSNPVFTSTNSTAALQAATRIATGSYAALDSSGLYLSPCISAGVGMG
                     TIRQPAMWAPSHALALAQPACAPPPPPVSSPQTAPSGTAMSASPQASSRWHPSQGNWR
                     PS"
     gene            complement(<585186..>586793)
                     /locus_tag="LDBPK_311360"
                     /db_xref="GeneID:13389401"
     mRNA            complement(<585186..>586793)
                     /locus_tag="LDBPK_311360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863179.1"
                     /db_xref="GeneID:13389401"
     CDS             complement(585186..586793)
                     /locus_tag="LDBPK_311360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863227.1"
                     /db_xref="GeneID:13389401"
                     /db_xref="GOA:E9BMR0"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9BMR0"
                     /translation="MFHAVYSNPVTSVPASNRMIAGPQPLPPQLLHSSGSQMMRDCPL
                     SLNDGRTVIYCVPAKNEASLQQVSYFRTLGQRWSSASADNTAQRTAETHSTVCFASCA
                     SGANGGAGGSPVLLQPAMGLPAFVTDKQQLPSMVAQPSPTLSRLTSGLCSTSEGTTTF
                     GASTTSVTSSTVGSGAATGTAATTNGSMSHTSTSPGLPGFQMSVSLPTSAITAVAAPP
                     QQPQTCFWLSHTTGALTPIRKEDMMAISDTSASTSTHSYAMPPPPPMPSQSSSVSATS
                     VPTYLMAPQVSSFGGAMVQAFSESLSGSTAFSVPAMPLPQPPRPPKTLNGLQYQLGEL
                     YEGFVKRYNPNRGFGFLTATAHVTMVNDGSNSDSVTGTPIASLNATTTAVPTTREAET
                     PKEHRTPVHLGDIFVHQSSMQMEGFRTLPVGGRVRFRIGYKDGQQTLQAVSVELLPQV
                     LPPNVEMASSASSTQQTAAAVPNQKTESMASWSQAAPPSICAGDSSVNARRLEGCAIN
                     FASEDDGDHKDDEPLIELAYDMYASFE"
     gene            complement(<592222..>593775)
                     /locus_tag="LDBPK_311370"
                     /pseudo
                     /db_xref="GeneID:13389402"
     mRNA            complement(<592222..>593775)
                     /locus_tag="LDBPK_311370"
                     /product="hypothetical protein, unknown function"
                     /note="contains an internal stop codon"
                     /pseudo
                     /db_xref="GeneID:13389402"
     misc_feature    complement(<592222..>593775)
                     /locus_tag="LDBPK_311370"
                     /note="contains an internal stop codon; hypothetical
                     protein, unknown function"
                     /pseudo
                     /db_xref="GeneID:13389402"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:E9BMR1"
     gene            complement(<600760..>601776)
                     /locus_tag="LDBPK_311380"
                     /db_xref="GeneID:13389403"
     mRNA            complement(<600760..>601776)
                     /locus_tag="LDBPK_311380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863181.1"
                     /db_xref="GeneID:13389403"
     CDS             complement(600760..601776)
                     /locus_tag="LDBPK_311380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863229.1"
                     /db_xref="GeneID:13389403"
                     /db_xref="UniProtKB/TrEMBL:E9BMR2"
                     /translation="MLGNLDAAAGDALRSFHDALDQAQQSLQRDEGRLRATAQLLSDL
                     TLEVDCLKADSAPNSATRQRREALQAEKLKMLHHTRHQREAITATAAHIQHLKEPRVK
                     LTERVDTLKADVKALRRQYGLRAAQVHAFIAQFLQPQNSLENLRCQLAQLQQGRVSQA
                     EALRASTRHLEELKAELAALKAAGLFDTTTDPNGDSTAGNDQPLGAKRDHEAAAASGL
                     ASDGNGEELNAEGDECTGSVPLLSEADRRSEARRRRSEQAAAHKAAETQQAAEQARLE
                     ALRVDLKRQVLLLCQEIEGADAAQQREQKAYHDALNDAASGAGGGVLRQCQRCACDLF
                     DGFS"
     gene            complement(<602799..>607259)
                     /locus_tag="LDBPK_311390"
                     /db_xref="GeneID:13389404"
     mRNA            complement(<602799..>607259)
                     /locus_tag="LDBPK_311390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863182.1"
                     /db_xref="GeneID:13389404"
     CDS             complement(602799..607259)
                     /locus_tag="LDBPK_311390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863230.1"
                     /db_xref="GeneID:13389404"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:E9BMR3"
                     /translation="MSSSSARRSEDAVAPPTPPPVHTSSSQAASRSLRKGLDTSPATA
                     VAPMSPLSPSEVNTALASTKTPASGALGEVPASSGDAPVAAGSAASRTVDPPDLTSTP
                     SPSGRTLLLQRRLEKDAEARARLHIVSDEPSALPDTEKACTRAKSTSSSAKPLESPDQ
                     THARRRPAVSPRRAVNGAAAAAASSGAKGGGESDSGTPATLSVCMVIGETAKPAAAKP
                     SAGATFPPTNGGKDAAAEGTVTTTPEVPSSINACDGSGALATPRRRYIALRPTMSVSP
                     LTTASTRTLSSNDDNEEGSPAAPKRKVDIAHTAATAGSKETETYGTQGASTAPRRTDS
                     GGASATVAALRGRLAAASGLSTTRTSTGSLNAGASAGSTADAKSAEAAALAELRELRQ
                     VLKDKERDLTRLTRDVEKATQAAAKAQKKTEDLQGKLESEKSAFAAHKKDTLAQRQEL
                     QRELRQAQAALRLAEQVQDKLQRELEKQKEKLATASSRATSVTTTPVMTPRSAAPSSA
                     SFDSMLQAKVSSLESEKKLMKDTIRQLEEKVSAAAAAAGLAKTAEQQRDASAAAAAEA
                     AETIASLKKEVLHLRQQLSTQETTVRDQRERLGALLEENKTLKAREKAERKPARKDAA
                     AATLRTGAAPGKGVSEEQLLSVRSPRQAVTLATPEKEAMAHLREELTAAQTQVGEHKR
                     MYEHAERRIKRLEIELAAVRRRAETAEAAKGIALQAAGSPASTTAATAIFKDTIASMK
                     EQLASVTAECSELRQRARERTEEATTLQSALQEAEDDRDACVRQIRDLKSRASEAEEK
                     AATALAAQKMELTGALEKVRTELRSVKAELRAAADSAQGHQEASKALRSQLGGEQQRC
                     SDLEKEKRAAQEEAAAKAAAADASRQQADHYKKKTKQITKKLDEALRELAVLAEEYER
                     ICEERKVAAKPDTEKNAIAEARRLMRRQPGTYIEQHTTTRDTETVIRAVSPLEAKRTA
                     SVSRNLSDALLSANRPAPVTGATSTAWAIAALDQERQAREQLELDVLSLYSKISAIDH
                     LEQKSWHSVERGGACAVAGASSTNLPVGSTHDRPRDPPQPPWMPVALQQSPGTCGAPG
                     RARSPGRARSPQATHALDARYFDPTILTCPESPPRSAGVDSINVRGHATANSHQHAEP
                     QQRSRSLPSEALQLSPGARSRGDAQSTYRGLSPRSMVLSTSTSAVQPYRSDSSASVIS
                     ALSELPATSVYYSTRGAGSSGNGTGLCATVELQFSSSAGRLLLSKRGHRVQRPVFSAA
                     ANEASDLDVCCAAIGSVSHTIYASHMLAKGHYHLKHIFRFIVRVLSDCESGGGGDILI
                     GFADRYIPMESFGAKRNALRYRGCYYLSLRNGGLFCPAQDICDATYEGWLAAAAAAAG
                     RRCGGGAGPRRDRGASVTFTHGVEAPLTDARTTSSPVHTRALPRPECVARAGDEIACT
                     LRTDVRSISYSWNGVECGVAFTEVSLSPSLYPCVEVNTSGGALELLGIDS"
     gene            complement(<608459..>611080)
                     /locus_tag="LDBPK_311400"
                     /db_xref="GeneID:13389405"
     mRNA            complement(<608459..>611080)
                     /locus_tag="LDBPK_311400"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863183.1"
                     /db_xref="GeneID:13389405"
     CDS             complement(608459..611080)
                     /locus_tag="LDBPK_311400"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863231.1"
                     /db_xref="GeneID:13389405"
                     /db_xref="UniProtKB/TrEMBL:E9BMR4"
                     /translation="MSPSHTPRTGGGLPSAEQSGDFKGRQSLGISPSNAYISDVFYDK
                     LKEREERARARVRKEFVRQAQESLYAEQRKRAEAEKATEVTLKRLDKAEEDISKAQEA
                     LQEATSVLEAKDVQLHERAIHVQELEAQVHLLERQLAAAQDAERLSSELASKNLEEVK
                     ALADQRQAELEAQRQFVHQLQEKIGLTTLDLFDRENDQEGVLRTVHELRARCRQLEEE
                     FAAAVQEATALLEQRRQRAEDEAQLLRGRNEELKQRCVTMGEELAELKTRLECDSSEV
                     AQLRARNEKALSECHVEIRSLQLQLERVTEVAQRRSSESATAKEIEQQQSAALVRQYA
                     AEARSVQEELDRLKSQSHREHEKHLTTVLDLSQQITALKQANTQLEHAINVRERESTD
                     ATRLLGRAREEVSQLREERRRMSAPFFDHREGSQPSSTASSYDALLRRIAELENVQKE
                     LTERLRVANSTVEQLQSMQQATADQPKSRRAPAGHHRRRRSKPYFPVPPTDSFLQMSD
                     DEREKLQAGGHDVATAPLSFMGGSLMSVFTGHREPTASLLDLLESIVQQLESIIRCAR
                     QQGEPAVRRNSPTASPSPQEHQVQQFKQTEELEALDRVLVSCMAALECCHLRRTSSPF
                     YSSFRDGAEGKESNGAAVRGEGKAAGREAPSPSVGASLVDSDRTGAARSRSSSVADRW
                     LQHVQNHRDVAQHATSAALPQDHFPQIPLERPRRSSQRSRSSVGGDDEFLSCFSNTSA
                     AAPHLPTERTARGGAAACVLQRSKQECTPAGKRLFDGSDAVQRIQPRTSASVSEGDRE
                     VLQSEPCWEGDADTEAIVQGERVAPSVLLHLSARYTCTTESPPARPRRTEAAPKRRGS
                     SGVTAAASHTKPDLSAK"
     gene            complement(<612852..>615173)
                     /locus_tag="LDBPK_311410"
                     /db_xref="GeneID:13389406"
     mRNA            complement(<612852..>615173)
                     /locus_tag="LDBPK_311410"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863184.1"
                     /db_xref="GeneID:13389406"
     CDS             complement(612852..615173)
                     /locus_tag="LDBPK_311410"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863232.1"
                     /db_xref="GeneID:13389406"
                     /db_xref="UniProtKB/TrEMBL:E9BMR5"
                     /translation="MRSKTQKNRSRYTGGPVSRVLFDSHAVDLSTDNSQNGSRPDTRS
                     ESHDDGSARWNPHGGADAYGKGHAERGAGTDVSPPPRLPLTFALGGFDTGAGPRGGYA
                     ARVYEESDDNEDAEDAGEGGDDFEPAHAEKYCREADDNDDEELGDYSLAGNGAAASGM
                     FPKDACARHLDVEARKAAPTAGAQPVDRFGFHTGKQAEPNVPGQQSIGAAMFAAAMSS
                     SATAAAPAASNTFRRATPVARAAYSVGYDHAVGESPADTLRASPLRGDGAAVSAAATK
                     EAGLLERASPKLTTTDTLGIARRGGPDMTAASQSFGYSMGDANPVPSADARYVPAVSV
                     AHSAAGSRAAYNRNLGTYSDFISATQASEVPPAHGTTISPKESMQGALDHRPSSTTSS
                     PLSPQRPTVGATDDMRAHRCGDHASATGFDHTFMPPVLVLDEDANVRNSDDEPCHRDA
                     EGAELPAPTEPTMAAIAVHAVPLATVGSALATTGEPKPRFFSGRRQSAENLRANRRAS
                     ATTADATKSACEQGGRVRSPSNMAASRVRESLSPEVAPLPTRQRPSELVRRREKTEEE
                     ADAVHHSAASERIERHSTAAKSDAPPVRAPTMALSISVTHMFNYSETERVWLSCDQSS
                     TLPVCSNQRSTCVNGRKAPPATAGSLDKALPPPSASPVQVSLYCRPLLVQLPSHSLHT
                     SILCAAGNSAFLRVTLAVLYYAPRVLVGSLLRALIRTAVVFLVLTAGLVTMDAAWGQW
                     PILSVYTAEAQGNATMMILSTREWLASLGIARE"
     gap             619957..620055
                     /estimated_length=99
     gap             620950..621048
                     /estimated_length=99
     gene            complement(<621875..>622255)
                     /locus_tag="LDBPK_311420"
                     /db_xref="GeneID:13389407"
     mRNA            complement(<621875..>622255)
                     /locus_tag="LDBPK_311420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863185.1"
                     /db_xref="GeneID:13389407"
     CDS             complement(621875..622255)
                     /locus_tag="LDBPK_311420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863233.1"
                     /db_xref="GeneID:13389407"
                     /db_xref="InterPro:IPR005735"
                     /db_xref="UniProtKB/TrEMBL:E9BMR6"
                     /translation="MPHSPQSTGQITCQQCHVTLAYPIGAPSVRCPMCAAVTPVQQFS
                     VTCVCCRCILILPQNTSLAMCPRCRTVMSIPASIREGHTGPQAPPKQCVYIDRPPTVN
                     SSGVKVTHLAVGTKLDDDNPPGKR"
     gap             623577..623603
                     /estimated_length=27
     gap             627171..627269
                     /estimated_length=99
     gene            complement(<627272..>629416)
                     /locus_tag="LDBPK_311430"
                     /db_xref="GeneID:13389408"
     mRNA            complement(<627272..>629416)
                     /locus_tag="LDBPK_311430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863186.1"
                     /db_xref="GeneID:13389408"
     CDS             complement(<627272..629416)
                     /locus_tag="LDBPK_311430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863234.1"
                     /db_xref="GeneID:13389408"
                     /db_xref="UniProtKB/TrEMBL:E9BMR7"
                     /translation="MGALPSHETHERGLYSHRHGRNRRNEIILIPLTTSFFPSPDCPL
                     FQHLYNSRYRRTAKYYFRALRSAQTPRDSDYFCTTTAINEEEEFEKFYKEYLEKRELC
                     GEKASVAAATATAVSPTASSPLLSGCSATGDSGADAGSTNGLSGAIPSAQSPQDCLNA
                     QGLPPRVGPMDFRSYSDTREGLYQILIRDNEPGVFATDEELRQAYWKQLQEQQTGRQR
                     AYQQQQQQQGRHSASQAATGGAGAAGSMPPPPPLPPPLSLSPSAPLSPSAGMNDAHAL
                     HGGLNASGAPSAASAAMDDLSFDEFVSGYVAAKRYMKGKPLHTSFSTTAAADVKGNPI
                     TPAMGAAGSAKVLNEYSARHYKHVTSPVAYDMRPLPCVIASRYDPGKPQPVNDPLYVQ
                     FGDSYVRIMGMFGFFPSTIGMRRAAGSRGSEDGTGSGKPQRSFPRKEGNCNGSDDIDE
                     EFEIEQHLLKGTMFVDKDVGDQILGNMVMLATYMYVRQCIEARIHPQAIPMLPVLIRF
                     PLSNIPMLQFVREFRVRLRSLLEAGTAKAGQKPVHTGMSGFNPEDLAEPHHPQLQRLE
                     EEGYLFEPDIPCATTPQQVFMSVEQASSTTAPLRRHVGMKTPSCGKYPIIMMSGFNVQ
                     STPLRHPALNTTGYPPAMAAAAMIAAAHRHSAMSSPQSSSKSASPYAASGMGRAPTFP
                     LTAPPPPLPGQVGSASASNSTTLPPPPPPPPPP"
     gap             637410..637556
                     /estimated_length=147
     gap             638150..638248
                     /estimated_length=99
     gene            complement(<639114..>646298)
                     /locus_tag="LDBPK_311440"
                     /db_xref="GeneID:13389409"
     mRNA            complement(<639114..>646298)
                     /locus_tag="LDBPK_311440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863187.1"
                     /db_xref="GeneID:13389409"
     CDS             complement(639114..646298)
                     /locus_tag="LDBPK_311440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863235.1"
                     /db_xref="GeneID:13389409"
                     /db_xref="UniProtKB/TrEMBL:E9BMR8"
                     /translation="MGLVPSRESLYETPAAASQPRALPFISRAAENYMYKTNRTERVF
                     GSGMALGSAGDAPRPTALLNGVPTAELAHKIMEADPNAVFIEDPAEATAAVAASRGSR
                     RGSAKSTEVQCRGRDAGTLALETPAAEALRQGRVPYVYYYEHRVLPLTTEFFPSPDCV
                     LFRQLWHARKQQNPRYHFQLDHTWSPGALTDPTAVYESFTELATRNMADIQAACLSAG
                     QPVAKENLAQAQGQLQAAMRALNGGGVDMGHCAASSAGSQRTRVPFATREEFYSLVVL
                     TTKESVIYDTNQELRAAVCGAATSGEAMRKRTDNAGKKPAAEESSKAERDRQRLRPVP
                     CAVVLVRRCMPAHEYRYTYFVANNERHHKASAGAAGGSSRRRGPANACGTSEAHQPQQ
                     RESCSTLVCGASVRAAVEESQLVDQTPQGKVGDDELTVPWVQVSAPQAPLGLAEVRVV
                     GMYGCWTVEEILRHTLFAPTVHTSSDPDRAAGTAATQNSPAREANVEKVLRRAAPHGV
                     PSSTLVNTAFFEKQVGDKEQCHTYFALCRLFAHGMRRCILGDTSDKAAVTSTGGHAAC
                     EQTSADDEVPDEPSQQTGEALTERQRADPAWQDFIGALSGGASAMSAFGDLANCFLIR
                     FSNIPQLQLCRQIRRMLTELQGIYPTPPSLEGFQAAQRQRNMTAMSKKIGASNGAGTG
                     AAQGGDPSAHRSPPLKCRNGDEDTTAPPRLQGENEASLMDSTGAPPSAVAKTDAKQQH
                     EGVTIAKRCGKPAVLPLSLDPEAIAERPHQLCERERLERDGFCCYASHGLVVFRLSRA
                     AVARALDQLSFAPLHDSVEALCVTLTAAAPPPLTYRGELRPPARLRAHTMAAAATDAS
                     GSGEEVEDGDAKVRGGAVTSAEAHSPDALANMYNNAVRYSSSCATGFSMEPLWPIKLD
                     SASWATHATALEDTPDELIGVLPRNSIEQRRGRLLPLRGVVMSEGAAAAANGACNGGA
                     AHQGCSSGTSAPSQPHQQRHSQSALSSTPACALFQVDVYTVSSELDGMPFRELVEMMH
                     EEQQQRWQSTACGASPESTLRLMIESVDAQGNVEPDSVLNWSPMSALGSLRWKRALAA
                     AGRGYAGASVDRSDAAAEVADMRSMSTLPANVPGSQGVVSIFVREPERILHTGDRIRF
                     SPHRGGSPNSGGRNSPMAASGSGTPHTRSRVGGNATSGSSQYGYWYVDDNLTTEDMIL
                     SWMRRVGGRARETCGTDTKWVRFPEPVLQVLLRFAHTCRQQPGGGWLVTGHALRPLHP
                     ADEELVEPDLLQNYPDILRTRRFRQWRFSHDGYVYFHGVTVRIPGSSPLPSHPPPAAA
                     MTASAYHAAIRNCGEMTFGMCGRRSPRLAVVSSARAAFEPPQQQSVVPPQSSVMQYGE
                     ESPPSDVMPHCGSGGGGGGQYGAGAATGGPAYYANQAMYPIMGGSAGGSGSMPRKHYD
                     PSMASQQLHPCLSVLPQHQQFSQHVPQQYSPQQLSQKKQHVGGASLHHTMQQQQTMPQ
                     PLQQRQQQHRGPEAHYACTAHSSMVGGSEQEATPSGYYGNSSSSAAEGAGGARPATPN
                     TMNGLYLNETDLLHSNAAATSSSSNQQPEYQPRGYHSRHADGASFSEGMPSGGAGFFV
                     DYPDGTFYESSDRAHSAATMVVPAQVTSSFYGGIYNPSVEQPPHTPQQQQQQQRYRSQ
                     VHSPFNVCEPASGHASGSRRTDNTLLAYGLPPNVSGVVPPGEEVPNPPITVAGCGRDQ
                     EEATTSSSEPFMMHVASGDHQHQQHSRQQPHSSMLPPPSAPAPPPPPQQPMNLSLHGE
                     GDRAGHAAERRTTDDYPPRRSPTTILAATAVTVSAAKPTPQTSIIQTLRGTHATAGHR
                     APPVAAFAPEVIDPSPLSSSGGNKCPVMTPKDRTAEGADSGADIVNDCSTSSQPTRAR
                     AVPVCNPDFSSTTQQMRVGAQQVYQQPQQQQQPLQQAQAPPPRSPQLASGPGSFRDTI
                     TTDVIEADSITVRVMQRKPSMARQSSYNGATGGAAASGYRTSSGAFGNSSNVAGDGGA
                     PDAFSPSSMGYGAMGVSPSGGLESMRDEANSVHRKTGGVSANDSRAAPELRSYRLSQV
                     RTSTTGQQVASGRSTAAAFAVPQLQRQSSMMGSSLPTQRTSQRISHNPYTTAGALCVT
                     PLATAAGLSIHSQGGAGGCKAGSNGQHDSFADALDNRYGSASDFNASVSAFPLSLAHN
                     ANGTTHGTYYSRCAGDPAGFRSSPATSQRPSLYPSQRATGDVDDSSRADRQQEGRHES
                     YASFYEGAEGAPASTHYSDIYHNAAADGTTQGFFFSMGEYEETGNSAEELYGGSPDYQ
                     YQSSPGCALQLEGRPDKGAGRGGSAYGGVPLPTRNVHYQQLQQRNVGGGKACNGGAYE
                     DSTPTSALPHSSQPHQQHAYSPTSAAFQRH"
     gene            complement(<651796..>655269)
                     /locus_tag="LDBPK_311450"
                     /db_xref="GeneID:13389410"
     mRNA            complement(<651796..>655269)
                     /locus_tag="LDBPK_311450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863188.1"
                     /db_xref="GeneID:13389410"
     CDS             complement(651796..655269)
                     /locus_tag="LDBPK_311450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863236.1"
                     /db_xref="GeneID:13389410"
                     /db_xref="UniProtKB/TrEMBL:E9BMR9"
                     /translation="MGISPSREAQDQYLDELCYRKKKAWRADRRRKEVSLLPLTKKFM
                     HFVQPDSATSLDSRTPSNSGSRNSNTDTSSSQTSRSSRRDYCPAQLCLDAAPASLPFV
                     QQLYNAYREPGTQFYCRKESWGTLNALPRDLYYPTVESFYAATVSCYEGDMYETNEDM
                     QRAYDQQKLACQLRAFGSMQKGAAPTRRQKKSTQGPQIRPTPCAICFEYPTSSIAPPP
                     REGADAFSAANANRCGAPHGSVVFAPHCSFMVIGFVGLVPVRRQKTKASAESFLRPPA
                     ESAGDEGEGECTGTRDEPAEYELVAFISKSAGEQHLGRALFQAAFLYVDQCRRAGLPG
                     NPPLPSTRFSCFLMDVPSLCFLREVRLRCAELQWTRRLARALRRIRIAAHHLAIEMNN
                     AVASELCAFMAECFLKLDFHPSPTPPVFLFAGFVGDAGSAIVVDANAAFPSAAIHAAP
                     LPSSASAEVQVLLQSRADSEGLPGHGGGSALCSGSCGGAKESSNGGTFGSAGPGAATV
                     KLVCVVGTNQLTVGKVVYPHATVLERVVQVGTGAFVDADWAVAQDLSGQEMLATDFYD
                     PDPEDARDYSVCVRPLEEPGPRLTAVASDVILSWSKNLYVQARVADTSNSHWVNSYPL
                     DYYTATRLKVMPPPQTEDPAARPSSPSPLSTVAPAAPSRTQGGSDGRVRSSPLTASNV
                     KALSRASPCGSNGGHAANGKDAADAGANPSASPEAATRAFYLWEFEHQGRFYTIGLVP
                     NFARAVQRGRGNAVDRDASNLRNKNSNRERNAPTAAWASTGGDVITSAVDPMSETDIS
                     SAVSQHNENSRSYSDRSSRSGETYHTAGSSHSTISNLHLASGRRTVRQRRMLLSLGTG
                     EAYENGIPVSSAIPPVSGSCHSRAMPDTASSIRNATNASIHSGGGGAGMTSKIFNASD
                     EAAAALPMSSGGNGTLNYVGSAHESSAAFGSHPVSGDGVPPPHELQQLKRYVNTPYEH
                     SRQQFQPAQALQRRLSDGVSRGLPPKSDARLFPQLQTGLDPDDDGIAGSDIPSLHGFG
                     PGGYSDGLADYAVYEGLGEICISPAESAIKATAPTAGGRTLQPPPTQQQQQPAGERKG
                     DGRSVLGPSRVLADNGKAGTQAALVTSNPGEFPMMPQPPVLRVAAHLQEVKDADGKTK
                     LRWDWRSLHER"
     gene            complement(<656280..>661700)
                     /locus_tag="LDBPK_311460"
                     /db_xref="GeneID:13389411"
     mRNA            complement(<656280..>661700)
                     /locus_tag="LDBPK_311460"
                     /product="pentamidine resistance protein 1"
                     /transcript_id="XM_003863189.1"
                     /db_xref="GeneID:13389411"
     CDS             complement(656280..661700)
                     /locus_tag="LDBPK_311460"
                     /codon_start=1
                     /product="pentamidine resistance protein 1"
                     /protein_id="XP_003863237.1"
                     /db_xref="GeneID:13389411"
                     /db_xref="GOA:E9BMS0"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BMS0"
                     /translation="MSSQRPEMPEGAASDSVYSFGEVNRRLWLLRSNSLPKGSACDDA
                     LVDWAAIRGLLEEAPEERSGVLSRYLLRWLNPYVMLAWRERLEEAYMPPPQRAHRAVC
                     CGALLSRAFREEEVRGGRDAWRARVEAALPVQCGACDDPSGESEVIGGDYNGRWGGAR
                     VAAINELSRVRFRGEEGVHGRLRWVGYVRSSDTPHTLLCGVEWDADSALPPYRARVAG
                     DVAEEVVHDGCVQGERLFYQVQDGRARCTCEYVQDLVPVSTIGIADTGCPRMPHAPSL
                     LWALLRTFRSDLMAILPPSIAGMICEVSTPWLLQQFVLFLQSSKERAGARKGLLFFSI
                     LVIVKLVQPALMNKEMHRSRRVSSLFRTSTLALIFEKCLTISPDALSRPDMNTGRVLA
                     MASSDVENIKEFPTRVMFLWMAPTMLTLYVAYLFVLVGPSALAAVLVFAALLPVQGGL
                     TNAMGGAQENLSSCTDQRLRRTNELLSGIRVVKMMGWESKFVSAIEDNARADELRFRR
                     RLQMRQVGLWACVFSTPTFMIAAVLTTYTLSGHKLDASVVFPLIAVVSAITFPVMMLP
                     EAFTSLAKFIVSTGRVTQFLECDDSHIIVEHAERMLNSTGSGGAASGDAPLPSAASAD
                     LARVLVSVPAALPVYEPRHVGLRRVAQRILCAVLRRRVPVELQWRRAAASPAMGEGGR
                     KPARVAVGNDDGGVAVAGGENGRGSDSGVALYAMVDRALLRDVRVSFPRAQLTVVVGA
                     TGSGKSVLLATLLGAFRFEGHVSVAKSVAYVPQQPWIMQETLEANITFFEGDRRGAAG
                     GAAVDSNSGSAQAFSPLRCAEQAAGAAAVPRCFSCGRDAASERLARAVRSCQLNADVA
                     LMARGLGTEIGERGINLSGGQKARVSLARAVYADRDVYLLDDPLSALDAHVGRRVMDE
                     VVLRALSGKTRVLATHQLQVLPHADQVVVMREGCAVFAGSYAAYAASEWKAYVESEEA
                     AAASKKSGCGGGDTVAECTEASSAWSSAVNVESCVGTREERDHARCGGADGRASKDGG
                     EWGENDGSPLPRMHWQGSWASENSEAEGCNNRDSTVCKGVRLASRSKAAPRTAKGSSG
                     LATGEDAADGGDLMTAEEKETGHTPWSVYRAYFEAGGGVPVAIQIVLRYFVSEALSTG
                     SSVWLTLWSVNYFGSSLSTNEQLGVYLGLVFVVAITVSANDLFIFQFARRAACRLHAI
                     LLYTVSSATLTFFDRTPLGRIVNRFSRDVHVLDDELPANVIPFLGITGYVMTSLAVTL
                     YTSPLSVVVVLLAVYAFVRLLKFYATVVREVRRRSSVGQSPLLSLLEEVVHGRATIAA
                     YDKSHVLFAEALLRLDLVYSCTYVEKVMTLWLAIRIEYIASLAVIAVGLIGVVEKLVE
                     ASPALPEARVGLISLSLTMCLDLSWSLSALLDLAAAVEASMNSVQRVCHYIDHVPQEA
                     ALLEPRDAYVARAVAASGGSRRGGGESSRSASDIVVAAGGDDDEAAPARQGVAARSGA
                     FGALRLEHVDLRYRPGLPLVLRDVCFAIAPGQKVGVVGRTGSGKSTLLLAFLRLVEVS
                     GGRMLVCGRDARTYTLPALRRLFSMIPQDPVLFDGTVRSNVDPFGDATDEEVRAALVS
                     VGFVGVGGSSATFPTASGLPSAASDSMPALDTVVQGGGSNFSVGQRQLLCLARALLKK
                     GSAFILMDEATANVDAQLDQTVQRIVAEQFGAYTVVTIAHRLHTVAAYDVVLVMARGR
                     VVEMGQPRALLERRDSVFYGMVAQSAAVADSREGLSREDAESAASGARSRGVSDGGAE
                     LGAAGREHRVEAAVASLLRQCK"
     gene            complement(<670326..>670781)
                     /locus_tag="LDBPK_311470"
                     /db_xref="GeneID:13389412"
     mRNA            complement(<670326..>670781)
                     /locus_tag="LDBPK_311470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863190.1"
                     /db_xref="GeneID:13389412"
     CDS             complement(670326..670781)
                     /locus_tag="LDBPK_311470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863238.1"
                     /db_xref="GeneID:13389412"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:E9BMS1"
                     /translation="MTQLHRRVALIAVLAAAVLLTLAAPVARARVASPWDAVEGGVSP
                     EMPDDFGATPFFISEAERSNTLKVMRAFAAAMPSLGWSGADFCTWAGVRCFDTNVSFI
                     ATGSLATGTLPEMPDDVDYSLVKLDQINLFARTPVSLEPCRAAGASCIR"
     gene            complement(<676920..>678158)
                     /locus_tag="LDBPK_311480"
                     /db_xref="GeneID:13389413"
     mRNA            complement(<676920..>678158)
                     /locus_tag="LDBPK_311480"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863191.1"
                     /db_xref="GeneID:13389413"
     CDS             complement(676920..678158)
                     /locus_tag="LDBPK_311480"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863239.1"
                     /db_xref="GeneID:13389413"
                     /db_xref="InterPro:IPR000458"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="UniProtKB/TrEMBL:E9BMS2"
                     /translation="MLRRLACAFLTAALGVFFVLLGSDAAMAHAAEDMPLSLQIEKAR
                     FSDAEPRYSFTTVQKLNTLKILQAFAEAIPSLGWAGTDFCKWPSVTCYQSTVLFTVSG
                     ISVKGTLPDLPDAVDYSHVMITTINLFNQKSSISGTLPSSWGKLQHLVTLNMGSTSVS
                     GTLPASWGSLRAVTFISLPKTSISGSLPASWRSMSSLATLILYDTQLSGTLPPEWSSM
                     ASMGILQLHQNQFTGSLPASWAQMPALRRLSLIANNFCGCVPDSWRRASFRVTVDSQN
                     SAANCATANSCDPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTTEAPTTTTT
                     EAPTTTTTEAPSECEVPHCITCVRGNPTRCDVCASGYMVTAAQWCMKRPSADLASSPS
                     STALNAATSLGVLAAVLLSM"
     gap             687098..687196
                     /estimated_length=99
     gene            complement(<687331..>688239)
                     /locus_tag="LDBPK_311490"
                     /db_xref="GeneID:13389414"
     mRNA            complement(<687331..>688239)
                     /locus_tag="LDBPK_311490"
                     /product="surface membrane protein gp46-like protein"
                     /transcript_id="XM_003863192.1"
                     /db_xref="GeneID:13389414"
     CDS             complement(687331..688239)
                     /locus_tag="LDBPK_311490"
                     /codon_start=1
                     /product="surface membrane protein gp46-like protein"
                     /protein_id="XP_003863240.1"
                     /db_xref="GeneID:13389414"
                     /db_xref="UniProtKB/TrEMBL:E9BMS3"
                     /translation="MMPVLLRRGVMQRPRAALLVVALTLCLLLSPVRGAESPFTHYSA
                     VQKANTRKFLQAFVDANPLLEKLPSVDFCEWVYSECTSKGVDLYLDERAVVQLPEMSS
                     GIVGKYVLVTSINLSYGKNTLKGTLPASWVFFFFFFFFFFYSNSLTGTLPPEWANMKS
                     AKWFLLYRNELTGTIPEAWSRLRYMTWACLNDNNLTGTLPSSWGSAPQLTIVEARRNQ
                     LTGTLPPTWGSLRKLSSITLTDNNLTGPLPEEWASAQTLYGVSVERNNLCGCVPKSWV
                     SHNFLYGMQVDDSLLAADCSTANACK"
     gap             688444..688542
                     /estimated_length=99
     gene            complement(<689721..>692840)
                     /locus_tag="LDBPK_311500"
                     /db_xref="GeneID:13389415"
     mRNA            complement(<689721..>692840)
                     /locus_tag="LDBPK_311500"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863193.1"
                     /db_xref="GeneID:13389415"
     CDS             complement(689721..692840)
                     /locus_tag="LDBPK_311500"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863241.1"
                     /db_xref="GeneID:13389415"
                     /db_xref="UniProtKB/TrEMBL:E9BMS4"
                     /translation="MLGGPTRRLHVLWGQTLASYVPPHSPSGLVRGHLLRRYPVSGVV
                     TASSPARRSDAEVEAHVTAAQWLPARTPAEVVLNANEFSTFHAVPTASPEDVRLCTRY
                     LLATSNTSAASVGMENPKLQERNLPTVTFMSDLRDTANSSYEAPSGRVDTASLPFPSI
                     ITNLNALRHVLGEHRCLLAGSEALQTGVPISCILAEHEEAQMYLTWSLGSHQSGSWAQ
                     GMLPKPSNLACDDDHDGSAGVAAGSREAAAPLTVGCVFAMEEASGGAESTATPHQHLD
                     PRERARRERLARLRRRFQSEVAHLHGHGQRGAFVEAFRGPMPISAEGAQGKTCLPMAE
                     PRVPLLTVATSAGSGLAAAIKAAAVAWACCACEVGGSSASSLRCCVYAMDILWRPAPA
                     TALVATWWAALLHQHQSSSSTDNSAENSHSSPSDAAAQHSLERHPPTFTGPASERSEG
                     HHNASVRQVEESSAVIASSLSPCTHNFHVLITGGDTADHFLLPLMAGVDDSIIRTHTK
                     NAHPNERIDVTAQNGDRSGGNLARQRGGDAACASSSAPSVHRRRTETLAMVLCYGCPA
                     AQVAHLHAIRHSYLVQQDMPDTSATAESRGALIGQGDANVTSDGESTAATSGQSDSLP
                     SMRQVDCATTGVVELCTETPAVSMVTVLPHVASAATSSSVGASSPLSLSYHLRGSGPS
                     LSPPSGAQPVLSNATAAAQPMTLKEVAACVFESSLLERPLRHADLRPRPRGACAGASR
                     ESPREPHAVVAPAALQGGASLQQGWCSLCFAPQTYAPALLSTLAESHFGQPLRSGHSF
                     DALCRRGPAPSPTHVHMAQEVLRCATRGGCGHRRSPEGGHHMRKHADAGSSPSRAPAS
                     TAFTLPRTCANEGTLKCGVLREVQWKHVCGGFPLPLTAVRGRSSPYFVPCLLFTDLAE
                     VASTIFTKGHEGRLHHAGIDTMEPSWPAALAYPDGHDGLPREALGAGLGASPQATLQY
                     SASEKSRQTQAQVACAVAAVEDSVFELGRTHDTEMLGYRGVVAGNYLFICCYPDAWQD
                     AVKDALMRR"
     gene            complement(<695817..>700706)
                     /locus_tag="LDBPK_311510"
                     /db_xref="GeneID:13389416"
     mRNA            complement(<695817..>700706)
                     /locus_tag="LDBPK_311510"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863194.1"
                     /db_xref="GeneID:13389416"
     CDS             complement(695817..700706)
                     /locus_tag="LDBPK_311510"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863242.1"
                     /db_xref="GeneID:13389416"
                     /db_xref="UniProtKB/TrEMBL:E9BMS5"
                     /translation="MQQRPQQYQEEQHVQLSLNSLGALTSYWPSRAPLGFAAAHPRCR
                     IAAEARLLGTYIHDDAESEYEAAWTDWARQVPFGDWWVSDLAERMMPSKRRFASEVPF
                     TDAAADIVDDARWYSDHAPNTLAVAANATSRGGERRCAARPHPPGTASASPSRYMLPQ
                     RRACTYFEHKQQRGVTAAAAIATGAVHSGLDSEDSLRDVSSLPEYPYAGTNVRCAAMR
                     AGYLGGVLVGHLVSFLVRSTAADAGQYISNPSSTVSLLSTGLAAQEHAQLQWRRVLHW
                     EVGVEREEERRRKHAAAPICSNACEDAAPSSQKGDYPGGSWMYSHWWLSRPLVLGRAC
                     VPSSPPPCSRFAHEDIRNHVEDDGIHQVSYDPTCAAAAAPPSTSLYAYGDHPASLPLR
                     MTEGCNACASYSTRGRKTTVTTAQLPGEITRRMDMLVPSPARCGQQPRRCCSSFLSAV
                     HLYECQAPPALPSPSLSATSDNPAHWWSAFLRCPCCAHLRILDVNFEGARARKLEGWA
                     MVAAPVGSAGQAAGRVSPPSASPRLKPLDLQASNDGSAPSDAPSRRFLLERRQLQRQT
                     ITSGTDCASSARPHLRAPVLRYVTEVHLTSSATLQDVGFLGELPVLRLADVSFNTSLT
                     DAGVHGLCRSTSLRVIDVSYCPQVDAAAAELVRCLVELEELYLSGTGLTDATLRTVAA
                     HLRSSGGTPHDALLVTETGAPASGQTPHSPRPGGVRRLRVLHACACRRVRNPYNALAP
                     IAVMQRNERRQWRGGGVAHGQSCWAGLQELRLAAVDMGELHHESDRSRSGSSDASGTQ
                     SEDIGSEVGAATERVADAADEGAGLLSSLLERGQGAALPQTPGRSLPVVSSSSLPSRG
                     TAAPVEKAGAAAKVTATTDVPRALTTPPSLLWQRLTTLVFTDTKFRCALGDVGRLPFL
                     QCLSLLRCSVEEGARLGAGEGAHRPWLSGLEQSALLHTVHLDGCSASAIRDAGSLQIL
                     ARLPSLQNVSLSHTDIRDADLDVFVAALCESGATAPQHQFHRLCLRSCGRITNVGAVA
                     LLSSVRFLDLSDTAVRQEVLDALGNSSAAQHPGGLHALQALNCSACSLILDLSPVAHL
                     RHLRWLNVSHTPLSTAAVAALRFCAALTHLTLKNCAGVHHVRDVMAIATLEVLNVQGS
                     GLYDGDDEDEEEGEEAIPGAERATEHSWRRSFMPGTPPYNFSNPLAHRDDSHALEEGI
                     RSRSAVADVFPGDDEALFTSSLHTLLLSHTRVRRIRRLGLLPSLMCLDLNNTAVTDAE
                     LVKFVCTGVMAADKRASDARSPHARNPPVVVHSLRARRLDECAGRGCRGPPLRLLSLQ
                     FCRRIFSVGVLGLCPHLTKLDVSSSNVTSQGLIGLHRSTSLVQMRLLSCKGVHDMRAL
                     HAIPSLAEVDGSGCNVHSGRITGAGVRGGSGTHVAAGAVADGGRRGAEAKESGGRLSP
                     LPLFAHGGNVTHMAAPLLRSDLLQESGSAAEDIAAVRRATEGTSFLTIALLQASTSLS
                     SPLGLTRGCQKLVLDGCVNICSFLELSMLSSLLELSLCNCHGITAASVAELISLSQWC
                     SRASGTDSAQSVVVSSVLPLSAPFPSLRTLRLSSCRNLTGSLAGLELLPQLRCVHADR
                     CGITSVYDVIPALQSRVVL"
     gene            complement(<701718..>706328)
                     /locus_tag="LDBPK_311520"
                     /db_xref="GeneID:13389417"
     mRNA            complement(<701718..>706328)
                     /locus_tag="LDBPK_311520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863195.1"
                     /db_xref="GeneID:13389417"
     CDS             complement(701718..706328)
                     /locus_tag="LDBPK_311520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863243.1"
                     /db_xref="GeneID:13389417"
                     /db_xref="UniProtKB/TrEMBL:E9BMS6"
                     /translation="MLLDALVMRMHARVRVCILHIASPSLTCAATRTAHALSLLGGTR
                     VRVCRCERLCVRAATPPLFLPRILPCTALQLFNNAMSAHGPSVDAPLPMVADIVERHV
                     DFISNTAAASSPALVGPLLRPIQAITGQAFPVVRTRHSYGRQRAIAGEATTHLSALQS
                     SPASLPSASAAARVTGFSAHVQPRDAITASADPYAAGGEFSSIPGTRTRMHGGETELA
                     LAAGGSAQQRLPAHQWSLLEFEQLQSGYYVRPVDVSYSKTGDTGKEEAATTCPTSLGP
                     SHSSCVRGEAFFSLLFQCLRSTVRKHQQLALEVLLAHLHGLEMRTTASKSARRTEAVA
                     LRDRCLHGPNCAPFVFFLLEILVSAGHPAMIELAATCLLLLFRGMTRGEPAGSTGSTE
                     APASVEDALGGCSTVLHFAEAVAELGSPAGGAPEEDTEEGRSDGRSVDVEGSGAEKPA
                     DDPDLPFSEVSELLRGPDARLGLEQLGFTNKVLGAMHPLLRNSSPASMVPRGDGEETG
                     REGVESEAHRGCVEPTATSSTSPFSSLASIHAEVLFLELLLCGGVGVGLRAACRRVTE
                     DPAFLTWAETQLSAVVMGHRRLEDIAELLCVLQHLSHVPSALNSFLCGSSVVNPNLTG
                     TLDCGSVAAAAAHQHAQHRFYETWLLFFTLVCSTRAAEVYTVRHASAILWSMLILRAC
                     ARLGYRRSGTNNNGETGEDDAGHSKLVARHSGYGMVQDVSDTLLAEGMHVGGGVVMEM
                     WFLQYASEDGTASAAGDAIGSLDHYFLDAARTALHLCRSPGSSRPRVTPTDASSGDSH
                     DAVSLEATVAQRVLAEIRWTASAHFLSTYIARTRHRSPAVCHTLCSTEGETHEAVQLL
                     LRSVVMDAGRLTRAFARFTSPLLSTPCSGSADGLRKADADGEHPHTTRGDPAAIPVGA
                     PTHHLKTISAQVSAVSAIRAVERCWWREPSGNTESNDRAVEADSAARDRALLFLCLEA
                     ASLYANTRLAAALAEVYPTIAVDTALGYAGLLAHAFEEAFLRMRDGTAVRLQVDELCT
                     MAEAVQLLQHLGNSGSSVEAAVPRSTLPTAGALHSNSPAARDAREARIAAFFLVHSIA
                     LSKRCLDAVPLSLPLLLLRPQVEAKTRPERADAAALVPAATSTAELVALMNSLQSGIE
                     LTPVSVMPATGDDAADISASLSSAAAVSVSGAPRCWVLYPLFDASFTAKDVWASWLRR
                     LLGLHQRVKDVLGWDGVLSHVLLWTLAHRRELWGTTGGTTCDGAEASVRASALSPSSA
                     AALCELMVDLCAILHALSARSCDLRCSADSRTAVSAAAASRTLEVSLAAYSDVPAEEG
                     MPLLLHALLAYVAAHSSARAALAALQVLLCSPVLPPSSTIAAGVEARGEPGDEQQSSC
                     SPAQSRPGSHDTSATAQVCAWLQSWSAAQGRRMQSARSMCWSLDDVVALVQLVGPHFR
                     NDDFSGRSCAYEGGATDGHGTVDAAAAEVMLTPTDADARLAVRDPMWCARCLTEGLLQ
                     YYVQQRIATSGSLSTMEKMVLRSTLRDLDWYPTMLWPQVEGG"
     gene            complement(<713031..>716477)
                     /locus_tag="LDBPK_311530"
                     /db_xref="GeneID:13389418"
     mRNA            complement(<713031..>716477)
                     /locus_tag="LDBPK_311530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863196.1"
                     /db_xref="GeneID:13389418"
     CDS             complement(713031..716477)
                     /locus_tag="LDBPK_311530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863244.1"
                     /db_xref="GeneID:13389418"
                     /db_xref="UniProtKB/TrEMBL:E9BMS7"
                     /translation="MGVAPSRETIRRGFFNVSQANSTAAGSGSGGGGGSSKRQDIILI
                     PLTKEYFPSPDCPLFVQFHKARCDAAVNYYFRRPGNPGDLSRIPNYASSYRLPGDETR
                     AQRRRRRQQEREARAVAAAAESAPESGVDADLQAAGLMPERGHSSSEGDDDDNEDDSY
                     PSREALYRGVIEHVEEMLFDTDAEMRQAYEWALAHPHTTMGPDGKKQRKVLPVLCAVA
                     FRSDISKVLNLHNAVPGGAAARTATPVSSASPPSPSYCGSSASTAMNNIQAALESGVY
                     MFGSIINIVGCFGFASMQEDVEDAQRVSTQASAMANQATSLLTPGSRQSPSLTAGGTY
                     HNDPYSFTSSQASSGGMKATSPMTSSGTLLRTRGTGMKGGSYLARIGTSEDVMTLPPP
                     VAAPLAAMVFLTKSAGEQNLGRVTYIAASTYYYQMIQAGLIERQPSLRMEGPIAYQSP
                     AAASAPPLPPYDSGVNSAVPVPAADAPPPMYGAAAGGGSSASPATLPTLSAVAQGAPR
                     PFLPPMETFSFSSLLTNIPILSFLYEMKWRWGYLGVLKGGTPTAGLSRNSSFSGPLSS
                     YHMDGMTARGPGTMMGNHSSGGLSAVDRSVGQGVTDEMEMWITADQMIHGRISKDLAQ
                     RLCWSLAERPEVMQERVTQLPSEESGYWRYRGLVDQAHPPPVPEPGRVVTIHPKDVYV
                     MGSDVLPGFNEGDILRFDPGRLVWFADHSIPLEGVVLAAMRPYCKQAREADSDDPAWV
                     TRVCDREELETLHSGDGDVCYPPPRASAEELAVLESCPNMVHVHEHIGNFYVYRFERD
                     GTTYYHGTVPNFANPNKKKQAASGGSLGASMPGSQNNANPPPSTAAVATAPYASPMAR
                     PPPILSASTTAASASKPASVPVPKTIASALFSLLPASRATAQKGSTDTSSASGSAVAR
                     SGAGEHGGQASSQTGAGNTSAAPTAAYLATPVVSSASSEAMSTARKWMQAIYSYAYGV
                     QNVQATRRGSSAANRTGAAAGPSRPPVLGGVPTPGAAGINHSGGSYPSTPVHGSRGMT
                     PTSIGASAGFPNVVTVDVAVWPPQRRMPAVTTPLLCPVTSTSPSATPSTPTLTAGNGP
                     AVARHSRSSSRTQMPQTGAPAAKGVSPAVPFGGITGTAGTSASKPIKRYVEGGSYEWD
                     WR"
     gene            complement(<719159..>724246)
                     /locus_tag="LDBPK_311540"
                     /db_xref="GeneID:13389419"
     mRNA            complement(<719159..>724246)
                     /locus_tag="LDBPK_311540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863197.1"
                     /db_xref="GeneID:13389419"
     CDS             complement(719159..724246)
                     /locus_tag="LDBPK_311540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863245.1"
                     /db_xref="GeneID:13389419"
                     /db_xref="UniProtKB/TrEMBL:E9BMS8"
                     /translation="MGAVPSRETVEHWLSQPPFYGQRQQIVLIPLLKKFFPSPDCSLF
                     VQLYDARCDPAVRYYYYANDGINKVQSTPTSPVSPTVHAAHESVGNVASPTYLAEVIG
                     NAPVYCPPADVFPSVNLTREAMYDAYITNGGERMVYETDEEMLRAYRADATSVRPLPC
                     AVAFLYHRPASAASPTTSTATGDAGFEGSSAAASINGTAAVGAHSFPEDCTEVLGCYV
                     KATGFIGDVHGLGASCPRKLPDCEMQMFLTKSAGDHHRTHVLLTAVYTYAEQWQRACL
                     HCVPCDLTARELAPAVTKGGGTADKDLGDVFFYYKPFSQPHYMLVEASRVAGHNCTAK
                     SAAAERNGNRGGTLKVDEKARFWAPPPLPSLVMRSRRTNVPLLCFLREMRTCARSFFL
                     FYFKHYLEHQDLLKPGCREKVGGADGGQDRQTENNHLTTPLDHGAGANCFLGMPPLGS
                     VQMWLQGATRASASLSEFGDEGSSTDTESMLNFHVMAPYVRALSEFIVACLLHNINPL
                     EVSRLSSAPDDSAIAAASTGDDAKDTTMKGEAPATDAVGGSAFFFTSPTDAAMMAASP
                     TFPQSFSFIRLPDEDMIVQPWPPSSSGGETGDEASATTAAASPSSAGLLSVWRSRHTN
                     HHLFWSVGPSIVNRRTATAALLHWYKTEKAPVVWGCNLDEKDCEMVAGGKESASASDD
                     VSAEAFPSSSLGSYMSTVTVNGQKEELLRCNTVLSLMRLEAGMPVEARVLRVCRIPLE
                     ELLLGELRDSSKLAREAGPEDPHWVRQAESPSGDGGATKYVGCVLHASDPAEGVSRTV
                     IANKGVELPVVPPEADGVIGDGTSCLWRVSLIERMCRIIAVTPQFLKPIRKKHPKKKL
                     QSKAVIVHGTASHVFLKVASPSQTTASPTSVSPTATEPAQKGAVEPKENEATPARASV
                     VTSPDRQDAVVLKEERPGGTVAVPAPLAPDAATSTAATTAYASAAATTKAKKKTQRMA
                     DVAAAPGSAFTPTVTVPKTADKAAPPAAVSAANAAVTTDTAAVVTQLNSTKGAKTTPA
                     EKNSKRAGAATKGSSETVTHTDAVIEDKQSKPSASLTPIVSAATKTKTTKSTARAPGA
                     SATAEKANELKAGNTASRSGAARAAETFARTTPTAKHATIPTAERQKKKSSPPRPLQP
                     PVPAGEYDSNRKSNKAAPGGKYPNPSTASSFGGASATACAPPHPPGGIYYPAPPSYEA
                     KTLQQLLRDPYEQHGYGYQVPPPPLPFADPHSSSNAIPSCVGYYYSSDGYQPHAVYGG
                     GFVSTNSHAAAYYNTDMRSGVAVAADAGKHMGDGGYGDSPYVYAAQPQQLQTLLPPGQ
                     PPRHTGTTKEIRGEGLFSPVGSYSLPSKEEGNSCEAVPTVAPGSRQGAAPSLRHHVSF
                     EAGVALSKEAVADKAALSSPRRAATLLRPGALCSDSPTTMSLASPNAHCPSHHHTTSM
                     PPPLLLQGSDIGESMSHDFEYHHNKSVSGTGSHLHFQLDELNSPVTNDSSIVMSNGHH
                     WHHTRHASSPYQTSTTIMEDAGVPCGQGCGSVGGSVNVTVRVRHHHSRTHSHAASYFS
                     DATLDSASTHHHHHHHDTVHHMNCSTSVASGGGVGAGAASLNGTQTSHSCASLEHSSN
                     AFHRLSGAGCGSPHEHIIATEGDHHHHASSPRQHYEHQPRHHAPGATASSTRSGDTAS
                     AARMTDKRTGTYRWDWRTASLDMGYED"
     gap             733140..733238
                     /estimated_length=99
     gap             734077..734175
                     /estimated_length=99
     gene            complement(<735944..>738772)
                     /locus_tag="LDBPK_311550"
                     /db_xref="GeneID:13389420"
     mRNA            complement(<735944..>738772)
                     /locus_tag="LDBPK_311550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863198.1"
                     /db_xref="GeneID:13389420"
     CDS             complement(735944..738772)
                     /locus_tag="LDBPK_311550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863246.1"
                     /db_xref="GeneID:13389420"
                     /db_xref="UniProtKB/TrEMBL:E9BMS9"
                     /translation="MGTAPSAEIVPDAPFRVPQSGVRQVALIPIVEQYFPTPDCPLFR
                     QLYEAYTDPSVRYYMRPNFDGKSGDLSRIPPIENSREDMHRLLLRHTAQGMFLTNAAV
                     REVYEAGDLYRIRPVLCAVVFLYEGTNYVPEGSVQLPSPSRGGASAFAKVIGIIGDTC
                     TLVNKPDDPLIPFRRDDVLKIRTLIMKSAGDHNMSRVVLLAAYIYYHQCCRIIGLPNV
                     PALSASFTCFKTNIPFLCFLREMRDRMANILEAPKSSKFYIDEYCLHGAVSREYVAKM
                     MPAVACYYISFLKAKSEQRVLKQLSHQQPIVTGCAGKERAGLTGKALMNRAETHVGSV
                     YTDVFNDHVSLAVKAAALEGALKSGGNTAPKITYVVKGYVTRAVTSISNWSHAANEVY
                     VVCVDSTVTVVDRASVEARNGPTHTPSLSHQLGLSEDAEAADGTTSAVVETLHVRRGD
                     ILSFYVPPSTRSTGASPSLGVTAAHDVSEDEDIFYGTSHLEALKFCSDNTSSLLSSSS
                     GAPSRCDSAGLALDAAKGASDEDSASAEATPSSGATGLDGDAVPFEAKKGSWRVDENI
                     FIESVLLSLVRDECKLAREATEQDPGWVYDDASRSCVHDGSFYVWHFRRGHEDFYYGT
                     VPKFANPNRQSNRKNGGCSSGNAVQGKVDRGGVGGAGAARDPNSGVRNIGARGKNGDT
                     SPMLPPSVPPVHRQNIFSQPSQSSKLPQKGELLPLTLSAASPDVQQAYLASIASGVSL
                     PQPPAYDASTQSAVQAAPMPFAGSIGQGHLNSMYATYPAEAAAMAAGCAPVMYTFMPV
                     SQGQSEISPAPQQQLHTMPPQGMYGHGAPPLPPSPPQQQAVWGVAGAGNIQGTAATSQ
                     SVGTCVVNALGQLVAVGGLMGSGVAPAPQVSYTPSVAAAAPQSYPSYVMVNGQLCILQ
                     STAASATGAAPSPMLSYQQHPHMMTFTQ"
     gene            complement(<745464..>752315)
                     /locus_tag="LDBPK_311560"
                     /db_xref="GeneID:13389421"
     mRNA            complement(<745464..>752315)
                     /locus_tag="LDBPK_311560"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003863199.1"
                     /db_xref="GeneID:13389421"
     CDS             complement(745464..752315)
                     /locus_tag="LDBPK_311560"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003863247.1"
                     /db_xref="GeneID:13389421"
                     /db_xref="GOA:E9BMT0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:E9BMT0"
                     /translation="MLRSGALCKALSSPASRPEASATVSSRGSATDHSIPVSAPVFID
                     AFEDLTTAKPSLHREPHISSSKSPNELERRRRCYHGTQPCEQVLFTPPVRETVISEEE
                     ELSLLHARRMCSSDVQLGTTQAACAWRPASPEFTDLVPFLASQSPLEPLCSSEPAAVA
                     PLSLNATRRASPRDATTDTAAAPTTSGDSSKITMATVSSLTVHTDSNTGRALHSRTSS
                     LLYYSPHIHYDGNSESLETEAALHSSHAAISSSISCFHASSLVTPRALPSYPLSSSSR
                     NSMALTKLQAESSRSEGNRSSSPTGTCGGAACIISDALALTHEKPDHLLLRALASEEG
                     AYVPPLSTFTTTQCTIPPITAPQAEKQNVNTKSGFAPNVPSIRLPVAYSIPVSDSERS
                     LASIPALGYGPRSTPNACSLTSARSGPSARSARHSNRCTSTLRNGVPTLKELFPTLPD
                     ELYLTRDRLCISHDSKRRLGSGAYGIVQQAELYPPGVEAPRMFTPTSESAASTSIPST
                     PCFSPANGRVSINSFSSIAAAVGNHENVAGASNGGYFGAEQTGRPGAMALAAKTSGNI
                     HFRTVSMFSSDSVTASALPLHQQPYNGQTASFYNGVDDMVRWSSAVESVKDLPWGHAL
                     SLNNDATPNMTTAQAAVLSPTSGSHETPALDAVSTASSEGQHSASQSPSVERPLHCKT
                     TAAATMDFNCQTQNDLRLPAVLGLRLGHNPDLRVSPRTSLPVSSGHLSGRVCGAATAV
                     DDAGESTVCTGICEEGRDCLASVIESVRPSRGEGEAVDGETEPGAQHSMTSRTGRGAF
                     ALPHSPVGGGRAYRSSSMRVWRRVACGRGNESEGSGLRTYPSFTSPTIQEVSMGTSSA
                     AAVEGKQTPCCEMVVPPATVDAYLHRFLSRTADLVSSKFVDHVDAADHTVREAAVVGA
                     DANDKAQAEGYGCLPSALPRALEDREEGGEYEPAEKTSATPERRGPESRRQRMQESLE
                     MSRSSFLVSISYAEHELTCSDAGDETLTLTAQQAIEGAIREAQEDHQHAMDQTPEGTE
                     KTPGAGLRLRLKGHDISCAGSEAQSEMRSDGEAATTTSTDVVLAAAAGEAERMAQRFT
                     HLSTGTSAPASTAMAKSTNAGFFGPRTHVGGGVGGDAILGGHVTPSSTSNSWTPSGTA
                     PIGASAAASAMSATSITRPGNLGGALVSGGTNNTLQSSFDFPRTPAVHHDMKPSMVSD
                     ALSSGAVPFRSVATKVIEKVDLTRNAMKLNAFHNELRMASRLRHPCLVNMFGVAEDAK
                     HFYLVMDLAEKGNLAQYQQRFGVRATREMAPQFTADVVLALEYLRDGSQHSYWVTPPP
                     DSTDDSLLQDHRHCTSRTLGMRGSAGEASAAEPRGLPGSTSAHLLRQATESASAATVS
                     KRLSLSAPTTPPLPSQHTGATDATDNVGADACSSVSAVRLVPRESMSESSESPLRTSS
                     TAFGHEPPVPAHTATLPRQQDDNGRSVAQQDSIIVHRDLKPENLLLTWDFHVKLADFG
                     DACFYGDNEANNFGGTPSYISPEVFARCKASPYSDLWALGCVLYELLVGERLFSGSLV
                     EVGTAVQQFKPEALIFPDTLTSTMADSLTAKGRDARERGTGSAAGIAEAAKDLVRQLL
                     QPVPEERLGSAERGGFDALKAHPFFADISWDKVLQTTNMTTTNTNYTAELAEYLEPTE
                     AVVYCSPVKLLPTVEGSSSKEHLSTKSGGTNSRSTQIALVMALTDAPRLLLVNLDLHM
                     VQFEIPWSTELCVSVLRTERFTVTVPFSDVLRSPSIPVPGSTLPPTTTAETSPMHSSS
                     NFSAAAANTITYTFSDCNGRADLWGVKIHHLQSMCSAKLESGSAAGRSLPRLYSTPVV
                     PTAGGAFHLPRSSASSQQLKHQRRRDTPTLSPRAGRRFLQWPRTTPRTMRAGSLGSLT
                     ISSNERSIGAPRDMRSTAATGTCAALSSDACGCTLSARITPATRTRATSSSHRISVSQ
                     SSAFTVSSAAAATPCTPSVMLHSSDMLQPPSLTGAALPSFHRGSAIVTVTIASSNTSD
                     SPRGSLNTWKANVGDSESVSSPKSPLEFDCTQSTACARPAAPPPLCSTASTSANTPGV
                     SPTNTTAIPIGGEDSPQCGGNVSEARWNGYFLTPATSTCASTGALHPLSASATATYAS
                     GSVPESALGCSSSVGNVTPHLAFCSGPRCGGEGLLSNSFEVTHEALSQGEGTPGPWNT
                     PTQADSTTGTPGTPDVLRLPSVCRDKEEGGAVGGGAPIIALAETAPAAAAAAAKLPIK
                     RSQARQQYHGAQKMKSKPCSAAATSSTAEAAPEKC"
     gene            complement(<759770..>761095)
                     /locus_tag="LDBPK_311570"
                     /db_xref="GeneID:13389422"
     mRNA            complement(<759770..>761095)
                     /locus_tag="LDBPK_311570"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863200.1"
                     /db_xref="GeneID:13389422"
     CDS             complement(759770..761095)
                     /locus_tag="LDBPK_311570"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863248.1"
                     /db_xref="GeneID:13389422"
                     /db_xref="UniProtKB/TrEMBL:E9BMT1"
                     /translation="MSMWKVSPVDGVDDGDCHNYNAFVWQQLLSNLDLEGNSDPTNAD
                     GVNKTPGSCSIPMIGLKQRNPSAKDTVLSVKLDALRTSSFGGSPTALQDDGYSSEDDH
                     ESPGDQAGSGRSTTPFYSSPTTTATTKSGSGSCVASTQNSSDATAPCFFINGVRHSIE
                     SPCKTPDWTVVPASSSASARQVSVESPLWASAHIDPSPNPAKTVVAGNNSGVPCAWVC
                     AEQSMTQSQSSPNLPLYAKPLTPPAGYAIPASPPSSGMGGGVQSTFTLPMGSSAYLAN
                     TVSVMQPLPASTMPVAQHASTPSFFPKKNDSAANTFPDCSILGFVFMDGEGCLRLAPQ
                     GCAAPASALSALPMMHVPCGATASSGMPQMQYTPGTMPAQPWRPTVTPAAAPAAASAD
                     ASATASAAAPTAAPAAAPSVSLPCTMSSESWGNTKAWVFRDGRWISLSI"
     gene            complement(<763267..>764055)
                     /locus_tag="LDBPK_311580"
                     /db_xref="GeneID:13389423"
     mRNA            complement(<763267..>764055)
                     /locus_tag="LDBPK_311580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863201.1"
                     /db_xref="GeneID:13389423"
     CDS             complement(763267..764055)
                     /locus_tag="LDBPK_311580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863249.1"
                     /db_xref="GeneID:13389423"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BMT2"
                     /translation="MSRNGELCLQKIIVSYSPNKGNPAMRQFMATYLPEFNRQYPQVK
                     IDIRPRQWPESSITGIYRDGSEKAYSIRFLSSMGINVRFHRLVNEGNDYNHSFSASHL
                     HLQRRSVQGTWNPYLWNYEGTRARHKPPAQWSRKLTEKEWDYYIRQYGAQMKAEEDTI
                     ADRVRRYTDIPEASTEEVNQRWKEHVMPRLQTDLEYNLSHWKKQHRTGAGRPAPPTLN
                     EYSLFSVPDHSSLGQDAIDMLRRREAQREEDWWRERKGQLKPPG"
     gene            complement(<764579..>765547)
                     /locus_tag="LDBPK_311590"
                     /db_xref="GeneID:13389424"
     mRNA            complement(<764579..>765547)
                     /locus_tag="LDBPK_311590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863202.1"
                     /db_xref="GeneID:13389424"
     CDS             complement(764579..765547)
                     /locus_tag="LDBPK_311590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863250.1"
                     /db_xref="GeneID:13389424"
                     /db_xref="UniProtKB/TrEMBL:E9BMT3"
                     /translation="MFAIRCPASMLWHPSVHHSLLLLRALEQPHTLLLDPHTTSRGRL
                     FVPLLSECAREVRIQTPPVHHEFDSAAGASTERSVLLYRAEDLLHVVNRPLGAGRDLG
                     AACPTQSGVFASLLEYLEASTVSSHVISAIDALLVSLNTGDMETMRQTHACLVELIER
                     LEASITDESLSEAYQTDQKEPLSAWPLFCTLQFLIEEGGMLTSAFPRTNKAYTRLCHS
                     SKAVAQHRRLVQRTVEQLLDVGSSTDTDVSQGARVEMNYPAKGFLRDVQRHLASYNRS
                     MEERTTDGVSGEKGPLNSRASGGRLGIQAVQARLPWTLQARPLRKG"
     gene            complement(<767340..>767813)
                     /locus_tag="LDBPK_311600"
                     /db_xref="GeneID:13389425"
     mRNA            complement(<767340..>767813)
                     /locus_tag="LDBPK_311600"
                     /product="cytochrome c oxidase VIII (COX VIII), putative"
                     /transcript_id="XM_003863203.1"
                     /db_xref="GeneID:13389425"
     CDS             complement(767340..767813)
                     /locus_tag="LDBPK_311600"
                     /codon_start=1
                     /product="cytochrome c oxidase VIII (COX VIII), putative"
                     /protein_id="XP_003863251.1"
                     /db_xref="GeneID:13389425"
                     /db_xref="UniProtKB/TrEMBL:E9BMT4"
                     /translation="MLRRTAPAVSFTVSHRALMMRPSRPLLGGDMHSSDRFKAAWDEI
                     PLHMLGASHKQMFEWYWRAMYQLGLRDPYRLTKLRSMLNWAAFFSFLYLTYISIFYSS
                     FYHVYMMDWPEHFKRENARDYAVSHGHDVWAGDGKFIRPYFHINPPMLTMTEEDI"
     gene            complement(<768386..>768757)
                     /locus_tag="LDBPK_311610"
                     /db_xref="GeneID:13389426"
     mRNA            complement(<768386..>768757)
                     /locus_tag="LDBPK_311610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863204.1"
                     /db_xref="GeneID:13389426"
     CDS             complement(768386..768757)
                     /locus_tag="LDBPK_311610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863252.1"
                     /db_xref="GeneID:13389426"
                     /db_xref="UniProtKB/TrEMBL:E9BMT5"
                     /translation="MSADPEAPADPSRVSGGHIVRNMIYAHDENHNLEILSGWSEQGT
                     REYDQETVRPASANMNKGHPCFPLNQELLRCSYSCPTEMKLGGRTATCNTERQALMRC
                     LVKNKQWKPDETERRPRYRFW"
     gene            complement(<769258..>769818)
                     /locus_tag="LDBPK_311620"
                     /db_xref="GeneID:13389427"
     mRNA            complement(<769258..>769818)
                     /locus_tag="LDBPK_311620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863205.1"
                     /db_xref="GeneID:13389427"
     CDS             complement(769258..769818)
                     /locus_tag="LDBPK_311620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863253.1"
                     /db_xref="GeneID:13389427"
                     /db_xref="UniProtKB/TrEMBL:E9BMT6"
                     /translation="MLQYTSSARQALRATALVLSFFPLGYTCGPKNKQVFFPPNNLDG
                     RTTHQMRKLQGSTDKHPGLVPRDKLKLHCEFCRFHWIQDTLVVRCAAHPKEHNQREIW
                     LEPTWTWGKQQPYQYYKYMPVNINPRTGMPLAREDAKSMNNERRSQGLPTKTRLLEQE
                     RRGISRAITGLGIYNQRWQTRFPFAT"
     gene            complement(<771427..>773862)
                     /locus_tag="LDBPK_311630"
                     /db_xref="GeneID:13389428"
     mRNA            complement(<771427..>773862)
                     /locus_tag="LDBPK_311630"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863206.1"
                     /db_xref="GeneID:13389428"
     CDS             complement(771427..773862)
                     /locus_tag="LDBPK_311630"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863254.1"
                     /db_xref="GeneID:13389428"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BMT7"
                     /translation="MSCVSVDALALISEHLPGQTGAWVSSSPQARRSRERSSHGLHLS
                     FNWFKDAAPSSLQRGRRPQLRCEINDVQGMRLCRWWLLRCSGASRPASSTACVAEATP
                     LSGTVRLRPPPKLSQYMECPLRVCCWGNRHASAAMKSGTVSTIDIPRLNCSLGELLSL
                     GCIECVEINGSALSPTPPEWLSCLAVARGVEKLSIKAATLPLNELLSFLYSSAATLRV
                     VEIAGIALPRLQMFALASRIEELVLGNVTVHPHSVVAIGNAEGQGNGRLPPPSNRVPL
                     SDLASLQKLRRLDMTNCKGDFDCAGIARCCFLRSVHLSGCNVKDADVPHLAQLPCVEE
                     LLLSRTRITNVQALAAGKGLRIIQLSNAQVDSDGIDGLQTLPYLTRLDLSSTLVSDVN
                     FLGQSQSLIYLNLAKTHVTSEGIAGLSRLLTLEHLMLNNNNIRDVSFLAESHSLKTLS
                     LQSTLVDSAGLEGFGRLQTLQDLSLAHTRVTSVTELQHCHNLWRLDLQGSFVDQAGIA
                     GLERLPKLRILLLSKTDVASLELILKSESLEQLEVKFSHVNEKSAFFGVTKASALTDV
                     TLTHCDVSDINNLGMCKELRLLNVWSSKVTSEGIAGLCEARSLQEVDLAETAVTDISP
                     LLSCTKIQALILYRSSVRSLDGIGALRQLRRLDIAETPVSSIRSLSACQSLEILNLSN
                     TAVDDDGFQGIGQVQSLRVVSMSFTAITQLGQLGQCSHLEELHAQSCPVTSEGLVGLE
                     RACCLVKLNLSYTKLQSGIQRLTNCRKLLKLNVKFTEVPYDEVAYVKRHLPGCRVMND
                     AAQRMAKDVTLLK"
     gene            complement(<774133..>774948)
                     /locus_tag="LDBPK_311640"
                     /db_xref="GeneID:13389429"
     mRNA            complement(<774133..>774948)
                     /locus_tag="LDBPK_311640"
                     /product="diphthine synthase-like protein"
                     /transcript_id="XM_003863207.1"
                     /db_xref="GeneID:13389429"
     CDS             complement(774133..774948)
                     /locus_tag="LDBPK_311640"
                     /codon_start=1
                     /product="diphthine synthase-like protein"
                     /protein_id="XP_003863255.1"
                     /db_xref="GeneID:13389429"
                     /db_xref="GOA:E9BMT8"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:E9BMT8"
                     /translation="MFTLVGVGLGDASDVTVKGMNAVKEADVVFLEAYTSFLINSNAE
                     ELAGIYGKPVILADREMVESGAVLDDAKVKKVVLLVVGDVFGATTHSDLIVRCNRQGI
                     ESKVVHNASIINAVGCCGLQLYRFGQVISLCFWTETWRPDSWYERLRSNRAAGIHTLV
                     LLDIKVKEISDENLARGRKIYEPPRYMTIRQAVEQILEVEGYKQGGAVAADGSTFAVG
                     LARVGSESQQVVAGTMKDLLSVDFGAPLHSLVIAGDVHDCEQEHVDLFRMAGQ"
     gene            complement(<775217..>775756)
                     /locus_tag="LDBPK_311650"
                     /db_xref="GeneID:13389430"
     mRNA            complement(<775217..>775756)
                     /locus_tag="LDBPK_311650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863208.1"
                     /db_xref="GeneID:13389430"
     CDS             complement(775217..775756)
                     /locus_tag="LDBPK_311650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863256.1"
                     /db_xref="GeneID:13389430"
                     /db_xref="InterPro:IPR002786"
                     /db_xref="InterPro:IPR026533"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:E9BMT9"
                     /translation="MTVWAIGTTNRAKAESVVTVVNRCFPNGTHEVRLCSVSSGVSDQ
                     PMSAEETQRGALNRAKAALEVISNADYGVGLEGGIEHIAGRWFECGWMVVLERKTGKC
                     GIGSSARFEMSETIMRPILNEGKELAEVIDNLTGEEDVRSGLGAMGVLTAGRLGRAAA
                     YEHGLVFALAPFLSDSKYW"
     gap             776307..776435
                     /estimated_length=129
     gene            complement(<778270..>778329)
                     /locus_tag="LDBPK_311660"
                     /db_xref="GeneID:13389431"
     mRNA            complement(<778270..>778329)
                     /locus_tag="LDBPK_311660"
                     /product="putative 3-ketoacyl-coa thiolase-like protein"
                     /transcript_id="XM_003863209.1"
                     /db_xref="GeneID:13389431"
     CDS             complement(778270..778329)
                     /locus_tag="LDBPK_311660"
                     /codon_start=1
                     /product="putative 3-ketoacyl-coa thiolase-like protein"
                     /protein_id="XP_003863257.1"
                     /db_xref="GeneID:13389431"
                     /db_xref="UniProtKB/TrEMBL:E9BMU0"
                     /translation="MGSQRCTLSAAPLFNGPSE"
     gap             778443..778541
                     /estimated_length=99
     gene            complement(<784254..>785690)
                     /locus_tag="LDBPK_311670"
                     /db_xref="GeneID:13389432"
     mRNA            complement(<784254..>785690)
                     /locus_tag="LDBPK_311670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863210.1"
                     /db_xref="GeneID:13389432"
     CDS             complement(784254..785690)
                     /locus_tag="LDBPK_311670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863258.1"
                     /db_xref="GeneID:13389432"
                     /db_xref="GOA:E9BMU1"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:E9BMU1"
                     /translation="MTDESRDSSPETGDDRPPVNRDSILRYPFREMRMEWFDDYMDNI
                     SPSKRVAVATRLMDCLMAHTVLHEDPFLEKAVTFIYNRVATHETFRNMTGVFGEAHDV
                     FRIVCMTAKFTVSNASEKNALLNLLDQHCTRFQAAAQKTKSESSETLIAAAGHVTECV
                     CSLRKNMASAEAFRRLMDSIKFLFFTVNTRNGVSPYSSNGKLLFNTFVCCDGCPCYAK
                     LRTGPTVFLRDMEKIKVLDCVMIAAVNAKDARMHDTTSKFLHNFCKDFMENPHLDDIG
                     HLIHNGRLFYCRTALFDALDNIESISSPQSDIADLPSAKTFTLDRIVLALLWVKSEVK
                     EIRLLCNLVPTLNEALSSAEAAYSRLDCEDVLQVVYTLKEHILAVFLALSAPEYHLAV
                     HSRDVFVGKQADMKCASPSCPGTTKDLLKCSGCDVTFYCSPECQKADWDKHKNFCHEI
                     ESRRSQPASPTIVYGPVQVLKPVSRRDD"
     gene            complement(<786157..>786717)
                     /locus_tag="LDBPK_311680"
                     /db_xref="GeneID:13389433"
     mRNA            complement(<786157..>786717)
                     /locus_tag="LDBPK_311680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863211.1"
                     /db_xref="GeneID:13389433"
     CDS             complement(786157..786717)
                     /locus_tag="LDBPK_311680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863259.1"
                     /db_xref="GeneID:13389433"
                     /db_xref="GOA:E9BMU2"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:E9BMU2"
                     /translation="MIRSYFDLDDIGACEEPVAVTFTVPSFSMGKDLTVRTHEGETVS
                     EVVAGCVATVPLWAATALRTEGYVSVHAPHTFSLATFREFKTDPLAPSLHRKSPYFYQ
                     AGLQLCRLLSNPTSSGHMSAEGNRLAAQLFRLYQLRYLRIIFAAAKKGFDLNDVRDKL
                     EESERHLLDSYLRGQAEEALWYANFT"
     gene            complement(<787857..>788705)
                     /locus_tag="LDBPK_311690"
                     /db_xref="GeneID:13389434"
     mRNA            complement(<787857..>788705)
                     /locus_tag="LDBPK_311690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863212.1"
                     /db_xref="GeneID:13389434"
     CDS             complement(787857..788705)
                     /locus_tag="LDBPK_311690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863260.1"
                     /db_xref="GeneID:13389434"
                     /db_xref="UniProtKB/TrEMBL:E9BMU3"
                     /translation="MSITAGTLPPVKGTSVKKSPRKGRPADSMVNGTGAAADPHCYHK
                     CRCYGHDDTLPNYKLLTIPRTNNYYAATGGCPCVPRVAAHPGSWRLKQGQLRSSTYRC
                     GTGCIKKSAALTLGCCHHSGDQYGWRRGPHTVLDKNTAATGKCDTFGNLAFKSTSRAY
                     CAVDGDDLSDVSSASPQKLEDLEALILEEHQQRMRVEEDVDELAGIQRDGTADWYKKI
                     HHDAERRRLLAQISEVELQDLLRDVKNIVDRPLNQTNMDLLRRILHRQEHLQRQREYY
                     AAQELE"
     gene            complement(<789759..>790586)
                     /locus_tag="LDBPK_311700"
                     /db_xref="GeneID:13389435"
     mRNA            complement(<789759..>790586)
                     /locus_tag="LDBPK_311700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863213.1"
                     /db_xref="GeneID:13389435"
     CDS             complement(789759..790586)
                     /locus_tag="LDBPK_311700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863261.1"
                     /db_xref="GeneID:13389435"
                     /db_xref="UniProtKB/TrEMBL:E9BMU4"
                     /translation="MPSVPTCQHGSYHQCECYGHNTQLPNYRHDISNPRTLQGYYAPN
                     GGCPCPGTCGAEKNGLYCSGRGADASAMPKLTFRAADGPHTVHTAADADGNGRDPATS
                     IRTAFPNSRNYGGTVAQRGPATLSTRAQLGASRKARAEAKREERAQDRKNFLRGVLRD
                     EMLARMDAEGKRAALEADMGLMGTHHGEEYEASQRVAGSMRGGLDSTSRDPDTVLTLG
                     EQYREIMDELEYVADQPVGSKYNIIRLHYLVEEEDRLSRLRLQERIQKTAEAMQSKK"
     gene            complement(<791188..>795504)
                     /locus_tag="LDBPK_311710"
                     /db_xref="GeneID:13389436"
     mRNA            complement(<791188..>795504)
                     /locus_tag="LDBPK_311710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863214.1"
                     /db_xref="GeneID:13389436"
     CDS             complement(791188..795504)
                     /locus_tag="LDBPK_311710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863262.1"
                     /db_xref="GeneID:13389436"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BMU5"
                     /translation="MQWTEVDQEQLHRFLESFTNPDPLVQASNLEQLQALSDYPSALV
                     STLAIVCDAAASVTVRLSATTVARQLLRCSDRLPLYLSAAGDDPATAAQSIAEALFDA
                     ALGGSSSLSSATTAAPLQRATANLIACLLSGLAHTSLASTATAVWSRIISSLLQRTDP
                     ATLIVNHAFQGGRWHTAQLGALCAALLRAICEAPLSTSKVLRERLGSQAAECLTLCSL
                     FTQLLQLLEKQMETEQAASGAAARFNALWLEETLTAFQACMESGLLPCAPSDFLRAPA
                     SDQSVTSPGADSSSTGLGEGPSMQALRAVGTAVRNVQIGAQDLLLRHVLGHLELLDGQ
                     RADGAFLREVVVSAAPFVAVGMRYMADAVALDAVHPLHDAFHATATPLLAKFCHAACL
                     AELQYDGAGESDSVHAAVLACINYVTEWMNTECAHLRAPSSRLAAFSAHPSTMTAPTE
                     GYVSCLYSMLVDAATLPTSVADALEEHTTHQPDSAAGFLVKSATGRRREPRGSHTKKT
                     YDEWASVAAEPAEATRNASAVVIPASCDKQDDTLIADALEVALPDNGTLRQAVAWCAA
                     GLSCKQAWMMAVAPLVVRPATISPLASLAVACAAESALFVNNEFLDGILADDEVSASL
                     AAATPELLDQNLAAQVQSVLSLLGPPTQDGFGTRAPFFVRMQAVRYLGRLVVDLLDAW
                     QHTSSADHVTRSRSGIEERAHTVMLAVGGLEKLLGLVLGRLTTEVSKAAQVECVKTLN
                     SALTSYLKVMEQLMRSAVNGGAASDLEEESLGSTSGSSGDMDAGDEGGDAARHLLLSD
                     RCERARAFFQSFGATTGLCAVVEVLRVVSSYLPSFQWSVRQAVYHLFSEALPSLWRTA
                     PLVDSLSASQADGTHSVASYSARFVTAQVLEALAQHYATLLSGSSLSENASPMLEMAT
                     LLTSMADVTSAMDGGALEMVVPWILQVAHHMLDLYAHYLTRRAHSNNLPTADSASGVV
                     DMTDMCMVSLDLVSCVCDGVIDRDALLEQQLRPKEDGDAFGTMDARVMALATSMLLPP
                     AASGIGYDGAPSSCSGAEALPNRCMALLAACQSLADHPSHVSTRPNTVTADGAEDEAF
                     CLSDEFGDVRRACFAIVYDCVFLAAYRSSLFRPLDVAVAPDTGLVSSPRCLSDSLGRD
                     LLALCMREVLPSSTPLSVTRSAEYAAHFRFVSAHNAAASDAWLCLGSLLSLWDQQHWQ
                     TRRSAARGAQPTCEGERGPRSVFHIRGLESTAELHSHCLHTLNYLLALLQDTRATVMS
                     NMRLNMITAACGLAVLLCDSGRSHTDSGALAPVCPLPFATISATFSEAASTRIQEYAP
                     NASGGDLSGISEAAHVLWCLGRLWQEAVQPLPQDALCSFLRSHGRETTKTILWWTRCV
                     FGAKKRLPPAEPPASASALFWGSLLELWRPVARELVQAAKGKALSLTQAQLSELGQLE
                     RL"
     gene            complement(<795965..>797998)
                     /locus_tag="LDBPK_311720"
                     /db_xref="GeneID:13389437"
     mRNA            complement(<795965..>797998)
                     /locus_tag="LDBPK_311720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863215.1"
                     /db_xref="GeneID:13389437"
     CDS             complement(795965..797998)
                     /locus_tag="LDBPK_311720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863263.1"
                     /db_xref="GeneID:13389437"
                     /db_xref="UniProtKB/TrEMBL:E9BMU6"
                     /translation="MHRSHFRVWRCSALAQLCGPSLYALRQVSRPAYTRSSSPLRSDF
                     NPRQHRSPDGADREPQRQLQSKLSRSAKVPVYTRDREERLAQQAPPSPVASYHDDSIT
                     SVVHESAPGLSDRETASAARSRVASSSSSPRTRHIRRQSHEKDPVVSSATVLRYLEKR
                     NSPYVSTLRKRVMPRHTGTHGAIEDPNSAYQSDDQRRAATDLRAEETRSIERDGYDPA
                     LVVHVDSRRRQVRLNDVQRELIWKARQKQYHDMLQRMVACLQSHRSPIEKCQTIYGLH
                     DEVIERHLRLRADTYEDIFHTLYSVGVRRGGGAGQPGKASLGSSAQLVSGGAGWENCC
                     GQEGSLWGSGGALPAELTTPSAASSTVLSPHGMEKVWEMYRYLVDSGTDPTPRILQYV
                     MGLLEHASVSLATARSHTTADASGTPTTHGRHRARCTGLILVEAKAHSLMMDADRFHL
                     TPTEYTVNSYIAICEACDVMHLAVARVTDYQTRQERQASPGMYARLLTGLVRCGHYTD
                     AMAVVTTMQNVSMTTYLVNAVLQAARHSRDPASVFAFYRSLFFAPSNPLRVSGDGDHE
                     RGGGAGKAPRPWRISATSRSATGLAPSLVTFSIMAEVMLQTQDYTELTFVIAEMQHYG
                     VKGNGLLLNKLLKMMHRAGRPRSEVRALQSAMDAKQVRVFDENRIGGHVPSLE"
     gene            complement(<798945..>801074)
                     /locus_tag="LDBPK_311730"
                     /db_xref="GeneID:13389438"
     mRNA            complement(<798945..>801074)
                     /locus_tag="LDBPK_311730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863216.1"
                     /db_xref="GeneID:13389438"
     CDS             complement(798945..801074)
                     /locus_tag="LDBPK_311730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863264.1"
                     /db_xref="GeneID:13389438"
                     /db_xref="UniProtKB/TrEMBL:E9BMU7"
                     /translation="MQIESSSATAASSLEGRRRRLVVSTPAPPSNPCAGSTMSALPPT
                     PATLRSNPVAAPATSRFETTSPTSTSKPTSASANGECSTRSSPGTRSRATVASRGSTL
                     VVVPPNTSVSQLGTSTKRSSRRKLPLKRKGTARTYKPVPLTAVGIGALISSHTPLTSS
                     PVLSSGTSRSPRVLISPGVRERASRTRANCTSSLPLSSTATSVPCALYDLHHALQHRL
                     VEDLGWSLHWYLDTETEIKQLEVFKELEEKTKHPSHKKKDKPTAAAAEGRANEAATGD
                     GKPKSAAASPRVSLTVDQQDSSAPGGSLKGNTSSLTSPRHSDPNTPQRHHRIDVDGRE
                     LPFLAQKPKLGVTTNRFDCCMCQDLSAEAHFAASQAPRSKLSRSPFEYRLASLQRWLR
                     KRSVESDKDGLLASCLSLETQRYLAYLGFADCWTSLFVTAGLPMVMPVAASCPSSPRE
                     ASPRLPTTLSGAASRLGSVPLSFYVLPALCRWKCVTPFRRDRMLRESVMHPFPLPEVF
                     LRDCRGASLAQLQSRAEASKVQAASADVSHSLSSLTFFTIQQRSALTERRRPSMWRNQ
                     TASLGEFCACDVYLVAAAGRGARDGAAAADTIASVWGYVKREDVDSRALSLPSSPSSA
                     AQKCKDGREGSTTTTTSAKSPSGELFYIASSLENYLRLGLVFGWVYGWQMCFSSAGPP
                     PNSVLWLRLVNRSAYEAALAASRHTAP"
     gene            complement(<802299..>805895)
                     /locus_tag="LDBPK_311740"
                     /db_xref="GeneID:13389439"
     mRNA            complement(<802299..>805895)
                     /locus_tag="LDBPK_311740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863217.1"
                     /db_xref="GeneID:13389439"
     CDS             complement(802299..805895)
                     /locus_tag="LDBPK_311740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863265.1"
                     /db_xref="GeneID:13389439"
                     /db_xref="GOA:E9BMU8"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:E9BMU8"
                     /translation="MGFGTDFTEEELAELEKLDSIYDKLLPKRSSESNNVSSSFLYRL
                     DDHGRIPLRDFFVPSAGSPSVARMRSNPPGIAAKWQTMLREMNGEMVVRSGQNIRNTR
                     AVINRILSWSITFQQADRAAAAVSLGHDGGRALAREWVRGIVVYFQERMDKLFAELNI
                     TAQEDACVQELKLPGMDGVDLVSRCVEAARTVITPMLTTSPYFIGIVRCCREMVLALK
                     VVQGLLSHISSHTRLMPSSAMVTTPDGRRNALAILTLGEDFLESLRTPLWLFRSVLLF
                     LGALDLQQSPQREATISEQHLDHSIHCIASLVAEVESKRDSSAAASLEVRATLDALVL
                     GHVKNACLARFPPSKTLELLEHAQGVRKDVAASEAAVGPLARCNPVLKQLLVDYPTFV
                     ESTAKFVERNEMSDWGISLMLVQLFCWDVKTPPDSAAQAKRQVIYHVPKLTGAFPHGS
                     TVLNAMVREALHPLLSALFSALPSGVRGYGTSGGAIGAETSTRASDGSAVAGPGRTST
                     IDGYDAGLLLYPSEQKVCAALLTLATWLQGLSFPAGSRMQRWASLDVGDQIMREFNLG
                     EGCFTSVLGEVLHDVIANALDQVENDCKHSCATRVVTAVETDDSVSRLSTAVLQYLRR
                     VERIWNAVTEPSLELHLSAFDDVFAIGAKTLPSVAAASTFGIAADVSATAERARYDTT
                     LFGDCKYLFYDTVQNVMRARWPGQYADMLTDPLLQSVHVYLLRAESASQRGRGLRSVA
                     LRGAPVRTIGAKWPNPPPQPALKELAPRPVNTGAAAAPARGPPPSAAEQDAVVCTSKE
                     ELHSALRMVRCIKNRDLFINRYTITVRERLLTRPAPDVISDAELESNKKRHEQEAEQF
                     LATWLGDASLLKPVRELHMSYSAQSELFDLASKGSVGVGEAPTKGIRLATTILDWRVW
                     GNKEAASAATSCQASESGAAPAAFPTSAAELVARAGQALSMALSETATLPFPNDALVH
                     LQKVEHAYNEKHSNRILRWDWNDHAYTSFTVSYPKEGGRVTTIHGTLLLQRLFLAIAA
                     YGRAGVELKTLAKRAGMDERRIAAVLRLCLDRDKLLVRISSSSDGAGEAAPSGGVHIA
                     LNYDYTRPPSRPHGEFTYWPNAERRRVAAGTVDEDATITKRRNMIKTSIMQIMKHVQR
                     IKHDELYNTVREKNAKAFDVTVRNFKQEIEGLIGQDFMARSCKDSNVYVFRA"
     gene            complement(<809703..>810851)
                     /locus_tag="LDBPK_311750"
                     /db_xref="GeneID:13389440"
     mRNA            complement(<809703..>810851)
                     /locus_tag="LDBPK_311750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863218.1"
                     /db_xref="GeneID:13389440"
     CDS             complement(809703..810851)
                     /locus_tag="LDBPK_311750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863266.1"
                     /db_xref="GeneID:13389440"
                     /db_xref="UniProtKB/TrEMBL:E9BMU9"
                     /translation="MASETSVALGVGVTLALFVLFAVALVFFGVYTNDSRTRSFERER
                     EQRVELVRQRQRQEQEQWRERRLRDVVLLLIERGEALEGVSLAFQLPNRPEVSARRTL
                     RSRRGVNSVRQNLEIELADEQENSRLDEEARRIARMPLHELLANGRPQNADAGPDVMQ
                     MLLDGQEIQRHTTSEDDSDFYLNDEDTTPASVTPFLSRQANEEARLGRGGGETAPPTP
                     LQSAAPAPGQPQPQQGDGPASTNVAAGEREIDARTAAVLLQEQRLRESRELALLQELR
                     REKRRKYRKTAEEVYGQGADYEHNPANDALLRIQVVNGGGTPGSPLWRFLTPLTSLRG
                     NRSRRDKKSAFDGLSPQESTVYQRENTGLPKSPASGKKKNRSFEVAPF"
     gene            complement(<813201..>814451)
                     /locus_tag="LDBPK_311760"
                     /db_xref="GeneID:13389441"
     mRNA            complement(<813201..>814451)
                     /locus_tag="LDBPK_311760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863219.1"
                     /db_xref="GeneID:13389441"
     CDS             complement(813201..814451)
                     /locus_tag="LDBPK_311760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863267.1"
                     /db_xref="GeneID:13389441"
                     /db_xref="UniProtKB/TrEMBL:E9BMV0"
                     /translation="MRATSLRARGSSGQHSHPRLFPATLSLFPHRPSAPYPALRAVRV
                     SLITQQACVPLLALHRQLSSDDGCLLPPTTPAAEVTVGSAAGEDDDDDLKMDIYRPQL
                     TPEDAERKAKTDLFLCLVLTLPRDQDWKDMLTAAFRAGTWKPHHLSAVLRGVQLNRYN
                     EPAVCALSCAGVCATSLPSSCTAALRHAIAEIAKTAPASSAPSTRLQRAKDILVFCAE
                     EGGVYAPPSAEDSLVDVSTAPPSPAEEETSRRSKAFAPSPADAHHLLVLLLKAAQRGA
                     SVASSLSKPNTPTQAVASFHDVWNFLAWMELHGYHVLSNAVLDALEVVVDKGGSQAGA
                     GAAAGLTRAAGPSSASSPLPLQYAMVSQRVHRLDYLRSERALLQEAVKNAEQGSGGAS
                     MSTGAVRERRRQRDVPRTAPVHTE"
     gene            complement(<818758..>819969)
                     /locus_tag="LDBPK_311770"
                     /db_xref="GeneID:13389442"
     mRNA            complement(<818758..>819969)
                     /locus_tag="LDBPK_311770"
                     /product="nucleosome assembly protein-like protein"
                     /transcript_id="XM_003863220.1"
                     /db_xref="GeneID:13389442"
     CDS             complement(818758..819969)
                     /locus_tag="LDBPK_311770"
                     /codon_start=1
                     /product="nucleosome assembly protein-like protein"
                     /protein_id="XP_003863268.1"
                     /db_xref="GeneID:13389442"
                     /db_xref="GOA:E9BMV1"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:E9BMV1"
                     /translation="MPSQVHVDPIARTGSDASEASSSEVDMVAVMTEMTVAERRRVYA
                     LQGLLKEYYEVRQRLRAEIAALANECAAENQKLFAVRKEIVTGARDITEEEMQRIGRT
                     AAPTEPDKKEDAAPAKKGVKFVDPVDEKQNSALVKAAASPSGGIPAFWLTAMSNSEAV
                     NSMITEKDRDALMHLTDIERGFVEGDPEKGDRLVFHFSPNEYFTNETLTKEYHTEYDE
                     DHGEPRITDVVGCDINWKSSKKNLTVTVKQKKQRNKKTGQMRVVEREEPCESFFNFFS
                     PPNPDDDDDEDGDDEDFLEQEMEMDVEVGTALTQAVVPRAIFYYTGEAVVETGKELRE
                     QYGFGNSEDEEDEESDSDKEDEDEDEAPAGASNFRNIVRQRGGGATPGGRGGRGGAVG
                     QQPPQQECKQQ"
     gap             821758..821856
                     /estimated_length=99
     gap             823291..823389
                     /estimated_length=99
     gene            complement(<826786..>827913)
                     /locus_tag="LDBPK_311780"
                     /db_xref="GeneID:13389443"
     mRNA            complement(<826786..>827913)
                     /locus_tag="LDBPK_311780"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863221.1"
                     /db_xref="GeneID:13389443"
     CDS             complement(826786..827913)
                     /locus_tag="LDBPK_311780"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863269.1"
                     /db_xref="GeneID:13389443"
                     /db_xref="UniProtKB/TrEMBL:E9BMV2"
                     /translation="MACAVPSPGTSQVVTCPSTLTSPVKIDQEWSITTSSATHATPIP
                     QAPVATLCTLSKASATTTPVADGTHAFLQPSPVSAMSAIRRFLRRSSIMVPFMAERAA
                     KEVVVLPPPIHRLYRQADETRRSLVRRADFLASCGENELAAENADACVSADREASAKV
                     DRPRGDVFDFTWTRKEVNAMRMQQREYLRRQRGSPHAPVLVRMNELASNLLNDGDWEQ
                     MEKASPTVAAVAAPAVHANVANIVAGLCTRAIPQAEYIRSVFNYRMSVLQKRINAVPT
                     GVVVPAVVQATMTLDELSESHSGESIPKYKKDKATSKKALSPTTAPTVTFPHPGVPFT
                     YQDLAQDPLLLTAEQRADRRAALLHRRTLSEEVYGQPVPYI"
     gene            complement(<830309..>833593)
                     /locus_tag="LDBPK_311790"
                     /db_xref="GeneID:13389444"
     mRNA            complement(<830309..>833593)
                     /locus_tag="LDBPK_311790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863222.1"
                     /db_xref="GeneID:13389444"
     CDS             complement(830309..833593)
                     /locus_tag="LDBPK_311790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863270.1"
                     /db_xref="GeneID:13389444"
                     /db_xref="UniProtKB/TrEMBL:E9BMV3"
                     /translation="MSLFSSTPTPEDTNPPPSNATLLTSSTSTAQPQAHLCYYYHQHY
                     SHAPHILPLRHPGSLEQRDVGDGSLQLPREAAAPGRSVASPIAPSPPQRLLRVHQPVV
                     YAPWDMMPQPTGGAPAHQLHAILGAPVGPTTATVIAQGAPAISLDLPVPPSPDKQVRT
                     YYALVLFVLMAAMGLLLGSFFTPICTACLNFTRSVTDVQDPAVYKRSIEGSRGMQISA
                     YAAFSPCTVFKRHACDTITADQVSGWMRSITNGMQAPFPDLFSYSGIDRARVSSCSYI
                     RLPAATTHPVPQLQNTAAPVVIGWRAFRSDCGPTPPALPLHTRHGWRSGGSGLGNVST
                     SLRAHEREPHSHPPLAAPGQGDAPGHNDPTHARPAAGAPHGGNASHVRIVLHSSLPQG
                     AKAAFTLTCDSDTDTVPMLNLTTIYNADVSAYLSDGTNASSSKMVSAADLITRADPKN
                     VVREYQPVMRTCAEYLAACATIEPGYYVVIAPASPLHRCGQEAISPPSSPSRSSATAA
                     KVLICGITVYEPTAYAAGAMRFTARAHLAMNMVVYPSNVRFPSSAAGAPVCLTPSAIL
                     LVFAEAFMLLTIVLTAVTVGMAPVQRAKLRQLRAALDVDASVAMEILYRAQGAVAAGM
                     PLTAAPAPAAPRAPHEPGAEAGHATDEPAAATADDASPMSFTSASTAPPRPHMQTSQQ
                     QPSEAHTPQSELSGTAAAMLLVPPYYQPGGMTVPGASGSGSMGVPGIMAGLHPSPYSE
                     GYYLEPEHGPRNAAAPRRDAADGVVPPAGAAHTLPAAAAARHGERDRSTTTRGVSYTA
                     SPGTSLVAQERSVVCSSSGVRDVSVRNVTLHRIGRRRQRQRGTAGVGSDEDQDADGGG
                     AGSGIGCAVAPTWVPAAPGALPARGHQPELLAGQAHAADAVSPPALMSLEHPEPLMPV
                     SEATGWMFGRSRHIASQSMLEESSSSARTAEERNAAGASMPGNWPGSDTESRLGSDDR
                     LPLASYVLPENSPGERTIQLFLLRARKSYTRLRRKQVRVLAKLLFYAKAAAFTALVFA
                     LVCTGLQLSGVSARGREGLQFRGGDTLSDDYVLNASHVALMSLSLACVVVVVVLDFVV
                     ERKRLW"
     gene            complement(<841325..>842710)
                     /locus_tag="LDBPK_311800"
                     /db_xref="GeneID:13389445"
     mRNA            complement(<841325..>842710)
                     /locus_tag="LDBPK_311800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863223.1"
                     /db_xref="GeneID:13389445"
     CDS             complement(841325..842710)
                     /locus_tag="LDBPK_311800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863271.1"
                     /db_xref="GeneID:13389445"
                     /db_xref="GOA:E9BMV4"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:E9BMV4"
                     /translation="MALRYSAETMRVQGIGSPYASLAELYIPDPTNASRRTLDTARTT
                     LNWSELPSAFLNIKAYQDKVGVGCSGWGMDVSLLLVLYPAVYWFLGIMLIRYLCREPF
                     ARFGIYMGVVTEKSTCRHRGIASGNRGVASLSPRNRKKIMKFQNQMWLSMFYFASSCF
                     GYYVQRDQPWFKLPLDDEASLHLLLPHPYNPPEELIMYYHYGLAFYFAELCSLFIIER
                     HMKRSDFLEYAVHHITTLLLILCSHIGLEHRFGAYVLFIHDASDIMLSVSKSLHYVWQ
                     EETARRERRNTKNAEERNSKAHRKSFLQRCVVSELSLNCCFAAFTLLFFFFRLYCLPF
                     MGKATIRMSPKVRHGNFNMWMLVFLLNVALQGLHVYWAVLIIVLSLSIAKGGELRDIR
                     SDDEEDSECPSCGHQRSLTESNGAAAAEEGKGMQQRNVARESKAAPSLSSSLASTRNR
                     SQRRGSSKRKE"
     gap             846190..846288
                     /estimated_length=99
     gap             847067..847165
                     /estimated_length=99
     gene            complement(<848692..>848820)
                     /locus_tag="LDBPK_311810"
                     /db_xref="GeneID:13389446"
     mRNA            complement(<848692..>848820)
                     /locus_tag="LDBPK_311810"
                     /product="amino acid permease"
                     /transcript_id="XM_003863224.1"
                     /db_xref="GeneID:13389446"
     CDS             complement(848692..848820)
                     /locus_tag="LDBPK_311810"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_003863272.1"
                     /db_xref="GeneID:13389446"
                     /db_xref="UniProtKB/TrEMBL:E9BMV5"
                     /translation="MYSGNFTVAQVGWFTYLNTYLLLICGVVGIVFGTGGTIYVTI"
     gap             848854..850824
                     /estimated_length=1971
     gap             852111..854885
                     /estimated_length=2775
     gene            complement(<854887..>855156)
                     /locus_tag="LDBPK_311830"
                     /db_xref="GeneID:13389447"
     mRNA            complement(<854887..>855156)
                     /locus_tag="LDBPK_311830"
                     /product="amino acid permease"
                     /transcript_id="XM_003863225.1"
                     /db_xref="GeneID:13389447"
     CDS             complement(<854887..855156)
                     /locus_tag="LDBPK_311830"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_003863273.1"
                     /db_xref="GeneID:13389447"
                     /db_xref="UniProtKB/TrEMBL:E9BMV6"
                     /translation="MSHPTSMRGDGAQRPCRHARSTTKDAHRTQNREVPPSRSQPRRS
                     GCLGVLQAIRDGVIKAVYVIVPPGGILSGAFNMASSSIGAGILGLP"
     gene            complement(<857438..>857743)
                     /locus_tag="LDBPK_311840"
                     /db_xref="GeneID:13389448"
     mRNA            complement(<857438..>857743)
                     /locus_tag="LDBPK_311840"
                     /product="acetylornithine deacetylase-like protein"
                     /transcript_id="XM_003863226.1"
                     /db_xref="GeneID:13389448"
     CDS             complement(857438..857743)
                     /locus_tag="LDBPK_311840"
                     /codon_start=1
                     /product="acetylornithine deacetylase-like protein"
                     /protein_id="XP_003863274.1"
                     /db_xref="GeneID:13389448"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:E9BMV7"
                     /translation="MRVVTCNKGFCEWHLEMQRKVIRSSMALMSTSCNAIEYAAQIIA
                     EICETALGITKSTVQERNYSCPLACISTDAVMDGNAANTVPAECDVMCSVRRPLGHL"
     gap             862325..863651
                     /estimated_length=1327
     gap             865159..865257
                     /estimated_length=99
     gene            complement(<865260..>866147)
                     /locus_tag="LDBPK_311850"
                     /db_xref="GeneID:13389449"
     mRNA            complement(<865260..>866147)
                     /locus_tag="LDBPK_311850"
                     /product="amino acid permease"
                     /transcript_id="XM_003863227.1"
                     /db_xref="GeneID:13389449"
     CDS             complement(<865260..866147)
                     /locus_tag="LDBPK_311850"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_003863275.1"
                     /db_xref="GeneID:13389449"
                     /db_xref="GOA:E9BMV8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMV8"
                     /translation="MSNRSADSCPHTCRGQQREEHPDHARSSTMTVGAARTAKPTATS
                     QSAGQRSQRQSRSQPRRSGCLGVLQAIRDGVIKAVYVIVPPGGILSGAFNMASSSIGA
                     GILGLPAATDSAGIILAMIFLAVITYFSVFSMYILALASENTRIKTFEGLARWLFPAR
                     RYAFSYWAAFVRWFYGFSGCVAYIISVGNCLGPIFTGAAKQHPDNRAIQFLATTQGNR
                     VLTVIVWLFVMLPLVIPKHIDSLRYASAIAVTFMVYFVFVVVAHSCRNGLAETSKHVK
                     LSGNQADDGKLEHNTVFLFR"
     gap             866320..866418
                     /estimated_length=99
     gap             868902..869000
                     /estimated_length=99
     gap             870076..870174
                     /estimated_length=99
     gap             872562..872660
                     /estimated_length=99
     gene            complement(<873599..>873946)
                     /locus_tag="LDBPK_311860"
                     /db_xref="GeneID:13389450"
     mRNA            complement(<873599..>873946)
                     /locus_tag="LDBPK_311860"
                     /product="amino acid permease"
                     /transcript_id="XM_003863228.1"
                     /db_xref="GeneID:13389450"
     CDS             complement(873599..>873946)
                     /locus_tag="LDBPK_311860"
                     /codon_start=1
                     /product="amino acid permease"
                     /protein_id="XP_003863276.1"
                     /db_xref="GeneID:13389450"
                     /db_xref="GOA:E9BMV9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BMV9"
                     /translation="CQVNAQEVLWDLRPEIRTTKSFTLSAFIGMMLCTTLYVLVSVFG
                     YFDFGSKNLLGKSLLLMFNPLEEADIMIAYVAVMIKVCVAYALLTIAARNSLYYWLFR
                     NTSTHCATPPPSR"
     gap             873949..874047
                     /estimated_length=99
     gap             875066..880926
                     /estimated_length=5861
     gap             884220..884597
                     /estimated_length=378
     gene            complement(<884599..>886731)
                     /locus_tag="LDBPK_311870"
                     /db_xref="GeneID:13389451"
     mRNA            complement(<884599..>886731)
                     /locus_tag="LDBPK_311870"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003863229.1"
                     /db_xref="GeneID:13389451"
     CDS             complement(<884599..886731)
                     /locus_tag="LDBPK_311870"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003863277.1"
                     /db_xref="GeneID:13389451"
                     /db_xref="GOA:E9BMW0"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="UniProtKB/TrEMBL:E9BMW0"
                     /translation="MEPPLHATLHTEAWASCSKEPRAETLPRLYANKQNVPRASKRAA
                     WLDFLCRVDILWSILFFALLATVGICSAVVTQTIVSAAVLESWRTLHHVHANIIRKRL
                     DQQISAVYNMAADLILLQARYPFQMQSEDTLATLCSILSGYDKDMLLAALSLVSHELR
                     ETITCMHGLTDDALTDILFGYVSYNHTVNATNYVDKDTYRFQRPLRMAMEWPPQVRNI
                     SNFIDENMNAVPIFALVNELAAGRNPDIDIRNAWRVNPILPHLMELNVPVGMVYGSPT
                     MPVTTPITDYALLHINGSRLLREPDGTHHIGARIALFVNQTLTDADPAIMSNNWGQHF
                     ISSVIHTPLVNTSVTYLKASDVRDPLMRAALQHVDLAQLQSEASRSTVGFQHNGAPAM
                     VTAWTYTTSKGLCLPLVYASVQENITVPHTLIRDMGNGIMVAAVLIFTLIFWRLIHRT
                     ISQPLNGVQASMLASVEHGDRQLYYLRDSKLVRFTEVDALIKAHNKTMQQLRDVDAFI
                     PEGLRLRVTDGSAHQSDDVPTRRFSCLTHNSRPPKLKGPQLSLHLSTVVYLSMNATAS
                     TTTDPFSSLQRRSLAEEQESGQIRGQRLIAAAEQTAQAANTANSGPFPTPAALTAFIT
                     AVHELCHTHHGTLHRLCPDACVLHFNSAVRAHLPRGPGDASAAAAPAAAPPAPAARHG
                     VPAAQSAPQPRPPRATRQEEMRLRAAQDA"
     gap             893402..893500
                     /estimated_length=99
     gap             894598..894696
                     /estimated_length=99
     gene            complement(<894698..>896752)
                     /locus_tag="LDBPK_311880"
                     /db_xref="GeneID:13389452"
     mRNA            complement(<894698..>896752)
                     /locus_tag="LDBPK_311880"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863230.1"
                     /db_xref="GeneID:13389452"
     CDS             complement(<894698..896752)
                     /locus_tag="LDBPK_311880"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863278.1"
                     /db_xref="GeneID:13389452"
                     /db_xref="UniProtKB/TrEMBL:E9BMW1"
                     /translation="MRLQSSRLSSGATAPKQLHRDAPSPGRPVKTRMRCRFAVLKYFL
                     LRVDVSVSIVYLLVLLCVAVPIVVVSQVYLTRMLVASWRTVHNTRVYYITERISISTI
                     SVRDIANGFMALNIPGGGSYGDHDLMENLCSSLDNYDKLTRFRALSLVSLETESAISC
                     IHGIPTMDSMRTLTGYFSHDNIINGTYLIDSETYDFVQPPQMVTEWPESARDISAAKT
                     TTYSGVPILELLPAYLDGSVDSVDSRHHWILPTIMPHIICYILPVGYLARGRTDISSV
                     RYTDFTQVLLDGSRMLLDYDFVEAPGLAMAAFINQSLADDDPLVLSNSWGQPSVSNDS
                     IYSIFTTVPVTYLKASNISDPLMRAALQHVDLAALQHEGYRRSVDFEYAGAAAVVTAY
                     AYTTAQGLVVPLVVASSHAAITTPYLFLMRIFDGILVAVILLLTGASFNSARCLISQP
                     LRRITALMLASMSAGRRALFYTTTSNTLLQLTEVHALIKAHNAAMQQLREIDAFVPDE
                     LRAEGRAQRAYSSVSNIASSMGISNSRKATKFGSRCLDTHLSTAVFVTIRAPAALSSS
                     SAVLPRTPSPPPILTEQGEQKPLRGQRLVSVVKHAAQAANTANSGPFPTPAALTAFIT
                     AVHELCHTHHGTLHRLCPDACVLHFNSAVRAHLPRGPGDASAAAAPAAAPPAPAARHG
                     VPA"
     gene            complement(<900458..>900763)
                     /locus_tag="LDBPK_311890"
                     /db_xref="GeneID:13389453"
     mRNA            complement(<900458..>900763)
                     /locus_tag="LDBPK_311890"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863231.1"
                     /db_xref="GeneID:13389453"
     CDS             complement(900458..900763)
                     /locus_tag="LDBPK_311890"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863279.1"
                     /db_xref="GeneID:13389453"
                     /db_xref="UniProtKB/TrEMBL:E9BMW2"
                     /translation="MPDVRALLDTSMFTCGQYRPAGSEQTLQVALGRDVQRDLGRVPQ
                     RIGVRVAMTEETATLLRAEDDSGGRGFCCGSRSAVQGVHEHSRCGRSPRGWCPRWTR"
     gene            complement(<901986..>902444)
                     /locus_tag="LDBPK_311900"
                     /db_xref="GeneID:13389454"
     mRNA            complement(<901986..>902444)
                     /locus_tag="LDBPK_311900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003863232.1"
                     /db_xref="GeneID:13389454"
     CDS             complement(901986..902444)
                     /locus_tag="LDBPK_311900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003863280.1"
                     /db_xref="GeneID:13389454"
                     /db_xref="UniProtKB/TrEMBL:E9BMW3"
                     /translation="MATDSDTLIIIFLWLVYVCLHVCIDYCERRSLLRAEESEAPERA
                     QAAAARSGSQPRSPRRRAGASGDVTAPIAVIVLGADGDLNTNLNEPCEGAVVPGANGY
                     MPVLPEQVHYGESTYMNRQEDRSAVALEKAVEELSPASEVDAGKEDPALR"
     gene            complement(<916967..>917770)
                     /locus_tag="LDBPK_311910"
                     /db_xref="GeneID:13389455"
     mRNA            complement(<916967..>917770)
                     /locus_tag="LDBPK_311910"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863233.1"
                     /db_xref="GeneID:13389455"
     CDS             complement(916967..917770)
                     /locus_tag="LDBPK_311910"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863281.1"
                     /db_xref="GeneID:13389455"
                     /db_xref="UniProtKB/TrEMBL:E9BMW4"
                     /translation="MIFFQYVFPCYTRKTASDRASLAERATTPSSNVASTTNLSGSAT
                     TSPGASRMSDLAGSIVSLAASAFFAFSVLVAIYYYFEVYRKRTTEERRILAHESGGRS
                     SSGSGAGGPPMIHVIEGIPMHYSAVSATQHESSEEVASLRRLAQASPAVIPRSSSVSV
                     AYHVRSRGRDRTIRVHTLDADPHVFNPFSLPSSSVEAQACVGHVVETDEGEQRLLGGE
                     ETWKRLDYGSAMYYSSPIEESSHKDGSEGNEDDGDVAFCDDSENQPPDE"
     gap             923404..923502
                     /estimated_length=99
     gap             925105..925203
                     /estimated_length=99
     gene            complement(<930420..>932993)
                     /locus_tag="LDBPK_311920"
                     /db_xref="GeneID:13389456"
     mRNA            complement(<930420..>932993)
                     /locus_tag="LDBPK_311920"
                     /product="mannosyltransferase-like protein"
                     /transcript_id="XM_003863234.1"
                     /db_xref="GeneID:13389456"
     CDS             complement(930420..932993)
                     /locus_tag="LDBPK_311920"
                     /codon_start=1
                     /product="mannosyltransferase-like protein"
                     /protein_id="XP_003863282.1"
                     /db_xref="GeneID:13389456"
                     /db_xref="GOA:E9BMW5"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:E9BMW5"
                     /translation="MPLLHGGDPGSGNTTEYVLLSNLLGPLVQSEDALCHRGANSAQA
                     PAYQVHAVVVSGAAAASSVLGGAVRGVLSDGVLHSGDVLPQGRPRDELTPAPSWRAWE
                     LNMDAVRAALGGAARGGARCLGDRVTLVAPAAPAPDTTVEVLVDAALRTRGGRAGSHF
                     VVLSSFLGATRMPYTEPGDALETRHEGTGLLDALVRTATQRNGGRVAAAQCTILQHGG
                     DSGGWRHPPPRLTARELASLRVVDKGGMTGATHNGEVLLPYLTRRLSGYSAADQRASW
                     EEVVDAVSLHCGIFDRRVYDAVGGLAGALSEPAVRDAVSVRDDHAMGAVDRGGWALTL
                     RMQEAYPAWQVWGSRAAAVVRDDVAGVRALPAVVSLQRPVFSLLDRYGRTAYSVVTEL
                     QRRRVGVPWRLRGEDSHHSAERTAVVQNCLPPVIRYHTDFSAPCIGLNREAMAYIRPL
                     MERYGIGVMGGGGRSSCPKSGDALLQLAYGGVRDLFSSVSSPATHSFFRDSLRHRALL
                     VFQHWRAHRFFPVPKRRFHECPEVYIGHSMSELSNIQQKWIVPMRTRADEIWTTADFF
                     ATIYRRNGVSPDKIRVVPEAVDVYEYDPANYARQPTMSRCASISSCDNRPSLTEEERL
                     QRYVFFSSFKWESRKGWDVLLKAYWAAFGPSAPSQLRERTTLVIKTRLTHRYSPELSR
                     DSVLHFIETWGRGGALPGMTSMADYPHIIIVTGEVSAAEVVQMYANADAFVHPTKAEG
                     WGLPAVEAMAMGLPVLVTEWGGPLRFMERDSCFRIPVDGLEEISPNSPYGYEEGMKMA
                     IPSVEKTAELMRYVVEHPEHARRVGRRAREYAVRELSEEAVADRMDRLFVDSVIGRQR
                     G"
     gap             937583..937681
                     /estimated_length=99
     gene            complement(<937932..>938318)
                     /locus_tag="LDBPK_311930"
                     /db_xref="GeneID:13389457"
     mRNA            complement(<937932..>938318)
                     /locus_tag="LDBPK_311930"
                     /product="ubiquitin-fusion protein"
                     /transcript_id="XM_003863235.1"
                     /db_xref="GeneID:13389457"
     CDS             complement(937932..938318)
                     /locus_tag="LDBPK_311930"
                     /codon_start=1
                     /product="ubiquitin-fusion protein"
                     /protein_id="XP_003863283.1"
                     /db_xref="GeneID:13389457"
                     /db_xref="GOA:E9BMW6"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BMW6"
                     /translation="MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEEGRTLSDYNIQKESTLHLVLRLRGGVMEPTLVALAKKYNWEKKVCRRCYAR
                     LPVRATNCRKKACGHCSNLRMKKKLR"
     gap             938409..938507
                     /estimated_length=99
     gap             940305..940403
                     /estimated_length=99
     gene            complement(<942579..>945128)
                     /locus_tag="LDBPK_311940"
                     /db_xref="GeneID:13389458"
     mRNA            complement(<942579..>945128)
                     /locus_tag="LDBPK_311940"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863236.1"
                     /db_xref="GeneID:13389458"
     CDS             complement(942579..945128)
                     /locus_tag="LDBPK_311940"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863284.1"
                     /db_xref="GeneID:13389458"
                     /db_xref="UniProtKB/TrEMBL:E9BMW7"
                     /translation="MLLGNGGVADSVTAVAATDSIKNPMERPPASEGNLQPQLSKGAL
                     QDVLEGEKHRRLQTVDVGGMVGYRRVARPRNESVYRGLAPSSRSTKKQLTAADEQLCK
                     RLAASHNSSSSTLQHHSASGVSSGAASQKVCNDNSTSLLSCKGARQQATEEDRDTDLS
                     AAACGGAVVGLRESSAVVLQPLDTLQDTPLDEGKDHPNGKGDYSPSFTGGTGYPDTAA
                     AAAAIRVPMLESRGQPSCRQSSRVSSPLSSHPTSIITAKPSFKSCSAQPQSVRTVESF
                     RSLTGSHINYPGSVPGSSVGYADDVTRVDERHRPIRRMSSSCDLSVVWIAPPLCEWLR
                     PGEACSVKGNSMARSHRAPSARTPVAQARVPGTPFRLPSTTTPHKKQETSRSRSSHGE
                     ASLGSAHMGEKSDEERHVLQCWLSSTCGSFTHANRPKMASAAEGRLIGHAADNDRSCA
                     DGHQWPLREQAARTPESAAQHSPSASSRREALSAVTPTLGEVLERNRADLKVQPNAPS
                     VAAPYSPSAAYTRSGDRWTAAPAHLPALTWSAVCAAAQHPYYASGQQQQRPVPYVHTY
                     DVAYHDEGQTYAATEVTNAYMHGGSGIFLPGLERAKPSCVRPVGGLKANKWRAPVPPA
                     KRRVVFELLDPLVPVRPRPTLRQFQRPRRPPQRSPQRPTSKLLGSSQQKRIGLAEVEA
                     AASPIQQVRQQALSLQRENTSAATSDREDMTLTGLGEDEEWASAHNYPAVEPPRTAAP
                     ADDTVYATVARKRKLNLHKRKAQQNARLYRAFAPYMASLRAGPGAGGRGRAVQRKQKC
                     RKNGLLPHQRGSSDAQNDLQSMNYPALATECDPLDHLLSRHGFWGEAMTRL"
     gap             947121..948283
                     /estimated_length=1163
     gene            complement(<949698..>953576)
                     /locus_tag="LDBPK_311950"
                     /db_xref="GeneID:13389459"
     mRNA            complement(<949698..>953576)
                     /locus_tag="LDBPK_311950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863237.1"
                     /db_xref="GeneID:13389459"
     CDS             complement(949698..953576)
                     /locus_tag="LDBPK_311950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863285.1"
                     /db_xref="GeneID:13389459"
                     /db_xref="GOA:E9BMW8"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BMW8"
                     /translation="MTQFHARARGNVAPMRSRVTTGITAALLSLLVIAACFVATAVSA
                     TPPADAEDRQGATLTLLGSATVAKTARRQTSVLSRFWLHSREEQNAFTETLFGESLTK
                     VSIDTISDIAREITPPADLKLDANLLGPLSRSAMLAATGSGVQLAASRSLQEHLTLAT
                     QADASNGQLVSKLSVLYATSVARMNEPPSAAVAQAQDPAAKMSAPQQNHRAASPAITQ
                     PLKPLKSSAQASPIESLRSGAVGVDKSRLRVPSTASRWFAALKRGAETVVRAVAEAKA
                     GHSAIKDDSSAKVLAAKKGAAALMRTMGNYVKDTLIDVNSTRALIPITIVGSGNTVVK
                     FNGEAGNMIEVVVQLKDHRYDKSVSRDNCYGMYLQVELRTSHKFDGGAYDSKGTAAVV
                     ATTQAHDHVGRNTWIRMKSSAKNSDIDDSSHPNVPTQEEESSRWSDFWDAFAPMLDNS
                     AMCKVLQSVSMRVEKVQVTEPYYIILHSTTIPSLQKPQNGTSASGTQVSRFDDSPYTC
                     ELNLFFNEEPAARLGRLQFIFAFVLPLIVLFLPLPFTMRRADLVQQYMMESDFAEWIW
                     MLPLLLRSKMVEALKAGIEWILSLRSAYQQRVLRNQLLRQEQAHQGTVAAQSATEQEQ
                     PSQQPGVQHLGWSAAAPMEPPLETPNLTGFHASAAADAQTEPSPLRQQHEPCTQCQFS
                     EEEVSFSARSSRSTCSTPSRASAGSYSDEPHDSAHCHHHGHHTHGGRNVGALMASHSP
                     CSSDALMEDVSCRSSTTGRTHGARRHRHHAEESYAVCEAATAVSVHVPPETDAAEHWW
                     KGNQSGPHARSNGHDLLFTTEELVDAGRSLTTREQHQHVAGAQRPTANDAIQTVSTRP
                     REEMEAMKSCGGAVDGVPAAGASAPMSTGITAPSAAAAEARRRAPASSAANAAPHEEE
                     EEEESFCRICREGSDIAPLIVPCACTGSVRFVHATCLDRWRIESAKRNLANVNHCEIC
                     KEPFRVNIQRSTLLWESSQQILNGVCLFLACFIMIVTTTTLTHVVLGEMSCSASYHQV
                     AYSTMFRFEGISLTLFVYCLAVLLVLFANLIVYSWFRSQPDVEEYVEEMHIVPPFYTR
                     RNVLLIVLVCLVLLAQAHAMGYLLKYFLYRTSHLVWNWETSPLMGGILLSIFTIATTA
                     FCGWVRDIYTVHVVDRDRRDAPATDVVIVPIGDADRAETAADNSNDGTAPAPLSRSII
                     VAGTAAPPASLTGASVTAASPPPPPFPSPATPGVSPSSPTLPTMLDSAAQQRSADEDP
                     EYTRHFGIPPDQRVIRAFEYCPPRRKMPQR"
     gene            complement(<955112..>957094)
                     /locus_tag="LDBPK_311970"
                     /db_xref="GeneID:13389460"
     mRNA            complement(<955112..>957094)
                     /locus_tag="LDBPK_311970"
                     /product="dihydrouridine synthase (Dus), putative"
                     /transcript_id="XM_003863238.1"
                     /db_xref="GeneID:13389460"
     CDS             complement(955112..957094)
                     /locus_tag="LDBPK_311970"
                     /codon_start=1
                     /product="dihydrouridine synthase (Dus), putative"
                     /protein_id="XP_003863286.1"
                     /db_xref="GeneID:13389460"
                     /db_xref="GOA:E9BMW9"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:E9BMW9"
                     /translation="MAYNQKQLEAYRQLIAEGKPFRSITCPYCNGRRDATVKHVHPST
                     KPPSAWGFWNDVLVRKYAAVQSPASRANMEAAVTDSSAVRGAPRRVTEEVTRNEAAAE
                     ALHLDATSGPRMFIVGPMVDQSELPFRMLCRQYGATVAYTPMLHAKCFAEGAVYRSHF
                     LSVCPPEEVKAAMEASLASPPIAAGGHGSGSSMRGGVGAGSENAVADTALVDRPCIVQ
                     FCGNDADTVLRAARFAVLGEQAAAAEQTSGSGGASVAPVYPVHVRVNGLSSSEKAPEH
                     LLYQCDAVDLNLGCPQGIARRGHYGSFLMEDWELIHTIVHTLHVELEVPVTAKIRVFD
                     HPGHVEAAGDKRECATNCSSAACQESDAVCAAADTSRESMKEVFDEALTILYARMIRD
                     AGAQVLCIHGRTREMKGQQTGLANMELIRRVRDALGGTIPVISNGNVRTYDDVIDHLQ
                     ETRCEGHMCAEPLLWDPKLFSNPSQPVMPGRTHGADKATRLSALHTALVYMQWVRHYP
                     VDIGFVKAHLFKMCFHSYELHKSFREELGQLKTSAAKTKVEKGSGMDVMDAMRLGAAP
                     RAGESTVPSGAVHGEGDDEEGAAVAMAAAAASVSASAFKQCVDAIEAHLLALVEAERR
                     CSVDGEQPKSAQAEKVKAKQEIVDVWEEGGDLGIDF"
     gap             957971..958099
                     /estimated_length=129
     gap             959831..959929
                     /estimated_length=99
     gap             961156..961254
                     /estimated_length=99
     gene            complement(<961874..>963310)
                     /locus_tag="LDBPK_311980"
                     /db_xref="GeneID:13389461"
     mRNA            complement(<961874..>963310)
                     /locus_tag="LDBPK_311980"
                     /product="transcription like protein nupm1, putative"
                     /transcript_id="XM_003863239.1"
                     /db_xref="GeneID:13389461"
     CDS             complement(961874..963310)
                     /locus_tag="LDBPK_311980"
                     /codon_start=1
                     /product="transcription like protein nupm1, putative"
                     /protein_id="XP_003863287.1"
                     /db_xref="GeneID:13389461"
                     /db_xref="UniProtKB/TrEMBL:E9BMX0"
                     /translation="MHLSATAAALLCVASAAALGFGIIFALFALMYFGCLRIPNGGVA
                     NGNRRWRRERNSPEQLGSSSSGEAAAVERQWKGIPLNSRPPRLTPEQEILREKAMEKY
                     KRRRARQERRSQRQAAREARMANVREGAREGAVSEDEFAGDSSDTSRTTLTSGATTVR
                     TTSTVAYGRSSYLRPPSGDFTVHVGEHDDNDDRCSSRSGGSRSSRGSARSRASQGTVA
                     TIKSYLRHRQRQRLRRREEQQQLELFNQWAYAQMVSSSELSSSSKSVSTSSQHDGEGS
                     ATGGGARRRTRTACGSRSRNHVHPGRSASVASSAPRPLEDVLGTDCESYPFLMNVERS
                     NLEGFRVDTQRASPHPTALSANTSGCDAASPGLFTYSNDTTDATSPHVASAEHVEYAV
                     RGGSGVHTGEHVDHRQPRCHKRTWKDVEHNVALSGFFNTPTNNNMASVDTASRSHYND
                     GEAPAPSLSAPGEPLDSSLGVHEPICHE"
     gene            complement(<964948..>966666)
                     /locus_tag="LDBPK_311990"
                     /db_xref="GeneID:13389462"
     mRNA            complement(<964948..>966666)
                     /locus_tag="LDBPK_311990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863240.1"
                     /db_xref="GeneID:13389462"
     CDS             complement(964948..966666)
                     /locus_tag="LDBPK_311990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863288.1"
                     /db_xref="GeneID:13389462"
                     /db_xref="UniProtKB/TrEMBL:E9BMX1"
                     /translation="MSSLILISSIAGAILAISSIIWCVTHVYSALHAPSRRLYADAES
                     VTLQEESAFGEAPSVQVGAGRGDDGAAYNSGQRPSQNIRDNYADRDAIDYRGEGNNYY
                     YGLDGGVRPASPNAERVEGIPIETRVRPRRNLPRNRIVVHHGDQDVCLDFRGVERVPQ
                     AGPPPLTLEEKQRLEDEQNRIASPEFYGRAEYEGRRTSDRNTPNVRLSSSLLQELQLQ
                     YSMASASRGALNNYATESSVGSMSFRPGSPAGSARHARHGWQSATPNSVSLQSGSIGG
                     LQFFRRRKKSPTRHDAGGSTSPSQGLHQVNSFSSAPRNRREDLESTSDDFEDVSLHNG
                     PAHPRLEQLREFLLKQEQQTLSRLSPTTRLGNVNGFDQISLHGTSPVFLDRQVSTRAS
                     AASVSPVGIGRGWTAAGTMASPYDQSVAPYPLHHPTMAAGLPPLNASFHSYQSWRSTS
                     VNSPVVGLAGATSYPHLDSSSPLSGAHPGAEGAGASARTGVKPLHPVLSPRKAAENAH
                     HQTSLSGAVQGSGSNAGAHAFHVDTFSPSSNRWSSGLRSPFSLPGSDPVTASCSASSG
                     GTRAQA"
     gene            complement(<969642..>970202)
                     /locus_tag="LDBPK_312000"
                     /db_xref="GeneID:13389463"
     mRNA            complement(<969642..>970202)
                     /locus_tag="LDBPK_312000"
                     /product="tryparedoxin-like protein"
                     /transcript_id="XM_003863241.1"
                     /db_xref="GeneID:13389463"
     CDS             complement(969642..970202)
                     /locus_tag="LDBPK_312000"
                     /codon_start=1
                     /product="tryparedoxin-like protein"
                     /protein_id="XP_003863289.1"
                     /db_xref="GeneID:13389463"
                     /db_xref="GOA:E9BMX2"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:E9BMX2"
                     /translation="MEPNFFNNSELMLLCKDGSAVRAIDVLKDAEYVLMYFSARWCPP
                     CRAFTPLLKSFYETHHAKKKFEVVFMSLDRSEEEMMSYFRESHGDYYCLPYADARSMA
                     RVWGDTYNIKIIPTLLVFENANPRKLIARCGREMVTQDPFGKFFPWPDAEPQQPAESF
                     ILDYTRKAAIVLGILVLLYSLSKRSS"
     gene            complement(<974451..>974765)
                     /locus_tag="LDBPK_312010"
                     /db_xref="GeneID:13389464"
     mRNA            complement(<974451..>974765)
                     /locus_tag="LDBPK_312010"
                     /product="tryparedoxin-like protein"
                     /transcript_id="XM_003863242.1"
                     /db_xref="GeneID:13389464"
     CDS             complement(974451..974765)
                     /locus_tag="LDBPK_312010"
                     /codon_start=1
                     /product="tryparedoxin-like protein"
                     /protein_id="XP_003863290.1"
                     /db_xref="GeneID:13389464"
                     /db_xref="UniProtKB/TrEMBL:E9BMX3"
                     /translation="MRLSRTHVCCCSKSSMGRHAFPHGPSCLYVHPSPPLTVFLSLAK
                     LCVVSYLPLAAAHVSSTRIVPRFSSQSRSAPRGLSSGFHVASVRECGNRAAAQTRHCC
                     CR"
     gene            complement(<976074..>976286)
                     /locus_tag="LDBPK_312020"
                     /db_xref="GeneID:13389465"
     mRNA            complement(<976074..>976286)
                     /locus_tag="LDBPK_312020"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863243.1"
                     /db_xref="GeneID:13389465"
     CDS             complement(976074..976286)
                     /locus_tag="LDBPK_312020"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863291.1"
                     /db_xref="GeneID:13389465"
                     /db_xref="UniProtKB/TrEMBL:E9BMX4"
                     /translation="MELYKRTLDGLMAFTLTQLEGAAVEVKEVKEKRSKEFAAAWKRL
                     EEMQANLHRRAASWDASCGRCLSAYK"
     gene            complement(<984208..>984411)
                     /locus_tag="LDBPK_312030"
                     /db_xref="GeneID:13389466"
     mRNA            complement(<984208..>984411)
                     /locus_tag="LDBPK_312030"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863244.1"
                     /db_xref="GeneID:13389466"
     CDS             complement(984208..984411)
                     /locus_tag="LDBPK_312030"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863292.1"
                     /db_xref="GeneID:13389466"
                     /db_xref="UniProtKB/TrEMBL:E9BMX5"
                     /translation="MPSSHACLRQSAPLLTQPLAGAWLITGELFQNHPPYAPRRIARV
                     SFCSRGKRHRRCTHQHIRPPPRL"
     gene            complement(<989967..>991877)
                     /locus_tag="LDBPK_312040"
                     /db_xref="GeneID:13389467"
     mRNA            complement(<989967..>991877)
                     /locus_tag="LDBPK_312040"
                     /product="GP63-like protein, leishmanolysin-like protein"
                     /transcript_id="XM_003863245.1"
                     /db_xref="GeneID:13389467"
     CDS             complement(989967..991877)
                     /locus_tag="LDBPK_312040"
                     /codon_start=1
                     /product="GP63-like protein, leishmanolysin-like protein"
                     /protein_id="XP_003863293.1"
                     /db_xref="GeneID:13389467"
                     /db_xref="GOA:E9BMX6"
                     /db_xref="InterPro:IPR001577"
                     /db_xref="UniProtKB/TrEMBL:E9BMX6"
                     /translation="MSHVPAVLWRMELWLNALFIYAAFTTVAAPSSCGHSQVVQEQGH
                     LPLTYAALRNNGNGLRYQVEMGLERWNGSATAEQHAVEPQATVTISSGREDSEWAPIR
                     IAVFMPDLEDESKYCTAVGQMRPDSSGSLVPCTSNADLLTDAKKAVLINSILPQAVNM
                     HAQRLKVRRLAASTSIVVNSMPGSYCGSFTVPTAHRTTGVPNADFVVYVAAGPTSTPK
                     SFIAWAVTCQYYPNTATITSRPAVGAMYFNPRYLPTSVGETQEHIDRYGGNPSGSTNR
                     LRRVAAHELLHALGFTSSVFKARGMFATVPSLRGKRNVPVLNSSSVRAAAKAKYGISD
                     AEVFYGAELEDQGAPGTSLSHWKRRAAKDELMAPVLSLARYSSLSLAALEDMGFYKVD
                     FSKAEPVALGATAGGKLFTEPCLTEGTSNTPTVFCDSLSPSVRSCTADRLSIGRCALT
                     TYSSSLPSYAQYFPNQPTLGGSLSHSDYCPVIQPLSNTGCSGGSLGAMPGSITGDNAR
                     CFDADNLLVKFTFTQPGAICAKVHCKSASRTYEVLVIGANSWLSCGAGGTGVTVQPAV
                     SSPNVFVEGGLIACPPYDDVCYANPVAFAEVEAAPTTSTTASPSAATAATHGMVVSGL
                     VAVAVLLGSGIC"
     gene            complement(<994243..>996390)
                     /locus_tag="LDBPK_312050"
                     /db_xref="GeneID:13389468"
     mRNA            complement(<994243..>996390)
                     /locus_tag="LDBPK_312050"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863246.1"
                     /db_xref="GeneID:13389468"
     CDS             complement(994243..996390)
                     /locus_tag="LDBPK_312050"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863294.1"
                     /db_xref="GeneID:13389468"
                     /db_xref="UniProtKB/TrEMBL:E9BMX7"
                     /translation="MGFIRAFFCFFFTLIRHLSCLSSSWATASESACTGLVPRSTLRR
                     HRDASLRPRQVAPPPRRKVSGTDTSEPQRSELENEEKSAVVLLSRSEAVASLPRLFVL
                     FCFLSCSMECINQENASARSATNVARGVDEPTVATVPFSPLQVELQRSDPLSRSLCEP
                     VQRSQSSASNAAEANDTDVPPLLGGDPAAARSSSIISSHDASFYSSLMVSRAENLDAL
                     ESCTSRTGCNLISPSTGAAAERYAHEQSPSAEPRLSTPGPRLAPNSADSHGGKEEVAP
                     NAEAEIASEQPVSSGAAVRTVESGVAATGPHSVGAEDHSSGSQAHAHKCLASPVGNVK
                     TLEELLDWRSHLSAWKQSVGAHESHNTDGNDNTVKHMCNDQASEGNMVGRVNRKGAPA
                     SEGSQVSSRSECLQGCHGGCHRTPAASSSSPSTDAITPAESNAAGGDTIAVTHNPQSQ
                     HSHPSSGAASQTEVVDTFFTKESSSASSSHPRSPAQVDGHPWSTQLNAHLEQHLSTGE
                     NLATQAPPTAHVTIIDGRVLREGGGTGKSGRPRGAGPPTLSSSRCLEVTGLEDHHPPS
                     STGHSSPYSHPALTHGVERRPWVRSALPPSAHTPILLHSSPVGGFDGCRSRDNWNNPH
                     SGSNKSTISSAGIQRQHSREESLSQATPRTPESWRHKVKAMPPMVKPLRELAMEEEYP
                     VFAVPVDEETNKAVVAFVSGFVLLICLVFICAM"
     gap             999348..999446
                     /estimated_length=99
     gene            complement(<1000059..>1001474)
                     /locus_tag="LDBPK_312060"
                     /db_xref="GeneID:13389469"
     mRNA            complement(<1000059..>1001474)
                     /locus_tag="LDBPK_312060"
                     /product="succinyl-diaminopimelate desuccinylase-like
                     protein"
                     /transcript_id="XM_003863247.1"
                     /db_xref="GeneID:13389469"
     CDS             complement(1000059..1001474)
                     /locus_tag="LDBPK_312060"
                     /codon_start=1
                     /product="succinyl-diaminopimelate desuccinylase-like
                     protein"
                     /protein_id="XP_003863295.1"
                     /db_xref="GeneID:13389469"
                     /db_xref="GOA:E9BMX8"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:E9BMX8"
                     /translation="MSAVWAQVRQTVESEWDKTIVPAISAYIEVPNQSPQFDPEWATN
                     GLQEKAFGILIDWMNAQNVQGLTYDFITADGRTPFLLVEIAGTEPTKNTVLMYGHMDK
                     QPPLRPWADGLDPHKAVVRDGKLYGRGGADDGYALFAAVTAISSLQRHGIPHGRVVIT
                     IEAGEESGSPDLGYYMERCKERIGKVDLMVCLDSGSMNYSQVWLTTSLRGVAIGELTV
                     QTLTESMHSGVAGGVVPDTFRITRDLLSRIEDCKTGEVTIPEAHCEIPPYAAKAAEAM
                     KAVPFKEQFAMAAGVATVPGDNVELAIQNFWKPSLTVTGANLPDPQIAGNVIRTHTTV
                     KLSMRLPPLVKAEAALQAMKRILEADPPYGAKVTFKSVGAGNGCAAPELKPWLREVLH
                     EGSTEAFGNTYACQGMGGAIPFIGMLIDMYPEAQFVVTGLLGPQSNAHGPNEFLHIPY
                     AKGLTYSIARVVAAHLHNTPK"
     gap             1002276..1003694
                     /estimated_length=1419
     gene            complement(<1004556..>1006058)
                     /locus_tag="LDBPK_312080"
                     /db_xref="GeneID:13389470"
     mRNA            complement(<1004556..>1006058)
                     /locus_tag="LDBPK_312080"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863248.1"
                     /db_xref="GeneID:13389470"
     CDS             complement(1004556..1006058)
                     /locus_tag="LDBPK_312080"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863296.1"
                     /db_xref="GeneID:13389470"
                     /db_xref="UniProtKB/TrEMBL:E9BMX9"
                     /translation="MPLYAPLGIRFSDDVNARARLERQRIARLNSILRHGSDEQRRQG
                     LKMKPLPLPEDPEALAVPGTAVLDLPGGADESLDSRNETGVFDPLDAVAQRYGGAPYN
                     DDDRRAAARGVDYSVFMEVLCPNGSSLLESLPLEPRTLRPHFKGSSSESKKSQFESAL
                     SSPRCGLHTRLPSTAVAAAMPEASLSLGHNAFVARGPPSASFVNTSTVSEASVQSGLD
                     EAYVDAPINLGSEAASLSAPSAENGFATPTHGVADPASDAARATAATHADDDDTAPDI
                     FVSAGSFSLAPSHRSSRWHSLLSFRRSPSGSSKASHTDSGHRNARSVANLSLTRSLSQ
                     RALKSSSELSLPASGATSAQLTPLAAADGCDLGGRVIFTDRFVKAQSHTALPTMISAF
                     KQYMRSASSATACSSLTHSQTLDIYTPYEHWSSLQHQQLQNAHQHLGPCHRGIPLKSD
                     NTNKEIENCVLEAGKCVRPTFRRMDPADLYGTSHYISGAFIKVAKPSTSI"
     gene            complement(<1008631..>1010193)
                     /locus_tag="LDBPK_312090"
                     /db_xref="GeneID:13389471"
     mRNA            complement(<1008631..>1010193)
                     /locus_tag="LDBPK_312090"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863249.1"
                     /db_xref="GeneID:13389471"
     CDS             complement(1008631..1010193)
                     /locus_tag="LDBPK_312090"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863297.1"
                     /db_xref="GeneID:13389471"
                     /db_xref="GOA:E9BMY0"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BMY0"
                     /translation="MATLADGASSEALTAHSDTHPLTGDQVDKIKALIRLMKERYDPL
                     PPQLETYLRLIPPTSGAASGEADGDDEAGPRRPDHGPMWFYCTSFLMSREWDVQKAFA
                     MMQEVVAYRAANRLDEQSHFPPAFSVRGWSTEDVCRALEHSPRKAGERIDRVCAGVAQ
                     GLTCGIHYWDKNGRPVFYMIIDSFDEAELMRQLKQMASVGKSHVDVMWEYMVHILSVT
                     ESLVLYQLIQRGAPLSGRALTSNTADEAAPAWDFSEGAVTMVYDMKGLTLKMLWRPII
                     DMFCDNAKMFFKYYPDRIHRIVCVNSPSLVRYAFILVRGVLPATFQKKISFVSAHDTL
                     ATLETMIDRKYIPHFLGGECRCKAHDGKCLSGYDPQHPRRTRRTRRTDAHTDASAEGN
                     DEVPTEYVTLAAGHECTRVFPVNASEVVVWEFAVEGGGHDIIFTTFFVPQLAASGMRW
                     TQVELNKLSSYTVTSEALAKGSDAFAAAEDGVVVLKWRNRRHWFASRHLQFRAYKEGA
                     PSTLHGQDSRSE"
     gene            complement(<1014113..>1015588)
                     /locus_tag="LDBPK_312100"
                     /db_xref="GeneID:13389472"
     mRNA            complement(<1014113..>1015588)
                     /locus_tag="LDBPK_312100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863250.1"
                     /db_xref="GeneID:13389472"
     CDS             complement(1014113..1015588)
                     /locus_tag="LDBPK_312100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863298.1"
                     /db_xref="GeneID:13389472"
                     /db_xref="GOA:E9BMY1"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BMY1"
                     /translation="MVAKESTAKGGSRYPPLTADQEKEVTELIELMRKRYDPLPRQLL
                     ALQRYNSPMEGTASDGAAVGTFFSPIRNYCYYFLISREWDRQKSFEMMQLSVSYREKN
                     ELDSRAELPSAICCRGWDQEKVLIALDKPTRPTNQRLDRLSAGIEQYFTFGLHYWDKH
                     GQPVVYLNLGSVDEPGLLKKLKQLANIGQTPNLVMWELVQHLIGVQEQLLFYQQMQYA
                     AGALKAEADDGLIRSATIVIDLNGLTYKMLWKPALDLFMNTLQTLFQYYPKCVHQILL
                     VNSPPMVMFAYKIVRGALPHGVQRKVCIVNVADTPATMQNFIDAQYVPDYLGGLCHCE
                     GGCVRGYDPHQKGTMKESGTAKSDTSNVQSGGQDDEAGVVTEDITLKAGQELKRAFSL
                     KKAESVLWEFVSANGHDVAFTTYFVPKKAAQSMDTSKLPTSMLEPYVVSKASPSEGSD
                     KYTASDDGLFVIVWDNKKSWFTAKHLQLNVFKQTATFTNGT"
     gene            complement(<1017024..>1018091)
                     /locus_tag="LDBPK_312110"
                     /db_xref="GeneID:13389473"
     mRNA            complement(<1017024..>1018091)
                     /locus_tag="LDBPK_312110"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863251.1"
                     /db_xref="GeneID:13389473"
     CDS             complement(1017024..1018091)
                     /locus_tag="LDBPK_312110"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863299.1"
                     /db_xref="GeneID:13389473"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BMY2"
                     /translation="MSAAASAPRHRRYVDMTPEREQKITQLVQLMKETYDPLPKQLQI
                     LLYYSPTSEDAPTPHNTTRSYCYCALISRQWDVQKAFEAMKKNVAYRLQCRLDERSEL
                     PSAVSIRGWDEMEVVRALGKEERASNQRADEIIAKLERYFPCGLHYWDRYGQPVFYLM
                     LGSVDEENLLKELKQTTDVGESMDAVMWEMLQHLLGSGEWLAYYQQMQYDAGQLKVDA
                     SEGLIRATTIVVDLLGFTYKMIWKPAIDLFVTCLKTLFAHYPECVHHILVVNAPSMVT
                     FAYGIIRHVLPGTVQAKVRMAKPSESLALLQEHIEEQYVPDFYGGACHCQGGCVRSYR
                     PKNAASGTTTFDQDDTQSAAE"
     gene            complement(<1018868..>1019344)
                     /locus_tag="LDBPK_312120"
                     /db_xref="GeneID:13389474"
     mRNA            complement(<1018868..>1019344)
                     /locus_tag="LDBPK_312120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863252.1"
                     /db_xref="GeneID:13389474"
     CDS             complement(1018868..1019344)
                     /locus_tag="LDBPK_312120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863300.1"
                     /db_xref="GeneID:13389474"
                     /db_xref="UniProtKB/TrEMBL:E9BMY3"
                     /translation="MTQLSKGTASPSSPYARPSGASGELSAPPMSASAGSVLCTSIFV
                     SLLLSSVCYAYLPNTVMFLGEVDTIDSMLPLIELDCESDQADALRRVLLLRRRLPQRS
                     LLLSLLPFWVPLLLLSSVGVCSSPLRCACACVHALLSSSLSTALSCSPVKAPTQPL"
     gap             1021537..1021635
                     /estimated_length=99
     gap             1022709..1022807
                     /estimated_length=99
     gene            complement(<1022808..>1024256)
                     /locus_tag="LDBPK_312130"
                     /db_xref="GeneID:13389475"
     mRNA            complement(<1022808..>1024256)
                     /locus_tag="LDBPK_312130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863253.1"
                     /db_xref="GeneID:13389475"
     CDS             complement(<1022808..1024256)
                     /locus_tag="LDBPK_312130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863301.1"
                     /db_xref="GeneID:13389475"
                     /db_xref="UniProtKB/TrEMBL:E9BMY4"
                     /translation="MSSVVDIPCTRKNNSFFSKGNHQHEAPAPPINESMVRERLSANL
                     PDSFNYLRNTLNTGRGRQRRSHRPHSRSSSNTSNSDRNATPPVRAGRNGPGNERRSRP
                     PHTHTRASSSSSSSSRSSSSTSSNGDDSYAFHARLVKVGYSAHGGESAALSQCCDTVR
                     NTLQLLERAQLRTGDGDGGDGFFWLDLHGVPPPAELHDAGSGDVPMSALWAALGLQAS
                     TAHTLTAVCEQRQAHPRPARSSLDNVYEEELVGLSSPADRVLQVEPVQATSVKRTSRG
                     GVAEPTHYVALELATLLTSVQASAAMSEAAWESALLSRASSAAEFANEPLNDLTWTES
                     FARSIRGLPAAAAAAAAAMSRHASSVSSASLRQVTQASLHGQEMAATPLITSIYVVCF
                     PTGCVTWCPASTLGLTSADRRAQRSAPAAEGQRRRRRSPHDPHEDAAAERSRDDVLYV
                     DGDNCEEVQYVKSWEQLQASVFSRLRYMTQLSK"
     gene            complement(<1026749..>1027900)
                     /locus_tag="LDBPK_312140"
                     /db_xref="GeneID:13389476"
     mRNA            complement(<1026749..>1027900)
                     /locus_tag="LDBPK_312140"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863254.1"
                     /db_xref="GeneID:13389476"
     CDS             complement(1026749..1027900)
                     /locus_tag="LDBPK_312140"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863302.1"
                     /db_xref="GeneID:13389476"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BMY5"
                     /translation="MPAAGDGVCGCRIHRQNRQRSSPIQHARRSSSASLPEMAVRLAD
                     DFRPRSTKSQLIRRGGGRYNEPYAAIVERDDAVSVLCVQLTRQQVLVRHMPEEEWNRI
                     VREGEKVHPGVEGKTSLHIVAPPEMSTLPAGAAEAADEPHSPEQQASPSTAAAEPPVF
                     DYFVAPENRIEKLTSTSKASFFSQLRLRAHYSRKELERMAREDRRAMLSVERRNIFLR
                     QYQRDMQHRMAGTPLYTVGRELPEEFIQLFFMSQDHHGTMTRRPERSDAVRTPQAQRS
                     LQRSAGGRHLFTIDRSFTCFGERLPFAGQAPVDGFVVVTVAPTADAFTSAWGLWDEVH
                     RLSSDTEEKPFVPCDYGSADYLPRAGPDDPRDPGECSEEGEAGTTASAA"
     gene            complement(<1030951..>1032126)
                     /locus_tag="LDBPK_312150"
                     /db_xref="GeneID:13389635"
     mRNA            complement(<1030951..>1032126)
                     /locus_tag="LDBPK_312150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863255.1"
                     /db_xref="GeneID:13389635"
     CDS             complement(1030951..1032126)
                     /locus_tag="LDBPK_312150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863303.1"
                     /db_xref="GeneID:13389635"
                     /db_xref="UniProtKB/TrEMBL:E9BMY6"
                     /translation="MSRSPKQHRRQQTVHVQQLSPTELCEATPILTRARSVSPSQTSG
                     ILQQLHVGNSEDAVGIGLPFFQAQPMPDVSPLATPHAFTHNSHYSRTASLASSTEDSV
                     AAASACYLHNRGARPSVHCVPTNQRDFQLGMVPPPSASFPHVPLVGNESHASFLASIV
                     TDPTSRRSSCSSSSSLAVQRRAHNDASPVSLGNPSVIRHLTKRRERRMSKAAKSGRSS
                     RSSSIASCTKEITPRSPIEDQIRVSQLPLYKSFFSSATVSPIFSAARRKSSRGREAQP
                     GTGVAVDVLPNDDSFSYILHREEEETAVRTKSGVKMVRRTTQEVRLPISADSHRRSDS
                     PRDRGDASRSNSRRPSGPAPFDETPSAVPSLFSEPSINDMFSGILLLGDERRGKADQ"
     gene            complement(<1040031..>1040192)
                     /locus_tag="LDBPK_312160"
                     /db_xref="GeneID:13389636"
     mRNA            complement(<1040031..>1040192)
                     /locus_tag="LDBPK_312160"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863256.1"
                     /db_xref="GeneID:13389636"
     CDS             complement(1040031..1040192)
                     /locus_tag="LDBPK_312160"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863304.1"
                     /db_xref="GeneID:13389636"
                     /db_xref="UniProtKB/TrEMBL:E9BMY7"
                     /translation="MCKPAPFSSPFPLSPPSDAGSLFVSPFVDRCTLKRLRCCDSPLL
                     FFFVVFFFA"
     gene            complement(<1043987..>1045066)
                     /locus_tag="LDBPK_312170"
                     /db_xref="GeneID:13389637"
     mRNA            complement(<1043987..>1045066)
                     /locus_tag="LDBPK_312170"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863257.1"
                     /db_xref="GeneID:13389637"
     CDS             complement(1043987..1045066)
                     /locus_tag="LDBPK_312170"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863305.1"
                     /db_xref="GeneID:13389637"
                     /db_xref="UniProtKB/TrEMBL:E9BMY8"
                     /translation="MFRPAEDHMQRMAGYHMQRGAVHDMGMILRMEEEQMLMRQMQEM
                     EMMQMQAMGGMPPCGDGQWASPQQQQQSVGSLPGSTGPVSLPDTIPSSTVQPPAARAG
                     NASTSPQWAVNPTIKGDANSQSPSTTAASRGLGLDGVPSPLGTSSTHAPKGLYSTTPS
                     MNDANGPAAAHDTMYNVSSVYGGNPSAYAPAFTGGGLNENGSSAVGYSMYDANNASSM
                     YQQPSPSSGATNASDAKAAPAAGAPAPGNASKAVTPALQRKSSATSLEKKSSTASMNP
                     SDSASASTTHRSREIRQKNSELKRQNSSGIINGGSSSRPASAEKRSSSRHKNKCPSSP
                     SSSKDKNTRQAFASSSARGKGKKHH"
     gap             1045477..1045633
                     /estimated_length=157
     gene            complement(<1046784..>1049075)
                     /locus_tag="LDBPK_312180"
                     /db_xref="GeneID:13389638"
     mRNA            complement(<1046784..>1049075)
                     /locus_tag="LDBPK_312180"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863258.1"
                     /db_xref="GeneID:13389638"
     CDS             complement(1046784..1049075)
                     /locus_tag="LDBPK_312180"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863306.1"
                     /db_xref="GeneID:13389638"
                     /db_xref="UniProtKB/TrEMBL:E9BMY9"
                     /translation="MDTAPTTLFVVLHNKQRYAIPVNAAGIQVGPPVLYPNPNRRKRG
                     GYGPGTVDGSSLSRPPLSSVSESTDSRLSSTSESTTLHRSSRSRSDCSVCFTDAPAED
                     VNDGDLVQLSTAAALWLQLPQPSILRKSSGLLHALPPLFDFDYKSPHTPRQSPTELKQ
                     HLPASSVNSQGNEKGAESAKQEHCCTFCPRVSSAAAVAHRHLFSPPAAHRPPSNNSDP
                     ALRFVMHGDIGDAAAVSRMVHQLPMSEATHVQHSLGGGSEATAKAAPSTPKQPPAVMS
                     KSTAASAPRPPQSLLAALEARSMQTVASDGPYGPTHASYRRIIPEYQTDKAEGTASQG
                     NGRDEATPTAPTARKPLKHPPRIKGESTARIPRTQAAVVEDDKASRIASDLTQGSYSI
                     YCMPSLNILTPTSREDNSCDMSLLPMHDAVAGKEPIHREVQLSEMECLMDRYFYGGQP
                     SSAAGDVRPISPLDNYEEGMESSAIWKPQPPHIDDKATPQSQQSTVVPKGTPENVLSL
                     PRDAAYADYEYVNPSTPITVSVFAAPSPLSVEGFSRTSLYGGQHAAARALPSREAHNS
                     IRERGRYAMLTLLRRFASTGHLKPKPAVAAEESTVSADFESNEHGKPMVSEWPSSTEA
                     LTSLTTASSTDTSCSENESLRSTSVSDFEEDDEDAAEMVNSVESQSLSSPEKSPSPPQ
                     SSKGVKNGHQWRWSSIRERLMRPLIPVPSDIKEPRLPSLQKWYRAKIKAKVKEALQSG
                     RASDSSATLDPLYLYDRPKKTIK"
     gene            complement(<1051329..>1054118)
                     /locus_tag="LDBPK_312190"
                     /db_xref="GeneID:13389639"
     mRNA            complement(<1051329..>1054118)
                     /locus_tag="LDBPK_312190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863259.1"
                     /db_xref="GeneID:13389639"
     CDS             complement(1051329..1054118)
                     /locus_tag="LDBPK_312190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863307.1"
                     /db_xref="GeneID:13389639"
                     /db_xref="GOA:E9BMZ0"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ0"
                     /translation="MRDTFRGSSGRGGKGRRGGRGRQGRGGGRGPSSSSRPPAASPNT
                     SGGKREQTQHDVESIVIPNAFDASFAHVSRCREKGRLFRLPLPAAAAAQRDFVVVERT
                     ISGIDEVVYSRHRDVWERLPRGNARVYVKSDWPNGTPTYSLVGAIDGLRKFGCKDSTY
                     GYPDAVQTVIAMEEENGECGHLSAFVVPPAKRGEKLTASQASCDAADEEDTSRRYWVI
                     GSKDVHIVLDYAVSEDCLHYYSSLGCHFSQVVKISRLWKAMLAGGGASSRCGGGGVGG
                     CAPSSANADARAVASRTLTPAQARAFHETLYKKMWTSCFVAIFSDSQHLMVDSGANEL
                     RFYAVTLSKHAFEAACTGRTDLSSNKAPELDDGGCHEETADAQNEAQQHSRQDGLCVP
                     VAEAEALCAGVGLAFSRYSAPAMYGSPEYVQRVRTINRRIDLEGCVMYGADASGKVVR
                     LWKEKSYPYAMERATREAVTNHKLNGNGLQAWLKKKLDQQQPELRDHLKEWEVNRMPW
                     LLHFAAWLQMTRRLTPNMQRNELLQLRKEWLSLQKEFQTAMDSDPKLRDACGQYRPDP
                     VQWGSGTHDLDVIKFVGPQGCGKSTLSRALYVLLQASRYQPRWVNQDEAGKRDKFLAL
                     LRQATQAESTVTHLIIDKMNLDAKMNHDYDNLPLSLTVTWFHPDGEKALYDVCIARVL
                     GRGNGHRSIRVDPNLTQQERDEKMTRTRSFVRKAVRDCETPRDPPELVLELDVTSPLS
                     DMVRMIWEKLQANGTHTLPPVTDEDVNEAISLAHQYESHLHNLPRAPTYACIGIEKQQ
                     DVEKLLALVPPEFTAGQVVQREFHVTTKYFGGEMDPVAFVTLAKLLGQSVTLTLESVV
                     ADADGVAITVRRDDAHYPCANPIPHITISNRKGVPPKYSNDLISPTTYPGDPAKRKVL
                     QLPANCTVMGIFEFR"
     gap             1054727..1054825
                     /estimated_length=99
     gap             1055637..1055735
                     /estimated_length=99
     gene            complement(<1057447..>1060596)
                     /locus_tag="LDBPK_312200"
                     /db_xref="GeneID:13389640"
     mRNA            complement(<1057447..>1060596)
                     /locus_tag="LDBPK_312200"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863260.1"
                     /db_xref="GeneID:13389640"
     CDS             complement(1057447..1060596)
                     /locus_tag="LDBPK_312200"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863308.1"
                     /db_xref="GeneID:13389640"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ1"
                     /translation="MERQSSMISAPFKAHRRRSAITIIVPGEETNPFQKDSVKTSHLK
                     DRSTFESFKAKPRCPTPDSNGAAHDGEHVHGLPTGAGARMPHLNGSNATGTKNGVLHH
                     SKPRNTAQTPVPQGDGTPALLPQVPPSPRQQRQPQSQALRGAVSNRLADMHLFPLVPS
                     STATSIRRAGARHEVNPVVAASDLSHAPLLGATTTADDATRRLGAPVSDISDSRRPLA
                     ASNIAFSSARVLSSSDEVPPRTSRRIRSSSRLPLHPATAHGATAGVSGNSKSNSGAAP
                     TSARPLLVSAGSTAPNMVTTIGVNGTRSCLSSPQLPSAPPLQPGTMFNAAAQRQSFPS
                     SYASMPSDATDSSRGDYQGVSYSSPSRRSTMPQPRVSHGINLTRFPRPPVRRRQQESL
                     AASSRNEMREAESKFESDGLFSPFSTRSISERGCSDDCGSSSGNTEYSNSSSVVGDLS
                     VVISDSDLASAVSLASAFAARAPLRQRSESPVADLSNLLAPGVAAQSAAVPQKGSPVA
                     SPPTSPLSDVRAANGSRSSNSKEAAEHHADSTSSVDVADLPSTTDFPVLMEPPRFLAA
                     ASERQGQPTTVSRRPLSANSGSKSVDGVREEPSDASISNFGLLPNDDSTAPNVVISSS
                     PTTKAAPASPMSPKLTHVQERTRRARGRTVPLPSPVDLNSLVLWKESERSVSSPLASS
                     SEHRANSALRSGSTKGGSSGGGRAHDGEGGKGSAAAHLEADSNLQETVAKPNTRASSC
                     GHTSLFQTHKQNEDDAVDATGDSTLELSAWRTGSRGPASGPPAQVAQAASAVAYLTAA
                     EKERWSVTQSLSIDADLFSFSQLPPEKRGSMVAKLRNMFESSAEKHPRSSSSQAGSLI
                     ATPSPKDQGSPLRHVSSVNGSNNGNSSSAPKSSSKRKTEDVSRKVPPSLWKEVRGSSQ
                     RPTSPQCRKSPTAAPPVANCSSPLLFPRSPTVATSEKGTLPPSTSTVKSGRVSGTYPQ
                     SSHTDSDCTAAGNSATPPPRTRHAKMDLQHEASSVKNSLGMFSYISPQASDPGFSLAC
                     FKASNVSADTVNMFDRGDF"
     gene            complement(<1062787..>1063641)
                     /locus_tag="LDBPK_312210"
                     /db_xref="GeneID:13389641"
     mRNA            complement(<1062787..>1063641)
                     /locus_tag="LDBPK_312210"
                     /product="prostaglandin f2-alpha synthase/D-arabinose
                     dehydrogenase"
                     /transcript_id="XM_003863261.1"
                     /db_xref="GeneID:13389641"
     CDS             complement(1062787..1063641)
                     /locus_tag="LDBPK_312210"
                     /codon_start=1
                     /product="prostaglandin f2-alpha synthase/D-arabinose
                     dehydrogenase"
                     /protein_id="XP_003863309.1"
                     /db_xref="GeneID:13389641"
                     /db_xref="GOA:E9BMZ2"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ2"
                     /translation="MAGVGKAMVTLSNGVQMPQLGLGVWQSPAGEVTANAVKWALCAG
                     YRHIDTAAIYKNEESVGAGLRASGVPREDVFITTKLWNTEQGYESTLAAFEESRQKLG
                     VDYIDLYLIHWPRGKDIVSKEGKKYLDSWRAFEQLYKDKKVRAIGVSNFHIHHLEDVL
                     AMCTVTPMVNQVELHPLNNQAELRAFCDAKQIKVEAWSPLGQGKLLSNPILAAIGAKY
                     NKTAAQVILRWNIQKNLITIPKSVHKERIEENADVFNFELGAEDVMSIDALNTNSRYG
                     PDPDEAQF"
     gene            complement(<1068329..>1070806)
                     /locus_tag="LDBPK_312220"
                     /db_xref="GeneID:13389642"
     mRNA            complement(<1068329..>1070806)
                     /locus_tag="LDBPK_312220"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863262.1"
                     /db_xref="GeneID:13389642"
     CDS             complement(1068329..1070806)
                     /locus_tag="LDBPK_312220"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863310.1"
                     /db_xref="GeneID:13389642"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ3"
                     /translation="MYANLKHSKEESASPYFGATSVPLHSRDEVPSKRSKNSKPRSPK
                     LKRSSSKSGRLAVEAKAATKAKAACGKARQRPNQNSGKLDARKKSSSSPSRPESGKVA
                     AVLRRPRPQEAPVNKDGDAPSSAGQLFESIGASPSVVALRSQTSDGEYFLPDWSVSSE
                     APPAIRRTGFPLNRPSSELRRNSLNANSSSNAVPRTTDRTLREYMDMSSSCAPQSQKP
                     LLWGASPKAAPKHTKGSSASPTTVRCYSQYHMASSTSSLLPFGAPYQVQQQRKVARTA
                     PSDLSPENFYPPLLMGPPSDRHQRTVDSCDASRQLRSRFNVANGDVVATSGKRGDFSK
                     LCSGSIAGFHDSHTDDISPLAAQRSSRAVDAGSLRTLSSAFFSTTSRSLPQSLFRVPM
                     SMSPSATLRSTTNGFDRGSAVWKSMYGTDKNGDDEESPLASGGHRTGAAGRRGIGGRY
                     QSSFHSATGLLPLSESDPNGGGTGADERPAWHHGKVSSLYGCMLDGAAVVSSSPSDDG
                     GGADEDHDYWTSSGTHPGQRCTLERKRTMNVLAWMKKTGKSRPCGKTGGTRGGSDSDD
                     EDNADAERRQSLSPTSTPKREGCGTTAHRSEADSHRDEVVVQNDAGSDEDADAERDSE
                     GNLASLSQQTALQRILSGMWKPSDPKEVDEAAAVQEERPTQRIEPSLPYRSGAGRGSS
                     NAHQKVSPAVADCRRPVSVHYHGSPRASMTPPAGYRGWCAGHGAQAAAYLHNRGIYQP
                     LSLSPSPQNANGWRAQLVEFTLPSTHIGCCAYTSPTPHTVPVACRSLPLMFRQTVTNM
                     AVHELLGLDPEAEIIFVESPVWKHLPR"
     gene            complement(<1074265..>1078038)
                     /locus_tag="LDBPK_312230"
                     /db_xref="GeneID:13389643"
     mRNA            complement(<1074265..>1078038)
                     /locus_tag="LDBPK_312230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863263.1"
                     /db_xref="GeneID:13389643"
     CDS             complement(1074265..1078038)
                     /locus_tag="LDBPK_312230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863311.1"
                     /db_xref="GeneID:13389643"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ4"
                     /translation="MQRISSLDELLQHVESLSHHSRCAILVEFGRCSITATAREPRDL
                     QNVITTLGAPSQGHYQHFLAACALCGAFAETQRIGRAMPAALLETASSLLEDASLKVS
                     QLLMTCMLISTTSDDPQKAAMAINFLQGARLPQFKCLVTRLAQAQQTQVLLRLYQTHT
                     VTDPAKMQLLLGSLSPEAFEQLPKEEQATLGIVALRLLCRHHPQWVAQYLTARVYEQV
                     SLNTVVDAALKELVQKACVFLATRGALKDSLSLFTATAHLLGLDQPTLQTVLERYYVS
                     TFPVEIGHYLLEGEGRHMLATFSEPLNCLISRRAWRRLGGHTDLILRLLDKSILSNEP
                     VDLLNMLPEARRAYFARGCRELQDTRGIPHINWIFCMPSAAERTAFAHRFYNHAKLQD
                     LPNERIEYLSFLPFPEAIQIGAAYVTSSDATIRSQLIRACVGSLRYYPEHLPAALAFC
                     AQRPKEQDGWRREMFKAWAALPHGFWRRTATHISDNTLQDTLTQLIQAAYSAKDMSDR
                     TLRALERLLFRLVGPQTNFAVSQLATLIRKRKQFTACNGDWDDFLQLAQLYPRAVPVL
                     VASLLPLAQMLLDSDNMWATIRILESLLDNKTVVKVLRREAPAPSNGEPEIWTMVHDV
                     LQAGMSSTDSGVAAVSLRLYARHFAQQLAVELPDLIAQRKDWITVSRVQRLVCDVLQG
                     PLLDMLVIPIENIPTGRFYHANSKSLAFVCELPVENAHRWTDRQQIRYAQSCLQAIYT
                     PLALEAFQCSRLIKNLARLPSVSSTTSWTDADGNARSLLTLATDAHPEHGEYAMRFAL
                     QALGQLDGDAAAVQALQNALDVADQRMDALRALATALRRAPSAEAVRVLEPVLTGKQV
                     TAQKEALHLLGAKCDNVAYARIVQFAAERHLPMPAEEDGDCGGVAALSATAATAPGST
                     EEAVLTMHRDVRAALVTALFHFLDKPQVWSYYAFIVTHDQVAEQCAVAAAESAINARE
                     ESDGDTDDASTADSYEKQVTTPSSAACVAMSTLPWALLRLPWQVREYQVLLRRLLRHP
                     VRDVRVSALHKLATVPPYDDLELCKAIAEYLDECTSPEIVQSVLRCMLRCTAEEAAPF
                     LISVIFTVQPDASLESVASVLCGIMRCAAAHEHKLLRTVATEVAEQLIAARRQPTIAV
                     SLIFELDISEWVSRLTTMEAAGLMHPGAAAAVIRAVQGDSSAIRDMDAAERLEQAVLR
                     KHPSALMRRLGLAILLEACEKRGWSEDRKLSLRLYCKDTDLWVSSDARMVRQE"
     gap             1082148..1082178
                     /estimated_length=31
     gene            complement(<1083060..>1085771)
                     /locus_tag="LDBPK_312240"
                     /db_xref="GeneID:13389644"
     mRNA            complement(<1083060..>1085771)
                     /locus_tag="LDBPK_312240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863264.1"
                     /db_xref="GeneID:13389644"
     CDS             complement(1083060..1085771)
                     /locus_tag="LDBPK_312240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863312.1"
                     /db_xref="GeneID:13389644"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ5"
                     /translation="MPTADKPKPCKRFGTFGDPDRVLTQVEREFYANMARIRKKRTQK
                     KEKPPAEGAHRKGKEKRGNESEMSREKSTDKLFALRKRSLTPADAASRSALPAPSSPP
                     RDNRLAVLSAVCLLDRAAPLVEEPDRRKPRDRAASECVSSCTQHMPEPRRGFGFNDQH
                     APESLCKPGDSILLPSRYQSARSGHESTPRWQRQRRAPKGLLVSAGNSPDHTPDVPLE
                     TGLVEKLQRMKVLSVPQTASQEFPKRGNSNPSSVMSGGGDGENVDLSRVAGLSDDKAG
                     VEGRIGMALGAHHREYFSGGSFRIHGLTDEQMPTLEVLAAIEKLLKVRKESKTTSMRT
                     DRTTKQEPKEEAATQKRRDHGNAHSAPTPKPKATASAGKGSQARASSFPSLIRSALQA
                     AAAAITPARTSPSLSRAEARCAAPSPPLAQPLPALHANDAGRHAQKGSSETRRQASRQ
                     PPACVSGKSRGASSSRSRKGGFPGPFCCINGKASRHGLAEKMGRRAAQGALRKDVYTQ
                     TKSPSGATAVDEACRQYVEQCRREEQELKKLIEWERQRAGTAPGKVSAAIYSAALSGT
                     TTGGDSAVAASSSPARKVAGVSAFSHHRPTSATSLGAPTEERVSPRSSSADRTKRRRS
                     PACRNGRPTPLSCTDLGHLNTNKSTRQRSGSRPPAHAYPFLAGMADDACDASSESTPS
                     AQPKIAFAGAGGGGVSPNKAARMTAVTIPTPMREAGGSRSRPFEAHLQDPDNLASFTA
                     ALFYEPSSAEESHMSSRAISVVDISSTANHCGTSEPVSVTEETVQEMVKAYSTADSPQ
                     MNTLHENAGARSDPTRQRANSVGVATEPSSSPSAGQRESRQGVLSGAPVHTASFDGSG
                     IGVSIDDAYETGSDLYVFPFLLECRGGTSPQQQNVHVKTPLCPQRPR"
     gene            complement(<1090491..>1092797)
                     /locus_tag="LDBPK_312250"
                     /db_xref="GeneID:13389645"
     mRNA            complement(<1090491..>1092797)
                     /locus_tag="LDBPK_312250"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863265.1"
                     /db_xref="GeneID:13389645"
     CDS             complement(1090491..1092797)
                     /locus_tag="LDBPK_312250"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863313.1"
                     /db_xref="GeneID:13389645"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ6"
                     /translation="MGNAVFCRADKEAGTECSTHGQIGQQRLLEKCPRRQKTLKPHLY
                     DEAKAVWSTTPARADGRGGRSPEQQRQQQQNDLSSFTGISPVELSSVSTSISLIPDCG
                     CASATPQLEWLQSSLPPSVSDPNLEPPHEYTVDFDTLSSDARPDRIAAAPHVGGSTES
                     SSRSSYFTLSMSGLEMPPDLGFAAHLERVASPELRAPPSNSPTPVQPPLLAASPAERP
                     HWNDAMLPAAALPVTAVSPTVPVAPSPYSPFARNASTGPKKPTGNWCSSDSESASPRR
                     EAPKMQKEPMNGSPTHPTQSQPHRRPFRQVTPLQAVHEVKSTDAVTSSAAHKGSKGHP
                     QDTLPRRRLTDKGGASALILPPLDGAGALSAKAAAKAAYTGSSSIAGLHGSQPPLVPK
                     DLLCYRENTLTGGGAYRAKTANNRGCAQSSASPRCALVARKMDEASAAATPPSGAPAL
                     PLPPNGDVSSLQGCAEQGSARLPLVKGASASFTAMKPVQANATQQTTQSGTNGGVCDN
                     PASYQPPWHVAPDEDDAITQLKFTAHAAATSSSLMRANWQTATAATTANQSHASTSSV
                     SISKEAHPHSALRDTMKRRSLTLTERGARQDAASTAHLQVSGQGASAPSRLPSANCME
                     VRTTEKAQDSLVSAPVPFSPSLRQVGAGEQCCSRSDDGSESPGEDKERPSGDGECLPR
                     SQSVCDLPPNLGASHRVNSILKKTSSYRSLNGSPVERTLPAVGSVSFLLCEQEASLAM
                     VSRQGVFKAVSHHAKPRQKEDHRLFEGS"
     gene            complement(<1100850..>1102613)
                     /locus_tag="LDBPK_312260"
                     /db_xref="GeneID:13389646"
     mRNA            complement(<1100850..>1102613)
                     /locus_tag="LDBPK_312260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003863266.1"
                     /db_xref="GeneID:13389646"
     CDS             complement(1100850..1102613)
                     /locus_tag="LDBPK_312260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003863314.1"
                     /db_xref="GeneID:13389646"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ7"
                     /translation="MGCGLSLSTPSTANKKQQWDVTVRPNTAHGSSHHAQASRQLDHC
                     KGLLRAATVYSSPNTSCPAFIERSGSAWSPSFSAQGSLFHQDRLSDGPQSSTPLCRGE
                     SPAGMEQVESMQCGALEEHGTVDDFDAIRQQLSMENVSWPYDVSVDAPLHKPVHSTKK
                     EGATLSRPPRMTPGRPPNAVMGAVSARPPRSVGRTNSIVGRVAAKKAAKVSVSVKQPI
                     PSATVRRASLSTNAGNSQVLAPSVQRMPGGRSRRGSPAAPGRSRRPVVDVFAEEAALP
                     RSTDAGQRWRSGTMPIRHSVRTSSTAAHSVECTTGMPLADEYDLSVMMRAAEAPLTLS
                     RSLSAHSTPSPKGKEAMSTPHSSLLGIVSANSSPFTLSRTSAPLGSAPSPTSPSELST
                     TESFERISRQSKQSTDSRRDGFARTPPNGPQSRERALVDSEASGTDFQYLCKSDENAL
                     YSFYAISHNTMGPFLKSEEGTERCSAHEENHRQLYNIPQASCANHDGGSEQAYVNPNK
                     REDTENAGSDGHGDDEYKAPDSLACKTSADSEILVGHAMRVLGASTAARKERRRTVTI
                     VDHAASPSLATKPPASPILIK"
     gap             1106036..1107542
                     /estimated_length=1507
     gene            complement(<1110577..>1112034)
                     /locus_tag="LDBPK_312270"
                     /db_xref="GeneID:13389647"
     mRNA            complement(<1110577..>1112034)
                     /locus_tag="LDBPK_312270"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863267.1"
                     /db_xref="GeneID:13389647"
     CDS             complement(1110577..1112034)
                     /locus_tag="LDBPK_312270"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863315.1"
                     /db_xref="GeneID:13389647"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ8"
                     /translation="MGVTCTREKGVVSSSAVIRFGLTRRCSHVERTERPKSFTRETSC
                     RHRSATRARADVCVGCDNSSEALRAVDTVTVPAPEPIEAPLLPSCAERLSSNRNRCHG
                     STAETTATPSFLVAETPTATRYSMYHIPGGEDDNSYTLVPFKSMYCLPRTTELEPDNF
                     RAMVTHSHAAAAEAPSTEATAYNLKGDDGREKKDAASPKTVSRKAFGTASRTFSRQSL
                     RALRRGFSFGIVSDCADDLVLRHADEMSCMSSVEYGLVRQQESHTDSASCWEVSSIFP
                     RATISTEADESSSTVLTSQSTLSRRHTFGVMMPTGHSQVVEHTEDGGAWEPALVSPSV
                     RLDARRSWQKQKSSMTVTNLTEEVVVQGGAFPLQDRHHHRHHVGRHCHLVGAAAAVPP
                     RASSHARSKVGRQWPQPIMEGPKSNLSRSRPFNVEATLGYSVRSARFVPSPDWERVCV
                     NEEEKLRLAQVLAAHQQRLKKWKRAQAARWNALSL"
     gene            complement(<1116226..>1118748)
                     /locus_tag="LDBPK_312280"
                     /db_xref="GeneID:13389648"
     mRNA            complement(<1116226..>1118748)
                     /locus_tag="LDBPK_312280"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863268.1"
                     /db_xref="GeneID:13389648"
     CDS             complement(1116226..1118748)
                     /locus_tag="LDBPK_312280"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863316.1"
                     /db_xref="GeneID:13389648"
                     /db_xref="UniProtKB/TrEMBL:E9BMZ9"
                     /translation="MLEKLSALWKVTKERICRPDSAPSTSGDGPPPHIPDSSPKPCAR
                     SATTARNQQSNPLCVPSDRSQTRSHRSADGQLAESSGFSPSSVSDRPVSGKATGDASQ
                     GTCLPSISGAPPLSRSPAQQQQSIKALSASPTRSDCHTSFLASPSQWQPTTSPVAPLR
                     EGQQRPPRANAKAPLGPHSATASTPKAADNEGGVGSYPMLRRLTADLAHTLDNCVAYG
                     TLYDNSGPEVHEGCPLPHPSAPPYSLLQCRTLAVPQPSPAPKGAGEPARDTVPRRNTD
                     GNSVNNNAFVHEPEGEKNFHEAMLHLSRLMSGTRDKTTGTMSDGASGTAIRGGRANNS
                     GRIRTLRSSRRASDATSGPANSSSAKNRDSSEASGFSRVDFASLFMTPSYDLRCDEPT
                     GMYNCTFLDQPLGQSAGVFSLAGTTSGFSTPPVSMTSRQTSKRKQNEESGSNARLGRH
                     VEDTAAEASESVAMHLTKMEENMEESMCSQTAGTAMLRRVNGLALSQWKYVALVANKV
                     MEKKTLVRASRALSQRVLSVSGALELNVLPHDRLREASAGGAKRNDSLIFDATTESRY
                     VFDTDDDEVSVYDADGRPLLIPNMSDLWDDFRSSNSSDESLVFGEADAFTVDDGAARV
                     GKEGESELCATRPPSPTETRSGPDTSYGQQAPPSRDAPPPPAAPAQQRTRRQAPQNGS
                     ANDSWGGRGYEYSNGDTNLYPAYQPHPDPRVQEQMKRHRIMQQQRQQLFQQQQQRHHF
                     HSLTAGYQKHTQPQLPAYARHRQGRSGSARGCPSSSAKMPWPQPDIYNGPKVYTGQSK
                     FVDFTALSGIRLSDVKRVKSPCWYSIKLADAKRRQETDDRKS"
     gene            complement(<1120116..>1126115)
                     /locus_tag="LDBPK_312290"
                     /db_xref="GeneID:13389649"
     mRNA            complement(<1120116..>1126115)
                     /locus_tag="LDBPK_312290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863269.1"
                     /db_xref="GeneID:13389649"
     CDS             complement(1120116..1126115)
                     /locus_tag="LDBPK_312290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863317.1"
                     /db_xref="GeneID:13389649"
                     /db_xref="UniProtKB/TrEMBL:E9BN00"
                     /translation="MSSVSRQARPANAATSEKATPFLSAKHLPEAMSLTNTPGKVCSS
                     DVSAAEDAERRSSASRISPISPSRISSEAYTSSHRTGSRQRSSSSEAQAGVTPGVVHG
                     IDSMGTARYGKDLPAELSTSTAKLRIQKPSEPLAVKLLAPPPALPERPALPPPPHASK
                     EPNTQSARASGVKSDSDAAASALSPFDPLHRDFAKPPSDLLSLRTPSTLPQESHTPPR
                     GQSPATHSARAGAPKVARNLGQRDLSSVARSNAHLSVLADLVDKKMFSEEDVLLELEA
                     VRKRSLLTSVPFNKRLLPILAWYLLRDKFGDEAATRYVSLLTSPAGTTPPDGAVSTTS
                     TIASFLPRVNEIRRVRREIKESNRKKPKHHYAINPPASPTEAAKLSDIEGAHDKRRQL
                     RRTAAFDALEDASDIPTTGLLSPQSRHTLSSPCVRNRSPLTYGRLHVYTREDAVIDRR
                     DAKAEDRPVVDVVVDAANRQDRAKNVFEVVEEQASSVVEEPSVFQGPGRKPPTTKGTA
                     SKSMSKERVPAPPASAHAACALGEATARSRHGLQVHGSDACAMLDVTPSIGVFSEVSP
                     ANESEEGLSLFYREFVGGADQERTPSVSAFWKAITSSDTPAARTEPGRRCLPARHPQH
                     GHVDRSGGPADYGASAQPSGLAGETVNSSDLSAVADNTTSARSVVEYLHGVSGDHEWY
                     DGEATAVPEENPASQTLASTVAYSALNDPHESSVGVGDTENTTGAVYCLATSFLLRDG
                     CAAEATDTSKQQPEQRLYAGLSSAESPTIHTVMATEYYSTLPNASTTTHRPECSQRSR
                     SEASWETSSATMPSMTETFQEEGAAGRKTGYGSLIKSHIDTAAMSNADSIKAREGTGT
                     GLHTVAEYSAFTDSGALAIGPCDASDVQSPTISKNGTLRRGTSAATAAPFSVLEASSD
                     TTDRTRQSAHRVRGTATVLKSPLLDSGVHSSRSEGRKTPFSDLPATESLHDGTPAYSM
                     CDGCTGTRLSPPSTTIDGSSYAPSAPSGESAFGSLLHTNAETSAMGGGNYRQGFPIEL
                     FDSIAVSDASANTYSALQRDNSANAGPCCASRNTCWAHVVEHSANGGAQFATPLHDSA
                     SRPPAAAATGPRTVSAHHRLSSGRATARRSLSDALAAHLGDASVLHNHRTDDSHSTQS
                     VDAPDTQSLTTVTSATSPPLDAGTHHDSVRSRGGYGSMMEADSAVAPDAGAASRSNGG
                     YSLADGGCCSYPAGTSALSASDKRAVKAGESGDSTMNCSNEQVGGRLANRGFADCAPA
                     GSESISVERRVSRVESSRDCDAFASHTTALLVSEVVCNGCDSGSQPRSPTCSAVNPSQ
                     LTASTREEMAASTCTAFLGCGREGATMSSIMDPDELADALQRLSERHVSCLKDNNACT
                     FGELGCQCATGKCQVCTTEATRPPPRQPQPVPPSDEVARAQRFDRFAMRSSSTEKAPG
                     CGSPAPPPPAAAPAEEKSLNTAVPLQSRQRKSRISSARVSSRSNATLVRVGAGFNLRT
                     SPSPARCAEEASTRQATQQVSTISEFDAVTAFPAKSTPPGRCTDSDANRTGSFLEGDG
                     LRSQVTILTYPRSSADLSVHNMPDAASERADASIQQLREHQRSGFDFSGYCRADCLMM
                     TPVSILQSSPGNSRIHDSKTVEFSTRPQAAATAPSGVSIPTDRTVCGALTAGDSAVTS
                     SVVPLPLPPEATVVNPTVCALSDELLRMPHDMTTVLLGGARQFGRFSTMQAAHEEASG
                     ADDAEEVHKAEFTREVHTKHRNLATLLCHSRLDESGVADVHSHVLESSAAVTKTGLAN
                     ADRSRSVGVLPREQTEMDAAGVDEARVDSSDESRETATPADSDADENWISSDPSTTQN
                     TQLAVSVPGRRFAHRPPMHPYNYVRADHDSPEQREQRQRRRTILDVPGVPYVDSPDIS
                     THIDKKEAQKEKDRQLFAMRWAERGLMWQQQENEAQRYEECQVHFGAGKERPRGPRVM
                     IMKPGQQGAVALPGPRLPNVPRPPMSMHPRSPGYPPRRRHR"
     gene            complement(<1127725..>1129065)
                     /locus_tag="LDBPK_312300"
                     /db_xref="GeneID:13389650"
     mRNA            complement(<1127725..>1129065)
                     /locus_tag="LDBPK_312300"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863270.1"
                     /db_xref="GeneID:13389650"
     CDS             complement(1127725..1129065)
                     /locus_tag="LDBPK_312300"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863318.1"
                     /db_xref="GeneID:13389650"
                     /db_xref="UniProtKB/TrEMBL:E9BN01"
                     /translation="MPSDTESSDFTDGDRPLSAAASVWNMTESSGAAASDRYATAPLL
                     LQIRYSRAAQQTELLVADVPPSPSRPYIHPQLLAQRLPLETQDSNNADVQSGTPTTVG
                     AAPQHEQKSEMRIAGPPAPSAMAREVSAWSEACAADSFAFLRNAREPSLSYTWTDSYL
                     DESPSTTKARWMQQRTFGPVVQSEGGGSSTVSSTPRAPCETEAVWGGVQARSAAARAG
                     AAEAVDRPQDGPGDERSRTTRGGGGARRRRFDLAAAETGENGLGRERPHDGVFDHVST
                     SHVGRRAKPTTAKPLFHVNRSDTSICTSNASTRIATVQQPHRMGQIAPIAKLLNAAAA
                     VNTAEVVRLGSDDVKAGVSPSPTTDANLREVGLSSAFLDIVAASRPLSPARAANVADS
                     HNAPRSRSSSDNRNQCESDGMGSSPTEMEQSRGNLRASRCCPPRGRVLKVIYED"
     gene            complement(<1132557..>1133015)
                     /locus_tag="LDBPK_312310"
                     /db_xref="GeneID:13389651"
     mRNA            complement(<1132557..>1133015)
                     /locus_tag="LDBPK_312310"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863271.1"
                     /db_xref="GeneID:13389651"
     CDS             complement(1132557..1133015)
                     /locus_tag="LDBPK_312310"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863319.1"
                     /db_xref="GeneID:13389651"
                     /db_xref="UniProtKB/TrEMBL:E9BN02"
                     /translation="MPPSPGTTSDIYLLILPAIFGFVLPFVAAIGFYQCISYSRAKAI
                     YEKRILVVRKKLRHRLRQFKAEGVVTPRHKMREHGFKDLCELSSDDDDHTTPGSSPRR
                     ENHSLPSDSRTSDRTNSQRSTNRSGEPCPSFVLEDVSMLESEEGSSDDSW"
     gene            complement(<1133804..>1134832)
                     /locus_tag="LDBPK_312320"
                     /db_xref="GeneID:13389652"
     mRNA            complement(<1133804..>1134832)
                     /locus_tag="LDBPK_312320"
                     /product="3,2-trans-enoyl-CoA isomerase, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003863272.1"
                     /db_xref="GeneID:13389652"
     CDS             complement(1133804..1134832)
                     /locus_tag="LDBPK_312320"
                     /codon_start=1
                     /product="3,2-trans-enoyl-CoA isomerase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003863320.1"
                     /db_xref="GeneID:13389652"
                     /db_xref="GOA:E9BN03"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9BN03"
                     /translation="MRRAISSTLTRGARTLGVKPGLFQLTQYRFQSQPPPGVPQGRHQ
                     DTNAAPAGSKRSDDAQPEFEPPKKPTEVPKFVRINTNEKGITNVQLARAPVNSMSLEL
                     FQELNQWMLWLGSNEETKAVIISSAIPTVFSAGLDLVEVHNPKPDRIAVFWQSFQEMW
                     LIFNSFPKPIIAAITGNSPAGGCIIAMGCDYRLMARGPKDNTNNNRLYRIGLNETKLG
                     LVAPPWVMPAYAYLLGSRQAERMLQLGETPVADDARNLGLIDEVAADEESTIEAAYQQ
                     AERFLSVPQQSRWMARDMMRREYLQMLASDEERNYDTEFFTQFVQSPEVQKNLESYLE
                     RLKSRSRK"
     gene            complement(<1135273..>1137138)
                     /locus_tag="LDBPK_312330"
                     /db_xref="GeneID:13389653"
     mRNA            complement(<1135273..>1137138)
                     /locus_tag="LDBPK_312330"
                     /product="aminopeptidase, putative"
                     /transcript_id="XM_003863273.1"
                     /db_xref="GeneID:13389653"
     CDS             complement(1135273..1137138)
                     /locus_tag="LDBPK_312330"
                     /codon_start=1
                     /product="aminopeptidase, putative"
                     /protein_id="XP_003863321.1"
                     /db_xref="GeneID:13389653"
                     /db_xref="GOA:E9BN04"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="UniProtKB/TrEMBL:E9BN04"
                     /translation="MDPSACIWNPIQCTLQLVFSRPSSGAAIRAGSAYHGTSVIRYRR
                     EPYRDTADSAAGAASSCATFSSEGNSEYDDFLRHRRVIAEKNALHLHALTTAGGIYKD
                     AKVLDVQSYQVRCVSASNEAAAAVLKVVSVEQEDAGAASADSSFSGGAAKRKGSSKVR
                     KGGGAAVVEHDAQTSDDSRAPAAVDWGSKLILFEGAGSLPPFSEVDLTTQFVGRVQSF
                     DCGGIYAACGIGSNPGTEDVPLLTHFEVRFARCAFPAPDDPQYRLDWQLKSIQVPSSF
                     RTILTNGEERGRKELAAQQAVQVSFSPCGPLPAYVFSFACFPGLAKPESTSATGDGLE
                     VVEGGVDIPKFAGDIASGVSHTSNVSYTLVPVRVLARRQARIATATLERVLRLTIEAV
                     TALQQLFQCPLPLLQCEHLDVLLGPTMPYISGMEHHCSIILNEAIYQPGKKTAAAGGG
                     SADRTAEVEQTELIVHELAHHWVGNAVGLPFAVKEGICQVIEQCLGDTLLGKPMRTYK
                     ADSSGSTKPESSSPCSSTATLPKSAIRASEKGREFTGTSYQHAFRAVKRLVAAHGFDH
                     FAACLRQLMHVHVVVPAIAVEESGGIQVLRCIHADVASPPYLSTEQFLRTVESAL"
     gap             1138004..1138102
                     /estimated_length=99
     gap             1138547..1138673
                     /estimated_length=127
     gene            complement(<1138936..>1140324)
                     /locus_tag="LDBPK_312340"
                     /db_xref="GeneID:13389654"
     mRNA            complement(<1138936..>1140324)
                     /locus_tag="LDBPK_312340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863274.1"
                     /db_xref="GeneID:13389654"
     CDS             complement(1138936..1140324)
                     /locus_tag="LDBPK_312340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863322.1"
                     /db_xref="GeneID:13389654"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BN05"
                     /translation="MSSDSGINAALLNLCAQLQDGGARSAANERPSAPNHTEGSRETA
                     EQSSTSAAVCATALTAAPAAAAQAQARRAADYEWLRSALASVESPEKRVKQLLFNMEN
                     LTTEGKLGPLVQEERLEALEELADMVEDVNWAAEFALMQGPQRLLDVMRCERAAHPLL
                     ATGSRDPSASVEAADSTGRGDREVQTATHDGIPSSAVPLFTEFAMIIAHSAQLNEPVQ
                     AAYEAAHWEDIILPFMGECIAAVQDLLHLGSDGHAIGAQGDGAEAANAAAGAASLMRL
                     LGALLHACSCLCRDSSPNTVVFFQTSGLAVIVDVLRLTRTLPDSILECTAEGGRTPVV
                     VTNIASDTASDQEVDDIYAPLLGTTRKVTARALFFVAYLASTGVSSEEIIQLTCLHAE
                     SGNSGETVQKAAAHALAALVEKSPKAIKEAVHALMPHRLKEWRTQVQRVEGDGEAQDD
                     RLHFLDALERIS"
     gap             1141824..1142133
                     /estimated_length=310
     gene            complement(<1143541..>1144089)
                     /locus_tag="LDBPK_312350"
                     /db_xref="GeneID:13389655"
     mRNA            complement(<1143541..>1144089)
                     /locus_tag="LDBPK_312350"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_003863275.1"
                     /db_xref="GeneID:13389655"
     CDS             complement(1143541..1144089)
                     /locus_tag="LDBPK_312350"
                     /codon_start=1
                     /product="ADP-ribosylation factor, putative"
                     /protein_id="XP_003863323.1"
                     /db_xref="GeneID:13389655"
                     /db_xref="GOA:E9BN06"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BN06"
                     /translation="MGQWLASAFSSLMGKKEVRIVMVGLDAAGKTTIIYKLKLGEVVT
                     TTPTIGFNVETVEYKNLKFTMWDVGGQQKLRSLWHYYYQGSNGVIFVVDSNDPERMML
                     AKEELDKILAEEELRNAVLLVFANKQDLPNALTTTQITEKLGLYNVRNRRWYIQGCCA
                     TTAQGLYEGLDWLSNNISATMQ"
     gene            complement(<1147033..>1147692)
                     /locus_tag="LDBPK_312360"
                     /db_xref="GeneID:13389656"
     mRNA            complement(<1147033..>1147692)
                     /locus_tag="LDBPK_312360"
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /transcript_id="XM_003863276.1"
                     /db_xref="GeneID:13389656"
     CDS             complement(1147033..1147692)
                     /locus_tag="LDBPK_312360"
                     /codon_start=1
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /protein_id="XP_003863324.1"
                     /db_xref="GeneID:13389656"
                     /db_xref="GOA:E9BN07"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="UniProtKB/TrEMBL:E9BN07"
                     /translation="MPAASRIHYRSIGTAAVAIAGLPTVWNMVARNEYRRHTIEKAVG
                     GKRLGAYALAAAIVVASGARDYAFRNAMAQNPCPLLPILCTQALGPENAGVVRGVMRG
                     VGAALMATGTTLVVSSFLRLGITGTYLGDYFGILMDERVTAFPFSHFDNPMYLGATLN
                     FLAASIAQNNAVGTLLTGLVGLVYHVSAKYFENPFTEMIYRKRAEDRAAAGVSASVRK
                     Q"
     gene            complement(<1153203..>1153289)
                     /locus_tag="LDBPK_312370"
                     /db_xref="GeneID:13389657"
     mRNA            complement(<1153203..>1153289)
                     /locus_tag="LDBPK_312370"
                     /product="3'-nucleotidase/nuclease, putative"
                     /transcript_id="XM_003863277.1"
                     /db_xref="GeneID:13389657"
     CDS             complement(1153203..1153289)
                     /locus_tag="LDBPK_312370"
                     /codon_start=1
                     /product="3'-nucleotidase/nuclease, putative"
                     /protein_id="XP_003863325.1"
                     /db_xref="GeneID:13389657"
                     /db_xref="UniProtKB/TrEMBL:E9BN08"
                     /translation="MADAARTAALYAAVVLVLLCAVALPSAA"
     gene            complement(<1155066..>1156202)
                     /locus_tag="LDBPK_312380"
                     /db_xref="GeneID:13389658"
     mRNA            complement(<1155066..>1156202)
                     /locus_tag="LDBPK_312380"
                     /product="3'-nucleotidase/nuclease precursor, putative"
                     /transcript_id="XM_003863278.1"
                     /db_xref="GeneID:13389658"
     CDS             complement(1155066..1156202)
                     /locus_tag="LDBPK_312380"
                     /codon_start=1
                     /product="3'-nucleotidase/nuclease precursor, putative"
                     /protein_id="XP_003863326.1"
                     /db_xref="GeneID:13389658"
                     /db_xref="GOA:E9BN09"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:E9BN09"
                     /translation="MARARFLQLLLVTLTLLSTAALPVSAWWSKGHMSVALIAKRHMG
                     ASLVEKAELAAKVLSFSGPYPKSPDMVQTAPWADDIKTIGLKTLSTWHYITTPYYTDE
                     DFTLDVSPVQTVNVASVIPMLQTAIEKPTANSDVIVQSLALLLHFMGDIHQPLHNVNL
                     FSNQYPESDLGGNKQLVVIDSKGTKMLLHAYWDSMAEGKSGEDVPRPLSEADYDDLNN
                     FADYLEATYASTLTDKEKNLVDTTEISKETFDLALKYAYPGADNGATLSDEYKTNAKK
                     ISERQVLLAGYRLAKMLNTTLKSVSMDTILQGLKSIQSEVDTENKAEVHNHYDQKGIS
                     AAVTAIVAVALFIAGIIIATLVVLALKCYLPKRDRFGSYEHVAL"
     gene            complement(<1156688..>1159414)
                     /locus_tag="LDBPK_312390"
                     /db_xref="GeneID:13389659"
     mRNA            complement(<1156688..>1159414)
                     /locus_tag="LDBPK_312390"
                     /product="helicase-like protein"
                     /transcript_id="XM_003863279.1"
                     /db_xref="GeneID:13389659"
     CDS             complement(1156688..1159414)
                     /locus_tag="LDBPK_312390"
                     /codon_start=1
                     /product="helicase-like protein"
                     /protein_id="XP_003863327.1"
                     /db_xref="GeneID:13389659"
                     /db_xref="GOA:E9BN10"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BN10"
                     /translation="MTLQCDELYRAADKMAKASQRTQSRIRAAVEAQRQRAALHQLDS
                     RAEFFPDDEACPTYSLTNALPGCVCQPSTATSPPLQLLEHQREGVRWLLALHELGLHG
                     IMADEMGLGKTVQVAAFLAALAKTGVLGTFLIVVPLSTMESWKKELLRWVPWMHVTEF
                     RGTHEIRAKLRSRLRSRHRRAFERQETLRAQWAQGVPVRVLAKTVGGVVLASYESVMM
                     DHGALARLIHWDITIVDEAHRLKKLQCKLLQTLHKAACPMRLILTGTPLQNDLTELWT
                     LLEYVGPQIFSHGDADQRRLREAVTALSCGCDRRVNERREERHGDGSGGKEPTERHTA
                     AAVRFPHAPQANTGANAGEEQGLLLACLKTVLQPFVLRRIKATVGIKLPPKYDLVLPT
                     PLTPKQQLLYARVQSEERYSNSRLTHLRKCCIHPFLIRDFYANSCERRRTPQSPSSAR
                     ERLEFMVKASGKLKLLDAMLPELRRRGHRVLLFSQMTNALDLVEEYLSLKNAVLEEAL
                     LGGDETEAVVAMDRCRESGSPKDSTGRKRLETMLSQMLVYTRLDGSSSAEARSEAIRH
                     FQGPPSSSNQPGNGAEYDSAPFSVNAAAGGDSVEVFLEHDRQAEKPPTPADRVLPLAK
                     PSWRRLGKGLRTRGIEEDDEVFEEPFLSARASTPAGVLAERSVNETPPHLFKATGSVK
                     ACYAHLVTRKRSASAGSDSLSTHKSSITSSKCKADVASWSSDLSLTSTATSAAIAAQP
                     GVFLFLISTRAGGTGLNLTGADTVILLDGDFNPHNDLQAVDRCHRIGQRNPVAVYRLV
                     SPHTVEDERHSGIVDRKLKLEHLVLGCDGAGCISQRCCTTSGDVGTRPPPIPAADVLR
                     CAAAAVCAEPPKKRARSGSSVSSSKRQALTAGELRLLLDRAWLQHVMPHRSA"
     gap             1161956..1162054
                     /estimated_length=99
     gene            complement(<1162333..>1163382)
                     /locus_tag="LDBPK_312400"
                     /db_xref="GeneID:13389660"
     mRNA            complement(<1162333..>1163382)
                     /locus_tag="LDBPK_312400"
                     /product="3,2-trans-enoyl-CoA isomerase, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_003863280.1"
                     /db_xref="GeneID:13389660"
     CDS             complement(1162333..1163382)
                     /locus_tag="LDBPK_312400"
                     /codon_start=1
                     /product="3,2-trans-enoyl-CoA isomerase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_003863328.1"
                     /db_xref="GeneID:13389660"
                     /db_xref="GOA:E9BN11"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9BN11"
                     /translation="MRRAISSTLTRGARTLGVKPGLFQLTQYRFQWQPLPGVPPQLRV
                     ALHDRHQDTNAAPAGSKRSDGAQPEFEPPKKPTEVPKLLRINTNEKGITNVQLARAPV
                     NSMSLELFQELNQWMLWLGNNEETKAVIISSAIPTVFSAGLEFSEVHNPKPDRIAVFW
                     QSFQEMWLIFNSFPKPIIAAITGNSPAAGCIIAMGCDYRVMARGPKDNTNNNRLYHIG
                     LNESKLGLVAPPWTVSAYAYLLGSRQAERMLQLGETPVADDARNLGLIDEVAADEEST
                     IEAAYQQAERFLSVPQQARRVARDMVRCEYLRLLATEDDRNYDTEFFTQYMLRPEVQK
                     NLESYLERLKSRSRK"
     gap             1163921..1164019
                     /estimated_length=99
     gene            complement(<1165515..>1166756)
                     /locus_tag="LDBPK_312410"
                     /db_xref="GeneID:13389661"
     mRNA            complement(<1165515..>1166756)
                     /locus_tag="LDBPK_312410"
                     /product="p-nitrophenylphosphatase, putative"
                     /transcript_id="XM_003863281.1"
                     /db_xref="GeneID:13389661"
     CDS             complement(1165515..1166756)
                     /locus_tag="LDBPK_312410"
                     /codon_start=1
                     /product="p-nitrophenylphosphatase, putative"
                     /protein_id="XP_003863329.1"
                     /db_xref="GeneID:13389661"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023215"
                     /db_xref="UniProtKB/TrEMBL:E9BN12"
                     /translation="MKPASPPCAAVQASSLRSCFIPPHLSFPVTAPGPPYTDRNNVPR
                     QILSAMPEQMTAALAARLVASPLKYVLLDIDGVIWCGGHVIDRVPETLQYLRGQGKQI
                     RFLSNNASLSREQLLQSLKAKGIEGVTMEECYNSAYTAALRLRQLLGKADVPGEEPLV
                     HGNVFVIGEQGLHDELQQVLAPGFITYGVELHDAERAGGYDTDALGSAWRVPCLPPPQ
                     KRLVVCNGKTCRMVQAGTNSAEKISLSDLNAAAVVVGLDKHFNILKLAYGSLALQGPP
                     KDLREESHTPPLFVATNEDPQLPVGRDGTMIPGAGSMVSALCTAVGKRPDAVCGKPHK
                     DMANILFAAEGITNPREECIMIGDRLTTDVAFGNAAGCQSMLVLSGVEGLADVEEAEK
                     QGKTALMPKYVAESLACFLPS"
     gap             1168717..1172731
                     /estimated_length=4015
     gene            complement(<1187026..>1187514)
                     /locus_tag="LDBPK_312430"
                     /db_xref="GeneID:13389662"
     mRNA            complement(<1187026..>1187514)
                     /locus_tag="LDBPK_312430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863282.1"
                     /db_xref="GeneID:13389662"
     CDS             complement(1187026..1187514)
                     /locus_tag="LDBPK_312430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863330.1"
                     /db_xref="GeneID:13389662"
                     /db_xref="UniProtKB/TrEMBL:E9BN13"
                     /translation="MCQRLPLPLSFADRQRARGRGSDLCRASSITHPLPPPTEKYVVF
                     FRRSSAACNTVFSSFALFPPPLTFSSALYRTRNKKRGQLSIVLAAEENGHAHVCYWVS
                     GLGGRAGPYIAPPWAQHLGRGAADRRGAAGCVQQPQRHAPGDASEAVRNAQPCRGARV
                     RA"
     gene            complement(<1188712..>1190328)
                     /locus_tag="LDBPK_312440"
                     /db_xref="GeneID:13389663"
     mRNA            complement(<1188712..>1190328)
                     /locus_tag="LDBPK_312440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863283.1"
                     /db_xref="GeneID:13389663"
     CDS             complement(1188712..1190328)
                     /locus_tag="LDBPK_312440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863331.1"
                     /db_xref="GeneID:13389663"
                     /db_xref="UniProtKB/TrEMBL:E9BN14"
                     /translation="MHTSTVAMMNKGGGGERPTIAALDRGDGVDLKRESSLLPGEVRT
                     PTMIVTLSEAWGDSSADWAAPGSSSVWEEEAANRPSAQTPLTRYGRSDVWASATGSPL
                     MGDGIVHQHNFGQTEAKGNTDSPDTAELAAAALQALSPQGVLHTDSRGVHVPLPQRQP
                     LQPRYSTTVHYGYESRFGTVHEAPLNNDLTQFFPRPRQQQSPQKPNYFTVQESSVAPS
                     AALAEPTAMSRGGTRTTSPGSDAVFSGGSTGMSYVPRLEDEEVAHRIIVSAGLPLAMH
                     SLVEYIHGGQPRAPAHATALGTTQNALRNYPNLSDPPAEEEAFGSRGGTGGSYGSRPQ
                     RGGYGQSLQGRCGPTIPSLKQDNGFAVRGQDAIDDSPQDQALAPSSNYGGGFMVSAGT
                     GTTAPSRVSARAPYSAHGNGVAGRHKSESKYLSDLLHFHANFFPPPPPPRVPKDERRN
                     RAELWYHYASKWDITHRLPPPPRTPLPEMELEYRMRLQQMTRVPYHGDGWLQMSERWF
                     DVMQALFDFPEDNVGDEVDFNVVLQQAVLS"
     gene            complement(<1191030..>1192571)
                     /locus_tag="LDBPK_312450"
                     /db_xref="GeneID:13389664"
     mRNA            complement(<1191030..>1192571)
                     /locus_tag="LDBPK_312450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863284.1"
                     /db_xref="GeneID:13389664"
     CDS             complement(1191030..1192571)
                     /locus_tag="LDBPK_312450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863332.1"
                     /db_xref="GeneID:13389664"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BN15"
                     /translation="MQQTHSTMPIYCPPCAGRLPLFSLCCQTASGSSPAGHPHTHTHT
                     RRQEGKSAAMKTLAKRQRSKSVHEARSHRASRKESATSSHSVPSPASSHTLAAASDTA
                     ATCSATASVTDDREPCKSALLVLSTCHAVMAGLVYRKEKFYIKFSVKRHVGRVNSVAV
                     TERYIASSGVDERVFLFTNKAEERLTAAARKKIREAGEPLAVRLADLGSIVPPSEVTV
                     LVFADGSQHLLCGCSDGQLLIYRCRDWSVSTTLTVHEKAVVGLAVHPGSHGSLAVTVG
                     EDRVIAVLDLLKAKLLTKWKYNPSLAAAGSLSRRSEDDAQEQAQRPSVFASAREVPVG
                     VLFSPQGTRLVIFSRFSFVVYEASVMKPICSLRCANPQPPDEMHRLAFFSETELIVGT
                     EVGALKVCRIEGTPDKPLNMTARLVPISVTYPESVRAAAAALLATPVKVDMETRLKNP
                     LRHINRVKALQVQGSTIFSIDSSGIVIAWNARTTAEDRLSLQYVTSANFQGRVTGMEL
                     YPLPV"
     gene            complement(<1197363..>1199819)
                     /locus_tag="LDBPK_312460"
                     /db_xref="GeneID:13389665"
     mRNA            complement(<1197363..>1199819)
                     /locus_tag="LDBPK_312460"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863285.1"
                     /db_xref="GeneID:13389665"
     CDS             complement(1197363..1199819)
                     /locus_tag="LDBPK_312460"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863333.1"
                     /db_xref="GeneID:13389665"
                     /db_xref="UniProtKB/TrEMBL:E9BN16"
                     /translation="MISAMQCSSQPSSTTSLHAELFGSSTPMCSMMGPYTMSNEGAAR
                     PPAMMGSAAGLAMAFSAFSSGFYGHDDAAHPYQRAASLREGPRSRASSHQGVSSAAQL
                     YQYAESNDGCGYSRVTLYGAPCAREAAVHDGAIAAAAFTEPRFGSAQRTNSFATSGTA
                     LSDCHLSRKDGGGFTPASAGTFLNSDDSFGGRSVNSRRSLHDSLTAPASSMSCSVRGS
                     VGSGYYYVDATFRGDEHDHGNVTRTADGAVVLSAAQHRLSDSTHLTSRGGASSRLSRE
                     NIFDLTRRLDAAERWTTNTETLHAPPQLHLSGFSTSRNDRLGSPRKRGTIKDDTQYAS
                     ANTASPASASFGNGLGPTGCSPFCDLGTGAVESNKAGQSRLAVLKRDDVVPTTTAEIN
                     WSRHSSGLRRRPASERRATVDTEGSASASSASSTTTSAAPRQPSLLPKTLNGASTEPK
                     ETACSLGSVDKSTPPAGHAPQSASRKPRRKDPRKWNNSRSTSIAAPHFEMDGVASSTS
                     SSDPAASRATTDAHRRKVTATSLTGAPPAAHTEDDESGCHSSLASQPPQPLQQQLNPA
                     RAPNSATSAFTVSPPSYNERHQRPFLRRRYLEGQVKPLSATEMQMAMVPFSPRRDVPP
                     SRSSTSGPATQAPLKPAVPLPPLQYDQVTVPGTAPAWSPSGTASSSTSFSVTPEKFIT
                     VASGGGAWRTQQRLAGFTGFHLSIGMEGLCVTTESSNEKSLRSLGGRSGTELRLPGES
                     SNGIMSRSCPSVEYSVDEGTNPFLIQRSASWSVHSARSTTDSGEVPGIARKKRQAERM
                     LSNAHELEEEHVIIHPKPSK"
     gene            complement(<1204282..>1205637)
                     /locus_tag="LDBPK_312470"
                     /db_xref="GeneID:13389666"
     mRNA            complement(<1204282..>1205637)
                     /locus_tag="LDBPK_312470"
                     /product="zinc transporter-like protein"
                     /transcript_id="XM_003863286.1"
                     /db_xref="GeneID:13389666"
     CDS             complement(1204282..1205637)
                     /locus_tag="LDBPK_312470"
                     /codon_start=1
                     /product="zinc transporter-like protein"
                     /protein_id="XP_003863334.1"
                     /db_xref="GeneID:13389666"
                     /db_xref="GOA:E9BN17"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:E9BN17"
                     /translation="MSPEQPRETTGLTVAPAGPAATNYHTASNTVHVTVAEERTIDEA
                     LSVVNARRESEKKVLLGALIFCFVFMIVEFASGVIAHSLALLTDAIHLLTDVGSYALS
                     IGALVAAGRAACGRYSYGWHRAEVIGTLISVFSIWALVTWIVIEAGYRTYDMYMCSRV
                     PAQASAGAVKARECQAVDSRLMILVGVLGMLVNVVCASILYFGGSHGHSHFGSSHGHS
                     HGESEMHDHDHSHRDLHEGGHGHNHAHDDRHDHGHDHGHGHGYLAESGGGIGSHKGFA
                     VHAAILHAMGDCVQSIGVIFAGSFIYFSNLAYYGNHTYEHSLFNLADPFCSVMFALIT
                     LSMTKALLMDLLSILMESTPASVDYYALETALQQIDGVASVHDLHVWSLSAEYVSLSV
                     HLVADNAAEALQKAQHICKEHFGIGHTTIQIDSVAVGTAGCASACASPTAHDEILSHY
                     M"
     gene            complement(<1207640..>1211320)
                     /locus_tag="LDBPK_312480"
                     /db_xref="GeneID:13389667"
     mRNA            complement(<1207640..>1211320)
                     /locus_tag="LDBPK_312480"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863287.1"
                     /db_xref="GeneID:13389667"
     CDS             complement(1207640..1211320)
                     /locus_tag="LDBPK_312480"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863335.1"
                     /db_xref="GeneID:13389667"
                     /db_xref="UniProtKB/TrEMBL:E9BN18"
                     /translation="MQATSAADAGPPRASRRYHVLFWPHVVSTPTSDLSGTGDGNRDE
                     PVELSARLKLKLGQVYLHLTHRPREANLPEHPASAPATQDGGARAKHSSFAPSQRSSK
                     QSRWLLLSLPPSRSSLHRRHSPVTSVDKKHEHAGAPSTSSASCAHPHLKQHYTIALTE
                     ISPLAAQLPLSAELRSSLHLNRVDRDAATYSSHSTPRAPFMSLASWDLSGAPSALSSN
                     FCCPPGCDLSVTSARPRDSNLSARRASSRRAKSTTATYGQYLDVAEPLRSSTRTLPSP
                     LLTASSKGTGCWQSSSCPGEGDATRGHHSPCTCTSHAPRGKGSRLLTPLVDKAPASQT
                     LPITHLSSSSFGSLTPPQTHAASLRLFTASVILEYEELLGVTFFGVPETAGVANCSSS
                     DDEGHGLLDKASRRFGHRQLHGTLLSSIVPPKQNARRPQSARAPSPHSEVISDDDRGA
                     VTPLHPPHGHLPTPWKCNHVTRSPVFAPTAHVCPRKVPELPFKLNQAQTCCLRFLTET
                     DMREFLSCYIEMQTYVKQMQEKSAAAKRWAEAGGRDSGGRQLATSRLTECDKENSVSS
                     EYEVYLRDSTTNSPGSPSTTTYNEHSRHSKALGPRGSSLSTNIVLDDLLRDSQPAASE
                     GIDGGQHDNSKRYAEFSALSTPVRTTVRSHGWQDYLRRKVDPRYGISYATVPLFLWHS
                     FLRLAPSVLYTCQRGFLIVERLPTPSSPDRSEYGSRNSRCAELEASKEASKQRLNDLV
                     CRPLSPIGAALEVAPSTMQPRQRQASPSPEGVSERCPTPLVPVAAPKSLPSASTTRSS
                     CDDVKLVLPSVASAPCERTDEHITTFKDVFLCLSESHLLFMNSFGHAWFHFSFDEIVL
                     ITHSAAMDSFPTHPFLRFRLKPSECFDTPTFVLMFILLPDVPHHVQLASASASLRPPE
                     AEPVAQRGSARSTSSPSVSAQRATAWASDQAPRESVAVADHCVSLVEAEEKERLLCRH
                     KALLDIFETVCPRPVERCTFTELMCGESSKAHRARLRQLLLRASTGVSGFPLADNSSD
                     VYAGASSWMAQQHSTTPILCVKLTAGDISVADPDARRSEGAHPPANQPPLASSRSSSA
                     RQARDSRRRLSPPHRAPDGSRTSAFAGPTLRWGRDDPGIVLKDAGHDMDFSFERATRT
                     MPLLACKETVSQGYSASSQAFQPHGLYPTRCGSGSAKAKQKNEDGGAKGSSLGGAEDM
                     YIPMAPKKRRSSIVRCVSMKEL"
     gene            complement(<1218762..>1219373)
                     /locus_tag="LDBPK_312490"
                     /db_xref="GeneID:13389668"
     mRNA            complement(<1218762..>1219373)
                     /locus_tag="LDBPK_312490"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863288.1"
                     /db_xref="GeneID:13389668"
     CDS             complement(1218762..1219373)
                     /locus_tag="LDBPK_312490"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863336.1"
                     /db_xref="GeneID:13389668"
                     /db_xref="UniProtKB/TrEMBL:E9BN19"
                     /translation="MSDRDVPASMTRTCAPHEVHFLFCSTDAWDAAPASNGDVAKLPA
                     PKKPISAPLASFHSLVDTHRGRRASRHASPPRQLGRPLPPTQPSFSDVAKRVGSFNDM
                     CEANSLLSSHMRLGEMSTLGISASTSTMPAGCSVSTTSLHWLRIAEDRVMPHPSSTKP
                     APAALQRNAEYVLERWVEQKVHRTAAMDDAMLKVAAAFDELYA"
     gene            complement(<1223265..>1223948)
                     /locus_tag="LDBPK_312500"
                     /db_xref="GeneID:13389669"
     mRNA            complement(<1223265..>1223948)
                     /locus_tag="LDBPK_312500"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863289.1"
                     /db_xref="GeneID:13389669"
     CDS             complement(1223265..1223948)
                     /locus_tag="LDBPK_312500"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863337.1"
                     /db_xref="GeneID:13389669"
                     /db_xref="UniProtKB/TrEMBL:E9BN20"
                     /translation="MPTLLPRTGKEAARPTGFRGVSPSSPQPPTLQQFVIEKQGSFDR
                     TLWHTRVLTIDTAHGRLYLSKAHKAENLDHRCMNRIDSVELWPTFSSDNIPEHFGSEL
                     ARRTVCLKGLVGIKTQSFFMRWFRSSDARTKEVAVVAANVAQTGASASRTQPHDIDSD
                     GHRETIEASVLCPVGSYMRFEVEVWLIRCMTLHDLHEMADAFRAAIPEASSVLKGYQA
                     LKQSTAGSD"
     gene            complement(<1232166..>1232876)
                     /locus_tag="LDBPK_312510"
                     /db_xref="GeneID:13389670"
     mRNA            complement(<1232166..>1232876)
                     /locus_tag="LDBPK_312510"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863290.1"
                     /db_xref="GeneID:13389670"
     CDS             complement(1232166..1232876)
                     /locus_tag="LDBPK_312510"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863338.1"
                     /db_xref="GeneID:13389670"
                     /db_xref="UniProtKB/TrEMBL:E9BN21"
                     /translation="MAAETKPPLQQQQQQQPNDTHPPQIAVRKQGTYERGRWSTRILT
                     IDVDAGMVTISRKSKPQDVLYRSLHVQKVEMWPRYSPYAIEGSYDSLKAKMVLCITGT
                     EVTLTNHGSSVGNFLRSNIGSLISASIAAENSAWSAKPSKRVGLKEVFSKRNPMFATI
                     PSNSAATDSSTITWLIQFTSIESYELAVMLFMRFKNEGGSRRKVFSNNVAADLACVKE
                     AWVNHAARFKTATDTDTS"
     gene            complement(<1235352..>1236011)
                     /locus_tag="LDBPK_312520"
                     /db_xref="GeneID:13389671"
     mRNA            complement(<1235352..>1236011)
                     /locus_tag="LDBPK_312520"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863291.1"
                     /db_xref="GeneID:13389671"
     CDS             complement(1235352..1236011)
                     /locus_tag="LDBPK_312520"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863339.1"
                     /db_xref="GeneID:13389671"
                     /db_xref="UniProtKB/TrEMBL:E9BN22"
                     /translation="MSKAVQFSVLKQGSLEPGSWTQRVLTIDTKSDTVTISRKHHPEH
                     VFYHSLEVAHVQMWPRYRASEISGHFNSLKAKMTLRIFGKQVPVPKMSVEAVTAADVA
                     EMIRVPSVPSSISLDASLNIERPPVAAATLSQKQKERHPATATSANDDLCDSWMIRFT
                     SIDSYELAVMLLRNMRNKEGKRKRLFGDHVLQDLECVKKAWDEETKGAKSTGGALRPG
                     S"
     gene            complement(<1237499..>1238083)
                     /locus_tag="LDBPK_312530"
                     /db_xref="GeneID:13389672"
     mRNA            complement(<1237499..>1238083)
                     /locus_tag="LDBPK_312530"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863292.1"
                     /db_xref="GeneID:13389672"
     CDS             complement(1237499..1238083)
                     /locus_tag="LDBPK_312530"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863340.1"
                     /db_xref="GeneID:13389672"
                     /db_xref="UniProtKB/TrEMBL:E9BN23"
                     /translation="MEEFNVQKQSSLKADKWTRRVLSLHPKLGIAAITDRGRPEDRFH
                     ECMRVSSMQIWPQYNKKHVKESFSSMEVMLTVRMKGIPAKVGVREKQSATGPVKIYRY
                     TMKGPEAEKHTWMLRFNNYEDFEKAVNLVQSMQTVENNSLVRYGETHRPEEGCEGVTD
                     EVEVEEFLPRPVMYGNVEDELAPIRAQWQQARPK"
     gene            complement(<1239142..>1240245)
                     /locus_tag="LDBPK_312540"
                     /db_xref="GeneID:13389673"
     mRNA            complement(<1239142..>1240245)
                     /locus_tag="LDBPK_312540"
                     /product="lipase, putative"
                     /transcript_id="XM_003863293.1"
                     /db_xref="GeneID:13389673"
     CDS             complement(1239142..1240245)
                     /locus_tag="LDBPK_312540"
                     /codon_start=1
                     /product="lipase, putative"
                     /protein_id="XP_003863341.1"
                     /db_xref="GeneID:13389673"
                     /db_xref="GOA:E9BN24"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BN24"
                     /translation="MTQLYLYRLVGFTTVVAGLIVFLTLYTVSTLRTKDSEATIVGVN
                     SARYNVTDGWKALHFSKAAYCEVENLRHWSCGNTCSNATPDFHVFNIYENTSTGNVGY
                     SGVDHDAERIVVAFRGTYNTVNWLQNLDFWLTPYPHPGCGKGCKIHRGFYSAYSSLRT
                     QMIEDVLLLHARYPFYTLFITGHSLGGAMAMLAAVELTTWNMLEADVLGKDVQSRGAV
                     SPPLHLAPVELYTFGEPRVGNGYFSNWSLSVLTRKRSFRLTHARDPVPHVPPRTFTYV
                     HMPREVWYPTDGEKYHLCRGTGFSEDPLCSNSVFGTRVSDHLIYLGICTRCECTVKEM
                     EEIYSYELPPEMYNIIALDHAMDDPNFTYRRAL"
     gene            complement(<1242582..>1244072)
                     /locus_tag="LDBPK_312550"
                     /db_xref="GeneID:13389674"
     mRNA            complement(<1242582..>1244072)
                     /locus_tag="LDBPK_312550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863294.1"
                     /db_xref="GeneID:13389674"
     CDS             complement(1242582..1244072)
                     /locus_tag="LDBPK_312550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863342.1"
                     /db_xref="GeneID:13389674"
                     /db_xref="UniProtKB/TrEMBL:E9BN25"
                     /translation="MLVTPVEKPCRYAPHSSLRFLCVDPATRMAYLSGKGTRVREWKH
                     RMTVYAIMPKCVEASHAMNHRAWNVEVSDLLIMTISGVAYSRLDRSDPESEAELQRLP
                     KLLSERYKSSDPTTGVYVGRQEISSSSERFVNNNDDENFFGRGREDWKLQCCYYSAMH
                     NVVTLAVDTLIRDGLRFPLHGVLRTGVDPRDGLRLASFPLYLQPAFHQLAVAVVYTCI
                     YGRMMGCDPRGRVGIYISHVYSCISERDILFVAENGAVARSLPLSLMEAVEYNGPLAR
                     GTSDTGAATTSTPLPPIEPSMPYAAFLTSGESADVLFIPCSAFLDECNDCSASMASAM
                     PQISVGTEINALHVLRTLSSNSLQDANSSEGCENECSAPRHEEADCANYLDGCPDSVF
                     SDPHAPAAPPMKPDGLAFVTLPSQQSLRDYVDGFQATHRRAFKWQPLPGNRQLTPALQ
                     SAASVAHSLGLRAPSRQAITCRSEFLSFYYGSEVAAKAARRAAEPV"
     gene            complement(<1244970..>1245581)
                     /locus_tag="LDBPK_312560"
                     /db_xref="GeneID:13389675"
     mRNA            complement(<1244970..>1245581)
                     /locus_tag="LDBPK_312560"
                     /product="uridine kinase-like protein"
                     /transcript_id="XM_003863295.1"
                     /db_xref="GeneID:13389675"
     CDS             complement(1244970..1245581)
                     /locus_tag="LDBPK_312560"
                     /codon_start=1
                     /product="uridine kinase-like protein"
                     /protein_id="XP_003863343.1"
                     /db_xref="GeneID:13389675"
                     /db_xref="GOA:E9BN26"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BN26"
                     /translation="MPPYDYVHHARSGSTITTTPTRIIMVEGILFFTNAELCKEMDGL
                     IFVGTARGICLTRRAECDIKECGRTFKSVIEQYATTVRPVHCAYAEPSKLSVDISAPR
                     WKNNGVAFGVLRVTQSHDPPPHTIKCDAAPPGLPNTIVCSVCEPFSLNPLMNTHMREV
                     LSTSLGLLLLCLSYRWTASFFESADRQTHKRPRLPAVQLTSSI"
     gene            complement(<1246243..>1246725)
                     /locus_tag="LDBPK_312570"
                     /db_xref="GeneID:13389676"
     mRNA            complement(<1246243..>1246725)
                     /locus_tag="LDBPK_312570"
                     /product="ferredoxin 2fe-2s-like protein"
                     /transcript_id="XM_003863296.1"
                     /db_xref="GeneID:13389676"
     CDS             complement(1246243..1246725)
                     /locus_tag="LDBPK_312570"
                     /codon_start=1
                     /product="ferredoxin 2fe-2s-like protein"
                     /protein_id="XP_003863344.1"
                     /db_xref="GeneID:13389676"
                     /db_xref="GOA:E9BN27"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:E9BN27"
                     /translation="MHRVALPRVVRCARRPAASAPLTTSSGASLRWCSSPPPSLSPST
                     TPGKVKVHIKSETEGTKKTVEAALGLTLMEVIRDVAKMDMEAACDGTCACSTCHVIFT
                     AASYQKLLDAPSEDEMDMLDLAPKVTKTSRLSCQVKIAPELDDISVTIPNEMENQMGY
                     "
     gene            complement(<1247417..>1247854)
                     /locus_tag="LDBPK_312580"
                     /db_xref="GeneID:13389677"
     mRNA            complement(<1247417..>1247854)
                     /locus_tag="LDBPK_312580"
                     /product="adrenodoxin-like protein"
                     /transcript_id="XM_003863297.1"
                     /db_xref="GeneID:13389677"
     CDS             complement(1247417..1247854)
                     /locus_tag="LDBPK_312580"
                     /codon_start=1
                     /product="adrenodoxin-like protein"
                     /protein_id="XP_003863345.1"
                     /db_xref="GeneID:13389677"
                     /db_xref="GOA:E9BN28"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="UniProtKB/TrEMBL:E9BN28"
                     /translation="MRSYSPLLTTGVLLRPTMALAGALCTSRVLYNIPGKVKVCARTR
                     DGTPCDFEAPVGMSLMHAIRDVARLEMDGACDGCAQCSTCHVYLSEACFKKLGKPSER
                     EQDVLDKALDLRDTSRLACQITLTPAMNGLEVVLPKNVTNLLL"
     gene            complement(<1248633..>1249058)
                     /locus_tag="LDBPK_312590"
                     /db_xref="GeneID:13389678"
     mRNA            complement(<1248633..>1249058)
                     /locus_tag="LDBPK_312590"
                     /product="adrenodoxin-like protein"
                     /transcript_id="XM_003863298.1"
                     /db_xref="GeneID:13389678"
     CDS             complement(1248633..1249058)
                     /locus_tag="LDBPK_312590"
                     /codon_start=1
                     /product="adrenodoxin-like protein"
                     /protein_id="XP_003863346.1"
                     /db_xref="GeneID:13389678"
                     /db_xref="GOA:E9BN29"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:E9BN29"
                     /translation="MHRKFLLGHLLPRCTLALVPFSASRALSSTPGKVELHVKKRDGT
                     HCQVYVPVGISLMHALRDVSKMDVEGTCNGAMACATCHVKLSAASFKKMEGPSEEEED
                     VLARALDVEETSRLACQVDLTPELDGLEVELPSYEMNRS"
     gene            complement(<1249849..>1250397)
                     /locus_tag="LDBPK_312600"
                     /db_xref="GeneID:13389679"
     mRNA            complement(<1249849..>1250397)
                     /locus_tag="LDBPK_312600"
                     /product="ferredoxin, 2fe-2s-like protein"
                     /transcript_id="XM_003863299.1"
                     /db_xref="GeneID:13389679"
     CDS             complement(1249849..1250397)
                     /locus_tag="LDBPK_312600"
                     /codon_start=1
                     /product="ferredoxin, 2fe-2s-like protein"
                     /protein_id="XP_003863347.1"
                     /db_xref="GeneID:13389679"
                     /db_xref="GOA:E9BN30"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="UniProtKB/TrEMBL:E9BN30"
                     /translation="MFVRRRGFSLVTLALPRSLSDAMTPIKLSRLSCSSETGPSPPSA
                     SSTTSLRSETPGKVLVRIRDRDGATYERMYNEGDNLMEAIRDDTTLPVEVPGACNGTC
                     QCSTCHVLLRSAEWLGKVEKLFAITDAEQDCLDKAPGVSDASRLSCQLTLSGELNGIE
                     IDLPTSTLDVRWQAAYRRSTKK"
     gap             1252049..1252147
                     /estimated_length=99
     gap             1252821..1253223
                     /estimated_length=403
     gene            complement(<1253225..>1254931)
                     /locus_tag="LDBPK_312610"
                     /db_xref="GeneID:13389680"
     mRNA            complement(<1253225..>1254931)
                     /locus_tag="LDBPK_312610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863300.1"
                     /db_xref="GeneID:13389680"
     CDS             complement(<1253225..1254931)
                     /locus_tag="LDBPK_312610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863348.1"
                     /db_xref="GeneID:13389680"
                     /db_xref="GOA:E9BN31"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR016201"
                     /db_xref="UniProtKB/TrEMBL:E9BN31"
                     /translation="MPVSVRGLHRVAGLVVACMILVITATAAAASIVDYTVAQVFQKD
                     LSRQPSSHWAQYETMCDAPGSARKIQLVDSLHRIFECIHTENVRFPYYAWNSTSWYAS
                     SMGFLSPTPYGMCSGYCPPRFFADLRGTYAFSDNTAVVYDGGGDWPMISFYAMPFETT
                     EVSSSKSFILTLESSDGSAKYTTVEYCNVPILGGTGSAQTQLTAQVVVYANGTIIMRY
                     ASLPDTSTLPEYMPSTGLIYSKTLRTVVPTPTTVNGIVAYRFDPVFDGCAAHGDASVC
                     TADTGGDCVWCSSTSACCASTLASAVCPRGQWTTPASSTAAFAPQKFYDVTVDFDTPF
                     VTMSSHNYSYTLEKGYFPLHLQYPEQNIPLFQTPSQSIMNCIPGASCPTQADTHSCGL
                     YRSTCVNGNYTLSILALESLFTFAKGGLWTAKLLPERARGEELCEEEGGCAPGVVGQL
                     TRVAFRNSYSSMPLFSVQLYVDVNGVIDITIDCASCAHGDPMLAYPPMRVGLVRYGVD
                     DVSSVMIPQGLLRSGLHVRFVPLSSCKDCGLNGWCDKVSGTCQCQPGYHGSSCVACPA
                     CWT"
     gene            complement(<1256366..>1258732)
                     /locus_tag="LDBPK_312620"
                     /db_xref="GeneID:13389681"
     mRNA            complement(<1256366..>1258732)
                     /locus_tag="LDBPK_312620"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863301.1"
                     /db_xref="GeneID:13389681"
     CDS             complement(1256366..1258732)
                     /locus_tag="LDBPK_312620"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863349.1"
                     /db_xref="GeneID:13389681"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="UniProtKB/TrEMBL:E9BN32"
                     /translation="MFYTYVEKQGGGFFGCWQTRQVAFDTLRRYLYYSEAVRNELPVV
                     HSHTPEAADATTTTDDNRRSGNVAAEPAHTGRVTPSSASLECAVSEVTVPPASLTWRR
                     KLKVTGVLPLATRPEFSAEHCLNERDFYQLEIEGESRPMARGETPPAGPLLCPAAGLS
                     QHERSRCNWSNDAYIRDPFFLKELFDSLRDQFEYLEAERARAAAAAADSGDGAADLTS
                     NSVVGAGVQTLVSPRGPKGELLHQGVVVPVRLIFRSRDEREFRRFWYVLQSVLGYDKL
                     IVRPYRGLPPYDPRNGVAFAHIPMSVWHTFHSLDKAVFYTFMRGNVYTLGEASSCGTA
                     SSTAAFHESSMPGSFASTPKLKRILKGAYLCVTHDSVLCMRDTGSIPRWLRLAEVQEF
                     HWNLVARDAATNMLAPFCVFISDEPIPDLFFEPLPPAHGTDAIAAYTPLVDVRRLACV
                     IHDSCFASLSTRRVIRMREVRDASMESYVARTVQEGQRRPVLERGAGHNSTLSCPLPK
                     EQLATVWQQVQAELLERGNMANRAAIPIYASNARDVELSEDQLSAVERALDDTRERRD
                     DIVGMPLERARQLERQGRAAAAVVTRANRLRQRHRDDTVGAHRDPAPVLVRASAAREG
                     TSAATPSTATTVARVAPLTMELLQTPQIQGHFARGTADGQAVQASQSDEGDASSAQSK
                     SCSESTVVASEYSSYLVPGARYISQEEWQSGAYATAYSALSADRAADVPRHSAAAVGA
                     DESAASTNKTAIAAASPPYAEERTLNEIIGRSMAALEESRTDLHHLDP"
     gene            complement(<1260945..>1263596)
                     /locus_tag="LDBPK_312630"
                     /db_xref="GeneID:13389682"
     mRNA            complement(<1260945..>1263596)
                     /locus_tag="LDBPK_312630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863302.1"
                     /db_xref="GeneID:13389682"
     CDS             complement(1260945..1263596)
                     /locus_tag="LDBPK_312630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863350.1"
                     /db_xref="GeneID:13389682"
                     /db_xref="UniProtKB/TrEMBL:E9BN33"
                     /translation="MFYTYAEKQGSVFFDSWQMRQIAFDTLRRHLYYSDCVSPEKIAY
                     PNANDNPFPTIGASDDSFEDGEDFDPGLGTTVENPAVSQLILRPPVSPVNQRRHFNEA
                     PPPPNNPDDVQWRKKIKVDMIVAVGKEHVFLLEDTHLKETDLFQIEIHGEVRPMASGE
                     TPAPGPLLCPSAGLSGMPNRCTVENDEFIRDPFFLRELYEALRYQFSNLRMERERAEL
                     AAGQPVVSANARKTQTLESPRPKGGSVYRGSRIKIVLRMRTDYEFRRFVYVVQTVLGY
                     DKLSARPYRGLPPYDPRNGLIFSVIPMCVWHTFKLLDKTVFYTFLRGDLVGRSAGNQL
                     YVTLRGAYLCITHDSVLVMRDTGNIPRWIKLQEVREFYYNVTGSRPFVAFLSDPGSPD
                     IIFLPQPPVFGPEAIRRFSPSLEVLRMRHVIHETCFASLEIRRVINIKIADMSVRSFV
                     ECYERETRRVLDLDAARCYAGVLSCPLPKEQLAQVWREVQGIYAARDPSVISHAAIPL
                     YQNNTNDTALTRDQLETLSRRLARERASRDDIVGMPYEEAQRIQAPARRDSRLHSRHH
                     LTPLQLHETTATQPASDATSVHLDPQSSHSSASPGRGETLAATSSHPRGIQMTTVANL
                     EHAHDQRSAGHDSAYDGSAGSQLEGSAVSATSSPRRPILLSAAPPNASSWTAADASAG
                     GNTHRLSDVSAPNLSGDAAMSSGVDNAFTQTNPRLTQLPNHRLGTPQLSSSVGGGAAG
                     FGASPGFVNASFASSQFGGNSVQYQIPGARYLSEDEIKGGSSCVAVDHHTVLMGETPL
                     VAEGTVTALLSSTELNVSEIVNKSITAMQATAPPPPKRSNSAEPSKDTRKGSEGKAAS
                     AALASPRTRAGRPTSESIKNDDSSVET"
     gene            complement(<1266034..>1269369)
                     /locus_tag="LDBPK_312640"
                     /db_xref="GeneID:13389683"
     mRNA            complement(<1266034..>1269369)
                     /locus_tag="LDBPK_312640"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863303.1"
                     /db_xref="GeneID:13389683"
     CDS             complement(1266034..1269369)
                     /locus_tag="LDBPK_312640"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863351.1"
                     /db_xref="GeneID:13389683"
                     /db_xref="UniProtKB/TrEMBL:E9BN34"
                     /translation="MHYFFLEKQSPLTQRWQVRQVAFDSKYRYLYYTKSLSRADIEEV
                     MTRCHDGDPSSGACPNSSSGTSSRKVKWSGKVKVTQLRYAADEYIVAPGSSDFDERIL
                     LTLIVVGYERPLGKHRSRGKVASSGNHSIGGTSEKSFSLWSSVSRHYSTSRISSVRLG
                     DSDGDADEDAASKTTGVNQPLLLNAENDVPEPESPSGFLHMPSYPVNESLDDDFEDED
                     ENMFRDIDLVPDDEEDEEETSVAASEAETEEGSDDCDADDGDDVAFNSPPSTPTGSTR
                     SSYSFFSRRQQSTKGVGKAKDEKTVQLQFRAANYDVFRIVSLRVRQALVRHGLCGPLH
                     AGLPPYDPRNGIALATVPLHLRHAFRRLNDVVFYSLQIGHVVYVRQQREVRGIEGYLC
                     ITHDSILLLQLDGKCPRWLDLEDIVGVQYVLRSNHSFISIRAAEPYPDFVFIPIIPSY
                     PPNSTFNSEECVEGIVSMVRRLLMQRLRAGEEVALAPISSCRFSVQTAEDIEEYDILC
                     HISDLSNTYTDVFKYIAQQQSTGAVPLRWRWDNSKTPSHFTFKRDLYHALEREEGEDS
                     EDDDEAALSRSQRRPSVASAAASHAHMVESLVPSRQQQHLSTGGGLVAVPVSAPASSG
                     AIGVHAAARSTPCMTPSCASQKSLRSALPPQDLLYSNASFMPATMTQLMAPPSRGAEL
                     RAKRKLLVTRTDRRNAGVAEAARNATGHHQPPLSRPPQPASVTAGTNLGLTQESSAAP
                     DITLTTAPVSRTPPEDAAPSALPPRPNTGGREAAIGAPPASPGLPPQRDTQRASSTPV
                     STRPASSKPNTYGLVPSQHHTDPATLDFWFSTAAPPVAPVATAQKGVHLSDIHSSIHH
                     GQPAAQQQLATQPTGAASGGHERLGVVPSANQRGVSAAPSAQAVKVVCGAPGIFGSSL
                     TSTTAPVGAVSAPYSFASAPISGGAFSSALQRAHSPSAGHGDSATNGSRSPKEVTHTT
                     ENMSNERAADEDEESDEDFDSEDMESMLQRPESRAPPASAGTTTPAAAAAGASGEAAL
                     DAAGAMAAEMKDGVVMNTDGAAFVPVGGGVVTQVMLTAEMLPGYGGRRDEDHRSDAAS
                     SPSPSLQARPEMVAFISPVALPH"
     gene            complement(<1271567..>1271779)
                     /locus_tag="LDBPK_312650"
                     /db_xref="GeneID:13389684"
     mRNA            complement(<1271567..>1271779)
                     /locus_tag="LDBPK_312650"
                     /product="ubiquinol-cytochrome-c reductase-like protein"
                     /transcript_id="XM_003863304.1"
                     /db_xref="GeneID:13389684"
     CDS             complement(1271567..1271779)
                     /locus_tag="LDBPK_312650"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase-like protein"
                     /protein_id="XP_003863352.1"
                     /db_xref="GeneID:13389684"
                     /db_xref="GOA:E9BN35"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="UniProtKB/TrEMBL:E9BN35"
                     /translation="MASDPVDIKLDLEKECLANECAKKVGAYNACLERIKTVSPEKEP
                     HCYNQYFAIVHCVDVCVDPKLWPTLK"
     gene            complement(<1272892..>1275666)
                     /locus_tag="LDBPK_312660"
                     /db_xref="GeneID:13389685"
     mRNA            complement(<1272892..>1275666)
                     /locus_tag="LDBPK_312660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863305.1"
                     /db_xref="GeneID:13389685"
     CDS             complement(1272892..1275666)
                     /locus_tag="LDBPK_312660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863353.1"
                     /db_xref="GeneID:13389685"
                     /db_xref="GOA:E9BN36"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="UniProtKB/TrEMBL:E9BN36"
                     /translation="MSCADVRQKVFRVPGSIVLSVGLSWDFIGADPVDLDLSAVCFTK
                     EGRFLDVVFFNHLFPEGTDETALRAHHMVDPELLPYMFLSGDSTVGGEDENQLPGLAL
                     AAGRRHQQLRRRARHQATARGGMLGTRDYTNAAANVFDRLYEEEQLADVQRAADEAIG
                     YDEDTADDEVGAGQRPLRRRPCRHRELADEVLTFFMSKIPSEADVIFITVSSYTGQDF
                     TVLSRAKLIVYNESTSERVGVMNVRQTTENGTANLAAMLIRLPPSQEEEGVDGTDWGS
                     VHGGAAAQEWDLRELNVRTFGYSFVDTLPLMMDVLGVPRRSLLDVLQNVPDYSLSKVK
                     AGIASWTLSDVRLGVGWSGEHDIDAFLVFLDENHNYVDHLYPKNGKLRSMARDAARHS
                     GDALCGSNAAGDEEFIDLLTYRVPGNVSSIVVGATWMESFGPEKRTCKSIFDVPDLYL
                     RLQNRTVMNPHSMEVDRWPLNREAHDPKVKKQLPTSYKDAENKEQPVRAVVLGALVKT
                     GTQPFGALFPNGRRIDQYFHKHGRPLSVSGTGQTRSASVTSRADDSGGVAMSEFEADR
                     EEEVPLFQLVPIHQYVPVDPREGLSRVIPYLQCMMAYAATVERHTIAAARRRVAEAEA
                     ARRGNATPYSGGESSEAAPLDTTAGTADTRLVLSRENNMVGWNPATSASLRRGGRGET
                     TVKAAREQAASDTAETTVLRDRYECMWSKMKHYDNRTDLFAIAVQFLEVVEVQPQMPD
                     RFRCHGEAWVFGQTNCIVPAHGSVSVFDNKPYRSPVLVDREKLAWADASSSSSGCGYF
                     IVHKYDRLRVMLFETASVGVADLDLLSMDALWAGKDNVREGTLADRFNPVECNVRLEG
                     GVNDAGTGELAYSAEVRLRVSRVPLNAAMKRLQQQADRINAQRGHVQKLQNRYDERYY
                     NEQYKPCTVM"
     gene            complement(<1277389..>1278591)
                     /locus_tag="LDBPK_312670"
                     /db_xref="GeneID:13389686"
     mRNA            complement(<1277389..>1278591)
                     /locus_tag="LDBPK_312670"
                     /product="calreticulin, putative"
                     /transcript_id="XM_003863306.1"
                     /db_xref="GeneID:13389686"
     CDS             complement(1277389..1278591)
                     /locus_tag="LDBPK_312670"
                     /codon_start=1
                     /product="calreticulin, putative"
                     /protein_id="XP_003863354.1"
                     /db_xref="GeneID:13389686"
                     /db_xref="GOA:E9BN37"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR009169"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018124"
                     /db_xref="UniProtKB/TrEMBL:E9BN37"
                     /translation="MAQRAMLAAVVGVLVLCVYVVQAEIFFHEEFNTMDGWVQSEHTS
                     DYGKVALSVGAIHVDAEKEQGLKLMEDAKFYAVSKKLPKAVSNDGKSIVVSFSVKNEQ
                     KLTCGGTYLKFFSELDQKDLHGESAYWLMFGPDTCGSSTRLQFILSYNGTNHLWKKLW
                     RPKTDKATHVYTVEIAPNNTYQLYVDGMHIQEGSFEEEWDMLPPKTIPDPTDEKPADW
                     VDDMMMDDPSDTKPEHWDDEPATITDSEAVKPVDWDDAEDGVWEAPKIPNPNYRGAWT
                     PRRIHNPDYKGKWAARQIPNPAYKEDPNLYRAPAPLQYVGIDVWQVEGGSIFDDIIIG
                     DDITEVLGVVKSTYGAMAEKERDLIQAEEKKEATKEPAEAAAEKPNVGEHADHTPDEG
                     DSEDKEDL"
     gene            complement(<1279655..>1284643)
                     /locus_tag="LDBPK_312680"
                     /db_xref="GeneID:13389687"
     mRNA            complement(<1279655..>1284643)
                     /locus_tag="LDBPK_312680"
                     /product="RNA polymerase ii largest subunit"
                     /transcript_id="XM_003863307.1"
                     /db_xref="GeneID:13389687"
     CDS             complement(1279655..1284643)
                     /locus_tag="LDBPK_312680"
                     /codon_start=1
                     /product="RNA polymerase ii largest subunit"
                     /protein_id="XP_003863355.1"
                     /db_xref="GeneID:13389687"
                     /db_xref="GOA:E9BN38"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:E9BN38"
                     /translation="MSGGAPLPPSQMPLQKVHEVQFEVFKEAQIKAYAKCIIEHAKSY
                     EHGQPVRGGINDLRMGTTDFEYSCETCGLKHPECPGHFGYVELAEPIFNINVFDVVLI
                     ALKCVCKYCGALLMDTNDPSEMKKIAHLQGLNRLRMVAKLCGSVCKRSKDIQGCEGKG
                     RQPRIGRFAGIYPGLQIKVTQEEQDYVWHAENARQVLDRVSDSDALIMGFDPRFCHPR
                     DLILTVLPIPPPQVRPAVAFGPAKSDDELTHQIMSIVKRNIQLRKDKESGVKAAVDRS
                     RALLQEHVATFFNNASTYYKPAKVGDTKKLKSLTERLKGKYGRLRGNLMGKRVDFSAR
                     TVITGDPNIDVDEVGVPFSVAMTLTFPERVNVINKKRLTEFVQRTTYPSANYIIRPNG
                     NVTKLALVKDRNAVHLDVGDVVERHVIDGDVVLFNRQPTLHRMSMMGHRVRVLNYNTF
                     RLNLSCTTPYNADFDGDEMNLHVPQSLLTKAELIEMMMVPKNFVSPNKSAPCMGIVQD
                     SLLGSYRLTDKDTFVDKYFIQSVALWLDLWELPIPAILKPRPLWTGKQIFSLILPEVN
                     HPASPYDKPPFPHNDKKIMIQRGQLLVGAITKGVVGAAPGSLIHVIFNERGSDEVAKF
                     INGVQRITTYFNYCFAFSVGVQDTVADATTLKEMNNVLHKTRQSVEKIGAAANNGKLT
                     RKAGMSLLQSFEADVNSALNKCREEAAKKALSNVRRTNSFKVMIEAGSKGSDLNICQI
                     AVFVGQQNVAGSRIPFGFRRRTLPHFMLDDYGETSRGMATRGYVEGLQPHEFYFHTMA
                     GREGLIDTAVKTSDTGYLQRKLVKALEDVHASYDGTVRNANQELIQLAYGEDGLDGAR
                     IEGNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKL
                     QEEFEQLMKDRAMSRLVIDMEDKNKLKMNLPVNVARLIQNARTTMGKRSQVSNLNPIT
                     VINRVRELQEDLVQLFPSYHKDYNGRFANVLSQQRVERALTLFGIHLRQILGSKRVLK
                     EYKLNDKAFEYLLKEIRTKYQQSLITPGEIIGAIAAQSCGEPATQMTLNTFHNAGISS
                     KNVTLGVPRLLELLNVSKNQRNASVAVCLIREYQKRNKAQEAQQFIEYCTLANITTTV
                     QIIYDPDPRNTVVAEDEEMIRWEQAVMNEEDEEPDAEQPPSPFIARLILDNDLFNDKR
                     LNMKDVKSAIRQVDDTYMVQANMENDGQRIVRLRPRKCTGADSVPALTKAVAQLLQSV
                     HLRGIPGIKKTLLKEGNTFRVDPETGGIKNESSWMVDTEGTALQRIFVGVVNNEGKNI
                     IDFSKTSSNKIPEVVTVLGIEAARRKLLSELREAYLAYGLNINYRHYTILVDTMCQRG
                     YLMAVSRTGINRSETSGPLMRCSFEETVKVLMTAAAFGEKDPVRGVSASLVLGNQARI
                     GTGLFDLLLDMSKLQHVVPLDKATEARTSNVYHTDASVAPGSSTLQGSHGELPPSTVH
                     ENSSLAAGASSVYPRHERAGMYGGIPIEASEVQFSSALPTVMGTVLAASNTTEYHSSH
                     HLSGASTYLASSALPSASALDTELSSYHLQSVARSTAYGYAPVTASGMPMPGGAQLSV
                     GEGGSMPYPYEASNGERFGSLGGAASSRASAPYDPTQQPSQEFSPTEEQEEP"
     gene            complement(<1285526..>1286704)
                     /locus_tag="LDBPK_312690"
                     /db_xref="GeneID:13389688"
     mRNA            complement(<1285526..>1286704)
                     /locus_tag="LDBPK_312690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863308.1"
                     /db_xref="GeneID:13389688"
     CDS             complement(1285526..1286704)
                     /locus_tag="LDBPK_312690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863356.1"
                     /db_xref="GeneID:13389688"
                     /db_xref="GOA:E9BN39"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:E9BN39"
                     /translation="MNRCSLRQQGARLDTVKPVKQAFPADVPPAAHSPAGAPDGHGTV
                     FSHHDGEAHNDTARRDEQASYSSQSPLPPAPSAVTPYTGNWPPYALLLVSCLIVAAAG
                     LGGSAARVALQKCFEKSPFFPKYNYIGPNILGSFLMGFSVTVLPPEAALPLTYRALCV
                     GFCGSFTTFSSWIVKVMVQNTVADAFEHLLIGGTMPLVFFLWGRDCGRGVRWCCAHVV
                     GSPWETWPLHCSLLRAVDAVVLVLVVLASVLSPVLVLVYISEGGIRAISADDVRVVAL
                     APAGAVTRFVLSVCLNKRACAAQFPLGTLAANLLGVLLAVVMCNMEVNHLSCEWCIVV
                     RNGIGGALSTVSSVANELVSFYGSGRMPLAYVYALVSVGFSVFIAGVGRPQLHRRGVS
                     "
     gene            complement(<1288622..>1289719)
                     /locus_tag="LDBPK_312700"
                     /db_xref="GeneID:13389689"
     mRNA            complement(<1288622..>1289719)
                     /locus_tag="LDBPK_312700"
                     /product="serine/threonine protein phosphatase pp1(5.9),
                     putative"
                     /transcript_id="XM_003863309.1"
                     /db_xref="GeneID:13389689"
     CDS             complement(1288622..1289719)
                     /locus_tag="LDBPK_312700"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase pp1(5.9),
                     putative"
                     /protein_id="XP_003863357.1"
                     /db_xref="GeneID:13389689"
                     /db_xref="GOA:E9BN40"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BN40"
                     /translation="MVGLSKVEVIIGKLLLNPAHNTAAPKRDANSPLSSFARQSRLKA
                     FQAETAAAAAAGAPKADSANRTGHTRGRSSSSISDPREFATGEMTEEEVVYLVMESRK
                     LFMSQPMLIEIEAPVNVCGDVHGQYHDLLRLFELGGYPPDSNYIFLGDYVDRGEQSLE
                     TVCLLLAYKLNFPNNFFLLRGNHESSSINRIYGFFDECKRRYSVKLWKLFTDTFNCMP
                     VAGLIDGRILCMHGGLSPELHNLDQIRRILRPSDVPDSGLICDLLWSDPADDPIIGFG
                     ENDRGVSWTFGENVVENITQALDLDLICRAHQVAEEGYKFFAKRKLLTVFSAPNYCGE
                     FNNYGAFLCVDENLMCSVKQLVPLFEVDDFE"
     gene            complement(<1290632..>1292068)
                     /locus_tag="LDBPK_312710"
                     /db_xref="GeneID:13389690"
     mRNA            complement(<1290632..>1292068)
                     /locus_tag="LDBPK_312710"
                     /product="2-oxoglutarate dehydrogenase, e3 component,
                     lipoamidedehydrogenase-like protein"
                     /transcript_id="XM_003863310.1"
                     /db_xref="GeneID:13389690"
     CDS             complement(1290632..1292068)
                     /locus_tag="LDBPK_312710"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase, e3 component,
                     lipoamidedehydrogenase-like protein"
                     /protein_id="XP_003863358.1"
                     /db_xref="GeneID:13389690"
                     /db_xref="GOA:E9BN41"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:E9BN41"
                     /translation="MRAIGYGKSVCIVEGGRIGGADLWGGTVPSKMMYEIAHFAASLT
                     GPEFARDLVNPDEMQSIVDSIPSERITQLLKKTCAEKEREYRAFLEASGVQLIEGKAT
                     FANPNEIDIHTEGTGEYRSLQADNVVIATGAIPRSHAFAKCDHNRILNSTDVFQLPIP
                     ASMVVIGAGAMGCEVASMFAKLGRTKVRLVDKAPRILPKEDEDVASYVQRHLIRRGVV
                     IHQGCRLFDLEAGEEDCRYSLRDIFSGDIETYHAERAMVAVGRQPNVGALGLENTKMR
                     VENGQLDCDEYGRCKPYKHIYCIGDATGRQKTVNTAQTAGQAVVDTMFGCSPKLAVSN
                     NALTNIATDMFLEDEVASIGLSEKQCRARGIGYIVARLEYKHLTRSIVMGAKDGFVKM
                     IVTNDREKRVLGVRAVGPHAGSVVEVASLPILKNESVYTMLKHNPAYPSLVSGVIECA
                     AMLVGRGARCSNVVEGISIKDWTPADRA"
     gene            complement(<1294088..>1295725)
                     /locus_tag="LDBPK_312720"
                     /db_xref="GeneID:13389691"
     mRNA            complement(<1294088..>1295725)
                     /locus_tag="LDBPK_312720"
                     /product="acetoin dehydrogenase e3 component-like protein"
                     /transcript_id="XM_003863311.1"
                     /db_xref="GeneID:13389691"
     CDS             complement(1294088..1295725)
                     /locus_tag="LDBPK_312720"
                     /codon_start=1
                     /product="acetoin dehydrogenase e3 component-like protein"
                     /protein_id="XP_003863359.1"
                     /db_xref="GeneID:13389691"
                     /db_xref="GOA:E9BN42"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:E9BN42"
                     /translation="MLRRTLYVLARPRELAAASRDKAHFDVCVIGGGPAGIAAALRAA
                     DYNKRVCIVEKARLGGNDLWDGALQSKTMWECSSIMAKMRGDAAMRLYGESLDRYLEI
                     DEVKMRQSMERVSRIREEQIQVALKASPNVELVFGRATFNSNHEIQCHNKRTKEFRSI
                     TADYFIVATGSKPRKHPYVATDGRLVMTSDHIMRAPLPKSLVIVGAGVIGCEFASIIG
                     RLGKTKVSIIDKAPHILPREDPDIVRVIESGMDRAGIVVHHNSDLYDMQPWEETEEEA
                     KARHPADPAPQSGVQYTLMDRTTRKLTTFQVERALISIGRVPDYSRLGIENTTLKTRG
                     SQLHVNEFGQCVGTPHIFAVGDAATHMQLVSMGEAQAKLAVDYIYGTEPKVVPNLTET
                     MSSVAFLTRAVASVGYNESQCREKGIAYIAARYSYEVVSRAVAAANTKGFVKIICADD
                     PERRILGVRALGMNASTLVDIGALAIQNGQSVFDLAGRLTAYPAVSQAFQECLRSILD
                     LPAQLHADPARGVKLTKWAPPDMSRGVAYKGKAAASG"
     gap             1298874..1298972
                     /estimated_length=99
     gap             1300192..1300290
                     /estimated_length=99
     gene            complement(<1301239..>1302972)
                     /locus_tag="LDBPK_312730"
                     /db_xref="GeneID:13389692"
     mRNA            complement(<1301239..>1302972)
                     /locus_tag="LDBPK_312730"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863312.1"
                     /db_xref="GeneID:13389692"
     CDS             complement(1301239..1302972)
                     /locus_tag="LDBPK_312730"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863360.1"
                     /db_xref="GeneID:13389692"
                     /db_xref="UniProtKB/TrEMBL:E9BN43"
                     /translation="MGFCLCHPKSTTALHAEQLEKLEAVPTEAPASASAPKIPLLVEP
                     HDTKSTCPPAPPDPSPVHERELNGRCSSLSRSTIIEGCGNPGWAPGTRAFVGRDDSAH
                     RGTSPRTRTLATDSIFDSSFQRGSDVVSRTLNCPSAAHSSNTSPLSLRDTRAGKPGSL
                     SVTDMHTIANGVANHTRSISGPADALQLSSILRPSSGWTNSRSPLTQNRPPSTEHWSS
                     SQSSGPQTTLVPSRGSVCFLGSDGKAAEPQGTGSNEVSHQGDQDRLKETSDGARTSAG
                     TPTAQGNRQRVPRSLIAGNGGADGGSPKKKTDPKFCSPAPTAASVSRETPSPWPSVEG
                     PPSSPSHHNGVFNDLAYFCFSENSDQSGVFYGNGGSGEMPPAAPLLTATSRASQSPKS
                     ILLRPSANTSGAGGLWTPQCPVSLPWQDSVSSGLRRVSRRRKSEQDGLLSERRPSFDV
                     GLPHRPSSSGLHRSGRDEDSGRDDAHIIASVRRTMMRLQRSDGAGSVCSNGPSRHGGR
                     LSSADINARALRTAERISVAMLSVPKAVKTIVDSKGSMSCSATSDSGSAETTSGARAP
                     APDPKKPTISQ"
     gene            complement(1306493..1306738)
                     /locus_tag="LDBPK_312740"
                     /pseudo
                     /db_xref="GeneID:13389693"
     misc_feature    complement(1306493..1306738)
                     /locus_tag="LDBPK_312740"
                     /pseudo
                     /db_xref="GeneID:13389693"
                     /db_xref="PSEUDO:CBZ36672.1"
     gene            complement(<1309397..>1311409)
                     /locus_tag="LDBPK_312750"
                     /db_xref="GeneID:13389694"
     mRNA            complement(<1309397..>1311409)
                     /locus_tag="LDBPK_312750"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863313.1"
                     /db_xref="GeneID:13389694"
     CDS             complement(1309397..1311409)
                     /locus_tag="LDBPK_312750"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863361.1"
                     /db_xref="GeneID:13389694"
                     /db_xref="UniProtKB/TrEMBL:E9BN45"
                     /translation="MTDPHTSTGFARTPMLLISCAPLAAVLLLLLLCSAAGQARIVAG
                     VPASSVEHGTAALSDQSRLRWRHAIGKGSMLGLPSVRMQVAGEVFGAAAPSSRSDSAS
                     PSTSSTTSTTTTTTTTTTTEAPTTTTTTTEAPTTTTTPTEAPTTTTTTTEAPTTTTTT
                     TEAPTTTTTTTEAPTTTTTTTEAPTTTATTTEAPTTTATTTEAPTTTAAPSRSPSTTF
                     SAAAWAGVIIGSIAFGILLGASAVLLVFVRTCPLLCCRRSSQADQEEDDNLAETREMK
                     SENYGTSQWSSEYGKPERQVKSFSNQFHKDGLLSAHDHRNANPLALPSAHSPKRAPPP
                     VAGDPAHVNNFNNRPYVHNGIVPWTGRLPVLRGPQPACMIPTITKEGKVIPREQRVLP
                     GLGLVETPIIPITLPAPPSLSPKTGTAAAFTRAKEFVRSKVLRRLRGAKSAEEEQAAA
                     VAAMKDQPAVQWFHHLVYFTALGRSPEISSLDESDADESGKHDDRGTRAAGVTVPAAA
                     AASAASGGTAAKLPLPETTAAPMLAPRAAPATPGVPPTATQRANTRLPAPQGVYDAQY
                     YPSAHSQMTGNSSAMMVCPPLYIVDHPVQPAYGMGGGGGAMLRSLAPGGQVVSRATAG
                     GGSSTSFPYPSQQAPSPQMQPYQQQLSLLPKQTILSQASRRSNPYA"
     gene            complement(<1312830..>1313402)
                     /locus_tag="LDBPK_312760"
                     /db_xref="GeneID:13389695"
     mRNA            complement(<1312830..>1313402)
                     /locus_tag="LDBPK_312760"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863314.1"
                     /db_xref="GeneID:13389695"
     CDS             complement(1312830..1313402)
                     /locus_tag="LDBPK_312760"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863362.1"
                     /db_xref="GeneID:13389695"
                     /db_xref="UniProtKB/TrEMBL:E9BN46"
                     /translation="MVTEWILSPELRRPADAQRTAENQTYATEAKGTEIARVRWALRC
                     MCVLRCRGKATLASVVTAGEAATAAGRAAHWGIPSAASAVPGRGLRPAFPAAAAGVAL
                     SLSLTAVRPHLRLLDLSNTTTLSSLDGIEVLVALEKIELIRCSQLHSLSPLETASSLK
                     DTVASQSCVLDLSGVVQSRTRLSRCVCTGA"
     gene            complement(<1316799..>1320749)
                     /locus_tag="LDBPK_312770"
                     /db_xref="GeneID:13389696"
     mRNA            complement(<1316799..>1320749)
                     /locus_tag="LDBPK_312770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863315.1"
                     /db_xref="GeneID:13389696"
     CDS             complement(1316799..1320749)
                     /locus_tag="LDBPK_312770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863363.1"
                     /db_xref="GeneID:13389696"
                     /db_xref="UniProtKB/TrEMBL:E9BN47"
                     /translation="MSSRSSASPSRASLARVLAEARQGRQSRHASSAQLQRYLLRWFP
                     RGLWSFIYRASPRGGQGVAAKANVYRRFCRDPPRVSHEWTAALQLVELACLVDTMPGT
                     SLSKGHQEAGLPISIPTPEPDSVVQATEHLLRYGVFPPAGWALTLRLLHQWRERQPRA
                     RLHVFPTSLSPPAAAQLLHHISLAPPSQQAWQDALCLYHLCATEVHTPSSNGQPLSTK
                     TVASPSPPRSTADTAVHSAFLKALRHMTLTTFLQADEWERGLHFYYHTLYQRDLPGPI
                     TTSYLVQQLGRAGQWAAVLQVYELCVKLLHAQRHQREQQQRLPLHGDDWSSRQWGTTL
                     SMAMAAAQNSPGAPASTLAAMMRQLQPGIGTTSTLSTGMTGAASSSSPPLVRLSGHFL
                     SALQALPSEKDRLTVLGLARSGSLLDIFKLIRGLISKHKWEEALLLFEEAMRSKPART
                     LSPDPRSGGAPGPHASAEPTIRKPLALSRREIGEARLGFLHEATIDSVTAVVAALNRH
                     RSATGKLRAGAQREGEGARHPPCAAEVNLMQLMLNDREVECVLSKTLALREAEHRVLS
                     PAALGTREHFWRYCLELLAFNYGALPCGDASAKVSRSPEQGNEGHSGPPRSPRRTPTL
                     AALSFLLRHPQLPWHVALRLLRHYGVLETCPDERAAASTRATGRRAASPSSVVQRTTM
                     SSPPTPRSLTLAAAVELLRTQGQLQAAEKLALESLDMEVAEKSLGAGAVVSLSAALLE
                     VAQYPTLRSVLLEREEERLTVEGSTLFHLLHESTRVRRTQGEDHGDDGVHGTSCETAN
                     SSAPPWWAGSAAFFQHPSGRALTVVWLLMQRRMHPQMTTTDAARQDGSGSLLSSLFLC
                     VPPPPTASVAAASLAAPLHSWLLAYPVAVHCEVVRAIKCLTSPSAPSMSSTSSSPEAG
                     LCYTQRWVWTRRYLASLAAHFSAPCTDTRARSEEGSFVENEPGHAAADAVAREAYYGA
                     TFEAVVSLLDAAVPRTPDSRDRVSQRMQMDAFTPATVAEQGEAAPRNSAKRVQQLCQL
                     LERAIMRYGCLPPTHMLLPNQLDRLLPPLPRSGLPSTDVSVGEKQSRHDCVDRDGACA
                     ERCAVALHLVRLVLGALKDAGARYSVEPVLLHGLLKLCCRVAEHDQASLTVAKGAIGS
                     DIDISAEVSRAGAMLVRLQCELCGLQTVRPGTLSLLYHLCAAAQSRASSYGHTVPRQV
                     ALETTRYLLEAQTAAAARKDQRHQRQEGALPSATSASTASSLRPQNGQQRLDALSPFC
                     AVQARHCELFFSLLGWEDALEVWYRAYPHEVLTQLSRNPQAVEACLSLGESSQI"
     gene            complement(<1321346..>1324021)
                     /locus_tag="LDBPK_312780"
                     /db_xref="GeneID:13389697"
     mRNA            complement(<1321346..>1324021)
                     /locus_tag="LDBPK_312780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863316.1"
                     /db_xref="GeneID:13389697"
     CDS             complement(1321346..1324021)
                     /locus_tag="LDBPK_312780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863364.1"
                     /db_xref="GeneID:13389697"
                     /db_xref="GOA:E9BN48"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:E9BN48"
                     /translation="MVRRRLVIDPIWRVIDAQQYHSLWEVLSAEAVSYGFVGFDMEWT
                     TTLQVPDADSDTNRPPMACGTSGKSKARRLLGPVATIQLSTYSCTIVVKWIHLHALTA
                     GGFADVLRDPFAPASACWPCYREGQRQNSVALLHKVYTDLLRLIHNRRIFKTGVGIHG
                     DEVKLHRDYPAAQLRSAVDLVELADACLPDMVPDHSLKHTNQEVTLVRTDSLRSLKNM
                     CSALTGRELGKDMAVVMSDWGGCHGALTPLQIEYAAQDAEASYDVCVAILKSGGFIVD
                     NPICATHSDNTATHLPWCTVKELDCREVLACCARPPMSSFKGTSAALKDAGNATGGIL
                     CDALGAGVNASASKEPCTTAANEGDPLQWCKGRERPYYDNISVFDPDMQLVFTVDKTK
                     ADWYVNKKGLARVVQWRTPAGAIVREEEKATLSDSVDNLVVTAIQLSFVPDFSRYNDV
                     HIRRNMDYFKQPKENICVVCGSGGMLVRFAVVPLMYRRFFPSVYMSHNSYDLLLLCPH
                     CFAKSRRLYDRLRQNVADDFGIPLMHLRGKQRDEYADVILKTEQAINALSAAYEEAKE
                     RVLPTPGHEDVPERDCDLHPRLRLRGMQDFLSLMVHREILDKVFSFAKALHHHYESLQ
                     RHGEACDSGIDKENVVATPGGACRPSGTPTGRRRSDRRHRQRAGTARAAAATILPEER
                     RTMMIEYLQTHASVYPFFARQRGEDSCQAGWQLQDAVFHAERDGAASAQGVRFILTGV
                     SALPDAAGYAYRESAGVQQGNSSRSVLTRYWVGEHSELLALLPTLTRAEERLRQPASS
                     DETRESNGGPAQRSSPPADMTADSEVSEVPYVDSHAFLVVRLLLEKYSDASSGAKTGE
                     HAVGQFIFRWRSSFVEGMHPQHLPRGWTPEDGILR"
     gene            complement(<1325047..>1328304)
                     /locus_tag="LDBPK_312790"
                     /db_xref="GeneID:13389698"
     mRNA            complement(<1325047..>1328304)
                     /locus_tag="LDBPK_312790"
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /transcript_id="XM_003863317.1"
                     /db_xref="GeneID:13389698"
     CDS             complement(1325047..1328304)
                     /locus_tag="LDBPK_312790"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /protein_id="XP_003863365.1"
                     /db_xref="GeneID:13389698"
                     /db_xref="GOA:E9BN49"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BN49"
                     /translation="MSINSSAQAAAPAPATPKGSASDTGGTLTTAGNEPTVKKKKKLL
                     NGTNIKFTFPSGATYEGSFRDGRVEGYGVYTYAKTGDVYEGEWKADLKHGQGCYTFAN
                     GDKYTGQWYMGKKQGKGQFVFVNGNEYVGSWRRNEMNGYGLFLLASNGDRYEGYWNEG
                     VRQGEGRLYYGNGDLYDGEWCSGQQQGLGVFLQSNDDLYCGQWDAGVMDGKGVLREKG
                     ILFLVEYVGGYLISKQRQSDALDETEKEWAPAYRHYLAWIERHQAPAASTLTAKEHNK
                     LRDELQAALAENSILRKRLEDLLALHRPKALSDNSGGESPSTFLSAALEEAGAEYWKE
                     SLRKLESRLKLLECTLAERVVEVRKLREQLKKSDAKVRELELEDTRRKVWLRGTKDKS
                     AKETPLFNAQAPSAPPGLLDMDIIDANEVDQLREQNAGLMRLNEELQRKASFLATENA
                     KLALKEEAAEEQYDKLMEEVERLRVTLENEGRVNMSIEPLKTGDIAATAAVSESVAVG
                     VSSPVLPPFSPEMSLAREELQQRLMQANQLNIELRLRMGKLERTAQSKPSVAELSSFT
                     PEASELARENEMLRSVVASLKAELAVMQSGLNDAKQQIALAHQRQVELEESMKMITHR
                     KAANPQLHEALERKSARIANLELENAELARLLDETRADLEERQAISLETKQQSSFGSS
                     TVGGALNELEFAQKEVKKLQRRIKKFTGERNSVTEQVYELQMWLARTDRTLSALQGRV
                     TVFASIAGDGISGAAVADVAARVDATDSTKLVVCDCGEETTYQYDYCFDKDASVEQVF
                     AELCGPLAFVWSGYQLALMTVGGFRSGKTGLVKEILPLFTKYLSKEAGEKPQRLFFSF
                     TYRVAVVEISARGGFDCASGDNVTEVCCDSNGFVQPKNVRFVDCTSGSIPIVIDNLLA
                     KRRQHYNGRSHTWIQLQCVRTSVARQCQTVGRLTIFDWCGSALLASQKKDIESARFAN
                     ASSQGLRDLATALAGELPVIPYTKSVETSLLFDLLGGNSITAVVGRIRSSTEHIEETL
                     RTLHVLTSLFGVCNGPLVPDNQTSDEIRWQGLVAALCSDHQAERELKAVENIRDF"
     gene            complement(<1328653..>1329093)
                     /locus_tag="LDBPK_312800"
                     /db_xref="GeneID:13389699"
     mRNA            complement(<1328653..>1329093)
                     /locus_tag="LDBPK_312800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863318.1"
                     /db_xref="GeneID:13389699"
     CDS             complement(1328653..1329093)
                     /locus_tag="LDBPK_312800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863366.1"
                     /db_xref="GeneID:13389699"
                     /db_xref="UniProtKB/TrEMBL:E9BN50"
                     /translation="MVSFLALEVNLVMVPVLTLFLLYCVPIRAISVTAERITRLVEGY
                     NINGLTIMSAMAIISSFSFLFHILEWNSKYAAKQRFTDISLQLQHDNKRLRLERNMYI
                     QLVICVLCLAVKKCATLLRHQEPRREASAAPFRAAAATAHTKAA"
     gene            1329549..1329621
                     /locus_tag="LDBPK_31_tRNA4"
                     /db_xref="GeneID:13389700"
     tRNA            1329549..1329621
                     /locus_tag="LDBPK_31_tRNA4"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:13389700"
     gene            complement(1329656..1329736)
                     /locus_tag="LDBPK_31_tRNA5"
                     /db_xref="GeneID:13389993"
     tRNA            complement(1329656..1329736)
                     /locus_tag="LDBPK_31_tRNA5"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:13389993"
     gap             1329955..1329988
                     /estimated_length=34
     gene            complement(<1330140..>1331747)
                     /locus_tag="LDBPK_312810"
                     /db_xref="GeneID:13389994"
     mRNA            complement(<1330140..>1331747)
                     /locus_tag="LDBPK_312810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863319.1"
                     /db_xref="GeneID:13389994"
     CDS             complement(1330140..1331747)
                     /locus_tag="LDBPK_312810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863367.1"
                     /db_xref="GeneID:13389994"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:E9BN51"
                     /translation="MLRRLHTRIIGMGSVCGHAPSPPAELFLKTLPSPCDVDPAKYRR
                     FEREETEAHAARPPLTTAPASPLSAPEPFYDVVDAAAGHKHVAMLTREGNLITVGDNR
                     YGQTGALNSEVEDSGGDAAASPSLSRSSTRHGSGSSSVVRASSVVADLDPLYIDLDGA
                     FPQTGSSVIRVACGSNFTLVYQRNGRRVIAFGNNHMGQLGVGHKQRIDGVRGFMEWDP
                     TASWWPAGRASVLETVYCGFNHAVATLSDGGLYAFGCNNWGELGIGNSDAPMSPTRIA
                     FFEERGMRVVKVALGNSFTLFLTKEGRVFGCGATNGGQLPPNAFDPVPIPLIRSFQQH
                     GSDEAPHTVDGAPKLIRVKDIACVGSLAAFLSAKNELLIQGSLPEYGVMIPSPRFAAV
                     DQGPALKYFAARMGAQTSETDYDIVGLTGGPSTLLVRYRNGCVAALGANTEGQLHNVT
                     KVLNGQRVNLAPAFKATELFPVFVPAAPLWGAAWFASGKGFNLLFDKNEAYHVPEGAA
                     PIELPPGSGNARCVALNRQQRLRASLK"
     gene            complement(<1332260..>1333051)
                     /locus_tag="LDBPK_312820"
                     /db_xref="GeneID:13389701"
     mRNA            complement(<1332260..>1333051)
                     /locus_tag="LDBPK_312820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863320.1"
                     /db_xref="GeneID:13389701"
     CDS             complement(1332260..1333051)
                     /locus_tag="LDBPK_312820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863368.1"
                     /db_xref="GeneID:13389701"
                     /db_xref="GOA:E9BN52"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:E9BN52"
                     /translation="MLPFRRAARGVMLAPVGNVVLPLLLLLLHSSSIIVTAATYGSKI
                     EAGETECYTEVLEAGGTLGFTFRVTDGGAFDVNAVMKVRFTPPVGRTMDLSRFHYNAH
                     FAGLRDRQRETVLNTWQRATDGSYSYTAPPILKTRHGLPEEVSVCFDNSFSTFSPKWV
                     RFNIMKRDVLEVDPDAVNKVESAMEEELHRYGTILFGLAQEANALQLVGESDRVKLNS
                     LAKIMAAGLVLNALVLLTMAAYQYVSLSRFLACQVRRGKFSISTT"
     gene            complement(<1333706..>1335109)
                     /locus_tag="LDBPK_312830"
                     /db_xref="GeneID:13389702"
     mRNA            complement(<1333706..>1335109)
                     /locus_tag="LDBPK_312830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863321.1"
                     /db_xref="GeneID:13389702"
     CDS             complement(1333706..1335109)
                     /locus_tag="LDBPK_312830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863369.1"
                     /db_xref="GeneID:13389702"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:E9BN53"
                     /translation="MPPFFVNSPSNASDLLRHAATTAAPLRQPPQVHPGTARVLHTRA
                     RWLVLSHSYLSTKRVHTMRQLKRLDVFPKFDRKFEQDARHRTVSGGVLSVVAIVVIIW
                     LLVGEVRYFLSVEEHQEMFVDTKVGGDMQVTVNVTFNHVPCDLITLDAVDIFGVFAND
                     VEGNTVKQRIDAATGQVISAARAMVDEKKVMTKAIDADGAEKENCPSCYGAERNPGDC
                     CHTCEDVRQAYARRGWKLDIDEISVEQCAEDRIKMAAAASGKEGCNLYATFAASRATG
                     SLQFIPGRIYETLGRRMHDLMGSTTRKLDLSHTVHTLEFGDPFPGQQNPLDGTAQGSA
                     LSGDAKDAMNGRFSYFVKLVPTTYQRYSLITGLQDAVESNQYSATHHFTPSEAAKAVS
                     QTPKKQEIVPGVFMTYDLSPVRILVQERHPYPSLVHFVLQLCAVCGGVLTVVGLVDSM
                     CFHSVRKIRKMCTGKLL"
     gene            complement(<1335697..>1337001)
                     /locus_tag="LDBPK_312840"
                     /db_xref="GeneID:13389703"
     mRNA            complement(<1335697..>1337001)
                     /locus_tag="LDBPK_312840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863322.1"
                     /db_xref="GeneID:13389703"
     CDS             complement(1335697..1337001)
                     /locus_tag="LDBPK_312840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863370.1"
                     /db_xref="GeneID:13389703"
                     /db_xref="UniProtKB/TrEMBL:E9BN54"
                     /translation="MSAHPYSALRSTTPPLYYRRPEGTAPSYYTVPAKEVEGLRIPSS
                     SSHPAAAMTAGAPITVAGGYPRPSASLHPSVDRSSLNRVPTTTAAAAPPPSPRLSGYV
                     MPSVVNPYSQGASQQPAVAHVAEPVNPASYLQQANAMGRWSYQQPQYPTLDPVATRVA
                     AIDSEEAAMAAEEMTLRAKLAELQVTRKQQEEEQLYLSHGWAQMLEKEERYYTEPVID
                     LRPEIMAREQQCAMLHNHLQQVEAQAQHAQSQLQGTEYILRDAESFEQERRRVQDAFQ
                     EVERRRRECVARAERYFDVEVKRVVEGNKVIRKLDSQLREMTQRGPLAQLQDGNRHPS
                     TGRRSASRAVTFAPDKSIVLDLGREESASSAEPVTIDDESGSLTNSYTSAHGTAPRYE
                     GHSTYAFCGLPDEDIGGTSVAFSLNDTRDSLMKRRKVEIASV"
     gene            complement(<1338531..>1342406)
                     /locus_tag="LDBPK_312850"
                     /db_xref="GeneID:13389704"
     mRNA            complement(<1338531..>1342406)
                     /locus_tag="LDBPK_312850"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_003863323.1"
                     /db_xref="GeneID:13389704"
     CDS             complement(1338531..1342406)
                     /locus_tag="LDBPK_312850"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_003863371.1"
                     /db_xref="GeneID:13389704"
                     /db_xref="UniProtKB/TrEMBL:E9BN55"
                     /translation="MAPRRSRAKRLHLPAVARCLAAQPSAAPHATVASPVAPPPAATA
                     PAAKPPRSVEPPVATCVQPAATSVEPAAIVARAPVVEETPAAPAPNSTYAATVLTRVR
                     TAEVQCPPDVTPASVAATASAVPAGEAMPLAAPVSAAPSAHSPRAAISAHRGRLRAKR
                     RAAAALARKSKHHRNTISAPQQAITPSTSSQPPAPAAAPETVPVATVEAPAAEAAVEP
                     TSDAAASNIAQAGSAASELEGPAAATVVSSPPAPAPISTPHRSAISRIPKKRKFFAEL
                     DDNVTLPAAEATPPPASSERHLQASDAAVDALSVTKAASAVPSVTLTAAVEEVTKKTS
                     AVAGALHAPAAARRMVTRRTSKTHAKGAAAKLQHSSGSLVSAEATLEAAPAVIASVTR
                     KASASSAATLTMAEKPATPTAPAVAAPSVEPLQRSASSTPPSTAPHVTSAAAVAPLGR
                     ATISRLSKKRKHFFAELEEPPASDAAPSVQGTSTLPAAAHAAVTLKGIGAATTIAAAE
                     PTAPTVEAVVAPTAAAVAVADVVETKATATRAMARRRSMKRGKLPPEAAVAEAPSAAE
                     AISSEATAPTPATPTVEATSAPVPEAVQGAEVAAPAESIGEAATTADAARPVEGPTPP
                     AAQRKLRTAKKKVKRLTAAAIRRRELAAYNRIPKRFRPPEVPRSVWSTPVAAPQSTPA
                     PTDVPAAVSATQTKSMEATGVMHAEGQTPAVVEAIVEAPAVELAQPPPRASTASAAAA
                     VEPEAPLTETTKSADLFAAPAEEQCLMGQARVATKSMKVRLAQSIRKRFFTSLEDVPA
                     ANPTEAAATETTAAAVEVQVAVPQTRAAMEAIEPSPQVAGDGTTVDAELTAAAEEAVA
                     PKSTLNAESKAAPATSAVEEASTEAPQPMAAHPPTETNSAEEPSFKAVKPLCTGGVAP
                     DSESVAVHTGAPALAQRKVVRVTNVRDLLKAIRKAKRAGKRGCSKERLSHRPLSQHLV
                     TAVTGAVDEVVNAEASSTAAEANLPAEVSGAGIHAPLHKEAEAATAVEETEAPSATEQ
                     QTVVQAQAAEVEVEMCVESTTTMAAPEVTEVRLTEPVDKEAVQPPEALQHAEMLVAPA
                     QAAVAAPVKDFLPRAFSSPSPARRQAAKQKIKKHAKLAAARLNKRQTYTVSATAPLAA
                     AHAPAETMDTPLVEAVHAAAEPPVPPAEEASAATLVRRSALVLPSGNVVVESFTDNEM
                     VLRRTALDNSWDVGLRFDWQERTLAISSFPAFEETDKRSAHPFVHRFKSKPRWLLKEV
                     NETNAAHMKKALDSMNRSLTARFVFRHLR"
     gene            complement(<1346266..>1347207)
                     /locus_tag="LDBPK_312860"
                     /db_xref="GeneID:13389705"
     mRNA            complement(<1346266..>1347207)
                     /locus_tag="LDBPK_312860"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863324.1"
                     /db_xref="GeneID:13389705"
     CDS             complement(1346266..1347207)
                     /locus_tag="LDBPK_312860"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863372.1"
                     /db_xref="GeneID:13389705"
                     /db_xref="GOA:E9BN56"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BN56"
                     /translation="MSHNARPSRYAVSQSKARIFVGQLEPYVTEQDLYPVFSCYGKIL
                     HLNIVRHSTTVTPNEERRIPTAFVWYETTTEADAAIAALHNVFTFSSPDEEENKVRYI
                     QVSYADKSPECTPWGRWQKTQAEIMRRTNPSGTGTGSNNMPGQYSHITGGGASTYSSP
                     ALNNGGGFTVSATGPAIRSSQSSGDISSMRYTRNPARGLRAMAPHIDHPEVQYYGSYD
                     NLYNLGNRNQLYSMGGAANSMTGYTKHRGMPPHESASSGDLGRGSTSSFWNMSEEVKK
                     STAADPSRFRHTARYTAPEPDEDLIMAASTFTVTSGP"
     gene            complement(<1352867..>1353580)
                     /locus_tag="LDBPK_312870"
                     /db_xref="GeneID:13389706"
     mRNA            complement(<1352867..>1353580)
                     /locus_tag="LDBPK_312870"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863325.1"
                     /db_xref="GeneID:13389706"
     CDS             complement(1352867..1353580)
                     /locus_tag="LDBPK_312870"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863373.1"
                     /db_xref="GeneID:13389706"
                     /db_xref="UniProtKB/TrEMBL:E9BN57"
                     /translation="MLSQTGGAVAVNEISQQHSTEQAMAAKEMAAENQVHVTLPEEVR
                     ERRRSRQSSQARNGSHEAPIISYGEAAPKQTVSRVLVRMPNEVRRRRSLSREARKSHT
                     HTQLEESEMPNATPKAMPEAAAMSTAEDGRVSPEKQCPEPELPANGLAMQPAVEEAVD
                     HEPPTEPSPAAEEAERSGRLTDAASRVEMELTGSDSAAVIEEANQEMEDNAAPHENND
                     AHPMIKGKEKDKHGCCIVM"
     gene            complement(1355684..1355896)
                     /locus_tag="LDBPK_312880"
                     /pseudo
                     /db_xref="GeneID:13389707"
     misc_feature    complement(1355684..1355896)
                     /locus_tag="LDBPK_312880"
                     /pseudo
                     /db_xref="GeneID:13389707"
                     /db_xref="PSEUDO:CBZ36686.1"
     gene            complement(<1358157..>1358693)
                     /locus_tag="LDBPK_312890"
                     /db_xref="GeneID:13389708"
     mRNA            complement(<1358157..>1358693)
                     /locus_tag="LDBPK_312890"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_003863326.1"
                     /db_xref="GeneID:13389708"
     CDS             complement(1358157..1358693)
                     /locus_tag="LDBPK_312890"
                     /codon_start=1
                     /product="ADP-ribosylation factor, putative"
                     /protein_id="XP_003863374.1"
                     /db_xref="GeneID:13389708"
                     /db_xref="GOA:E9BN59"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BN59"
                     /translation="MGGWLSSLLGKKEVRILMVGLDAAGKTTILYKLKLGEVVTTIPT
                     IGFNVETLEYKNLKFTMWDVGGQDKLRPLWRHYYQNTNGIIFVVDSNDRDRMRDARAE
                     LDKMLVEDDLRAATLLVFANKQDLPNAMSTTEVTEKLGLHALRQRNWYIQGCCGTTAQ
                     GLYEGLDWLSANIKKSMN"
     gap             1360258..1360557
                     /estimated_length=300
     gene            complement(<1363000..>1363809)
                     /locus_tag="LDBPK_312900"
                     /db_xref="GeneID:13389709"
     mRNA            complement(<1363000..>1363809)
                     /locus_tag="LDBPK_312900"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863327.1"
                     /db_xref="GeneID:13389709"
     CDS             complement(1363000..1363809)
                     /locus_tag="LDBPK_312900"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863375.1"
                     /db_xref="GeneID:13389709"
                     /db_xref="UniProtKB/TrEMBL:E9BN60"
                     /translation="MCRNNNSEDGDCPGCFGFLASWIPGLRYPAKRCMSQDRSTFSSC
                     SSGSMDTKGASNDVTDVDDESPLSEESRSSSTGSWSSMGDLQTTESAESDAPSEESDP
                     QERVRRATASFLQWKNKEYVPLSPDEKRAIKEYRKTVAQEEGTYTSTRAQRQRGGAPK
                     ELISREDEWVDLGTPVEDGGLVRRRNRKIRFVAAVIASKEVDVHNDGLVVVTDTGEEV
                     PELPRCASILRTSCVKHLTEEPPVFVEDLNSCMLEEEGQSCESALCVPGVS"
     gene            complement(<1365360..>1366199)
                     /locus_tag="LDBPK_312910"
                     /db_xref="GeneID:13389710"
     mRNA            complement(<1365360..>1366199)
                     /locus_tag="LDBPK_312910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863328.1"
                     /db_xref="GeneID:13389710"
     CDS             complement(1365360..1366199)
                     /locus_tag="LDBPK_312910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863376.1"
                     /db_xref="GeneID:13389710"
                     /db_xref="GOA:E9BN61"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:E9BN61"
                     /translation="MPEKCIGITPVQVGHVVGRGGSTLKGIQERTGATLCIVEDGPQV
                     KITADDAAKVAAAEAEVQKIVANQQKPDYEGPCGARLRKEADELGQKRSKLFEEATKM
                     REAGDHEGANKLVAMAKKAGEDMKARHREAALAIAKHNNEEKGKGQNYFDMHGLHLEE
                     AIEMLKVRMDKLEEKPVGSTTEFEVIPGAGHHSAPGTQKLRRATLEYVQLKGYPYEEV
                     NAGAFLVKVPGLSGGVLSKPEDGDKAPTKPKESATGVANKPKALASAATSKSKGQSCC
                     ACM"
     gene            complement(<1366998..>1367810)
                     /locus_tag="LDBPK_312920"
                     /db_xref="GeneID:13389711"
     mRNA            complement(<1366998..>1367810)
                     /locus_tag="LDBPK_312920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863329.1"
                     /db_xref="GeneID:13389711"
     CDS             complement(1366998..1367810)
                     /locus_tag="LDBPK_312920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863377.1"
                     /db_xref="GeneID:13389711"
                     /db_xref="GOA:E9BN62"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="UniProtKB/TrEMBL:E9BN62"
                     /translation="MKFIPLDSFSALNSLLQGVEAQGCCITMRLEAYTCRHTKEERQI
                     ANSIACYQNNVQLTPPISPLPTIGAYAGFTQEALPPLVLGGSAENVTASYSLVSPNEI
                     DDRLVYFVAALNTVYESDGYDFSVLRENDFVRYTEPQFRTEVSSTLQSLPEQCRPAVQ
                     RFWPTIEEVVENAESGCEYYEFRCPSCDPLADTTVYARHYFVYNRRKKVLVLLVEYGE
                     SNPYRGDDGLPHAGDPTSAWDAESPTYASTPDPGEEGEAYDGGKNRQFYGYY"
     gene            complement(<1369732..>1371606)
                     /locus_tag="LDBPK_312930"
                     /db_xref="GeneID:13389712"
     mRNA            complement(<1369732..>1371606)
                     /locus_tag="LDBPK_312930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863330.1"
                     /db_xref="GeneID:13389712"
     CDS             complement(1369732..1371606)
                     /locus_tag="LDBPK_312930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863378.1"
                     /db_xref="GeneID:13389712"
                     /db_xref="UniProtKB/TrEMBL:E9BN63"
                     /translation="MLRPTLAKWLERKGVRPIVERLARSTLRGPSVSHSASHVAAGSV
                     SSSLYHTGDVDDIDAAESLDMMDGIPNEPCGLPASAAPRRNAHPPEPRARAANSYSWS
                     SGADSAGAGSGTVDHRDRPSQDERSASPARRVITVARRHHSPPAEASSVSRHAHAPVT
                     HAPLSSSPREAQVTDHAKGAPHRDKPGHTAAPVNPSDVNVGGSGTIAETGESAGSAAT
                     KAKSSDAYRFLLHHIDAEIAALQRRHASVTTRRQSVQTRQTQRIKELFEVMENPWTLL
                     PTEVQPALPATGVDVYIKEQQIARQQQNHTHPIPEGQDKMYVLALHKNYKSMPAGRKR
                     FYEEAAHYNAAVREELKYLLTRGCSRFEAFLDTIKECTMEMAREGQVPELPTTHAQNR
                     FHAARGGVSNYRHANTPRALPAGGDAGTTRSRKSHQHAQPQQVVAAQETSARAEAEAE
                     EGDTTAEWVDEGDTAEDTAKAAARGARHGSVGRKRGRKASQRIQSAAKRAHAKSAAAA
                     AGVHSSARVPKRRQGSQTSATRQPDARPMRSGGGRSGAGAGAHSKSDRKKTVRQAGRG
                     TGVSRSIPLPNLDHLAVKKIKRMLTSPSSSGGAAKKAAKAKRASPSRKPAAGGTKKKR
                     "
     gene            complement(<1372643..>1373617)
                     /locus_tag="LDBPK_312940"
                     /db_xref="GeneID:13389713"
     mRNA            complement(<1372643..>1373617)
                     /locus_tag="LDBPK_312940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863331.1"
                     /db_xref="GeneID:13389713"
     CDS             complement(1372643..1373617)
                     /locus_tag="LDBPK_312940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863379.1"
                     /db_xref="GeneID:13389713"
                     /db_xref="UniProtKB/TrEMBL:E9BN64"
                     /translation="MLPDPFSVSFRHFPHQREAGGCTCTNASPPPSSSRTPLITGRHT
                     RPSHLAAVMSESLPGVLCFLGLIVFFVADFFYAKKLNEQKNAHPELDDCAPATSPDLD
                     TIAVLDSLTATAVDFYRHERQRFTGVAAPASPNEYAAVGENGVSEEPAANHDFGDQTG
                     KTVMHTIVVVCSIAAPLLTVLVALMPSLFGWTRFGVHSSIAYLAAVPGMAATGFYAMR
                     SYELTQVFDVTKTEWIAMMWLRLDAIFLMSAVAFFGVGAWVVAGCMVTTAMYLAHRLM
                     RMEKQLNRVQRHTQLVRDEVDVTRVLVPGTAESKRASGINDGYSALSS"
     gene            complement(<1374111..>1374746)
                     /locus_tag="LDBPK_312950"
                     /db_xref="GeneID:13389951"
     mRNA            complement(<1374111..>1374746)
                     /locus_tag="LDBPK_312950"
                     /product="ribosomal protein l7/l12-like protein"
                     /transcript_id="XM_003863332.1"
                     /db_xref="GeneID:13389951"
     CDS             complement(1374111..1374746)
                     /locus_tag="LDBPK_312950"
                     /codon_start=1
                     /product="ribosomal protein l7/l12-like protein"
                     /protein_id="XP_003863380.1"
                     /db_xref="GeneID:13389951"
                     /db_xref="GOA:E9BN65"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:E9BN65"
                     /translation="MRQRVLAWEVARLRVATAALFTSHRAIINGVASNRIPRGMTPLG
                     VPCSEDVLEALAEAYVNMDMATMTAFHKKAMAEMLRAGGGGGAEPAAVDYEEHLLRAS
                     GGASGAAVATSAPAVPVAPGGDAAAAESAAPLAKKAPEKTAFDVTLKIFPAENKIKLI
                     KELRCACGLSIQEAKTAIDKCPGVIARQVQKGDAEKLKDAMVKLGAEVELM"
     gene            complement(<1375514..>1377544)
                     /locus_tag="LDBPK_312960"
                     /db_xref="GeneID:13389952"
     mRNA            complement(<1375514..>1377544)
                     /locus_tag="LDBPK_312960"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003863333.1"
                     /db_xref="GeneID:13389952"
     CDS             complement(1375514..1377544)
                     /locus_tag="LDBPK_312960"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003863381.1"
                     /db_xref="GeneID:13389952"
                     /db_xref="GOA:E9BN66"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BN66"
                     /translation="MEAAPAAAAQRPPQTQKRPREESNAPLQEGSNGSVPATFSSEAS
                     VTTPVADTELVVDVDQPETNPQAPAVDAPRSRSRGLAAVGPGSISPVAASRSGTDGAN
                     NCQPAAAVTTLSSSSASADARRFKQPTLAAYGMVSDTMALKKEISDRDSHIEELNREV
                     EGLRAEVGRRNDQIHFMDGQCRQYQKKLEHFQSVMRQEMLSAAQKDRSEARRVLYQKH
                     FELGQTATWHSNGQTVWMEGDRVRTLFLKLANLTQKREEVEALKKAAQSNVKHLARQE
                     REREDSGAGPDLQDALMAAQMEYQLRASEHAALTNTIADIKLKQTEIEHEKKAFVKEM
                     RRVNDEDTSEFLAIPTIGEGDRYVLMHLLGKGGFSEVWKAFDLVEGRYVACKIHHIQR
                     EWPAQTRTHYLRHAQRELDIMRALDHPHLTHLYDVFPRGDNMFISVMEYSNGMDLDTY
                     LKRYRTFKEADARLIFLQVVDVLRYLASLDSPIIHYDLKPANILLHRDDPTILDIKIT
                     DFGLSKIIGATREGPSDNPSIELTSQGTGTYWYLPPECFETSSTPRISNKVDIWSAGV
                     IFYQMLFGKRPFAEGESQRRIWQEKLIIQSARTLHFPDTPKVSEEAKDIIRGCLAFNE
                     RERCDVFQLSQDPYLFRTSRRSAHKAKSAAPSGVGSSNSPLMPPVTDATPAS"
     gene            complement(<1378265..>1378714)
                     /locus_tag="LDBPK_312970"
                     /db_xref="GeneID:13389953"
     mRNA            complement(<1378265..>1378714)
                     /locus_tag="LDBPK_312970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863334.1"
                     /db_xref="GeneID:13389953"
     CDS             complement(1378265..1378714)
                     /locus_tag="LDBPK_312970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863382.1"
                     /db_xref="GeneID:13389953"
                     /db_xref="UniProtKB/TrEMBL:E9BN67"
                     /translation="MGRKKRVSDVETTPELSFVQGGVLNTIIVKGTEEMQQIAVDTAA
                     FLEDKRVVRSTNMDQVTFSQNAIFKVTLDFAEAIPCIPEIAVRESTDWMLLSCAGNHA
                     HYSTVDQRLILQQCKASLQSNIPELEFPICLVLRFDDDQWVVERAIR"
     gene            complement(<1379451..>1380311)
                     /locus_tag="LDBPK_312980"
                     /db_xref="GeneID:13389954"
     mRNA            complement(<1379451..>1380311)
                     /locus_tag="LDBPK_312980"
                     /product="aldehyde reductase, putative"
                     /transcript_id="XM_003863335.1"
                     /db_xref="GeneID:13389954"
     CDS             complement(1379451..1380311)
                     /locus_tag="LDBPK_312980"
                     /codon_start=1
                     /product="aldehyde reductase, putative"
                     /protein_id="XP_003863383.1"
                     /db_xref="GeneID:13389954"
                     /db_xref="GOA:E9BN68"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:E9BN68"
                     /translation="MAARRVVRLPDGTAAPALGQGVWMMGEKPENRTRELAALRAGME
                     AGMTLIDTAEMYGNGRSERLVAEAIKETPRERLFIVSKVLPTNASRATIFRSCDASLQ
                     NIGTDYLDLYLLHWRGRVPLPETVTCMEELVKSGKIRRWGVSNFDVDDMKELWRVPGG
                     DKCAVNQVLYHLGSRGIEYDLLPWLREHNVPVMAYCPIAQAGELKSELYKSTVVQSVA
                     ARHNATVTQVLLAFVLRSGHVIAIPRSSNPAHTKENAAADSIELTEVDMAQLDAAFPA
                     PKHKTHLDIV"
     gene            complement(<1380994..>1384716)
                     /locus_tag="LDBPK_312990"
                     /db_xref="GeneID:13389955"
     mRNA            complement(<1380994..>1384716)
                     /locus_tag="LDBPK_312990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863336.1"
                     /db_xref="GeneID:13389955"
     CDS             complement(1380994..1384716)
                     /locus_tag="LDBPK_312990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863384.1"
                     /db_xref="GeneID:13389955"
                     /db_xref="GOA:E9BN69"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:E9BN69"
                     /translation="MTDGVWRSFRFFDSEALAAASSLAELNVVCSCLTPTSLVVGDCE
                     GQVLFLERHPASTAASPGGRWCFQAYAGPVTHIRYCALRNTLITIGNDDAVHNTILRV
                     WDLDQLVALYRGLLGLSPADVSTSVPGASAADAPLRWRPPCQEHRILPASKGASGGAS
                     SAHASCEEAPLVTILLDESKQMQCHFKPSCTTAGTLSPSPTGNSTAKGFSSHAGEAGS
                     TGVVSCGSIRSAVVSFDVVPDLSCAAVGLVTRDCVVLQGDLAKERSVRVLTIRSGLAK
                     GALTFVGLPSMQLATLWETKGGGHASDISGGGTSAFSFLTDSARALTRSASASKVDCS
                     GDAVTAAGVQVLYTVYEDVVTCWALRANGNWSEYPCPTSSGGAPRFGAALTSRGELLV
                     LCKQAASHATTGSRVVRLGPADPASSVPVPYDPTMKSCVHPIHVDHVPGRCFLYTHRQ
                     YLVLLVQHDGRPEQFQLQCLDLAYRIRGLSRPQETYTNCAMLLADETDMLVLFLDPAV
                     RTRQLALRGVRLREADTQTKLELLFSKECYGIAQQLAQTMEGADPTLQLRIRKRYGDY
                     LYGKRKFDEAMAQYVGTIGHLESSYVIQRYMGSAHMEQLIRYLEELHNEKQSAHTNVA
                     HTTLLLKCYIKRKDEARLKAFIHRDDVRFDAKNAIEVCREGGYAAAALHIADRYAAVY
                     DCARIRLYDMQEPLETLSYVRTLGIDEAEPICSQLGKDLLLAAPRATTELLIELCVHW
                     KGPGRRLVNVPALPALAPDAARFPTCTGDAIGGGPRHPHHANASAFLHIFVDAPVCLM
                     NFLRAVVESGVLNEDAATPAPMQMAVEGNAATPSSPAPHSPTVTSGPHAVLYNTLLEL
                     YMTRELKSTLRLVPQTTAATAGAVSSADATAEFPLEPYKRRLEQARTFLEAYKGRYDH
                     YLALNLAHQHGFEDGILYLLRLLGLSEEILGYYGAKLNDSNSTPAERHEATAKLFQAC
                     QDSPASDSSTTTMWMTLLSQLMRTAKTESLDIVKVLDYIEAHDALSPVVVLQILSSGP
                     ESTLDLRTVRNYCQRCLLKQTQQLQEVLAQTSQRLGEMERIKKEVVALQTSAVVFQAT
                     TCAHCHQVLDTPTVYFMCRHAFHHRCLYTAAECNVCAAAHRRQLDTTREAAQHDLPLQ
                     NPSNFAAQLFQDVKCGRDATDEVAGAGAGRNGRTPQDGFRVVADYVARGALGAPPPYK
                     DAGPFGCQSPTVPHHPSGSHQRGAAGVAGADDLDTW"
     gene            complement(<1385179..>1386534)
                     /locus_tag="LDBPK_313000"
                     /db_xref="GeneID:13389956"
     mRNA            complement(<1385179..>1386534)
                     /locus_tag="LDBPK_313000"
                     /product="nucleoporin (NUP54/57), putative"
                     /transcript_id="XM_003863337.1"
                     /db_xref="GeneID:13389956"
     CDS             complement(1385179..1386534)
                     /locus_tag="LDBPK_313000"
                     /codon_start=1
                     /product="nucleoporin (NUP54/57), putative"
                     /protein_id="XP_003863385.1"
                     /db_xref="GeneID:13389956"
                     /db_xref="GOA:E9BN70"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:E9BN70"
                     /translation="MFGATAPSAGIGAPAAGFGKAPATFGTSALSGTNTTATTSGGFG
                     AAAGASATPGFGTAFAAPTASAAPAGGASGFGSSAASGTTGFGGAAGFGAGGFGAGGG
                     FGAKPGGGFGASATSGFGAPATGTTGFGAGATAPAAIGGWGMQQPNPDIQPQAPQQQQ
                     PTVTLQDFARQSALASYLVKLDESYNALHPNCRFRAFVYNSCGAGQVMDAIQKERYTA
                     YLNGGGCSEEAYMQALHQNPDPGRLYPSPIHFSQELLRRTEKQRDAVKVLQKKVTELL
                     QDIDTVAGMDAANVRRQREVEQEEVMLQHRWYSLLCKMELLRRHGSSCGEEGLLSSRV
                     EQLRKLLRAPGRFSQLLSELRPFLTEEASRVAIITQQSANKTEARQQQQQRRFVGSAP
                     AAWRNPGGQPLLRSEVDPCIINGWIQFAKQMQDGIETLNELLKTDLKEMQAIRSRVEA
                     S"
     gene            complement(<1387142..>1387393)
                     /locus_tag="LDBPK_313010"
                     /db_xref="GeneID:13389957"
     mRNA            complement(<1387142..>1387393)
                     /locus_tag="LDBPK_313010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863338.1"
                     /db_xref="GeneID:13389957"
     CDS             complement(1387142..1387393)
                     /locus_tag="LDBPK_313010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863386.1"
                     /db_xref="GeneID:13389957"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:E9BN71"
                     /translation="MSGKAPAPLCLRSLKKEDLNYEGRVRAEKHKDELIIDYTAYLAA
                     HPEITPLLHDIMQHLLLQKPDHPLAAMSEFVRARTSSFL"
     gap             1388226..1388324
                     /estimated_length=99
     gene            complement(<1388872..>1389615)
                     /locus_tag="LDBPK_313020"
                     /db_xref="GeneID:13389958"
     mRNA            complement(<1388872..>1389615)
                     /locus_tag="LDBPK_313020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863339.1"
                     /db_xref="GeneID:13389958"
     CDS             complement(1388872..1389615)
                     /locus_tag="LDBPK_313020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863387.1"
                     /db_xref="GeneID:13389958"
                     /db_xref="UniProtKB/TrEMBL:E9BN72"
                     /translation="MPPASNTPAREKEHLHRMFSAAANALADLYRESSNSYEAGYRDA
                     LLFVQRYLQSSSPVTERGLPPSSAFSICETVNAQHMAQFLQHTIATRRERMAAVRGIH
                     SLRRRRRESEQGNSGIDDAGIARDDGDARENDEDDDGEEPCLTPRSSPVVAIEPPADL
                     TALAASGVVSTATPRFSPGALVTVNSTSPALSREMEHVIHTEHPVSGRLPYQPRRQRP
                     RMERMHGHGSLGSADGRPLPTQLRIGRRS"
     gene            complement(<1392176..>1393063)
                     /locus_tag="LDBPK_313030"
                     /db_xref="GeneID:13389959"
     mRNA            complement(<1392176..>1393063)
                     /locus_tag="LDBPK_313030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863340.1"
                     /db_xref="GeneID:13389959"
     CDS             complement(1392176..1393063)
                     /locus_tag="LDBPK_313030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863388.1"
                     /db_xref="GeneID:13389959"
                     /db_xref="GOA:E9BN73"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="UniProtKB/TrEMBL:E9BN73"
                     /translation="MAMHYKAISAMPYEAELYAHLQASEKSNAGADAAVVLHADSDEA
                     MRRRLGIFIDPIDGTNCFVDGVWQAPMTLVGITLDGVPIAGVMNRIFYYPLTCTDGPA
                     ATEPQEKTCVPGLSVVLNTPTLASPFVVFDGELVPAPGQMEPQLECTCETPLAVCRSS
                     TTKEVFLQRLLTQLEPCNAVYARGAGYKQYHLLKKILTGHHVAHEAITPADIFVCPPA
                     TIKKWDCCAAHAFLYALGGEIFDQNGVPIRYPVVGTYSAATTSLPEIAVLTDGLVAVT
                     PYAMHEVARRLGWTLTLAP"
     gene            complement(<1394164..>1394913)
                     /locus_tag="LDBPK_313040"
                     /db_xref="GeneID:13389960"
     mRNA            complement(<1394164..>1394913)
                     /locus_tag="LDBPK_313040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863341.1"
                     /db_xref="GeneID:13389960"
     CDS             complement(1394164..1394913)
                     /locus_tag="LDBPK_313040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863389.1"
                     /db_xref="GeneID:13389960"
                     /db_xref="UniProtKB/TrEMBL:E9BN74"
                     /translation="MNALGNRCRSVIVLVNTSLYTSPLLNEGCGYHCGCVVVSSDLAP
                     LARGIVRHAEHFCEENNISYRIVTISEKATEIGEMMTSAPAEEWLTSPLTLIDCTPAV
                     DEEVRVASLLAWLYGAYSSAASREGSATEAPYTLVAVLDAARQVPCPPPITASSSAGG
                     DTLAWLRPTPSYYSELMESVGSSADSCVVFPVHMYSRYPALRDCGLRERCTDGGATAP
                     VPLAAWPNKCTLSALLRELAFKAGQLAKYGA"
     gap             1396291..1396389
                     /estimated_length=99
     gap             1397780..1397878
                     /estimated_length=99
     gene            complement(<1399954..>1401198)
                     /locus_tag="LDBPK_313050"
                     /db_xref="GeneID:13389961"
     mRNA            complement(<1399954..>1401198)
                     /locus_tag="LDBPK_313050"
                     /product="farnesyltransferase, putative"
                     /transcript_id="XM_003863342.1"
                     /db_xref="GeneID:13389961"
     CDS             complement(1399954..1401198)
                     /locus_tag="LDBPK_313050"
                     /codon_start=1
                     /product="farnesyltransferase, putative"
                     /protein_id="XP_003863390.1"
                     /db_xref="GeneID:13389961"
                     /db_xref="GOA:E9BN75"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:E9BN75"
                     /translation="MGLFSDSVAMMRVKWQMRSVKIQVPPEETDLRFCYDIMNDVSRS
                     FAVVVAQLADQQLRDAICIFYLVLRALDTLEDDMSVPVDVKLKELPKFHTHTSDMSWC
                     MSGVGEGRERELLEKYPCVSRAFKKLKKGYQDVIANICERMANGMCEFLKRPVVTKDD
                     YNEYCHYVAGLVGHGLTQLFARCGFEDPSLDDDLTSSNHMGLFLQKTNIIRDYYEDIR
                     EEPPRMFWPKEIWGTYVTELKELKSESNNAAAVQCLNAMVADALVHVPYIVDYLSALR
                     DPSVFRFCAIPQVMAIATLKEVYNNPDTFQVKVKVSRPESCRIMLKATTLYSSLSMLR
                     DYCVELQEKLDMQDASSTSIANSLAAAIERIDLQLKKCQDVSYTRSLLARYPGLGGQF
                     LLTVMDTVAGFFGGRKGIADHA"
     gene            complement(<1401923..>1402900)
                     /locus_tag="LDBPK_313060"
                     /db_xref="GeneID:13389962"
     mRNA            complement(<1401923..>1402900)
                     /locus_tag="LDBPK_313060"
                     /product="mutt/nudix family protein-like protein"
                     /transcript_id="XM_003863343.1"
                     /db_xref="GeneID:13389962"
     CDS             complement(1401923..1402900)
                     /locus_tag="LDBPK_313060"
                     /codon_start=1
                     /product="mutt/nudix family protein-like protein"
                     /protein_id="XP_003863391.1"
                     /db_xref="GeneID:13389962"
                     /db_xref="GOA:E9BN76"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015376"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:E9BN76"
                     /translation="MSRPLEFAFSGGHLRRLEQERMVPGFQVQRLQPSHKPRVVIAKK
                     EHAGFVPRAQRQPNVAWWHHSLCDGALIVKDLKELIYVGEDPRTGENIFSSMADNLAG
                     RRLSQLIWAPSKDGHVFEMARPEQAAYGLAMSLVRWHASNRFCANCGTATDPTRDVGF
                     SRLCPKCRKQHFPQLVPAVLVAVLDGKGNVILSQRRKESKMLTLLSGFVLHGESAEET
                     VRREVEEESGARVSEVRYIGSQPWPYPYLMMMCYYAVADASPSLVVDASELEKVMWVC
                     KQDVRRALEGQHSDMELRGPGTTPYAMLKPWVDGEVDDRGQVTKPQSQL"
     gene            complement(<1406039..>1407364)
                     /locus_tag="LDBPK_313070"
                     /db_xref="GeneID:13389963"
     mRNA            complement(<1406039..>1407364)
                     /locus_tag="LDBPK_313070"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_003863344.1"
                     /db_xref="GeneID:13389963"
     CDS             complement(1406039..1407364)
                     /locus_tag="LDBPK_313070"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_003863392.1"
                     /db_xref="GeneID:13389963"
                     /db_xref="GOA:E9BN77"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BN77"
                     /translation="MEEQDQRKPNGGNNGLPVPPSTTETGQGPLQDILGRTPNCQYVK
                     KRLLGQGSFGSAWRVEESATGNVFAAKVMDLNSMSEKDRGFVTNEVKCLSRCCNPHVV
                     RCENAIEREGQLLIVMEYADGGDLYKQIKARVREMKFFREHEVVFIFLQLCLALDHIH
                     SNKMMHRDLKTANILLTTTGLVKLGDFGFSRQYEDSLSNAVGSTFCGTPYYLSPELWH
                     RQPYSKKSEMWALGVVLYEVMALRRPFTGKNMDELITNICHGRRSDLPSSYSASLRDV
                     CNRLLSVDSNTRPTIHELFHEPFIRSNLETLKRSVEKHNRIPADVREAIARCITQSLN
                     TEEPPAHLEEPEPLIGTVKRHTALRGWQKCLLSFDKKQISIRDPSGVDPEEVVPVATL
                     TSVCPIDVMMAGEEFVFAMKNQAGKAFWFMAPTQRAYEQWLTTLQEAAP"
     gene            complement(<1410245..>1416751)
                     /locus_tag="LDBPK_313080"
                     /db_xref="GeneID:13389964"
     mRNA            complement(<1410245..>1416751)
                     /locus_tag="LDBPK_313080"
                     /product="acetyl-CoA carboxylase, putative"
                     /transcript_id="XM_003863345.1"
                     /db_xref="GeneID:13389964"
     CDS             complement(1410245..1416751)
                     /locus_tag="LDBPK_313080"
                     /codon_start=1
                     /product="acetyl-CoA carboxylase, putative"
                     /protein_id="XP_003863393.1"
                     /db_xref="GeneID:13389964"
                     /db_xref="GOA:E9BN78"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9BN78"
                     /translation="MEAMQEKSSPVGFRYDSMEQLCSSLGAIMPIKRLLIANNGLAAV
                     KGMDSIRSWMYEHTGDSDAVQFVVMATPEDLKANAEFISLADKHIPVPGGMNSNNYAN
                     VDVIMQTALQNMCDAIYPGWGHASENPALPRECMKSKRVTFLGPSEDAMFALGDKIAS
                     TIVAQSNGVPTVPWSGDSIRLPPKTFSVDAAAYEKAYVNSPEECEEVCRRIGFPVMIK
                     ASEGGGGKGIRSCKCLKDVKSLFFAVSEEVKGCHIFVMRMLENVRHLEVQLLADCYGN
                     CIAVRTRDCSVQRRHQKIIEEGPAFGVDPAIITAMERAAIQLACAVKYCGLGTVEYMY
                     DKETHKFYFLELNPRIQVEHPVSEMISGVNLPAALFCVGMGIPLDRIPEVRAFYGEDP
                     YGTTPIDFSARQSVPPKCHTIAVRVTAEDTDEGFRPTSGKVEEIAFKNSKECWGYFSV
                     GSGGEIHQYADSQFGHIFSSGETREDARRGMVLALRKLVVRGEIRTSTSYAMELLETS
                     AFRDCDVSTAWLDGMIAKKAAEAPAHQRSIHSALIAASIYRNMRWMQEHKDKYIAFLA
                     AGHVPSTEYLSNLHTESYVSRSEKYTLSAGMVSLNEYAISLNGSIVLVPYRILTSGAL
                     QLTIGDKTLVAYVAEEPNSLRITIGGKVTNFSGDVDPTKIMASVPGRLVRYVIDDDGH
                     VNEGDAFAELEVMKMILPLRARTTGTLHHRAVPGTTIAMGSLLAEITPDDPSKVARPK
                     EIQDPWPTELLVARQYERPDGVTRARRAAESLWLLVNGFHFKEIPIEERVRRAFADLA
                     SLGLSSVTLKAVHLPFIPAEICDETEARPQTPSEKYRAIIDTIVDRYVTVEQPFDGHS
                     RQEAIEGLRNTLDDNEAVFQIDFAHNQECHHYVMRSVLKYLESNALLLKSLKGTLSKL
                     VTLKSFAYGSLLLQARYLLRMCSLPSFTERKAQFAEALEEGSLRSLVASGFGYDLLCS
                     IMFDRQMEHLVHICLELFIRREYSGESEIKDLDILKQGTSWYASYNFDPIEDAEVLHM
                     SDELAVGSRRIIGGRGICVMLPDEKLLQSTLASSFRDVVSHYSDDIVIATVFFSVSRE
                     STQSDVARMCRLLMEENAAVFQKFEKLETVYFMAHGMPEGPHFFTFRAETGFQEDTLL
                     RNVLPQSARRLELDRLSNYEVSMHPTPYKDVHVFKAAPKKAGASALEHRMFARVAVTP
                     HDMGMTPWTEVTDVDVGHMLAKCLAALQVARDDSTVKFPDSNHVFVKMIELTFDVRSL
                     QPLLVAAASSYQEKLTELGVRDVEVSFHVKVPSGLIPMRVIAKSPSGYGVSVHVYYES
                     LSNGQLQLHRAETSEDVDYSSTGRSAESLLEMSLTSPMMPAPRGTPHLMRTASKLGDL
                     REMLPSEKEQQISVDMMSEPTETRHRAITLGPYPQLEARDVKRLQARRAGTTYVHDWP
                     AVLNLILRKEWMKLRCALDLPHTSIPKNPLRATELFLCEDGELLSTRRTFAQSCGMVV
                     WMVEYAPPRYFDMELKTAQTRRIVVVANDITFQSGSFAVPEDCVFKAASVLARAQHVP
                     FVYISTNSGARLGLSTEVKKRFLVEFTEKNDIAYLYLTKSDYEELRERKKIQMEAEPL
                     EVKGETRYVIKGVVGGPTEYIGVENLSGSGLVAGEMSKNYSEIPTISLVSGRSVGIGA
                     YLNRLGRRVIQTNDSPLILTGAGALNRLLGKDVYMGNSQLGGKQIMVPNGVTHWCTHH
                     DYGSARVLLRWLDYVPAVLHPRRCTPHRLLWASVDPIDRDVTFCPTSNTQYDPRLLVT
                     GLLGQTGLFDRGSWMETLEGWARTVVVGRATLGGIPCGVILVETRLTKKFDPADPADP
                     TSTSSFITQAGQVWFPDSARKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLK
                     FGASIVDNLRVYTAPVFIYIPPGGELRGGAWVVVDPTINHNGVVEMYCDPSSRGGILE
                     PSGVVEIKFRDDDVLQLIRRSRPDLAAMEAKAAREAEKELLPHYRDVAVRFADLHDTY
                     VRMKATGVVRDVVPWKDSRRHFYHKLQRKLKELEVANDMLEVGVVDSLAGGVRKVEEC
                     YSVAHPNGPAWGTADQDQLKWLQGLDGTWVGESNGHAALNNSEWAKELQRLLTLHGGE
                     ESSMERALAKLFENPAIAKAAKVALDSSACAHSTAE"
     gene            complement(<1417538..>1420501)
                     /locus_tag="LDBPK_313090"
                     /db_xref="GeneID:13389965"
     mRNA            complement(<1417538..>1420501)
                     /locus_tag="LDBPK_313090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863346.1"
                     /db_xref="GeneID:13389965"
     CDS             complement(1417538..1420501)
                     /locus_tag="LDBPK_313090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863394.1"
                     /db_xref="GeneID:13389965"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="UniProtKB/TrEMBL:E9BN79"
                     /translation="MESADPITKAKLFASHETGQWTEIGFGVVSIVKEQLPISSADGS
                     IGGGGAAGVSAGGGGKRGKATDEETGTRLAARLQIFSTDNPNDLLLSSYVSLDDVYTI
                     QGETILLWYDEAVSNEIACSFDDKDGCEFIYRQIKSYQQSERLRRVQDERVPALADKF
                     LVHPHNLAGILDAAQAQNKRFGLYVREDPQYFTKLAQLFHASREKQDTASMELIARIV
                     LTLFQSPYNTEGKIVAQLVENERIDDCIDIVQYGLGRRDKESGFVSFEERRATFHDPC
                     HLPESMLPRIHVLYSCGFLRDLIPLNLEPADAASYSLLSTFTLRFTMNLLTDVVASPT
                     ILPNAFRTTVEAVRIDSPSADPASIEPSKVAHLFELAAFVGDVAKTVKNAMIGIDMRA
                     EIFSSLVRVGALPFLTAVLECALRYYDSTLAHPPAQQWAVEPPRAVQLVCDTLYSCAS
                     HFPECVEDLVAEAHAVPDRCLLRLLLRAITVVRSGAEAQSVVDAVQCCGVGVPLTLAM
                     FGDNAQLEARRHEVLRFWIEGNNVDRPPLFYLAEHLVQMLDQAARVTAPAPPSGGGVN
                     GACFPFTGGALQLSLVQERQIVYGLRIVAVVISKVDASRCDSLLEVLTLSKLMPALAT
                     TLVSPQRRMANLQSSVTSFLATVLDRRDARLVTLVTGDPAPSLLHTALLLYLQCSHRD
                     NVLSSSLAHLVAAVCEGVHREKLQGTFSMSSGGSLGPSPFVTILHGDDSISKAEKTST
                     AAAPPARPFEAVATVLLSQFGERLSKKVPVLYERLQRALEETPEQAQLAEAETSSLAS
                     SVERSAISGFADFDAAAIDFGLESPLGTPIMDGGSEARLHGLIHSTAATSDEDGENGG
                     DPLASLSSIDDDSDNEEVGTPVPPSAQPSKSSLSAPDSPPGAAATSSAADQHSGDTAG
                     ISSLAASTSLASSAVAALECLDPPSGRGSLLEDEENRLPRRVSIKRTRADSDKLNDDE
                     EEAEAKRVRAEESAA"
     gene            complement(<1422058..>1427919)
                     /locus_tag="LDBPK_313100"
                     /db_xref="GeneID:13389966"
     mRNA            complement(<1422058..>1427919)
                     /locus_tag="LDBPK_313100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863347.1"
                     /db_xref="GeneID:13389966"
     CDS             complement(1422058..1427919)
                     /locus_tag="LDBPK_313100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863395.1"
                     /db_xref="GeneID:13389966"
                     /db_xref="UniProtKB/TrEMBL:E9BN80"
                     /translation="MRAARTRHRPSQRHSGYPISLGWGGPIKGRHGLSTHATKHHMEE
                     LAKSLQQAQAAFLGAQDELALLRAYVEEEAEGRGADNVAKAAAVGLETGVALDNPYYV
                     DLHTSVHRRQEAASLLLQRCAHIFYEQFGALEEKAARLENVRVKEKELQSAKKSMQRY
                     FDAHSKELAEERDRHDGALRLEWERRHHLEDGILRLKLERRQQRLAHSVLLMWMKKAM
                     VRNLAREYTRRREAARETYQSATCDALVQRQRVTAARRALFTWRSRVQQRRCQRLKTA
                     AAEAEQRAQFFRGELAATQQNLHARLNRDVGERDRIATAVATQEKECAQYEDEVHRLR
                     TALRDMTVEFSERTRTYVRQQEAAEQLFARKEATLRDTVCSLQAALTTEQQAHAALAE
                     SSEHFLDHVNACWKAQLQEVAEAVRRKEEYAHHTILGLIGRLQHRHGSLRQEAAKLAR
                     DVDTLAPLSERCVRLENALAESEQLLKRSKASSQSWERRCKAAHVVEALLTDRVASAE
                     SAALRARSFIRWLGHSHTTSSEKSQRSICSLSDKMETQRRQLLVQHQEQSSRHHAEVA
                     HLRDELEQLRRANVRLQSQLEAAARTQRERDGAYYDSEVRNGELSAAMLREKMERRGV
                     EDKWWSSRASGLLLQEAQQRLYIEAHEGQWWTTLLTRESKVLKVWTASLHGDAAQLTA
                     VCEGWQQHCHQIEAAHAAVRKIATARTACALERGVLYAQTLAVWTTWRDWARQRRGVA
                     ALEARLSASRREMMERHGKELARAHTSHDTALQRLQREHMLEKTQLQSIHQERCAALR
                     RAQAKEVEQLAERHAQQLKIAQTAYAADVAQRDEQAGTMQAQLDHVGCLVVEYCAQAT
                     YSRWRAWAAERQAQRTARQRRGMIIRIWEWQTVRTTLIDACAAAKASLWASFTIEIAQ
                     ERAVEVRRQVRHAAQEKELCHSQQHKLQAAKEVAEEEAAYLRGELQHVRTLYDAEVHY
                     TELLLRTATEERRARRSTLVFTARMAEWRELAHGSLAEHQAAAMEAFADAAGKAVTEV
                     SVARRDELAAYAAQAEEEVVVRNARVSGAIAPSPEETGAEKTRTSDGDSALDVSGRAP
                     GEREVDANNAEVTTGDGGGQRRSTGAMAMTPPLVQLVPEDLVPRLRSIESYVTATGDS
                     CEAECEADTTPSAQCGPLLAEPFLEALALSSPHLTAAFSHQVGQADVPSTVRHLLELV
                     RLAALRGAAAHRRDHAAELAVIQEKRAHSEEALASLRESMRGLLAEQRSLAGEMHADA
                     QQQRQQYPTSREAGSAQASLASTESWQERLSALADRYTRALDAFYVDTTGREETFYSV
                     SGVLVEADEFSERLLQRFSENASTMAQLRAQVLAHVPGIASAHQRGAGPDATLPADVA
                     AAVRTVPPSSPEPKAPSLPVTPPSSPGLPDNPIQAACSQRSSLGATTSAVGSTTSPAG
                     STPERHGLRDRVRFLERLLVETKVQLAEAKSLVGVAHRAASLSKASAEAQVWAAQDAE
                     DFSQLALSKEQLLVLYAASESTTRTLMTAMREYDTQLRGTQAEMSQQLRTACAAVEEA
                     LQARHRVDVERYEAKVRALSDSLAAAAREQSRAEARYGELEQQLKSEAASWAEKYSRD
                     TQLIRQSCLSEIDELAGHQRLLEDELQQCRRATQSSIQRAVERQTELLRLEHTEKLRR
                     SERNVARLATEKALLEGRLRSVEEDCERQVQQERAAVARLQHGLAGDAGAAAEMACVA
                     TLASFEMHLFGATELYARCATEKAAWLTACVAGLMEQEREQWETEVMQLRERVAFLLE
                     ASGADPAAPARDGSFHQGSRNVQESGRTTSPQDKAENSSQALTVSPSPRRSNQGVSSG
                     EGGASIAAWGITAQSSPRRAVSSPSAAKTSRGTQGTMSLASHDTTPTRCRSLSVDSLE
                     LSQSFLRYSKMLSDQRSRNATRLERANALAAEVDDLLLRGAQLGHSAASQSAR"
     gene            complement(<1429203..>1431959)
                     /locus_tag="LDBPK_313110"
                     /db_xref="GeneID:13389967"
     mRNA            complement(<1429203..>1431959)
                     /locus_tag="LDBPK_313110"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863348.1"
                     /db_xref="GeneID:13389967"
     CDS             complement(1429203..1431959)
                     /locus_tag="LDBPK_313110"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863396.1"
                     /db_xref="GeneID:13389967"
                     /db_xref="UniProtKB/TrEMBL:E9BN81"
                     /translation="MLAYRVHRIQTGVYIYPWANGEEATLSVSGDHQVTLHCAGDLIS
                     DPFPFDEVVFAPFHNTLYSCCVADGLRLQFGSAVQRRAPSFRDVPRRTTIVHGDPVSH
                     VGETFYNVLLLAAEEVERIAGARHSQSAYECVFNVVRVYPWGEEDLLEAAGRAHRRGS
                     ASSSGTAAEQGISLWNKRTSVPLRTSAQRQLFKSTLKQLCCGPRSEGRDDTAACVQQV
                     RLAVYAPARDSTAGDRVLCAEHLFSLVPSVCDVGASFGTTMEALCEMLVCRRQGNVLD
                     NPLLPVLLPGVSVDCLTILTCISARGEHASRPCIDACCFGCSSERRRHPTAASSLAVP
                     PAGASGNGTAKGTPARGLAPLLRQPVSRSAFFQRMTGDLLMSVAPSIRNASWQTSQPQ
                     KPSATTPRTPPSGPSRASNSDPFAQLDESVDRLLMLRRLRESPAGKPSLLGDGTTSTS
                     PPSETRRTASALPATSGASALSMAVEPLVATPPGRAQNESCESSRGAEIRKLDSLKEA
                     SALIDGANMVANGRAASACRLDESASARALEIEAKVRKRCPDYYAKEATLSLHHEELQ
                     TPCAELVQRERKRHVLVDEGQYHTAELWRTARVFQSLEPSVESLRQREQELSAYLKML
                     DSYVAYVNATCRLYTDQVDAKMLLMDGVKRYLTRRISIAAWVERAGILRQRCEHYDRR
                     VDALQRQEAALSHQMHSMELEATALRTEVQRLEELRDTTERDIAEDKRAAAARQVKAL
                     EEYEESLVSVRRVQGERDAVAREVADLAARRAEVHALEAELAGLQATLDAAREAGAAE
                     ATASSGAHGAENAASKQLSGDEGALSDSSLAAAKGVIEDELHKVIEELAVATEELVEV
                     EDVIIEEVDRAVMVLRRCDGEMTLRFDRLMDRCASFIDVESRLARRSASMFSESSSQR
                     HTRM"
     gene            complement(<1433176..>1434549)
                     /locus_tag="LDBPK_313120"
                     /db_xref="GeneID:13389968"
     mRNA            complement(<1433176..>1434549)
                     /locus_tag="LDBPK_313120"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863349.1"
                     /db_xref="GeneID:13389968"
     CDS             complement(1433176..1434549)
                     /locus_tag="LDBPK_313120"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863397.1"
                     /db_xref="GeneID:13389968"
                     /db_xref="UniProtKB/TrEMBL:E9BN82"
                     /translation="MPMTLSGRGSPSPAPLRRQFAKKPAFNVTSPVLASLSTFAEYAD
                     RRHELLVDIHDGLEDDVRKMEERARQAVAHASAVTEACRAQETECLEYIERLEDNIRD
                     LHRAKRECAAELKGLQTSTERSRQDLEKELHDLRQAVEETRRQKLLAQEEQQHYEMLR
                     DAAKRHYELIEAYLEEFTAKVEFHFHEAVASLQATAQERKRWADEQRALNEKRVREAA
                     LGAEQSDFSAFLCRATEDAERTGAAKPAEQRAAAVEPQLMRDLERDVAALAASVAARL
                     QLIVEQESAAEAGLERLPLRITDESCDLIYSLCRTAAQSTLEGDQESWKRDQRDSCEA
                     ASVSHATRALGTLEVTVKHALLDLCAAAASASSTPSAKCRACPHESPTGAAAPLHIRA
                     ANASASSSAPPSSAGKALPPTPVQAPSLPGSSRRQSESVTFPERRLIDDFSCTTDAFA
                     TIFTPRK"
     gene            complement(<1435051..>1436463)
                     /locus_tag="LDBPK_313130"
                     /db_xref="GeneID:13389969"
     mRNA            complement(<1435051..>1436463)
                     /locus_tag="LDBPK_313130"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863350.1"
                     /db_xref="GeneID:13389969"
     CDS             complement(1435051..1436463)
                     /locus_tag="LDBPK_313130"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863398.1"
                     /db_xref="GeneID:13389969"
                     /db_xref="UniProtKB/TrEMBL:E9BN83"
                     /translation="MSAAAALGAYSCGSRGALCRVRAVPADITTAMSDRYESIETSLQ
                     FSSSSSFSTVLPPIGEEGCTDVRVLVVAGASSGKRQNEKGNDTHARSLQRVVPPSFLH
                     NEGAAASVESQPLAHRALSASSSGRESGNRVHDSATATADSEYYFLSTIRGSTSPPGM
                     STYFGGAVAPTAPVARVTETAMSLMSDIESFEDIETPRSSVVSAVAAEQVSRTISPSP
                     PTPSLHSRKTGARGDLLYAEVAVVNAEEARAAHALLTSSSAAIIARYRLVKLKVVQRI
                     YRIYYDKWRWRIFQSASAVPPLHVTMGIQTSAPCQRSASVETDFADIDSFHGSRSMSL
                     SGDSPGVHVAVTAPPRDAQPLRSSPATPTPSPRLGEGESERGISVTWSPAPAFRLETF
                     ASASPPSPPQPSKYRTPTFSIPPAAPPTDGIGVRTKPAKLVDFGHPSEGPQRKTLHIA
                     STPAVNLPVVVPSPERIFRC"
     gene            complement(<1437096..>1442429)
                     /locus_tag="LDBPK_313140"
                     /db_xref="GeneID:13389970"
     mRNA            complement(<1437096..>1442429)
                     /locus_tag="LDBPK_313140"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863351.1"
                     /db_xref="GeneID:13389970"
     CDS             complement(1437096..1442429)
                     /locus_tag="LDBPK_313140"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863399.1"
                     /db_xref="GeneID:13389970"
                     /db_xref="UniProtKB/TrEMBL:E9BN84"
                     /translation="MEHNGVKPPMPQLRLPADYAYNPLYFVPNSNAVSEGGIGEDDAV
                     EPLHRLSHAVLQATTYLHRPLHFSPSPSNATPVRSHDNRSRSRESSLTRRSGELSPAA
                     ASARRQRRSTSMAASHAARRRRGHALTQEVAAWQRRSGKDCADQSSVATPSQEVTADT
                     MHADLSTSILRPTRATQLREDYVLHYIEERDEAAQNIFFRPKGWPLSGAALNSPYRQH
                     CTSSASPLRNGFLTPTRPENSSAASLPTPRFTKAAQLRQQSAVQLMEKLERCELEKAA
                     EEALAHVVAESSSRRALMRLRTGAHSNSSSRFLAVQRSGGARGASTAMPFSGTQPSHH
                     VPRWHHTSRTGSSGDTINGAGHRIRATSSASTHSSPREEWLSAASTCFDDREKTLNKQ
                     QHAAEATHAPSRGLVPDAPAPLPSSKYRSCKISKEALKAPRGELSSAKATEAMAVLPK
                     PAACNGGERVPSRHHRRRRCSYAAQRDSESLSPVAIRDVRDTAHPSPSTAALASPPAA
                     VHREREQRGIRTPPAVRDTETKMTSRGDAPLAQRATSLTPSHLRDGDDASSSSVSSIM
                     FTVLSAPQDDTAGAHLPEARHDWQQVATQGSRMRESGGAADDSSLEFRSTGRSDCEHS
                     ASLLACLTPVAAVPPSAMRGAECSSFTSPDFSRVPSPTQASASVTSDEARVSAATAVA
                     APHERETKTSCAEREVERTPHAVGANASLAPRRPLEQALQGTREEPSARSSARCLGRR
                     GVCPPPVDAYPAPAHTPHTPSTERSGDVSRRSLSQDPYHAGSSISSRSGEFEAQPPSQ
                     SESTGRSAQVAATTLPQTVRSEVAEGDSEKEPSDAAEVRHEGSALSTQSSFASIASYH
                     TEVHVHIPAVVSDAADESLEAATSQTELLAFYRIAKPSSAAVESRLHRRAEHDWSLKS
                     NVRASSQGDEASRAGDDKQVLRGHGGAVPSSPSWLLNASEGISSALCGLVPSAASGES
                     DASRSVATDAYTVVAGGGRRVLAAWSLPVPPTNCTHMVAAKEARQRAAVEAGLSKLCT
                     ASEQPSRLLSGHISDSRIRQLTAAGVNSASSYQPRRERPVGKEALDSPRKPSMQESSR
                     CTSAPPSAAEAPSSLVVASAENGTRDDARPEVVADKAEALAHGKTTDDAPSAAVSLAD
                     VAVLGTDRKGDVDAPSVQREGGYPRDATQSLATVTVAAASEKSSLSLVGAEQPAAIEN
                     ALAESLPVKDAPASRAVLSRSSCVAIGRENRPTEKAMGSLALGVDSVPPQSHAESIRS
                     VQETGVFTSDGTVGSRTAVLASLPHPLSDTHAGAAVAKAEGRQNDVVPCDGAEAAPAP
                     CIAKIRSATSSVRESAQPKEVSDIPLSVAAVQPEDATLHRSRSSSAEVGGANRAERTA
                     VVGVNTPPSLSTWPRTVELAFATASFLTTEHGSFSLHFTEAEQSPRERSVYARQAASL
                     SNGGGEELGEGVPHSHAPTPLHCRLPPQRRQATSPYEGVQLPDASAAEERKRDAPLAQ
                     AFSRSDTSTRCLCAASAEFQADVHVRAHTNERAEGTPAVPFGASVNGVSSVREQSRRA
                     AAQDSVALDRSAPPSADATLELAAVCAPFSHDSPARPLSSSTSSSTHFLARSPSCSSQ
                     SSSSPTTPTATGRFMPSSLGRLDTPNQGDGGKVDFELRADDDCNGLLTGNAADANRST
                     FSRSTSCDLLEHAALVQLTEPTSTDAAVITTPFRPSSPVPGSEFSTTCSQISERITWS
                     AGTWVDRERASASPDHAEAGVAESDLGVLRKGTRSAPSVPLTRVRYLNQDM"
     gene            complement(1444096..1444353)
                     /locus_tag="LDBPK_313150"
                     /pseudo
                     /db_xref="GeneID:13389971"
     misc_feature    complement(1444096..1444353)
                     /locus_tag="LDBPK_313150"
                     /pseudo
                     /db_xref="GeneID:13389971"
                     /db_xref="PSEUDO:CBZ36713.1"
     gene            complement(<1445477..>1446223)
                     /locus_tag="LDBPK_313160"
                     /db_xref="GeneID:13389972"
     mRNA            complement(<1445477..>1446223)
                     /locus_tag="LDBPK_313160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863352.1"
                     /db_xref="GeneID:13389972"
     CDS             complement(1445477..1446223)
                     /locus_tag="LDBPK_313160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863400.1"
                     /db_xref="GeneID:13389972"
                     /db_xref="UniProtKB/TrEMBL:E9BN86"
                     /translation="MWRSIRRTSCPVPWMTVARWQSTSGKDAAAAAAPAANCTREATR
                     ADTSASVETPDAVNGGSAAQSSAKSDAYRFPAGEVMDAVKKRDFNAMQTHATKLVQSQ
                     WKEEYNVPAACVVIFIVMWYWIAWTRRSIRRKCEATKASVKQQTDEMVEIVRNMTEKW
                     KVDMSKANKQMQGIIDKNSELTRDIDRMTTALRSCSIRPTAASAAAIAPTVSVVKRVD
                     PVDEEAPAEATETAAGESSEALAMVEEDKD"
     gene            complement(<1446869..>1447393)
                     /locus_tag="LDBPK_313170"
                     /db_xref="GeneID:13389973"
     mRNA            complement(<1446869..>1447393)
                     /locus_tag="LDBPK_313170"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863353.1"
                     /db_xref="GeneID:13389973"
     CDS             complement(1446869..1447393)
                     /locus_tag="LDBPK_313170"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863401.1"
                     /db_xref="GeneID:13389973"
                     /db_xref="GOA:E9BN87"
                     /db_xref="InterPro:IPR007325"
                     /db_xref="UniProtKB/TrEMBL:E9BN87"
                     /translation="MRLVDLSLPLYDGMPAYDGDPPVRVTKVCTREKDGWEVRHLQMG
                     SHTGTHVDAPAHMHEDGSNLDEVPLTRFCGPAVVVKVADSSFPPNKGLLFYEAVPAEC
                     VPRIVAANAPFVGGPLEEETERLLLSRGIITYTDLVNVDQLIGESFTFYGLPLRIRGG
                     DGSPVRAVAVMDDD"
     gap             1450867..1451666
                     /estimated_length=800
     gene            complement(<1451668..>1452027)
                     /locus_tag="LDBPK_313180"
                     /db_xref="GeneID:13389974"
     mRNA            complement(<1451668..>1452027)
                     /locus_tag="LDBPK_313180"
                     /product="iron/zinc transporter protein-like protein"
                     /transcript_id="XM_003863354.1"
                     /db_xref="GeneID:13389974"
     CDS             complement(<1451668..1452027)
                     /locus_tag="LDBPK_313180"
                     /codon_start=1
                     /product="iron/zinc transporter protein-like protein"
                     /protein_id="XP_003863402.1"
                     /db_xref="GeneID:13389974"
                     /db_xref="GOA:E9BN88"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:E9BN88"
                     /translation="METAKLSVEASTRYLMALGYRVSAPLNADGSSTANVGETEHSLC
                     RGFTGAYSLGLHVGALFLILFVSLLGTAIPILGKCIPSLVRYPYVFSVAKSAATGVLL
                     SVSTIHLIFEGAEAFSED"
     gap             1454976..1455074
                     /estimated_length=99
     gene            complement(<1455271..>1456569)
                     /locus_tag="LDBPK_313190"
                     /db_xref="GeneID:13389975"
     mRNA            complement(<1455271..>1456569)
                     /locus_tag="LDBPK_313190"
                     /product="iron/zinc transporter protein-like protein"
                     /transcript_id="XM_003863355.1"
                     /db_xref="GeneID:13389975"
     CDS             complement(1455271..1456569)
                     /locus_tag="LDBPK_313190"
                     /codon_start=1
                     /product="iron/zinc transporter protein-like protein"
                     /protein_id="XP_003863403.1"
                     /db_xref="GeneID:13389975"
                     /db_xref="GOA:E9BN89"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:E9BN89"
                     /translation="METAKLSVEASTRYLMALGYRVSAPLNADGSSTANVGETEHSLC
                     RGFTGAYSLGLHVGALFLILFVSLLGTAIPILGKCIPSLVRYPYVFSVAKSAATGVLL
                     SVSTIHLIFEGAEAFSEDCIPAVLKSYGPLYFLLALIAVLLMQALDMQLADIAERWMK
                     AKLKREAEAAKAESKGDGECCGLSPDVDAGVTSGLAPADGPLADERKSTSLKSGAQTT
                     VPVAALDDCEVPLVALSPEHPVQHHHCDEPAAHGHQHLSVAPPRDMGYLRCVISAVCM
                     EFGVTLHSVFVGLDVGLKKDSELKPLLVALVFHQLFEGMAVGSRLVDAKFSATLDVVL
                     ALVFSLSAPAGMAAAAIAVSVSPSAMSGSGFATVVAVLDTLCGGILLYLAFTLLLGDF
                     VADVKHYCCDGQGHRTVKKIMLFVSLWVGMGLMALVGNWL"
     gap             1456574..1456672
                     /estimated_length=99
     gene            complement(<1460747..>1461832)
                     /locus_tag="LDBPK_313200"
                     /db_xref="GeneID:13389976"
     mRNA            complement(<1460747..>1461832)
                     /locus_tag="LDBPK_313200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863356.1"
                     /db_xref="GeneID:13389976"
     CDS             complement(1460747..1461832)
                     /locus_tag="LDBPK_313200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863404.1"
                     /db_xref="GeneID:13389976"
                     /db_xref="GOA:E9BN90"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:E9BN90"
                     /translation="MGGSCMGLQSIIVVRIVGPLIYGMDSDEEPPAAVANTFSTTAAR
                     GVSSSLISRPLLSSGVGFRRESDSLAELCAHLKRRYEGLSRLPSHVPSVVSFCVGGKD
                     FAVSRALLEKDPGSLLFSLARLHFCSTSSAKGAADASARGRKRSRDGNDETMTDAVVS
                     IPERNARLFGMLLNLLRGYKNAIPEEWMDSCREEAAYYGLSGLWNSRFHITSSQYYFR
                     NPLHNSKLISDAVLGVASDFFSTGQHHIDFSVSQCDRVAVGMISSNVGSAEELATPPH
                     DGNNGAFYWNDGKLSFYLGEPRVVETGLPFPAGAIIRIIFDADERIVRWIVNGEYCVA
                     MERLPAGRQYAFSSIAARSSQVTIVPT"
     gene            complement(<1462472..>1465864)
                     /locus_tag="LDBPK_313210"
                     /db_xref="GeneID:13389977"
     mRNA            complement(<1462472..>1465864)
                     /locus_tag="LDBPK_313210"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 5"
                     /transcript_id="XM_003863357.1"
                     /db_xref="GeneID:13389977"
     CDS             complement(1462472..1465864)
                     /locus_tag="LDBPK_313210"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 5"
                     /protein_id="XP_003863405.1"
                     /db_xref="GeneID:13389977"
                     /db_xref="GOA:E9BN91"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:E9BN91"
                     /translation="MATAVALPQPILSFTLCLSNPRSSCGSFSTLTQITGSCCLACTH
                     PARQAAMASVAQHIITPAVIRAKYSGYVLSNGVKCVIVQDANAKMPAAAMCIRAGQLN
                     DPVELPGLAHFCEHMLFMGTEKFPKEDEFDSFVSKASGLTNAFTEDCDTVYYFSVSDG
                     SLEGALERFVEFFASPSFSAGAVAREVNAVHSEDEKNHNSDYWRLDELIRDFCNPKHP
                     RSRYGNGNLTTLRDEPQRRGIDVRESLKTFHSRYYLADGATIVVVSMRSADEVLSLIE
                     GPLARMKQGAVPRFSFLEAGEHLFTSAALGSWTNVRTVQKMRELRLMWAVRSPSSAWR
                     TTPSAYIAHLLGHECDTSVLGVLKKRNWATGMLAGSHRVDDDFEVLDASVTLTVEGFR
                     NALKVVDLLYQGIGQSIAHGVDAEVYKGMKAEERLFFESVDAGSPANHCVALAQNANA
                     TDLEHCWIGGNVVLEDDMEAVLAYVRQLTPQNCVMVMQWGDMPIDAATGATPAEGNPV
                     ESHAQQHDEEDDEDSQSAEEETAEETEQASESNASAEELFLSLPAFAQVRVSNVSRFH
                     RALYQTVKIPEEHEARWQSLISGPYPPELALPSTNPFIATDFTIYPPAAEEAVDEIAS
                     PHAVTYVRKDAGHHSTFKMALRCNVLSPVASASPLNRLYTRVMHGILSNALTEMAYYA
                     MLASLTNEVIFSPTGLGFAVEGPSQKLYEFFFAVVRKGLSVQVLQGTAEEYATYLETG
                     VQKLKNVGMAQPYKVLHETQKKATRHTYYLFNEMIACESAATYEGYCTFVKQYLESGL
                     LLECFVAGNVLSTQDVREMLVGRLEDLLGTLTIPIPLKETIPRVRDTYGPRAGDGKAN
                     ESVLCSFDVLSMPPSNPADPNAAVVVDVIIGEATPRVMALTDTAMKLISSSFFNVLRT
                     REALGYVVFAESSVDYCTAHALFVVQSALKDVDCVYLLSRIVAFLSAVEAQLDTVCSA
                     EEVEKVKRGLIAALEKVPDSVEGDVKRLEGEYVSLSKFESRQRTIAALLAITAEDVKS
                     HLRNYFFNNRSESRALALCINNARTVAADVLAEPGNRRVPLPSVRSRQEDSDDAPGDA
                     SEDTEPLTLPTFSDGSSCVEITSYASALEYQHGLCLVKCNAY"
     gene            complement(<1466902..>1467555)
                     /locus_tag="LDBPK_313220"
                     /db_xref="GeneID:13389978"
     mRNA            complement(<1466902..>1467555)
                     /locus_tag="LDBPK_313220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863358.1"
                     /db_xref="GeneID:13389978"
     CDS             complement(1466902..1467555)
                     /locus_tag="LDBPK_313220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863406.1"
                     /db_xref="GeneID:13389978"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BN92"
                     /translation="MLRLSRRLLGAAGAGPFDPYKILGVKPDATKDEIKKAYHRLALR
                     FHPDSGAEGNAARFAAVNEAYEAVKDGKWKYSAQQQQKAEEQNRGGWRDPKMRMYVYE
                     QPGSTTDGYVSGDTEKYMRFFMIGCFLFIFVRVSLFFLLPVTRNGGRHETVLDQERSD
                     GCLPLDAVGNQETPFEQSLANAANGCSSGSVHADEEVEYKWAEGGASTHLKDPLSYR"
     gene            complement(<1468016..>1468681)
                     /locus_tag="LDBPK_313230"
                     /db_xref="GeneID:13389979"
     mRNA            complement(<1468016..>1468681)
                     /locus_tag="LDBPK_313230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863359.1"
                     /db_xref="GeneID:13389979"
     CDS             complement(1468016..1468681)
                     /locus_tag="LDBPK_313230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863407.1"
                     /db_xref="GeneID:13389979"
                     /db_xref="UniProtKB/TrEMBL:E9BN93"
                     /translation="MSSRATRLRLTEVAPQRCRLRAAGLPASPPHETMKTDTASVHCT
                     RASFAQFARQRCADSPWELRSKRDPLGAPVEWLEATYNVCSSFEGSASAVLITVCVLF
                     NADFAVPQLGFYNSTVTSLEGLRMAVPNLTFVNAPSTVEPADVAGALRRPLVSFSWNQ
                     ELGQYMWLVHPCDTENLLLCRRYDGEQGDILSVFLRAMSDYFPFAPLLVPRAGGNFDT
                     ART"
     gene            complement(<1469764..>1472304)
                     /locus_tag="LDBPK_313240"
                     /db_xref="GeneID:13389980"
     mRNA            complement(<1469764..>1472304)
                     /locus_tag="LDBPK_313240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863360.1"
                     /db_xref="GeneID:13389980"
     CDS             complement(1469764..1472304)
                     /locus_tag="LDBPK_313240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863408.1"
                     /db_xref="GeneID:13389980"
                     /db_xref="UniProtKB/TrEMBL:E9BN94"
                     /translation="MSLPRVEISVELGADTPDHSRTDYPFNRSRRDSLASSRFSSRLS
                     RRSSVRDEVQSLDEFLRKQRVIRYMQEERERAERSKLLREEHDFWVEFRDRERAERLK
                     YMTEQEIVELLQREADEATRESNRADQFHQRAMEDALRRRHITADVQRGEEDSALARL
                     KGEVQVDGIRLAAERETSVMVEAMTVAERTRRACIERQQREEDLTAKCQQLTTELEEA
                     RASATRAQRYQKRAEDDLTRERENTRKEKTTAAACKEANDKLLKELAEVRQQLTASEA
                     ERKKAEAAKAQAAREVAQKEEELTSLRKRNDELSAQQTSPKAAAEDEKQRAFPFQEEL
                     KAYRDALEKEQAARSRAETEVAALRAQAKALEAKVAAASAPDPKQVADNMRKLKAVAD
                     DARKAQADLVKERQARESAEAVAAEARDALAKEQAAREKVEKEAQRALAASSVPVLHV
                     QKAESDRKKLAEAEKKLEEMRRARNRDEVEKAALKREMEKVKRDLEDEASARAQFEQL
                     ASQAVSADDRVPRREVDQLRKALQISQEQCDAARRDTVACQQNAAREVALLKAWCERL
                     QQQHRMQQQLLQSDEEFTPRTATPTPHSRTPRSVRKRIPQDLAADHRQAEEMAASDQR
                     IRELEAHVARLQADLERSKDQERKAAAEAEQARKALKASTATSKPDSSKASPGPSERG
                     AAKQQEAKERAMLQRLDALERDCAEAQRKYDDLVVAHRQSEAARCEAELQVAAQRAQI
                     EQRQREEPQSYTSALGNYETSRSEPMPATAGESTSALEERIKELERHLTEERVVRQAA
                     ERRAEELQKLCAAPGADAKSAAKQAEANVSSSGAGAKCKPQKAKSGCC"
     gene            complement(<1473236..>1474984)
                     /locus_tag="LDBPK_313250"
                     /db_xref="GeneID:13389981"
     mRNA            complement(<1473236..>1474984)
                     /locus_tag="LDBPK_313250"
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /transcript_id="XM_003863361.1"
                     /db_xref="GeneID:13389981"
     CDS             complement(1473236..1474984)
                     /locus_tag="LDBPK_313250"
                     /codon_start=1
                     /product="phosphatidylethanolaminen-methyltransferase-lik
                     e protein"
                     /protein_id="XP_003863409.1"
                     /db_xref="GeneID:13389981"
                     /db_xref="GOA:E9BN95"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="UniProtKB/TrEMBL:E9BN95"
                     /translation="MSVESASGSAKLSLTSSEDGESYGLLHDGTRFRVPDTMSVMDAL
                     LTPKSWRSPATLIWIASWFAVGMTGLLYFTHGLPMWFFCAHFAFWRLAYNIGIGAILH
                     YHSRYGSFLKFYRRIVNDYPITRRLLEASVVFQDNTEYKVSSFPDEFNAWMLFRQIEN
                     VILANDLVSYCVLSVVCWEKMSLRSPMDICCFVFGCASIAFALWSKFDAHRVIGDFAW
                     YWGDFFFLLDKNLTFDGIFQMFPHPMYTVGYAFMYGVPVMAKSYTLFYMSVFGHLCQL
                     AFLAFVENPHIDRTYNVLSSPTPEEQQRHAVLYGNGSEAYLEHNELVVLMHFDIFRAS
                     DLLLALTIIYLLATLLLPLPAWVYAAHVMAWRLFHNGFLGYLLKRESCEKWFSRNYAS
                     PQAAFNNWKRIYNASVTITNLSYCLCAVKYFTWAMPLFSSGEARCFVMIVGTLLVGIN
                     AYVSWSIYEAIGDYGYFYGDFFIENVPAKLNYSGIYRYLNNPDSSLGMSAYYGIALLS
                     GSPVVLVVAMMSHAAAKIFEAVVEEPHMRKRYGDQVREAGGMQAEFVRRMKVSKAEYD
                     KKMRAIKAKLECRKKQ"
     gene            complement(<1475782..>1477845)
                     /locus_tag="LDBPK_313260"
                     /db_xref="GeneID:13389982"
     mRNA            complement(<1475782..>1477845)
                     /locus_tag="LDBPK_313260"
                     /product="methylcrotonoyl-coa carboxylase biotinylated
                     subunitprotein-like protein"
                     /transcript_id="XM_003863362.1"
                     /db_xref="GeneID:13389982"
     CDS             complement(1475782..1477845)
                     /locus_tag="LDBPK_313260"
                     /codon_start=1
                     /product="methylcrotonoyl-coa carboxylase biotinylated
                     subunitprotein-like protein"
                     /protein_id="XP_003863410.1"
                     /db_xref="GeneID:13389982"
                     /db_xref="GOA:E9BN96"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:E9BN96"
                     /translation="MLRRTDRCGQRKVEKLLVANRGEIACRVFRTCREMHIRTVALFC
                     EAERNAKHVVEADEAVCIGPPPAVNSYLRGDHIISVAKQLNVDAIHPGYGFLSENADF
                     ADAVTRSGIEFIGPPASAISLMGSKSESKRIMEAAGVPVVPGYYGENQNVSFLAEEAN
                     KVGFPILIKAVSGGGGKGMKIVERPEDLAFMLESAKREAANFFKDDRVILERYVKRPR
                     HIECQIFFDKHGRGVFFFERDCSVQRRYQKVLEEAPAPHLSMEMRQRIGEVALQAAKA
                     VGYVGAGTVEFIFDTSTGDFYFMEMNTRLQVEHPVTEEVCRIKGAPLDLVKLQIKTAM
                     GKPLTFSQEDVALVGSCIEARVYAESPERGFLPESGPLTFIREPFQGVRGPTRTRLDT
                     GFCEGDNVLIHYDPMLAKVISWGRNREDALKGLRQALSEYKVAGINTNIEFLKRCCEA
                     PEFTRGGVTTNFISEHEKQLLNAPAVTPEVAAMAATAWLLNRCDNWRGAFRLNGDTNA
                     TVHFYIDNRPVEVRLHTEGANYHKIFFSVWDHEGSFAVGSGPVTSKHRDQRSIVNDFT
                     FLFENGMRHTVLAVATEGDVTIIGSFGLHQIRLLPLTDGFGDASMAGGTSAKIVSPMP
                     GKVSKFLVNSGDFVDKGQALMIVEAMKMEHPVKALQDGQVSFLVKEGEVVGSDHVLAT
                     VVQKE"
     gene            complement(<1478405..>1479688)
                     /locus_tag="LDBPK_313270"
                     /db_xref="GeneID:13389983"
     mRNA            complement(<1478405..>1479688)
                     /locus_tag="LDBPK_313270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863363.1"
                     /db_xref="GeneID:13389983"
     CDS             complement(1478405..1479688)
                     /locus_tag="LDBPK_313270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863411.1"
                     /db_xref="GeneID:13389983"
                     /db_xref="UniProtKB/TrEMBL:E9BN97"
                     /translation="MGKPPSTSATRASSSLSWRTTSHMVTLSVSALSLPLGSSVALMY
                     AVKPWGHVILVGGCVGTYAMGIGMRWRESNVTIVERRRSPSYERAEMRRCVLTDQTVK
                     LLTDLGCTERKVLSVLRPARGWRFLSPDLTPLREGSVFPGCAIGESAYQCTEGVLLRT
                     LRTEFLRFGGTIDWETEAHSADANNDGSDTWCLRRDYGLSTNVEAIITMAKGTPFAEM
                     LVARDPSRIAVLFDVERGVCKLESRDTSVLFDQQSDVSIVVGNGIALHCWRSGTDECA
                     WRLVRSATTHSSLDASLDGMHDVLKTVIQKSQQRIRSVCALPGTTPAIKDEAVRFRVG
                     LLGDGLLPIDPFEWRGDNARCMIEEASAVCRLLYGKKYQRGDVASLLRGAEQDSISKR
                     ANLLQRDLQDAEHFLAAHPLLESEPTLPAMRRVGS"
     gene            complement(<1479902..>1480273)
                     /locus_tag="LDBPK_313280"
                     /db_xref="GeneID:13389984"
     mRNA            complement(<1479902..>1480273)
                     /locus_tag="LDBPK_313280"
                     /product="dynein-associated protein, putative"
                     /transcript_id="XM_003863364.1"
                     /db_xref="GeneID:13389984"
     CDS             complement(1479902..1480273)
                     /locus_tag="LDBPK_313280"
                     /codon_start=1
                     /product="dynein-associated protein, putative"
                     /protein_id="XP_003863412.1"
                     /db_xref="GeneID:13389984"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="UniProtKB/TrEMBL:E9BN98"
                     /translation="MNKANPSAAEREAHLQNVEDTLNRIAHHKGVLGYFIMEPQKGKL
                     LSFAGFRGSSREAHRYADTLKGFIDLTTSTVRTIDWKDEMTFLRISCDTVDILVAPDA
                     NKEYTMVVVQTVKGRCAGGDT"
     gene            complement(<1480726..>1485135)
                     /locus_tag="LDBPK_313290"
                     /db_xref="GeneID:13389985"
     mRNA            complement(<1480726..>1485135)
                     /locus_tag="LDBPK_313290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003863365.1"
                     /db_xref="GeneID:13389985"
     CDS             complement(1480726..1485135)
                     /locus_tag="LDBPK_313290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003863413.1"
                     /db_xref="GeneID:13389985"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BN99"
                     /translation="MVQSIARVIGCSGSASFAADKSRLFFPADNGVVVVEDGGEHLWL
                     PFPSGKYPIDKVAISSCGVLCVTEKRLRVALHFFDATSLHSLGCTETEISVSVADIVF
                     SADGTELFVLATVPDTAVTVFRRSTRSGGYSFADCVPLRHSGEPKSLLAGGLEEAVVR
                     FAICRSDGIVGYSHGDDGKSFQKCLFVEARVESACTSGPNMVCYATKEGSVYVYSHDS
                     QTTREVCEAPAAGGAVAMLALDGTAFIFTCSGALLSVDLTEGTCRCLSLGCLPSCTSR
                     IAATSGGELLLSTQRGLLAVTVPTATSRGGAALRLVKGWTEASTLRCLSVNGGALVAW
                     VLRDGSVALYERNAVRVFASCGARGPAVHVCVLSASQIAILFEDATVVCFDCMGGKDV
                     WAHKCLECTPIFLEADGCGALACCGRDAVRFLSCLGDSVEDRGIVRATLLASICLARW
                     VPSETNLLVVCENGDAFLIEAPDDGDAMTTHPAETLVRKWWRLDFPITDALVCYATPE
                     VLNLFVHSADHDSKVYTLDRQREGDVKVSRPLFLIHDHSSGGSCLLRLNDATVISCGR
                     DGSIAARDLTPYQVQMTPTPPSREKRKPLWIHAARSSFCGGITTAAIADAGAEVVCGG
                     DDGVMQCVALKAQGAQATWQEPEWTHAVRARLGTAEDEATVVQASDAAPEREALLREL
                     SRVRELWAKAMSEKDADVPLEAFLTPEQREQFAAECESAVLEMRERHYYHAILNEYLQ
                     DTIRRRCFEAMEVTRMKVVSMNTPGLEVHNFHIHRRTRAEASLSRKALFLRQLQEKVS
                     AGRRTPPGMQIVSKTATHVAVSPSGAEDFDAAMLNDADVYTQCRMVLQSLLVKGRSLV
                     LKDAFNACFTHLQDLKRQSVMQVEERTQRCITIGKQLGSLPAQLFSAVVDTEESPNSL
                     FVVEDKELGAEARALIAPSEGTVVVSPVDEAALHLWMDGLEKEVERLEVHVPLPDFAD
                     DTRDTFVPPEERTEEQTRIVEAYAKRLKEENERVEGKREALRGEFRALQEKNREAAET
                     LDEQLRQIRQLRLSTAEEVDEAELQLALLFQHRLCVSAAYRQHRSLAREREALRDGLT
                     GAESIAARQKRTLTAAQARLTAAESKTDSYAASARLLSPFDDGATGEKLHRRFVRWQR
                     RFEDGKAPLPDADTPAPDCTAEQWAAFCEHCQTVAKLQQLADGAEAEVQRAAEDFREA
                     QQHCKLIAHQIDATGEEMDAVRESSVTRLLDVHALCRLHQGQIQDESATTATAFSSSN
                     LRWHNDVAQYNDLILQSDAESRALLNKVFARRKLMKLLEWEGERLRHCAGTLQLELRQ
                     LHTLRVTRQMQEWLNGEVDLSEEKTLAHIQRHMDLVETNMSRKVEELRGVVRQLKNQI
                     AERVTENTIVGAQCGDLDDTVRANGAVYRLVETRADGSHSRAARAKEIFVTSELEELA
                     RSQQEELVRLKREVDRLRERTFPSFAVVSKQTR"
     gene            complement(<1485978..>1487267)
                     /locus_tag="LDBPK_313300"
                     /db_xref="GeneID:13389986"
     mRNA            complement(<1485978..>1487267)
                     /locus_tag="LDBPK_313300"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003863366.1"
                     /db_xref="GeneID:13389986"
     CDS             complement(1485978..1487267)
                     /locus_tag="LDBPK_313300"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003863414.1"
                     /db_xref="GeneID:13389986"
                     /db_xref="GOA:E9BNA0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BNA0"
                     /translation="MSAFSSVLGAPGATGDVKYVKKKLIGTGSYGEAWLVERVSDKAI
                     FVAKTMDLGKMSSRDRTYAYSEIKCLASCHHPNIIKYIEDKEDNEHLLIVMEFADSGD
                     LDRQIKARATDFKHFQEHEALFLFLQLCLALDHIHGHKMLHRDIKGANVLLTSTGLIK
                     IGDFGFSHQYDDTVSGVVANTFCGTPYYLAPELWNNQRYSKKADVWSLGVLLYEIMAL
                     KRPFTSTNMKGLMAKVLSGDYEPLPEVYSADFRDVVRKILVCDAAQRPSVRDIFRFPY
                     VREGLKVFMHTMKKNSRIDNEVKDALMEHVTEILSSESVEVPKSTPVGQINKDVFFSG
                     YLNKLKGGDNHSWKRRYLQVQKGHFIMSDKESDTEGKALSLEHIQSVCPVPVSTAKRE
                     HVFALHTTSGKSMWFEAASLENMEEWIHAIQCGLGVA"
     gene            <1488941..>1490848
                     /locus_tag="LDBPK_313310"
                     /db_xref="GeneID:13389987"
     mRNA            <1488941..>1490848
                     /locus_tag="LDBPK_313310"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003863367.1"
                     /db_xref="GeneID:13389987"
     CDS             1488941..1490848
                     /locus_tag="LDBPK_313310"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003863415.1"
                     /db_xref="GeneID:13389987"
                     /db_xref="GOA:E9BNA1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BNA1"
                     /translation="MSVVEEVYAEGRRSIQETRSSQAPRFCPSRTITINEPQRFFMLL
                     IGVYACICTSISYVYNLFSGQLQEKYNFTQKQMSVITTMSNILGLVVFPLAGLYDYYG
                     PRPLFMIGMIILPLGGVLFGLAFADAVGGSVARFTIFSAFLGVGTAMFDIAGLMTILS
                     VFPSSRGAVIAVMKTFIGLGSAIFGAIQLGFFEHNITGFFYFLSAFAAFVGFLCVLFV
                     ELPPYQLTGYEEKYLTEAEKAKKLSTKKAYLEKVPSPRRFKYGFVLVAFLIVLLPLQS
                     AVVAYMQLGHPYKVAFALITIGVMALYCIIAIPLRWLDVGSANIIEQLPEENETAEAA
                     AAAASDRRMTAAQRLSMRINTTRTSIAERAIFNAASLDESAHIAPQYQTSFFESVCTL
                     KLWALAYSLFSICGTQMVIIVNARFVYAAASETHMTPEVASLLTIFNGAGSAVGRILM
                     SIFEVWTQKRKPEERIPLTISLFIPSLIVLAASLMLLFAQKEWLLISFGLTALGNGFS
                     AASIVLVMRTLYAKDVANHYNCMSLSSLASSVLLNQMLYGNWYTKEANKQGSNICIGR
                     QCIFVPFAIMSGLLFTSLFSDLYVHLHYKKFCDEVLAERAQLRGARASTPQTDEPDVL
                     DEHEPFLSSTN"
     gap             1491686..1491784
                     /estimated_length=99
     gap             1492499..1493200
                     /estimated_length=702
     gap             1493823..1494157
                     /estimated_length=335
     gap             1494848..1494916
                     /estimated_length=69
     gap             1495732..1495830
                     /estimated_length=99
     gene            <1495866..>1496105
                     /locus_tag="LDBPK_210010"
                     /db_xref="GeneID:13389988"
     mRNA            <1495866..>1496105
                     /locus_tag="LDBPK_210010"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 2"
                     /transcript_id="XM_003863368.1"
                     /db_xref="GeneID:13389988"
     CDS             1495866..1496105
                     /locus_tag="LDBPK_210010"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 2"
                     /protein_id="XP_003863416.1"
                     /db_xref="GeneID:13389988"
                     /db_xref="GOA:E9BNA2"
                     /db_xref="UniProtKB/TrEMBL:E9BNA2"
                     /translation="MAELRVHCLPRRAVHHEGRRRHVLEGATVLERPAACARWVGKTA
                     QLDGDHSPQRGYPTDAGHRRRGGMPVSSVVVVRQS"
     gap             1496665..1496763
                     /estimated_length=99
     gap             1500661..1503248
                     /estimated_length=2588
     gap             1504497..1504595
                     /estimated_length=99
     gene            complement(<1504598..>1506400)
                     /locus_tag="LDBPK_013340"
                     /db_xref="GeneID:13385812"
     mRNA            complement(<1504598..>1506400)
                     /locus_tag="LDBPK_013340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003863369.1"
                     /db_xref="GeneID:13385812"
     CDS             complement(<1504598..1506400)
                     /locus_tag="LDBPK_013340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003863417.1"
                     /db_xref="GeneID:13385812"
                     /db_xref="GOA:E9BNA3"
                     /db_xref="InterPro:IPR002049"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR016201"
                     /db_xref="UniProtKB/TrEMBL:E9BNA3"
                     /translation="MWRALRRVAFWGSWLAVAVLCGSSGWVSRATIVNYTVTSVTRGQ
                     LAVLSHEHWAQYQTICGSPNATQTWNDTSLMRFVFPPLSRAGVSAAFYAWNGISWYVS
                     DMGFLSPTPYGMCKGFCQKEIYATLQGNYAFSDNVSVLYDGGGDWPMISFYAAPFALS
                     GGFPSQVSIATQDTIADRDVSSAAGEHTPDSIQGIRNAGVDGGYTTLEYCNVPILGGT
                     GSAQTQLTAQVVVYANGTIIMRYASLPDTSTLPEYMPSTGLIYSKTLRTVVPTPTTAN
                     GIVAYRFDPVFDGCAAHGDASVCTADTGGDCVWCSSTSACCASTLASAVCPRGQWTTP
                     ASSTAAFAPQKFYDVTVDFNGVFRDFVSTYRDLSAVDEFEVITGWDGVLFESYNSTFL
                     QCRPGLSCTIAPHMNSCNPIMDTCPNGNYTLTILGLHSNLVWGAEAKAISTLTSTEPD
                     GTPLCTSEGCGQGFMLKVTGSRLQTGSIVSTTFTVQLFLDTSGMVDLVIQADRVRAGT
                     PLLAYPPMRVGLVRYGVDDVSSVMIPQGLLRSGLHVRFVPLSSCKDCGLNGWCDKVSG
                     TCQCQPGYHGSSCVACPACWTGSKCDDGINGSGTC"
     gene            complement(<1508023..>1508208)
                     /locus_tag="LDBPK_013350"
                     /db_xref="GeneID:13385808"
     mRNA            complement(<1508023..>1508208)
                     /locus_tag="LDBPK_013350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003863370.1"
                     /db_xref="GeneID:13385808"
     CDS             complement(1508023..1508208)
                     /locus_tag="LDBPK_013350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003863418.1"
                     /db_xref="GeneID:13385808"
                     /db_xref="UniProtKB/TrEMBL:E9BNA4"
                     /translation="MDVFSVIGAPEFRNLQREREVVQAAFTRKRVREREMMGIPLKQI
                     SLRRLFKRRKEGLMNEQ"
     gap             1508327..1521008
                     /estimated_length=12682
     gap             1524018..1524116
                     /estimated_length=99
     gap             1525399..1530230
                     /estimated_length=4832
     gene            complement(<1531123..>1531263)
                     /locus_tag="LDBPK_073400"
                     /db_xref="GeneID:13385809"
     mRNA            complement(<1531123..>1531263)
                     /locus_tag="LDBPK_073400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003863371.1"
                     /db_xref="GeneID:13385809"
     CDS             complement(1531123..1531263)
                     /locus_tag="LDBPK_073400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003863419.1"
                     /db_xref="GeneID:13385809"
                     /db_xref="UniProtKB/TrEMBL:E9BNA5"
                     /translation="MLRKMSGIPESAELINNVTNLVTGLYGPDSSEWHIIASILRKHL
                     EG"
CONTIG      join(FR799618.2:1..1531288)
//
DBGET integrated database retrieval system