GenomeNet

Database: RefSeq
Entry: NC_018261
LinkDB: NC_018261
Original site: NC_018261 
LOCUS       NC_018261            1750858 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 34.
ACCESSION   NC_018261
VERSION     NC_018261.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 1750858)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1750858)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799621.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1750858
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="34"
     gap             1745..1843
                     /estimated_length=99
     gap             3208..3306
                     /estimated_length=99
     gene            complement(<5443..>6363)
                     /locus_tag="LDBPK_340010"
                     /db_xref="GeneID:13387471"
     mRNA            complement(<5443..>6363)
                     /locus_tag="LDBPK_340010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864118.1"
                     /db_xref="GeneID:13387471"
     CDS             complement(5443..6363)
                     /locus_tag="LDBPK_340010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864166.1"
                     /db_xref="GeneID:13387471"
                     /db_xref="GOA:E9BQF5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BQF5"
                     /translation="MPCFLSVLGAVALGAIFFKVIGFVKINYLTSLNMKKRYGHAGDW
                     AVVTGASEGIGYAMALDLGRRGFNVCVIARTLSKLESVVADLKQLGVQGKAISFDFAS
                     ATPKQYDDMFAELDKIEIAVLVNNVGVNYTYTNNFDEVDLETDLRLLKVNCESSVRMT
                     KYVVPKMKAKRCGAILMLGSVSAVTPAPLLCTYAGTKAFNLSFGCGLHYELKEFGIDV
                     LAVSPNMVVSKMTQGISSRKPRETFLMVNADNMAHQTLDKLGSVPQTPGHRNHAVLEA
                     IVRALPTDYVSNKILQTHKSIKCKAERKRE"
     gene            <7937..>9286
                     /locus_tag="LDBPK_340020"
                     /db_xref="GeneID:13392576"
     mRNA            <7937..>9286
                     /locus_tag="LDBPK_340020"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864119.1"
                     /db_xref="GeneID:13392576"
     CDS             7937..9286
                     /locus_tag="LDBPK_340020"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864167.1"
                     /db_xref="GeneID:13392576"
                     /db_xref="UniProtKB/TrEMBL:E9BQF6"
                     /translation="MGLLLLTEVCQFHEGGERSPLSTRRRLMLASLSPATRKLALTGE
                     GLTIGSVSFRNGGTEMNITIANDGPPPPVGWWRYSGTVTVAGHNAPLGACGVISTVKN
                     AWSVCRVTRVELTSDDGVDAVVQRQILYILGLLQNEVISLCLGKLRMKNADLAPCLPS
                     LNSLSLYGCDGRIEKWLSALSTAAEIVEISDCFSLSDATFKSMPTTSVDRLVLDNTNV
                     AASFLEHLKCRHSVRTLSLMDCRKIDTSQVGAFPQLRRLLLCRTPVASESLEGVEKCH
                     HLQIVNLGGCQEVVDVNVLGALKQLRELFLHETSVTNAGIAALANCKRLEKLNLGGCV
                     HVSNVNHLGRLANLLELHLWSTKVTNSGIEGLASCCSLVELVLDDCVRITDVLPLGCL
                     QSIRWLSLIGTEVEAPGVKGLIHCEKLETLALGGTRIAHPPKLWRHEAIVEYLGNLT"
     gene            <9999..>11021
                     /locus_tag="LDBPK_340030"
                     /db_xref="GeneID:13392577"
     mRNA            <9999..>11021
                     /locus_tag="LDBPK_340030"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003864120.1"
                     /db_xref="GeneID:13392577"
     CDS             9999..11021
                     /locus_tag="LDBPK_340030"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003864168.1"
                     /db_xref="GeneID:13392577"
                     /db_xref="GOA:E9BQF7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BQF7"
                     /translation="MGNYFSLCPEPFHGLISSYGIGSTSSTHPSGVAVKGQEYSAVKL
                     VGEGGYSFVYEGYNNASGQRVALKRYVFSETQQQQGAVEEMSIYRDVCPNDYIVTYLD
                     SEVVYRHGVPLPEMWVVMEFCDGPSLQEYINNRLRSPQPFSVREVFEIVDNIVHAIGH
                     LHSQSPPVSHWDIKPENFLFTDTGRLKLCDFGSATRQFYAPTSAEEVSAAESELGSRM
                     TLLYRPPESLDLWSKDRVDTKADIWALGVIIYVLVFREMPFDANPMEVMAAVPKRYKG
                     KTQEGCPEEFRALMDIVRTKMLTKKPADRADIFSISEELEGITHLPPLSRPRPGFQSA
                     QRPRFA"
     gene            <12090..>14129
                     /locus_tag="LDBPK_340040"
                     /db_xref="GeneID:13392578"
     mRNA            <12090..>14129
                     /locus_tag="LDBPK_340040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864121.1"
                     /db_xref="GeneID:13392578"
     CDS             12090..14129
                     /locus_tag="LDBPK_340040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864169.1"
                     /db_xref="GeneID:13392578"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BQF8"
                     /translation="MKGMGRVFAVKSKSDTALRVIIPPRDDEAAEGDLSREWLDCCLR
                     EYLERKRLFENRFRSRAQLMARVLALLVPFLGVLWSIWPIWRVLIDVETDAYYKALEV
                     PPTATPSEITRGYRAMMKRWHPDNNPTCGQYCREKTERIKEAYDMLLSRSNHHLTLAN
                     QYHKSLMALRSLLSFRGFQISGDAAMNVFMILLRLYPASARKSATLRLACSIVILVFC
                     TVHETLFVSGFSIVTVVELFYYSLSMAKASAQQQSMEEVRRNSYFDVLRDAFVLLGCA
                     SVASIAVRMRENAAMPMEEASRMFYGSVYVLSFLYRFSPNAYDNFLMRKCSLPLTYLD
                     MTSARFTWTRFATSELMFLVDDLFVFTCRISSPYRVVVYIAHFVALCQFFMLPWDTPI
                     INGRSSAKGRAAGIEEPKAPASASARTRVAQSTNSDVMETAEKSTFAQSYITKEEEDV
                     VTDLDSEAVSWMDIASLKYKALVFALGRKHAQQHGQSADVVDIAPSSDLQNVLVVAFS
                     RGAGTGPAASQQRLDVLCQVRDPEMSRLVAMERGPKMMVPARPKSPWNLDLARMEYRK
                     VLGSVAPLTSAQVWRKRAPGSPSAGWKVLATMMCVWIVFAVACAVAGPSPHDAVRSSK
                     GIDSSLRPQLFARFLGALPPTHFVNALSGGLLTVAQIPFCTLDWWDAGATLGFVR"
     gene            <14645..>16399
                     /locus_tag="LDBPK_340050"
                     /db_xref="GeneID:13392579"
     mRNA            <14645..>16399
                     /locus_tag="LDBPK_340050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864122.1"
                     /db_xref="GeneID:13392579"
     CDS             14645..16399
                     /locus_tag="LDBPK_340050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864170.1"
                     /db_xref="GeneID:13392579"
                     /db_xref="InterPro:IPR008429"
                     /db_xref="UniProtKB/TrEMBL:E9BQF9"
                     /translation="MTNTDTRQIRDGNDGNQRDLRSFLSKALLYAFLSLVLMNIFGKA
                     PMVSVPNTKSVQPQSPAPPSTLSSLRPLARQGERFSVVVETQPPLFEPLKFENLLLNH
                     AALAAANLSVTIPVDLKPCAAANCTVTLRVQWSVRNYTFSLTEPLVRFFRDSTVQKKY
                     LFGKNSEGESANVEAAVSTAYKQYFQPEVTLSPVVFFDYPLPDPCFEFTPVVESRPGF
                     YGPSLYINNFWMLREHHVQLNASSTSQPLNFTVRLTPLPRWKVLLYTQFEKTMATQAT
                     AGFSKASEAEETKRMLLDVSTRNPVLLVVTAIVTVLHSVFEFLAFSNDVKFWKGRKDF
                     RGLSVRSIIISCYFQSVIFLYLLDSQETSWAVLVPSGMGAFMEFWKLAKTLKIVKVEA
                     ESTTAVEGQGAARESAEKKGKWRIAGYDIGFKDSYDSRTQKHDDVAVRYLIYAMILPL
                     TGYTVYSALYKTHRNWYSFLISTQVQFIYSFGFAQMTPQIFINYKMKSVGQLPWRTFI
                     YKSLNTVIDDLFAFVIKMPWLHRLACFQDDIVFAILLYQRWIYPVDMSRFDGDSGADA
                     AEEGAPAAEAAESDKKNQ"
     gene            <18648..>21848
                     /locus_tag="LDBPK_340060"
                     /db_xref="GeneID:13392580"
     mRNA            <18648..>21848
                     /locus_tag="LDBPK_340060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864123.1"
                     /db_xref="GeneID:13392580"
     CDS             18648..21848
                     /locus_tag="LDBPK_340060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864171.1"
                     /db_xref="GeneID:13392580"
                     /db_xref="UniProtKB/TrEMBL:E9BQG0"
                     /translation="MHVEIRLCGVEQACAFDPQSFYRVKQLLSSYNGQGSGAEETARR
                     AWNGGSLLRLRHTTPFTPELKLQVVVESLIEMESRCFSAVMDKKQHEARIKSNWNNSA
                     VGTAYHSADVDEVILAALPTAAADSVVKIRLLQLPPPLDYDAQQVVKRAIGNATVSRH
                     RHDTPLCIGVAKISLRELMLARRTVSIAMQAKRAVVSTVEAHNLDTLITNAMFGRGER
                     NGSAVLSVQFNGYTFGRVPRGKSIRSHSPTDTTKRITAAMDSDAPLPSASSGAAEEAA
                     IGMEETLNSPAIRFVLLPYVALVDVLLRMVDVTSWRVPRKTGMALAAVVIALYSDLFD
                     MLFVLTVALGVLSVLRNISLFCYVPASDSTAARVAAAPVGGSGVTKFQPFLYSRENAF
                     LNSLLRARVFFSRGLMEDTYYELALAAHIARRNRRRLVGFGLAVCCSFAFLSMGTVII
                     LLTLGAFTAYPVFLNLPNTLRRTRRRKGSALALIRYAASAIRVPRRYKVVRVIRVAVA
                     RAKTTSLSSRNDSIAGSGAESLQQQFLNCIRQQAESNGVRSPTERSEISLKTREKNNL
                     TVGRRTRTVDFDVLPSNAVNFASTLDRFQVTHVMRYFVALCFSSNVMETPELASTTSG
                     LRKASSNAVLQRRLCYQLRQARMVSDLLPSALPQPTNISTGGGLATISQQGGSVVGDA
                     KPLAVSKEIQEAFQSYFNSTLNLLFYLRQQWTFHPYVTQSSTTKCMPDSLRSVSVLAQ
                     PQGLIDAGEDDGVTKALMARRNSMSNPPMVGMFNSSNSVEVSGRVMALYAAYLLQGAR
                     LSVYTSSSGCATVLPLRAPGNCMERFPQPNPCPADLLNTLDSVWRGETSDTAGKGEEV
                     YFNADAVLQIITVYKDYWEGGANLATTRSSVRLESSAAGENHFGNTLMRSSIRGALVS
                     ASPVPRQQTAPLSATTSLTRSPRQLTTALTGLAGAAGSAGQPRGDISPNPASSTRDVN
                     AGLAALPLLPAAMAEPYTTNAGCEISFSSSAKANSISNKALSDPPVLDATCNRNVNGR
                     QLADHERATNSDPNCSGSQTGAGKGNSAERLSKSKR"
     gene            <23081..>23992
                     /locus_tag="LDBPK_340070"
                     /db_xref="GeneID:13392581"
     mRNA            <23081..>23992
                     /locus_tag="LDBPK_340070"
                     /product="ascorbate-dependent peroxidase, putative"
                     /transcript_id="XM_003864124.1"
                     /db_xref="GeneID:13392581"
     CDS             23081..23992
                     /locus_tag="LDBPK_340070"
                     /codon_start=1
                     /product="ascorbate-dependent peroxidase, putative"
                     /protein_id="XP_003864172.1"
                     /db_xref="GeneID:13392581"
                     /db_xref="GOA:E9BQG1"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019794"
                     /db_xref="UniProtKB/TrEMBL:E9BQG1"
                     /translation="MSGTSRRAKGLFTGIAVGTFVSGAMFVSCASARVEEPPFDIRAL
                     RADIESMISDKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPECLYEGNKGLD
                     IPRKALEPLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGSVCGPDGR
                     LPDGSKTQSHVREVFTRLGFNDQETVALIGAHTCGECHIKFSGYHGPWTHDKNGFDNS
                     FFTQLLDEDWVLNPKVEKMQLMDRATTKLMMLPSDVSLLLDPGYRKYVELYAKDNDRF
                     NKDFANAFKKLTELGTKNLHRAPASGS"
     gene            <26498..>28186
                     /locus_tag="LDBPK_340080"
                     /db_xref="GeneID:13392582"
     mRNA            <26498..>28186
                     /locus_tag="LDBPK_340080"
                     /product="glucose-6-phosphate 1-dehydrogenase, putative"
                     /transcript_id="XM_003864125.1"
                     /db_xref="GeneID:13392582"
     CDS             26498..28186
                     /locus_tag="LDBPK_340080"
                     /codon_start=1
                     /product="glucose-6-phosphate 1-dehydrogenase, putative"
                     /protein_id="XP_003864173.1"
                     /db_xref="GeneID:13392582"
                     /db_xref="GOA:E9BQG2"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="UniProtKB/TrEMBL:E9BQG2"
                     /translation="MSEEQSHADQDAYVADVDGILDVLRAQVLERKPDDIFQFISKSA
                     LSLQKDRGAESCDRINCKVKDEQKSRALTIIVFGASGDLAKKKTFPALFDLYCGGLLP
                     PEVNIIGYARTKVDDVEKWKHETLMKYFSNLSERGCHAEDFLKHISYFCGAYDSVDDF
                     KRLDAVIREKENAFKGPEKGGNRLFYLALPPSVFASVCESIHKGAMPQEVGGWVRVII
                     EKPFGRDTKSSAELSQALEPFFDESQLYRIDHYLGKEMVQNIITTRFANRIFSAVWNA
                     SNIACVQITFKETIGTEGRGGYFDSIGIIRDVMQNHLTQILALLAMEKPRSLDAECIR
                     DEKVSVLKCIEPITKENCVLGQYTASADGSIPGYLEDVTVPEGSTCPTFAVMRLNINN
                     DRWAGVPFILKAGKAVEQKYVAIRIQFRDEVHPYGEATQRNELVIRAQPSEAMYVKIT
                     TKVPGLSGDLRQTHQTELDLTYHTRYDVRLPDAYESLINDALLGNSTNFVRKDELDVA
                     WRIFTPLLHQIDSGEIKPIPYQAGTRGPKEADEFIANNGFKHQKGYHWLPSNKL"
     gene            <30244..>30768
                     /locus_tag="LDBPK_340090"
                     /db_xref="GeneID:13392583"
     mRNA            <30244..>30768
                     /locus_tag="LDBPK_340090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864126.1"
                     /db_xref="GeneID:13392583"
     CDS             30244..30768
                     /locus_tag="LDBPK_340090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864174.1"
                     /db_xref="GeneID:13392583"
                     /db_xref="UniProtKB/TrEMBL:E9BQG3"
                     /translation="MASVFTDITLIVLAFIEASGLQPCEVGLDSCVSSFGVSCCLLMY
                     LLSECAAARTHFLSHRQCFSWCDGASRYQLVAEAAKPTTGVRLCGWHYGSSLDTDGFA
                     AALCLSYYVPSRVSYRQLDERLRLNVHGDASHGGPLLDCASRLCLQQSRALASLLSGT
                     GVTRWQESQVAHRR"
     gene            <32705..>34495
                     /locus_tag="LDBPK_340100"
                     /db_xref="GeneID:13392584"
     mRNA            <32705..>34495
                     /locus_tag="LDBPK_340100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864127.1"
                     /db_xref="GeneID:13392584"
     CDS             32705..34495
                     /locus_tag="LDBPK_340100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864175.1"
                     /db_xref="GeneID:13392584"
                     /db_xref="UniProtKB/TrEMBL:E9BQG4"
                     /translation="MTAHAAVIPCLQRYARLSASVFASPDDAETQAALSLLLQYLSLQ
                     SCNTSEVEALEQWCRKQGNEERLKKYGGEVTAVVKRRVTQRARVLSEAVANRQDMLVT
                     DARSTGVPAVVCSAGAHDSGRSGTATLVQWWHLSDDDPWNFTASASCSQATRGWSDGY
                     RFVCLKEALTLVGPYLDLMRQAAATGDWESVSRLFIEATSYVNRVSFRDDPAAIFGSL
                     ELSRLHLALTFASRGGVASVEKVLQQVRVNDDMRRAAALLDGLGARERGTAELHSPPN
                     ASAASVSKVQAYWRLILSYSTFFNTVAAYVDGSLGRFESCAKALLGDGTETGACLWGA
                     ARYPNIHFCLPHSTSRVRQPDAQPGGPKTQSGACTVMPVLFPYSSSHVRASASDHYLD
                     EFAPLVTRVIAPASSFSTLVVLSAVGTLPLHVALTQLRTCVELREVYEGCSELTSLLD
                     ALWRGQLGVAWRCAKEAAARYLNREPHVQDSVAKKLLQYVRRSVCFHYLRVRRTALIS
                     DAAVDLGFESSEEVVETATALISCNYIDARIDLVKGAICSNELDERSEVMMEVKAEAT
                     ALAKLSFSALKVRLACLSAERNLIAFPGDG"
     gene            <35682..>37763
                     /locus_tag="LDBPK_340110"
                     /db_xref="GeneID:13392585"
     mRNA            <35682..>37763
                     /locus_tag="LDBPK_340110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864128.1"
                     /db_xref="GeneID:13392585"
     CDS             35682..37763
                     /locus_tag="LDBPK_340110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864176.1"
                     /db_xref="GeneID:13392585"
                     /db_xref="UniProtKB/TrEMBL:E9BQG5"
                     /translation="MNVVDGSVFQVLSDAWAAVGVPADRYWRSSQHLRGGSSAAMLPK
                     KTPSSPLSLLGLRVPNPLHLHSSFYPARVEALAARGYGAHRGLLPLALDRRSGSGSKL
                     FNVLPRWSTNVVGIGESAVEASAGIWHGSAVADFVSAIPHMQDRNLYALVDESCPVDP
                     YFDLDFSYDPDQDDPSDVLLVQSHGEGKEVAAVTAFSAEAVEKVLLTMLTALRREVET
                     ELKTTVAECLVLTSSLQTGRRPDTPSEPASLEQLKLSFHVHFRLADRAVLASVREMHN
                     FMTRLRSRLQDEEAAATTSPSLGSPTREKREEARQASALLLRCVDFGVYTRWRAFRLP
                     YNVKASEAARSSALVSGAGDDLLEEQLQQLGIALPDNGVGRAAPSVLQSLFLAADVAT
                     YKAQRYLLKRLEPHFRFLLPVLPGATELRSATLAEFLSPLVPPQVRAAAAEVSGPSSP
                     SSSARDVVSAWAMELACIVRDASTLPHSRDDGAVQESPTSSSFRLLLDEGAITSAAAK
                     ASAQATSSPFDVPLPPMPRSVRVRVEDAEMKRLLAEVFWCIAPEYGGPGTVVRASPAT
                     DARNALSAPNPITSERINAHYEDSIRAYYVFQKQNKYCIRLHRNHKATFAQLYLTFGS
                     IKIRCYANDCCDRCCVIPWEAPDNPKSGPQYHAGYPRYERLVAIRNALFPPLSTEELV
                     RRYGTGVLHYV"
     gene            <38637..>39293
                     /locus_tag="LDBPK_340120"
                     /db_xref="GeneID:13392586"
     mRNA            <38637..>39293
                     /locus_tag="LDBPK_340120"
                     /product="adenylate kinase, putative"
                     /transcript_id="XM_003864129.1"
                     /db_xref="GeneID:13392586"
     CDS             38637..39293
                     /locus_tag="LDBPK_340120"
                     /codon_start=1
                     /product="adenylate kinase, putative"
                     /protein_id="XP_003864177.1"
                     /db_xref="GeneID:13392586"
                     /db_xref="GOA:E9BQG6"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQG6"
                     /translation="MKIVLMGAPGCGKGTQSPYIQDRYGLCHLSTGDMLRDAVARKTA
                     NGKLAKDAMDSGKLVSDDIVFGIVKDSIKNPECRYGYILDGYPRTLKQAQMMEDAGEK
                     IDKVIEFSVPDEVILERTSGRWIHKPSGRTYHEVFRPPKTPGKDDITGEDLYQRPDDR
                     REVCEKRLDIYKNETRPLADYFIKEGVYSMINANQTIDEVRKAIAALLDPIGIATGLK
                     "
     gene            <43498..>44187
                     /locus_tag="LDBPK_340130"
                     /db_xref="GeneID:13392587"
     mRNA            <43498..>44187
                     /locus_tag="LDBPK_340130"
                     /product="adenylate kinase 2"
                     /transcript_id="XM_003864130.1"
                     /db_xref="GeneID:13392587"
     CDS             43498..44187
                     /locus_tag="LDBPK_340130"
                     /codon_start=1
                     /product="adenylate kinase 2"
                     /protein_id="XP_003864178.1"
                     /db_xref="GeneID:13392587"
                     /db_xref="GOA:E9BQG7"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQG7"
                     /translation="MKIVMEGPPQGGKTTVASVVKERYGLCYVSTSEAVRNAVRLGNS
                     AYSSQLKQLIDNDELIPDSLEVKVVCEATRRPDCVNGFVLDGFPRTRKQSRMMQDLEN
                     VKVDIVVELEISDKELQTRFGGRWYHPKSGRIYHTFYNPPLNAGKDDYTGEPLVQHSE
                     DTPERIRQRMSQYRQQLSEVRSTFVGNAWVTVEASGNVESVRNNVFAVLDPLYFAQTS
                     KKVPKPWWKFW"
     gene            <45291..>46319
                     /locus_tag="LDBPK_340140"
                     /db_xref="GeneID:13392588"
     mRNA            <45291..>46319
                     /locus_tag="LDBPK_340140"
                     /product="malate dehydrogenase, putative"
                     /transcript_id="XM_003864131.1"
                     /db_xref="GeneID:13392588"
     CDS             45291..46319
                     /locus_tag="LDBPK_340140"
                     /codon_start=1
                     /product="malate dehydrogenase, putative"
                     /protein_id="XP_003864179.1"
                     /db_xref="GeneID:13392588"
                     /db_xref="GOA:E9BQG8"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:E9BQG8"
                     /translation="MGLFFRRSPTALKKGKVVLFGCSNAVGQPLSLLLKMNPHVEELV
                     CCNTAADGDVPGSGIAADLSHIDTLPKVHYATDEGQWPALLRDAQLILLCFGSSFDLL
                     RQDRDIALKAAAPTMRRVMAAVASSDTTGNVAVVSSPVNALTPLCAELLKASGKFDPR
                     KLFGVTTLDVIRTRKLVAGTLHMNPYDVNVPVVGGRGGVTACPLIAQTGLRIPLDDIV
                     RISGEVQSYGVPFEAAAGAGSHDALSTEVAPPVALGLAYAACDFSTSLLKALRGDVGI
                     VECALVESTIRSETPFFSSRVELGREGVQRIFPMGALTSYEHDLIEAAVPELMRDVQA
                     GIEASTKF"
     gene            <47036..>47989
                     /locus_tag="LDBPK_340150"
                     /db_xref="GeneID:13392589"
     mRNA            <47036..>47989
                     /locus_tag="LDBPK_340150"
                     /product="malate dehydrogenase"
                     /transcript_id="XM_003864132.1"
                     /db_xref="GeneID:13392589"
     CDS             47036..47989
                     /locus_tag="LDBPK_340150"
                     /codon_start=1
                     /product="malate dehydrogenase"
                     /protein_id="XP_003864180.1"
                     /db_xref="GeneID:13392589"
                     /db_xref="GOA:E9BQG9"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:E9BQG9"
                     /translation="MRRSQACFFRVAVLGAAGGIGQPLSLLLKNNKYVKELKLYDVKG
                     APGAAADLSHICAPAKVTGYTKDDLSRAVEGVDVVVIPAGIPRKPGMTRDDLFNTNAS
                     IVRDLAIAVGTHAPKAIVGIITNPVNSTVPVAAEALKKVGVYDPARLFGVTTLDVVRA
                     RTFVGEALGKSPLELDIPVVGGHSGETIVPLLSGFPSLSEEQVRQLTHRIQFGGDEVV
                     KAKDGAGSATLSMAFAGNEWTTAVLRALSGEKGVVVCTYVQSTVEPSCAFFSSPVLLG
                     NSGVEKIYPVPMLNAYEEKLMAKCLEGLQGNIKKGIAFGNK"
     gene            <51234..>52229
                     /locus_tag="LDBPK_340160"
                     /db_xref="GeneID:13392590"
     mRNA            <51234..>52229
                     /locus_tag="LDBPK_340160"
                     /product="malate dehydrogenase, putative"
                     /transcript_id="XM_003864133.1"
                     /db_xref="GeneID:13392590"
     CDS             51234..52229
                     /locus_tag="LDBPK_340160"
                     /codon_start=1
                     /product="malate dehydrogenase, putative"
                     /protein_id="XP_003864181.1"
                     /db_xref="GeneID:13392590"
                     /db_xref="GOA:E9BQH0"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:E9BQH0"
                     /translation="MKPSTLSRFKVTVLGASGAIGQPLALALVQNKRVSELALYDIVQ
                     PRGVAVDLSHFPRKVKVTGYPTKWIHKALDGADLVLMSAGMPRRPGMTHDDLFNTNAL
                     TVNELSAAVARYAPKSVLAIISNPLNSMVPVAAETLQRAGVYDPRKLFGIISLNMMRA
                     RKMLGDFTGQDPEMLDVPVIGGHSGQTIVPLFSHSGVELRQEQVEYLTHRVRVGGDEV
                     VKAKEGRGSSSLSMAFAAAEWADGVLRAMDGEKTLLHCSFVESPLFADKCRFFGSTVE
                     VGKEGIERVLPLPSLNEYEEQQLDRCLPDLEKNIRKGLVFVAENAATSTPSTASP"
     gene            <54406..>55383
                     /locus_tag="LDBPK_340170"
                     /db_xref="GeneID:13392591"
     mRNA            <54406..>55383
                     /locus_tag="LDBPK_340170"
                     /product="mitochondrial malate dehydrogenase"
                     /transcript_id="XM_003864134.1"
                     /db_xref="GeneID:13392591"
     CDS             54406..55383
                     /locus_tag="LDBPK_340170"
                     /codon_start=1
                     /product="mitochondrial malate dehydrogenase"
                     /protein_id="XP_003864182.1"
                     /db_xref="GeneID:13392591"
                     /db_xref="GOA:E9BQH1"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:E9BQH1"
                     /translation="MRSSAARLFRVAVLGAAGGIGQPLSLLLKCSPLVTSLSLYDIRG
                     GPGVAADLSHIPSPAEVTGFSSGELEKAVKGADLALVVAGIPRKPGMTRDDLFHTNAS
                     IVRDLAIAVGTHAPKAIVGIITNPVNSTVPVAAEALKKVGVYDPARLFGVTTLDVVRA
                     RTFVGEALGKSPLELDIPVVGGHSGETIVPLLSGFPSLSEEQVRQLTHRIQFGGDEVV
                     KAKNGAGSATLSMAYAASEWSISMLKALRGDRGIIEYALVESDMQRPHSRFFGCAVEL
                     GTNGVERVLPMPKLNAYEQQLLDACLPALSAEFRKGVDFAVKPHLSQDS"
     gene            <57404..>58363
                     /locus_tag="LDBPK_340180"
                     /db_xref="GeneID:13392592"
     mRNA            <57404..>58363
                     /locus_tag="LDBPK_340180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864135.1"
                     /db_xref="GeneID:13392592"
     CDS             57404..58363
                     /locus_tag="LDBPK_340180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864183.1"
                     /db_xref="GeneID:13392592"
                     /db_xref="InterPro:IPR019186"
                     /db_xref="UniProtKB/TrEMBL:E9BQH2"
                     /translation="MVKYVDTGADTAAGGNKKMRKGFKSDRLENYKRMLAKKNGKTVR
                     DAPTCTARPKALTFDDSSRRDYLLTLHKKKNERRVQAFVDAKRKQRKDSAKTRREQRE
                     EARRAYNNYARVPILPDYTYRLPRQQDDMFADDEENEEREGEDGYSSQSAEDGEEDAD
                     MPWISIDDPEASQRRRREKRLATLPHSAHAMPGAMLGQEAGTAADTHLPVGPSSSSKL
                     DSEYVTVDVKPLFSTSSGDAVSTRKGGAASTKTLPCNNFDDLPLVVRQELHRLRQETK
                     GPAKTKPRMRMMKELEKIRKIRKHSRKGHGKRKASGKRKNRKK"
     gene            <59293..>61164
                     /locus_tag="LDBPK_340190"
                     /db_xref="GeneID:13392593"
     mRNA            <59293..>61164
                     /locus_tag="LDBPK_340190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003864136.1"
                     /db_xref="GeneID:13392593"
     CDS             59293..61164
                     /locus_tag="LDBPK_340190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003864184.1"
                     /db_xref="GeneID:13392593"
                     /db_xref="UniProtKB/TrEMBL:E9BQH3"
                     /translation="MSSPFFGELRKTLHNRSYSSCDSLPRHAASPPRHAQYVEADRAA
                     PSLSKSPTFSSAPPSPKCPVPCTHTMSHTNSTVPSSKLPFSNSVTGNGAVLIGTLASF
                     DSEAPRGRPASAVEDGAASGSSSSGLSRAAVLMSGRGDASPPFSPQPSGSVLAVFCPL
                     TSKAWQSGTLRDGIAFDADTTSKVSTISPQTGLQSPFLFSSGWSQQSVSAAAQGTPPS
                     FVGTPGQSLISAGDEGDDAEDMPHSCGAMYSPNHSVSLLPAPKAFVPVCPVQSPEPFA
                     TKFTGSPVFEVSLTTPPSIRAPRTGAARGAGATPTQSSCLPSESLEQYSLLRSPILHS
                     LTPLSISPSAPLSPGFGCIMGTEQTQSRLSRHRLAASAGSEQLPVRTSTEMRSRGSAV
                     ASPPSAAVPSVNSNHETLNDRLVSPARRSYRCPLPSSNEASLSSFFAVYDAGLHANLS
                     MAQASEEDAAHRATSATLPRVCSSKDTEAEEGVAAALAPDTTDDPFEAFRDILPAAQW
                     GSSVTEMPPHITTSSAPFETGSAFHSVTAFASEAHEKDNHPSEELNQSNRLSCFFMES
                     HRNTIAHRPSAAQQRNSVNRSVDTQRTASKAMTLQQRQRRFSLQQEDSIEIKRRGYA"
     gene            <65191..>67488
                     /locus_tag="LDBPK_340200"
                     /db_xref="GeneID:13392594"
     mRNA            <65191..>67488
                     /locus_tag="LDBPK_340200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864137.1"
                     /db_xref="GeneID:13392594"
     CDS             65191..67488
                     /locus_tag="LDBPK_340200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864185.1"
                     /db_xref="GeneID:13392594"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BQH4"
                     /translation="MHASCLLAQLVSEQMPSSLEALVSLTEEWWGLVERLVQLPVVAA
                     DLGQLLVETAHAEEVQRDHGSAGLEEKAIAQWEEWVWTSVPRTVPAPAAREAAVSEDA
                     LPVSPPDILSFTQFADLLHSYDRYRLGVRWGASRPSGDWASRGGAVAAAAYYRRRYFL
                     RPWHGMHCPAGAAEQMPYVHVLQWMLARKGSSVEASPTAAELWERHRALEPFQPSSSS
                     FKALDVCCQSGYVSDLLIRAGAGVVVAADADPTALANAESTYHECVREGGGRSRNAVL
                     YTRRCEGLPRPTAARASRRSPSAPKRGGAGADVGAGVQSTSASAAERRRRRAREEGRG
                     YSGLTWPSEERSISGAESADADASAGPFDVLYIHPPSAVSIWPVATTEQFNLRRTMWW
                     HKLNHSVEAEGLDATLLLPYLPCTAAPALARHNPLATRSGLERALDALRADVTERSAA
                     ASPSGDEALRSGALLADEGYVVLVLPRTYDTDLLLRGEMLGAPSLADWAVSQLDGYYD
                     LILRRRCGAHAPPSASNAAQSSNGVDGMLLGAFRNAQRRFERASSGASAQWAAELQRI
                     SREEMWHDVLVLRKSRTMARRCAAPHTEGLGQDRAAAAGTVQWEDSFEYNEYYPRGTV
                     PHTSHHWTALVPTYSYLEEDFYESPSAARNFLAVGYPVSANSAVTAGYGVPVGATPRA
                     AAAGEHNPATDGVKEASHLASANFHTVFAQELRTRRRSKLRKLALSPLEQQEWYIDEK
                     LVKSSAAKLELLNELSKWDLKDYDK"
     gene            <68309..>69784
                     /locus_tag="LDBPK_340210"
                     /db_xref="GeneID:13392595"
     mRNA            <68309..>69784
                     /locus_tag="LDBPK_340210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864138.1"
                     /db_xref="GeneID:13392595"
     CDS             68309..69784
                     /locus_tag="LDBPK_340210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864186.1"
                     /db_xref="GeneID:13392595"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:E9BQH5"
                     /translation="MTEEIVAPAVPQFENGEPSFEYDHIFRCFKGRGNGLLFRMVNTK
                     QKKWAFYNDTADTIMQVRARFSPDCKVEKLNRARATQVPIGTEEHPDLFETVVTLEVH
                     PFATEPFIKGDVNGFELEFHTEQIPVNDVKFMNRHRILPRYDKVYKCFKSEGNGLFFR
                     LVDEKDNKWYYYNDTHEFRMTATVSFPSADEVKPLGNTETVPVQDDESEVAYQITVEP
                     GNAEPFIEGVPASYHQTFNANPIDENCLDPKDVQYINGEPDSNIIDPSQCKVYKCFKE
                     NGNGLLFRLVDEKAGRWAFYNDTHEYLMKPKVRFFGGAAVVPGPDAQVLPDPEEEDTA
                     VITVEIPPCETRLFIEGRPAKYEVSVVADSIHKTAPEESPEFVNGEPDRKVVNYDAVY
                     QCFKDKPEARLFRLVDSNRQQWGFYNDTADVFFVARFTFDAEGKVRALGDTEKEQNSD
                     NETEYLVSIPPMETVAFVQGDVRGFKSQFTGKRRTAVPTPA"
     gene            <73160..>74713
                     /locus_tag="LDBPK_340220"
                     /db_xref="GeneID:13392596"
     mRNA            <73160..>74713
                     /locus_tag="LDBPK_340220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864139.1"
                     /db_xref="GeneID:13392596"
     CDS             73160..74713
                     /locus_tag="LDBPK_340220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864187.1"
                     /db_xref="GeneID:13392596"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:E9BQH6"
                     /translation="MTELVPPEAIRFANGEPLCAYQECYRCFDGRDILFRLVNVEKKQ
                     WFFYNDTTDTIAHVCAVFYPGSVIRPLQRADMHVIPGPTGVADETCSIEVTLDIQPGF
                     TESFIEGEHKGFHLEFRTETAPTKEVVFEYRRPTVPYDKIYRCFKNGNGLLFRLVDER
                     VRQWFFYNDTRDLMMKVSVAFANSAEVRPLGCTALGVPHADTAPESVVYTLLIAPGCT
                     EPFIEGNPVTYTLEFAAEPLDAPVTPALEEPVQYLHGCPDVAVIPHQTHVFKCFKEHG
                     NGLLFRVVDDVNTIWAFYNDTPDYVMTANMRYPGTSDIRLAPGVQVIADSEREGGFVA
                     AVEVLPLATVPFLVGAPEQYELAFAATPVVPLTPLPTTPAEPSPPPQLAAAADTATTV
                     PPALPVPEEAPVYCNSGPDLTVMPNIDEVYKCFKDYGNGLVFRLVDKVQRRWAFYNDT
                     TDVVALVRVQFSPGARIQPLGHTVLGCDLESGSVLHELRVNPLETALFVEGDVDIFTT
                     KFVAEQIQT"
     gene            <77186..>77815
                     /locus_tag="LDBPK_340230"
                     /db_xref="GeneID:13392597"
     mRNA            <77186..>77815
                     /locus_tag="LDBPK_340230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864140.1"
                     /db_xref="GeneID:13392597"
     CDS             77186..77815
                     /locus_tag="LDBPK_340230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864188.1"
                     /db_xref="GeneID:13392597"
                     /db_xref="GOA:E9BQH7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:E9BQH7"
                     /translation="MSTSGPLVPPISWAQRPEYVLITIPLQDTTGVSVEIKDEGRELC
                     FACSSPEHKQYACTIHFYGVISSEESQHVVRPRQIELKLRKKFSKSLEDANDDEVEWP
                     RLTKEKAKYPNISIDWSKWKDENDDECAADDLGDFGLSGGDAMDGQYSEMLSQLMQAQ
                     GQKDAEESAGLPPGTIPGFGSARGQEATHGACAVAGDDDGDMPPLEEDT"
     gene            <78606..>79613
                     /locus_tag="LDBPK_340240"
                     /db_xref="GeneID:13392598"
     mRNA            <78606..>79613
                     /locus_tag="LDBPK_340240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864141.1"
                     /db_xref="GeneID:13392598"
     CDS             78606..79613
                     /locus_tag="LDBPK_340240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864189.1"
                     /db_xref="GeneID:13392598"
                     /db_xref="GOA:E9BQH8"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:E9BQH8"
                     /translation="MWCTTTQRLALLASLLWLVSGVQAAISFNLNSVDYPVYVDEKMS
                     AKEYAVLPGGGSACLLLSLDNGLGGVVRFAYSSNVSNLHWRSDVLVSTHQPSASHPSV
                     AILDKADAVIQTKLYSAEELERRNRAGGAVQQSRTTAVSIRPAQDGTGPAAKFIDGNY
                     AVCFRLIRSKAAAQKPSSTQYEEVKVQLFEVASTRHSTSTYISRLNDAAANSQNGNGA
                     AGGTMAEVNREYAKMIRSLFRSSSSADLRKLLDEEEPVSSEEVKSRLEEIRALQKQLF
                     GLYNNFEYLESRFRRMRATAETTFSRIWLCTLFTLAVMGGTVWFTFHYTKSIIIKKKL
                     I"
     gene            <80743..>82902
                     /locus_tag="LDBPK_340250"
                     /db_xref="GeneID:13392599"
     mRNA            <80743..>82902
                     /locus_tag="LDBPK_340250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864142.1"
                     /db_xref="GeneID:13392599"
     CDS             80743..82902
                     /locus_tag="LDBPK_340250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864190.1"
                     /db_xref="GeneID:13392599"
                     /db_xref="GOA:E9BQH9"
                     /db_xref="InterPro:IPR029600"
                     /db_xref="UniProtKB/TrEMBL:E9BQH9"
                     /translation="MSASSPPPQGGTATSTVAAPPEDASQLSADDLLQQIVELVNREL
                     DRRYSLVDFDALGRIELLQVVNDIFAKLQPSMKMDMHAAPPEEAMPRMLEFLLKILGY
                     RVPVFVQGSFPQSFADGEPLVVYPTMYWILTHMELNEKRVYLARFLQPLDIPDDIRAQ
                     DEDVRTLFMQYQALRGAFIQTHQRVEKLRSAFADPVETRRQVGVLEDERDRLQGYVEA
                     ALKKLAAVPEKEMLLAASKSLRMAREESTKLAEREVEQQQAKVSSEARRTEISTRLQN
                     LRRDAADGRVEMMIRRMKDEMDTNRMKLQDQLPHELESVKNENAELQKLVSEPLDMVA
                     LTARDRKLDDELKALHAKIAQRQQPGADGASILRFRDQVQRVMARKQEVLNELSSLQA
                     DNNKALNDIRERQLRITQLQSATNMLRSDDFRDFSNQVRAKKAATEGMRTRLAELRTE
                     WGTLTFTEATLQEQYNALDAAIGDLESKLGLQGYSRTVEALSKLAHEKDAIEEVKGKT
                     LEELSRVVQEFTLAIREGRTRLAPLINELRAVRQTAAEVDQEWSARKSQYEYQESLLT
                     EDIQKIDEDVTRLKEETTTSESLYHRVRTQVLLLAAQAKRAEEEQTYRTDRNASLDPQ
                     HKTYGDYLAEVTRTLEARTKEMQGKRRDLEETHDTSVRQVEWFNALRTILQAKLKSIQ
                     AEAPSAGARTRDNTIDDDIQQVMGRAGGTNMLVLNSN"
     gene            <84298..>88314
                     /locus_tag="LDBPK_340260"
                     /db_xref="GeneID:13392600"
     mRNA            <84298..>88314
                     /locus_tag="LDBPK_340260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864143.1"
                     /db_xref="GeneID:13392600"
     CDS             84298..88314
                     /locus_tag="LDBPK_340260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864191.1"
                     /db_xref="GeneID:13392600"
                     /db_xref="UniProtKB/TrEMBL:E9BQI0"
                     /translation="MDRPSRDDSTVIAGTPASSTRALSGNLLDQLQHDYPAVYEALHA
                     YEKAVRHLKCKYKAKEAELLRCISVGEELLGQMDVLKRRCEALTHERDEAMAASASVT
                     ASPREHAHTAGGAASSSTSWAEERHRLLRSHETECERYRIEVQKALQDTEAAQAQKRE
                     LELALERTTTQLSEAEKQLRTAHNAIADCEAHYAAQQEREMERHRAALEKQLAEVRQQ
                     ADVDRETVLAEAMVELERLQRALVRTQKELAEQQQASSGAQALQAGLTSTAAIELASL
                     QKQISTLAETNHDLRQRLQRREAEIQLGCAASSTGARRDDSQRSLALASDSNRGAVLY
                     DSTLANSLVDARREPRDDAADASGLDAAQERLREENARLRQRLQEVARRGQDDVDKEH
                     AARLSLQQQLQAMEAQSHVLRSEVVGRLQRELQQAKDQLEVLQAQGATAQRAAAELEV
                     QTAALREEKTTLADALRAEKVTTEKLRRELKAAQERQDALAQELKGASAAAQEREQVV
                     VQLQREKGQLFNALRTFQAQAADIEVALKTVTAEQSESTAAHEGTVSRLRDRCVLLEH
                     EAEELKTERAALRRRLGDAEEAIDVLKGAQRVSQELVREAQRGTKTAEDRANFAADQL
                     TLQQQSSAVRLAQAQQHLERVRTQQRDLSRRMEVCQQELSRKEEALRKSAEAQEALVA
                     EVQRLREEQANRDESVRERWRQQYAQSNREREKLIAIKEAHVADLQRQQKELQMSLAE
                     SEDRVTQLHEQRQQLQEALSDSLATAASHKGRIRALEEELARTAAEHRAAQRELQRVA
                     GERERSSSTTPGLRPSGECDASAVVRLAQLQGQLTECEAALCAAEQSRQRMQSAVLGC
                     LMPVDASGEVTADADNMWDTLLDLLREGDQELCSRSTSAAPVQLRQMKAEEGNPVSDD
                     KQASNAVSVPIDASRCAAAAVMRAIHDLVLHLHDADRRRWSCVRNKVLAACVVADATS
                     DEAAPVGAAPPATEDPAGALSEKLCADLASALRAWALALRSAQEHLTDYVAQVAKVAH
                     LLSKEAAQQVQLTQLTVAARTAEEQRDALQAALEEMTAKYSEAAKRADAQESRVEALR
                     HDVAVRDTRVREMEHRLDVRQAEVQAERAEWVSKWQEAQRHREAEKKEAEVERAHLRA
                     QVAAAEEAGHQSTQRAAQESADALQQLRAQLQTLRETSSATEVQLRQQITQLSSEKVD
                     AARAVSRLKSVVAQLEERLSSTEATLRSREAELETAMASMQELKRVQLQRRADVAAGE
                     AFEQRTLTEQVASLQAQLLSIQRDHDMQETLHATERAEMAALRKVNASLEARLAEVEG
                     DRAPLREQLHSLLSFTES"
     gene            <89388..>90539
                     /locus_tag="LDBPK_340270"
                     /db_xref="GeneID:13392601"
     mRNA            <89388..>90539
                     /locus_tag="LDBPK_340270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864144.1"
                     /db_xref="GeneID:13392601"
     CDS             89388..90539
                     /locus_tag="LDBPK_340270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864192.1"
                     /db_xref="GeneID:13392601"
                     /db_xref="UniProtKB/TrEMBL:E9BQI1"
                     /translation="MPSEYHSGLADVSPRLSSQQRCSVRAGLSSAPRHAQGRRHLDPH
                     HFTNLTDDAKRAEGRLGRAHVASSEQQKRADAYYATKQATVAQPPGAECNLYLKSYYY
                     TPLSKQDTPSPPPRPTTGFRADAQSTSFQLAEARLRKIKREHPQYEEEVMRALQQQHG
                     DYSIVSTEQKISRRIAVEEYADGTNARMAQIEASTKCRGTPDLGSPAPVIKRSVPYAL
                     SEECPPRADTQLPCTSHVRLYPGRGRSSSPPETSVKPRARHLHDGPAPYDTTAVSGQA
                     YPSPPAVGERCNIYAKPTLVHVDERRHRNCVEDADSLAMKRARARSGARASQERPDFI
                     FGPGPAPQPRPPSLRYRTEARWKAQERNAEERRTGRALYPQSYQSTSLW"
     gene            <92012..>92374
                     /locus_tag="LDBPK_340280"
                     /db_xref="GeneID:13392602"
     mRNA            <92012..>92374
                     /locus_tag="LDBPK_340280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864145.1"
                     /db_xref="GeneID:13392602"
     CDS             92012..92374
                     /locus_tag="LDBPK_340280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864193.1"
                     /db_xref="GeneID:13392602"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:E9BQI2"
                     /translation="MPHTRWLLRSAQPISEHTRIESSSCFNVQNMADTTATTLMAEPT
                     LEEAAAAVFSKEELAALKTNLRSEQIAQAKYLRDHPEIHEAVQEALARVLQAQPEDPV
                     AFLTQYFMSEEFLHQRPQ"
     gene            <93202..>95583
                     /locus_tag="LDBPK_340290"
                     /db_xref="GeneID:13392603"
     mRNA            <93202..>95583
                     /locus_tag="LDBPK_340290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864146.1"
                     /db_xref="GeneID:13392603"
     CDS             93202..95583
                     /locus_tag="LDBPK_340290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864194.1"
                     /db_xref="GeneID:13392603"
                     /db_xref="GOA:E9BQI3"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:E9BQI3"
                     /translation="MRRTRLPRMYLPKVPQKDPNAHPLQVQNSQHFLRTAGVGAILTV
                     ILSVFLALRQVQQRSRLSEKELLRKRKGQRVVIIGGGAGGSAVAALIANSAPDLKITV
                     IEKDKQQVFLGHVPLAHVGHRSYDIATSTGVDIVRSPAAWNVTRDANLVAAEVLRVDP
                     DAKKVFVRTTKAMLAAATVPSSDDASERHPRWGIDLLRRCWPSLRLQVSTVSINNDGS
                     TNLSDGTTVFSYDALVVAAGAHRSLGSLAGQVQPGQLDTHRIAVNPGTTRDNLVNLFS
                     GNVLHVKVPPASFVLQMEAARALMTAPHAASGSGVPSLDLGTTISPALRTPPPTAAPS
                     TRPSPAEAHTFSVPTSLARWFGTLRAAIASPEAADAALIPDEVAERVRPVSGLATTVS
                     PLDTLAQWCMHYSSRQHDSTFVSSVNTIWKYLHYYNKLSLCHYMAVTADPQPIGPAPR
                     AVNEVIEKFWRERQLACQQHSGGVAERFHLLFHSYLAAVDTAANVATLYDYRNNVEVR
                     VPYNLLVLDLPLCAPSFVRQSGLHRMRYVDECVMPALRRGIDEVAAQQLRRHPLLRKT
                     KKELEAFFADEASFMDVDHETLQHRRYAEIFALGDVAGVPSLKSYGAVSAQVPVVAHN
                     VQQVLASQRAQAQQDRDLVELPRSETSAAVAPAPVLPKANAKYTGYSSFHVVMTTWRA
                     MWPEMCYDEPQTELRCCSQSSSPADLAEAATKRGLDVVAPLAHCDHHLWDSLAWRDLR
                     GFLNGLFHELALYEVMYFFIFSRGLWHSPSWFYVPTYSPIDGTPRVPTWKDLL"
     gene            <98008..>102666
                     /locus_tag="LDBPK_340300"
                     /db_xref="GeneID:13392604"
     mRNA            <98008..>102666
                     /locus_tag="LDBPK_340300"
                     /product="calpain-like cysteine peptidase, putative"
                     /transcript_id="XM_003864147.1"
                     /db_xref="GeneID:13392604"
     CDS             98008..102666
                     /locus_tag="LDBPK_340300"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, putative"
                     /protein_id="XP_003864195.1"
                     /db_xref="GeneID:13392604"
                     /db_xref="GOA:E9BQI4"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:E9BQI4"
                     /translation="MKGSKNARHAPEHTNSGDDLIMATEGGAHARIDSTGGLRALSSA
                     MSGDDSEHKLELNVLGATGGDVHRSRPGREEDDVVTKPPVSRREGLLPPVRQCPSGAC
                     ENGSSGADKTAKRTAGTSTRPKGSVQEYVRKKLQLQSEQGIRTCSRVRRPLCSILVKS
                     DASESKGGEDANDTQRCDAEPRCGLDSDKSTNNRAFWKRTMSKQETDADLRCYTAHEY
                     ILAFYYHESKECDDSLELATPDSSQRRQRERVARVVAEATPREEAERLKLKSRGSISP
                     STRRAKMTCATVEELYEQLMVCYRKAGVEKGYLDTLFMKEVLSGRRQPRVHEMEKDDD
                     LGENLSAPSDDEVAEVPREVVQVGRPKRSKPVAISKRSAESPSLYEIMLEQMRAKTTP
                     AFLHHNAIPLPTMRFLQNRGTIKLGDYSYVLHLWDDEEKGYLVTGVFDRKPGFPKQFK
                     DSCTYAIYSLEMGRDWGMRFGELVLMRQHLAPGARKHFPEEGKLIRGHTVIRAASVLD
                     IFDGRVCGIPSNLRELDYRRTGIHASVQALAHYNHLFPRWSPLRSIVHPQDIFGCPVV
                     NPTGGIYCLSMIVNGATRMVKVDDRVPVEPESGLFRCLTSATFELYPALLEKGLLKAN
                     GCGINLALMESAAVLFQLCGWIPEVIRFRSAGEVEEPTVDGLMRPSEMWSVLMEGYNF
                     GRLMMTLTAHWCAGRPPLTASERVMQSAQWFVTPVVYPVIDMITQRLSTTGEPTIRAI
                     MLRDTTKDPSTRKFEPPFKTSLTAEQLLDLGYMNAHREAGVFCVTWEEALAHFDHCSI
                     NWSPFTYWDLPSGSETPEDCTRLCCHGIYDMRNAGKHMARQPQFHICSHLVDRCTHLF
                     LVFCPHAGDQSPLPHDNNMLDKKTVDELSGGGAVVRLRVYEVTTLPSLTQCKMRDSRG
                     RRVTCCFGDCQGRRIVSETEGPRGLQSLAMAQGNRNEFITLGFDCLPGTREYVVVMDV
                     HDRHRPPRGKGTFPYTLTLFTCLDPLLERNPNKLPMFAIHAHHATLEQAKQAAMGGGF
                     SHLDVASADLNVNDLIEEEAQRKPPRQTITIHAIPEHPDIHSRTVQGLWSVPESRTRT
                     VLLPHDATLEVLYTGTQYYFHLDKPSYFALRICQSMQAGPALSTVKMKVLLVRRTGRD
                     DMCTKEKDPPAERKTQTGGGAAGKGGKAYVPRSVQGIVMKGSDVVLSSGAWSVDGAVI
                     DSVSPHTVLLDRNGVLVQNPRRLRQYYHTSFNIALSDRENKDKTNMSFFLMSHPDPSD
                     QMRSVILQAFADGFLISPHACNIGIKGNLIPHDTEVRAVLTSSNFSYELHGDEGHSVP
                     FTQESAQRSLAAPVPQLDLFIDVDLQNTAPAKSTSFSPGSSASYAVDRLRAVVRSALT
                     SSPAQRLRLLRTLFSTMTFVRHTVKNESHRAFLMGLGGSIEAWVRWHQSLESPGVQAP
                     VLSLPPLPEGDYIIIPCFKPLSDEKATELGKKRGVVTGNQGALAFDITLSVPGRVVEL
                     IPTRNPADGQGSTQAVQTQMHCEQTIASAERLCPDVHSRRYGVTSSLSRWISGSRKGA
                     "
     gene            <104855..>106894
                     /locus_tag="LDBPK_340310"
                     /db_xref="GeneID:13392605"
     mRNA            <104855..>106894
                     /locus_tag="LDBPK_340310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864148.1"
                     /db_xref="GeneID:13392605"
     CDS             104855..106894
                     /locus_tag="LDBPK_340310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864196.1"
                     /db_xref="GeneID:13392605"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="UniProtKB/TrEMBL:E9BQI5"
                     /translation="MSMSRPAAVLHAGSDDGKKDDPMAVLWQHERHVLVLTRAGKPIF
                     SQHGHEEQLSPLCALLQVLLHIHEDKESGDEQSRGPSQPVPRSDGAVSSAAVRDELRQ
                     VVYYRSRSTSGQVSHQGDVNAQVQALTLFFYVQGELIYLMSVRSVAPSLPAGAVEMSS
                     AEGECEAPPLASCCLAQLRHVHHCILLVLPTVNTLLARSPGLDVMATYTSADRAALRE
                     LIESHQTELTYAVGAVATLALSVEKRRVVERALLCCYRSCADAAVGPPAHQLFSFLYF
                     KNYLVAAVGPPETYAADPKVSVSAPLALGPDTALCGCLHVDDALLLYRYARSLILRQL
                     GEAWVPVCLPRFNSTGYLWCYAVNFTRYARELRQQQGRTVWPKVWEEHTELDLMLLHV
                     SASQDDFTALSRSTRRFAQILYAPAVGDSFYYRLEEELYYRTPAPLTELLSSSHMSVT
                     TCSPRDLPGCTGGVPLWYGVVIQGGDASFLNAAQGEESKATTRAAAAATRALDCPSAS
                     IRLLFESQPSPLLNIATVENVKEFRQLAARYQAQLRAAPASSSAPCMLFVRHNSALAF
                     AVVQPTPATLAALAEQFFSPKNPFDVPTDGTAAGGDAEEFKEGRFSVAAASHRGVSYT
                     AWVEAVRALGVAELTVVFAASTPEAMAWYWVAHILFMAVQRRSHFIVRQLIGDRR"
     gene            <108213..>110501
                     /locus_tag="LDBPK_340320"
                     /db_xref="GeneID:13392606"
     mRNA            <108213..>110501
                     /locus_tag="LDBPK_340320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864149.1"
                     /db_xref="GeneID:13392606"
     CDS             108213..110501
                     /locus_tag="LDBPK_340320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864197.1"
                     /db_xref="GeneID:13392606"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BQI6"
                     /translation="MLSKKKAAKRAAISATVRREHQAHEKLSQQNTQLHTSRKKAAEA
                     STSSRGADDFVDPKKSRTVLNSADAAEAVGSGNGNRAAMIRSLGDHINTRLQEVTFED
                     DLDGDVFHERRAQLMEEARLAAGVKQRDMSTSVRHYLGHQAETHDLHSVRIAHNCNSI
                     TCVAALGTDRIVYGDKSGKVYLVDISLATSGAGMSVSDKAELQRRRKVLLEPVLPSGI
                     VSIAVSDTTANRPTARDVFEKTTVDMSCPSYVAAGAIDGSISVWETLTKAHKGLLCMH
                     RKPITGLQFRMDTATLYSSCEDGTLRVWAVPQMIAVDKLFGHEGPTHFLDCLRKETAA
                     TVGEDGTMRFWKMDAATQQAYNYAPARLPEKSFTPAAAAASPPPPPPSVVMDTVAMLN
                     ESIIVAGARDGAVVVFDVNRRKPLVVVPAAHGYGFIGDGTGLEKAAAQLAEEDDGDRV
                     AREHATAPSFGTVDAQRRNPNPITAVAAVPYADVVATGSYDGVVRVWHVVGVGAGATA
                     PGKRTDDGRNGDAAPSSRKGTEPQLVLVAELPVRAIVNSLRFCSNGDVLLIAAAKEPR
                     RGRWVVQSSARNGVLLVPLTDSGRKKLQGVRGEVEHIPAQLFGIDDAAAEEDAAGEEE
                     EEAHVSEADASKADLDASGELHASDGEDGAGRDEAEDVADMFDVGPDGMMRFREGVSL
                     AGEAAVTSKKRKKGKSGMPKVLRQSKKLSDVTVARDSGSHKMKKALSAKKAKRVEAKS
                     EKLHASNAALATTKKAMKRAKA"
     gene            <111578..>113683
                     /locus_tag="LDBPK_340330"
                     /db_xref="GeneID:13392607"
     mRNA            <111578..>113683
                     /locus_tag="LDBPK_340330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864150.1"
                     /db_xref="GeneID:13392607"
     CDS             111578..113683
                     /locus_tag="LDBPK_340330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864198.1"
                     /db_xref="GeneID:13392607"
                     /db_xref="GOA:E9BQI7"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BQI7"
                     /translation="MPNPSADAVTLATAEEAKVAGQPTPKAPPLEPIIPGCTPYKYYR
                     VPDGLKRVRRKQKVGIIFGYVGECYCGLQWNHLPEYPTVEEALMKALFETDMISEVNF
                     SNVKVQQLLNFERASRTDKGVHALRNVVSVAVMLPYDPSYTKKRVAALQEHAEGAAAG
                     EVYNADGDVEDDANSAQAAVFSCDEAKRLLNEALPRDIHVYAVVPVTRSFNAYLNCGG
                     RRYEYYLPTFALMTAAEYTKTYFPAFLAPSKPTLKEVGFVPGKHGKRDPPRAATVTDE
                     EEEARRRKHKNSARKSKGHFPKRKNAKVAARAVAAATTGAAPPDSTSPLEGKGDVSAA
                     EATAPLHTEPLVLSSETPARPTSTVALNDGEEGKDESDVESQDSDAEVQAALERAAEA
                     RPYEDNYATHFHDGLFESMILFRSIPADAMRHVANYRLPAEQLQHVRHLFHEYEGTHC
                     YHNFTPGGRSYDASCYRFIRSVVVSDPFVVSPEEELLQHSINSWSLNHFYSPDERVAV
                     TYEEWMTEGETAELQGAAASVSEQGKRQIPKSADAALRERMRQHIRDVYAGGIEVVRI
                     ELDGQSFMLNQIRKMIGAVVCIAAGGLPDSYIRDVLLRKGVRRGIPMAPANGLFLSYL
                     DFSGYNRRLERIQNDGNNGAGKGTLDVEAGVDADEVEAQRRRIIAVVLRNEMAEDIMG
                     KWMRSLRHVLRLAWKRSLD"
     gene            <115570..>116646
                     /locus_tag="LDBPK_340340"
                     /db_xref="GeneID:13392608"
     mRNA            <115570..>116646
                     /locus_tag="LDBPK_340340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864151.1"
                     /db_xref="GeneID:13392608"
     CDS             115570..116646
                     /locus_tag="LDBPK_340340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864199.1"
                     /db_xref="GeneID:13392608"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:E9BQI8"
                     /translation="MLKFVSSIGDAAYKAASKTGLAAGSEQPPYPCALPLQVIEDCED
                     TETTERVLNDTYAAVQDLLSDDLPLLHSTISDVQAHKPFKLVDFTDREGDIRLFTRPH
                     VGSYNFARVTLTLDSVSPAKVLTFMHAQSLEERNRYSNNLCQYDVIARNPELPAQYIG
                     NDNDHLEELCRMGIRDWHVEYNRYSAPPPVAARDFIYLVEKRYVPEQRCYYIYGTSVD
                     YRDTAGITIEKDNCVRGAVVFGWRFQHVGRKTYCTYVSCMSPNGWAPTFIVGWMKTAI
                     AKELQNARRVLYQDVPSCHTAGASSEYVRGALATYDAPITSCRQNKPNRNHSSSKSSA
                     QKLGDAMKHEERRLLEDEKPIVFE"
     gap             118208..118925
                     /estimated_length=718
     gene            <119908..>121713
                     /locus_tag="LDBPK_340350"
                     /db_xref="GeneID:13392609"
     mRNA            <119908..>121713
                     /locus_tag="LDBPK_340350"
                     /product="deoxyhypusine synthasewith=UniProt:A4ZZ93_LEIDO"
                     /transcript_id="XM_003864152.1"
                     /db_xref="GeneID:13392609"
     CDS             119908..121713
                     /locus_tag="LDBPK_340350"
                     /codon_start=1
                     /product="deoxyhypusine synthasewith=UniProt:A4ZZ93_LEIDO"
                     /protein_id="XP_003864200.1"
                     /db_xref="GeneID:13392609"
                     /db_xref="GOA:E9BQI9"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:E9BQI9"
                     /translation="MANIAESAVLVSSASSAQAVAKLTQVRGPTSGFDKAQHIIGSYS
                     TMGFQATNYGLARSIAQRMIRKQPPSKVYQIKDGKYVLVPPDVGEDGKTLQQEHVYPN
                     LFMGVTANLMGTGCREAVRFLVQEGVVHRSLEASAPASADGTDDQLMFARLKREYVET
                     YGGPPHPDEEIPRAHSFLCAIVVSGGGVEHDLRRACTAYTLHHYASEAQGHVSSTVSS
                     EATAPPKGLQQRAEKPLGTRAAAGTAKPARFGNVEYPRQGSTGSELFDCLMRTFVQRL
                     CARQARLRAAAMAKPIPDKYDDVCSWSVTPSEVWALCGLWLVDMLAEALGAVQSCTSR
                     LTSGSAVGTAESVTANGKGPEADRDAHIATSASYRAEALARARTTVVYWAALQQVSLF
                     SPSFVDGDITSYLLPTPAPAARPAHRKGGSVADENAGNSKELKRSRKASSSSSTSATA
                     VKVKPPVVERLQVDLVRDVYSINKLAMLSKKTGMLICGGGVVKHHVCNANLMRNGADF
                     TIILSNGQEFDGSDAGAKPEEALSWGKVRMEGAFVKVYGEVSTYLPLLLAEVFVPAVR
                     QRRATDDAQPRRKRSSRGARPPQDVSGHSHPCLGE"
     gap             122443..122541
                     /estimated_length=99
     gene            <123051..>125462
                     /locus_tag="LDBPK_340360"
                     /db_xref="GeneID:13392610"
     mRNA            <123051..>125462
                     /locus_tag="LDBPK_340360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864153.1"
                     /db_xref="GeneID:13392610"
     CDS             123051..125462
                     /locus_tag="LDBPK_340360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864201.1"
                     /db_xref="GeneID:13392610"
                     /db_xref="GOA:E9BQJ0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ0"
                     /translation="MDAPFSLGSGSSLTSLLLAAVVPFLCLRAFPFLFHAWPNFLYRW
                     LTSCFDRQVAMVMERVNPNRVIQDDIMIRSIMGYVSHCYVRSMQRGADACDAVATADY
                     EYSFLFDKSDMFEEDWVPYSTRFRSLFGRVIASCMELSVVPSYGHSIQVEPGLFVRFL
                     PNRHARGGRRDEDGRWSEESQQSSECPNGGKRPGAAASELNQVDKLNMYMFYSMRRYA
                     ESMDDHPEPCVGGRAGAVISEERPFDPGTQSNADRGRGGGGGSSSSSTQSESTFFEDP
                     KQPPEDRVVVLEYRRPLPHEHSQALCNSSNTRGGASKYDASQSAEDVIEGFLGRVHTW
                     YLGHVAQSKRAALLVIYPSLLMAQFTKMGTMAPKMRNINPHAEFSGKYYVLESAALGS
                     EEITGAAAASSASFSVNAGTKAGDSTTVTAVRELATTTTTTGGHVGLRGAELSSGSRG
                     KTFNSLFFPGKTRVLSMIDDFVEERGRFGVPGVVPRLTFFLHGAPGTGKTSFVKALAR
                     HLRRNLVVVSMSEIITVNELQRVLQPFDMELREGGESRSRGTGPLSVRPHQSVYVFED
                     FDAIGDAWEALINMQARQRKLAGERQLGKWTKSSGGKVRGSDDGDGDKSQAASPSSSA
                     GSRSGESFDSHEDYGSDSDDGDSECRGTFLLRDSVPEELTRDHLTVERFIDLFNGLNL
                     PDSFIAVFTTNHPERINPLIASSSVMDVTLNMGMLDDECATQMVEHYYAAELADQTVD
                     GGGRRHLSTSQLAALRAALRVFNASSTGLSGALLEKMCVECDTVAALTARLSSVDSFD
                     AVDVF"
     gene            <126806..>127942
                     /locus_tag="LDBPK_340370"
                     /db_xref="GeneID:13392611"
     mRNA            <126806..>127942
                     /locus_tag="LDBPK_340370"
                     /product="eukaryotic translation initiation factor 5,
                     putative"
                     /transcript_id="XM_003864154.1"
                     /db_xref="GeneID:13392611"
     CDS             126806..127942
                     /locus_tag="LDBPK_340370"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 5,
                     putative"
                     /protein_id="XP_003864202.1"
                     /db_xref="GeneID:13392611"
                     /db_xref="GOA:E9BQJ1"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ1"
                     /translation="MAAQMVPIDPDKKDDVYYRYKMPAVQTKVEGSGNGIKTVLPNIH
                     DICLVINRPEEVLMKYFQFELGAQRTVSTKDDKFLLMGAHPTERMQDKLYDFIRKFVL
                     CKYCRNPETAIHLDAGKKGSASISMVCGACGKRSNFDEHRTKTFMAQYYEKHPVEAKA
                     AKGAAEARKKDDAPAADEVAAPTKPEKESGKSVGKSDLRDDREDPKVVFARVLKESWG
                     KNDELVGRTVRLLSQYNLPEHYGPPMALSAMLLEHRDDLLSTMKTHARLLKRLCTVPE
                     LFSRSEGYDEKELTEFYKREKKIQKTFLRECAKEFATNFTPDKFAVLIFMLFVEGVLR
                     DRSIADWAKDTKPFSDGDPKVQEEMRQKVAPIVSWLGMDAKADA"
     gene            <129047..>133819
                     /locus_tag="LDBPK_340380"
                     /db_xref="GeneID:13392612"
     mRNA            <129047..>133819
                     /locus_tag="LDBPK_340380"
                     /product="DNA-directed RNA polymerase III largest subunit,
                     putative"
                     /transcript_id="XM_003864155.1"
                     /db_xref="GeneID:13392612"
     CDS             129047..133819
                     /locus_tag="LDBPK_340380"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III largest subunit,
                     putative"
                     /protein_id="XP_003864203.1"
                     /db_xref="GeneID:13392612"
                     /db_xref="GOA:E9BQJ2"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ2"
                     /translation="MSQTATTAAQFVQPLLDKPVEVTSIKYSLLSEDTIHRLSVLPCH
                     RVIGTEKNFGVNDGRLGPSDRLSVCNTCGQRSIECTGHAGHIDLEVPVFHLGYFSAVI
                     RVCRTICKRCSNVLLTREEMEYYLHRLRSTTHEPQQRAAIIKGIQEDAYKTRVCLMCG
                     GLNGTVRRVRPMRIVHEKYLVDLRRGEQANEDPTAFFQEELRSAAMHNSEVGAHKEFV
                     HEFLHPQRVKELFEAIPREQVPLLGLQPGTSPCSLLISTLLVPPVCVRPRGMSTTNHI
                     REDDLTTQYNEILICSDMMSDGTNDAARSVETWELLQTRVARLLDAALPGFPSHLRTV
                     ECKSYAQRMKGKQGRFRGNLSGKRVDFSGRSVISPDPNLRIDELAVPLRVARVLTYPQ
                     RVFAGNIQLMRRLVRNGPHVHPGALTVYLSKECSRKSLRNARDREAIAARLSIGDVVE
                     RHVMNGDYILFNRQPSLHRISLMAHRARVLPFRTFRFNECCCAPYNADFDGDEMNIHV
                     VQTEEARAEAKELMLTSHNIITAKNGEPIIACTQDFLTAAYLVTARDALFDRASFTQM
                     VSHWLGNETQYTLPIPAILKPAELWTGKQLFELILRPTPETQLLLNLEAKARFYSGAG
                     RHDDPAEGYVAFLDSVFLSGRLDKKLLGGGAKDGLFARLYALGGGEQTATCMSRIAQF
                     TARYLQNYGFSLGLGDVSPTPSLNEKKAAVLAVSFDKCDRLISLAKTGRLIPKPGMSV
                     KQSLEAMLNAELSQVRDACGSAAVQALDAKSNAPLIMVNSGSKGSALNTAQMMACVGQ
                     QTVSGKRIMNAFQDRALPHFPRFAEDPASRGFVASSFYSGLSPTEFFFHGMAGREGIV
                     DTAVKTAETGYIYRRLSKAMENLSVGYDASVRSVQGSIVQLRYGEDGMDPWLMEGAHG
                     TPLNLDQEWLSNRAAYARFRKHIDNVLSVGGGSGGLAASADPLLQTYRRLYDEWHAVS
                     MLPGELDTFVHHLLHADEATLASCARLMKAEAAIRGAAPSSAAAGLQLLQQLAQQHGS
                     DRLRSDIQAFFRKKRDELVQLRQKLKLPLDAHAPAAAELAAASAKAVRGGEKRKPSPH
                     NGVQPSVKADASASAAAVQAFAESLQAELLPLTKGMLLHFLEASARKVHRKLCEPGTP
                     CGAIAAQSVGEPSTQMTLRTFHFAGVASMSITQGVPRLVEIINANKSIATPVITAPIV
                     LEDEFTSIDLAPASRTQYQAARAVKGLMERVLLKEIAREMVEVVTPRAYYIHIFLNME
                     LIERLLLPIDAAVVCQRLYAAAARPMSPLRHLSEACVDVVSRDSLVVKSYEKDPARVH
                     FNVQHLLTLLPDLVVGGVPGVNRVMIADRSEKLLAEGAELLSVMSLPYVDGVRTTCNH
                     VAVIERALGIEAARETIVREITSILQAYSLNIDIRHIYLLADVMTSRGVVLGITRYGI
                     QKMNNNVLTMASFERTTEHLYNAAMTEREDVNLSVSESIIIGKPIPLGTSSFNILLDK
                     GSIAPPGSNTGRMPSPRRSAHVAATAAAALKSSGKAAVAGKHSKKVEPTPKEVFLRSS
                     FMAYAAAHGAATHRGLRGCFSSRSLSAEGVFRLDLFAL"
     gene            <134591..>138010
                     /locus_tag="LDBPK_340390"
                     /db_xref="GeneID:13392613"
     mRNA            <134591..>138010
                     /locus_tag="LDBPK_340390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864156.1"
                     /db_xref="GeneID:13392613"
     CDS             134591..138010
                     /locus_tag="LDBPK_340390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864204.1"
                     /db_xref="GeneID:13392613"
                     /db_xref="GOA:E9BQJ3"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ3"
                     /translation="MPLSVPSSWGGPGPSSQEAANVRPSLAVPEKQSAAAGVTDGFAP
                     AAAAKTSHAPPSLPTPSVLAQPQPPSAAVRPTDAEPPSSAAPASAFSTSAKSNATQRK
                     VAKLLDITTSSEIKDLASYVDNILPGYFYSLGDSEKDESSSAEVVAANGHRSTPAPSS
                     AASSHSNNNKTITSTALRSALDHRTIDVHKSFLQEFTAVYQSYQRVAAQVNELQSKCS
                     SLEDTLNTTAGRPSREVEDFFYQIQAYQAELQLVRSHDKEVDEFRKQHHFGAAEQQVL
                     EEGAVDMNFLNVLERARQVHQRSSELMQSQEYHQGALAVMESTYGAITRATEKIARHL
                     LSTAGSGEGRSAGVAASAAAGGAGSIAADVPEVTGFQLRCVRLLYEESPSLHEKFLDE
                     VARLRRASVLRRYFHLLTTGSANTSTGLYQSGGQPSAYDGGVGSRHGSSEAGMGARPL
                     EAELNNPTYFFSSLCAWLHQTIAEEQDFIHNFFVSDEPEVGQGGRRSHATTAAPSSAC
                     LQAGSDAARAARDTARQQALLEGVFGGVCKHIRAALDNVLERLGRTAAVLGAATCSSE
                     GEGRASGCGSIALSGSADALAPRKGPRGLTGGLTRLFMAATGRSPIAAFRGAGHDESN
                     ALLQRYAGVTTRAQQEAVASSMLRPPLQGIQTCVTLVQLFEYYTATTFAPLLGEDSAL
                     TRLIRKTAPQKTRELFQRLLHVLTAHLLDSTAGIIGRTATLRRLASSHALKQAADGDD
                     AQGVSPLAAERRAVTKTGPSTFVLDFLVTFTYGNDANSLGGAPNGSESALLNDSESDI
                     YMSFSSLSAAAATTRFRQANDGQLLHHSAHDLRRVLSQLILPPSPEVAAYCAVVHSVL
                     QDTARQVELLGAIAEQQRAAVAQGHRSSGPAAASDAGVAALATHTEVTFFVQEMLQSL
                     LKAARSVEADGPLRTNLDDPCRAIVEYNVLYQLRDVLEQHAAVLGVLFKGSDAQGQEA
                     ERTLDSIRMECSTTMTALRQRLVSAWTTAVELFYFPVSTEAVVAAMSSAAAAEANEKR
                     LITVKKDVRRVLKQFVNVYNTIASLGHLPEPVPLLLALAGGDDVCEEVRRKVTLSIVE
                     DVYTAEFKMLSSLPPTEELVAVQTEMAPQNLLKLVDFSSSAPAATSQPLSS"
     gene            <139096..>140814
                     /locus_tag="LDBPK_340400"
                     /db_xref="GeneID:13392614"
     mRNA            <139096..>140814
                     /locus_tag="LDBPK_340400"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864157.1"
                     /db_xref="GeneID:13392614"
     CDS             139096..140814
                     /locus_tag="LDBPK_340400"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864205.1"
                     /db_xref="GeneID:13392614"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ4"
                     /translation="MCRPPSRRVRLAPLPLMLLILLACVSVLPRAFTLSAVDPDAGAD
                     ANGRSSPAPASAVAGEHVTVFMCAGSSDFSGVHELGGLMKAMEETQVLSLKYCQTAHL
                     GYIRHADGHAVRSLVVTTGINYISSTLCTRSVLKLRRQRGYTYDAMVFIGTSGFSPMV
                     GGWDPTNTSSYAASKASEQEAMMKGEAATAGVGAAPPALPLKTLQQVREEQAEEAQLR
                     QAAVDGGQLFTLPTASQLNFENARTGEQVDWDGCSPRVPSAITPLSLGSVCVTSTAYL
                     METGCCTERVRHSQCSRPHCTSFRSELGSVTKVFFTSDALARKIEAASHHKAWPAMPE
                     IVKKGQMRFWATNEAVEPVGEGADRHRAAPSGPSFVTCAEATGNTINTGAERDYLCRE
                     HTTQALDMAQYRLAELQDGKAAPQEPPLTTQNVACVRAMESMGFLHSVAEDSTARDIP
                     VAVVRGAANYDMYPMKKVYVPPAVWRSALVAGRLKVSPRVAAALKAEEAAAANGEGAL
                     RESAIAAYTWHQNVHFMSEAEHQAFVNASFHYAVETATFVLSNYFFGGRCFASASGAR
                     PARSTE"
     gene            <141371..>143089
                     /locus_tag="LDBPK_340410"
                     /db_xref="GeneID:13392615"
     mRNA            <141371..>143089
                     /locus_tag="LDBPK_340410"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864158.1"
                     /db_xref="GeneID:13392615"
     CDS             141371..143089
                     /locus_tag="LDBPK_340410"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864206.1"
                     /db_xref="GeneID:13392615"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ5"
                     /translation="MHAQNLFKAVGALLVAYLLFVYTNRDGIEPPRRAEGYYYVANET
                     QQLLDEARKEAARVMAALTAAQQTGGQAAASALLRYGVALKDGDEGLASTIEYVHQYQ
                     QLAAASQLQGDARAAPAQSEVAKHPPVRVHVFLAADNGTYSGMHELFYITAAMRYSTR
                     LHIEGCRSALFGFLEKPVRGPLMHGVRNQQRAANESATREVQMVPVLAVTTGIYVTRS
                     ATCTAAVMELPMFSIQSVTLIGTAGVSPVVGGGGWNPHVPPAELAGESVKATEAAANP
                     ACQRHWAPESEKVAIGSVCVTYASLVQECGFCVEDNDLSSLCSRPRCRMQNSTTLFGP
                     CAFRHPVSSFAEQMKGAMRGKPFPSPSATVREAMQVFWEANEAVADYVAVAEDTKTRQ
                     GKHAHASIPSSDAPATPSEVVRSYNRLAPTTPILLNCAEVTTSQILAGPRSDILCRQY
                     TEEVFQGLYAAKDLSCVQAMEGMGVLHVLTGEYPTVPVAIVRGGSNYDMFPLSRHVYH
                     LNGTDTRGRREEGDWYVAWDQKEHYVSEDEFHRYTKASYRYSIETASAVVLNYFLSAE
                     TVLPGM"
     gene            <143710..>144189
                     /locus_tag="LDBPK_340420"
                     /db_xref="GeneID:13392616"
     mRNA            <143710..>144189
                     /locus_tag="LDBPK_340420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864159.1"
                     /db_xref="GeneID:13392616"
     CDS             143710..144189
                     /locus_tag="LDBPK_340420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864207.1"
                     /db_xref="GeneID:13392616"
                     /db_xref="GOA:E9BQJ6"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ6"
                     /translation="MVFYSLVLVMKPRPRKYTSQALREIAVNIYNHGGLIRKLSNEGI
                     LRPYSRFRDADNTAITYARYVTLQLDMGEEQMNKVEKIIREHADVNITLRLNNLERPT
                     GVKHNQQNAAAYFPLDTFTRLEEEINWPPQVSGDVYEQLDMNWKEFSRTRWSNYLRN"
     gene            <144781..>146043
                     /locus_tag="LDBPK_340430"
                     /db_xref="GeneID:13392617"
     mRNA            <144781..>146043
                     /locus_tag="LDBPK_340430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864160.1"
                     /db_xref="GeneID:13392617"
     CDS             144781..146043
                     /locus_tag="LDBPK_340430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864208.1"
                     /db_xref="GeneID:13392617"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ7"
                     /translation="MSARPSDGLACLHEELEQEEKDLAALEDNVEAHAAQLGYLHTEY
                     TLNKTRVCHHYEPRLEPLRVITYAAAQKESLIAFQIEWLERKIVVQERHSQGGQFIET
                     RDMKPAAEEYQNKARQSLLRCYEHISECPEEALHIISQYVCPPEEAIATMELVMKVRG
                     EPPEACTWEASQVLFSYTYFHEFFATRSEALLKTCDLLSDALMTEVEHFCADPHHSVS
                     ALCRISIPIGCMGEWLHSIRNYYRVKLVTAPVLLSQSADTGRMAKQAQAWLAVVTLGE
                     VNNQAPPQQPTTAAKHAVTEDAELGALVAAYEASKENLQLSTEPVSVTAATVHKLRHR
                     LHKLRESVRAAEEERMAIEGELQAKLAEVRGNYDETMVPLEDQLEEMTECFVQRATRK
                     VDVAAAPPSPVTTAANIADNAAAVAAAG"
     gene            <148090..>149346
                     /locus_tag="LDBPK_340440"
                     /db_xref="GeneID:13392618"
     mRNA            <148090..>149346
                     /locus_tag="LDBPK_340440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864161.1"
                     /db_xref="GeneID:13392618"
     CDS             148090..149346
                     /locus_tag="LDBPK_340440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864209.1"
                     /db_xref="GeneID:13392618"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ8"
                     /translation="MTGVSSFEVRLSPYVPPLQWCRAVDGVFGSHHFVCGSYTCGIDE
                     PRDDNDDSAGAAHTREAWKERDTLRTPPKAVVDAAATDVAPHTPSAGPPVRMPRREGA
                     LAAVWAGTPAAEETPCCSFALSSGHLPLRVAGVLNGNMPLDNATSSIPGTRVLCLVAL
                     DGSLLTGRTCPDSPSPSWSRDLFDTLCDFISRDVMPRVSLRLIDGTWARAEASEHLLD
                     DVCQVRQMLGTSYVVQYPSDAAAAAATRARSIVMVLDLSVPLQKLLSTLPSMRTSSPS
                     PATDAKSERRRRCLATQFAEAVQDTIGQLVSQHPDVFAFTREAARATESALVAQLSRG
                     PTHFTREMLCRSIAASVSQILSLSSNAAFVEEVVRLLWGCETHVEPTDVATATERSRE
                     SLRISQRQPVQIQRRIEERLMSAIPP"
     gene            <150148..>150957
                     /locus_tag="LDBPK_340450"
                     /db_xref="GeneID:13392619"
     mRNA            <150148..>150957
                     /locus_tag="LDBPK_340450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864162.1"
                     /db_xref="GeneID:13392619"
     CDS             150148..150957
                     /locus_tag="LDBPK_340450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864210.1"
                     /db_xref="GeneID:13392619"
                     /db_xref="UniProtKB/TrEMBL:E9BQJ9"
                     /translation="MQSRVRLLYLEFMYLLPQLKGFYSPQGAAAASKAPASGMATSKP
                     FYLRLPASHPACESLRSAHVTELSSHRQGKRPAGASPTHATATDGEAPPPLVDVSTAV
                     NSESCVVFKLQGDSERALVAPFMPANWDNSIARKPSPSPAGQRAPAAERAAEAEYRAR
                     VQRLFYANALVPVGSPEWKRCLARGRYEVRSVHNVLHVRKYRALHKRYSWASQLSRTE
                     LEAAWGGSVEDVEQALLGLSNRDVYGYSGSDAEASEEAKGDAKREEHAARS"
     gene            <152165..>152527
                     /locus_tag="LDBPK_340460"
                     /db_xref="GeneID:13392620"
     mRNA            <152165..>152527
                     /locus_tag="LDBPK_340460"
                     /product="ribosomal protein S25"
                     /transcript_id="XM_003864163.1"
                     /db_xref="GeneID:13392620"
     CDS             152165..152527
                     /locus_tag="LDBPK_340460"
                     /codon_start=1
                     /product="ribosomal protein S25"
                     /protein_id="XP_003864211.1"
                     /db_xref="GeneID:13392620"
                     /db_xref="GOA:E9BHM6"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:E9BHM6"
                     /translation="MPPKAGQTKKAKMEAANKGAKKTTKKWSKGQSREALQNAVMFDK
                     ETYDKLRSEVPKYKLITPSIISDRLKIAVSIAAAGLKQLCREKLIRLVSCSSKTRVYT
                     RIVQAAPAEAAAAAPAAE"
     gene            <154974..>157787
                     /locus_tag="LDBPK_340470"
                     /db_xref="GeneID:13392621"
     mRNA            <154974..>157787
                     /locus_tag="LDBPK_340470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864164.1"
                     /db_xref="GeneID:13392621"
     CDS             154974..157787
                     /locus_tag="LDBPK_340470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864212.1"
                     /db_xref="GeneID:13392621"
                     /db_xref="UniProtKB/TrEMBL:E9BQK1"
                     /translation="MAGDSCPSPSAAATAVTTTASFASPRTPKSTPPPTASRCLVRPL
                     LLQRRHSRSDGPQHQQQQSSCASNPSSANLCESEQEGAGGVEILLAKQYRPMRAIVSS
                     RYAGTAAGQQERRQRQEDAAGTAVDGGAAEKLASGAAKENDGAGHSSSSSTTTTDGTA
                     GGVRCIAVQLPSDHHTAAAPNSASRGQEDKRQVANRSVPINSARPCGEALVAPSSSSY
                     FSNLSASTAHSSSASSSFYGAPASVPRASGAGKGHAAVASLSPPALPDGVPACNGDGN
                     RSGSSTEAKVVPLLLRTWLSAHTIGEELGSPSISRSASRNLVRGPSLTVPQAPLGTLP
                     PSGATSMGSVTPLSSNRSSTHPSFMRPPSVTRSGGEQGSIKVPGGLRQISGGGKGKSS
                     PTGGIAHAVNGRVLCSPHGARRPDLGSRRTTFQRSTSNLSLPEASSSGGAPPPSDLGE
                     WSSGAAVRKDTASARPPPSSMPKEMHSFILSQYRTLQRDVLSLPAPQQSVYPDVTSVD
                     FQHIKRATCSKHSKAAKKALKAQEEVRLRALQQQHHDMEVIRNGGREHVGQSMKSSVV
                     LAGSLSKLRARTRSSLGRSAATALGASPATSLVIGSPDECSVTALYPGDGSGRATPEK
                     HDAAQSQTPEREREAWHASKAFMASNAPAGAQRHGRQSRSVNKNRMKGEEIVVAIALD
                     SEDEEDVDASTTSNAETWRRSRVDQPHRSAHVSSTALGELSSDTATKCAGERLVSQPQ
                     RRRGAAASKRCAERHVHSSSSSSSSSRNEEGCFPCKQQRGSRVRSAPSPSSALPLELC
                     SPPVASRSGSRASLSAHALDSSHHHSNATTALLAHSSSESDDGEDAADECCHCCPCKR
                     PKNFFALCRTSSQSAASLVWRGEKRNVAAGAMQEEKPSSTAISRASPDDSQFVVEDLE
                     DSDEDEPTLSMQSFRRANIQRIR"
     gene            <159562..>161775
                     /locus_tag="LDBPK_340480"
                     /db_xref="GeneID:13392622"
     mRNA            <159562..>161775
                     /locus_tag="LDBPK_340480"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864165.1"
                     /db_xref="GeneID:13392622"
     CDS             159562..>161775
                     /locus_tag="LDBPK_340480"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864213.1"
                     /db_xref="GeneID:13392622"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:E9BQK2"
                     /translation="MRGAHVRTCARLTALVGVAALFLLATQGPVAAAVGLTTDPVQPL
                     LDVPFFATGTDLSMGSRLFASSDARCTKSVTTACSVKSEVSGSSFRNGTCVFTVSSAA
                     LGVTLDTPRTSVPLAHWCVGSPGSAQRVATLQMHKMEVTPEYVLNGEESALNFGSAVP
                     VGTTLGFYADSQCQLLLTGAGPFVITNERTVRFTIMHSSSPLFMCASTITVNGSETPT
                     KLVNAVALATPYTVDPATGVRHQTVVVSSSTQAYPQFYLSTMAHCTDSHPAYQSTTAS
                     EMAVKVSVSRGAYFFCGSRDFGENGLYIPASNTFTVLEYDVVPHTLYVDKATVMSFAL
                     DAAPVQSTLEAVLSTSDDCSAASSWQSSWSSTMRWTANQLGVYYACVRRKHAAATDGY
                     ANIIIATNLPTTTFSPAAPVRGVSMRATLTHVNATNAFFVVGLFDSQDCTTLLVRGIA
                     SPSTSATASLAVPLSARDTLYLCVSNPLEAEPTAQDVSVRFHKLHALTPQPFALEYAP
                     LRVGALSTITLDGTVFLAKGTTVALVRADARKEQCGATDIPTFHVFGAAFALGPVTFP
                     EAGDWDVCVREPGASYVAVHRVTVYGKATVEPPGIVAGVEGTIAVSGLPPNAVVFVTS
                     AAECGNEAAVLGRATASGEGAAKITLMYDSVGTLLLCSYYPATAPQPVLQAAGNVRTA
                     NPRVAPAVVALTAQKDDPQVLRFVAPGAAVLKGHAAYLLPGESACPSGSHVPGAAT"
     gap             161778..161876
                     /estimated_length=99
     gap             162679..162777
                     /estimated_length=99
     gap             168477..168575
                     /estimated_length=99
     gap             169747..169845
                     /estimated_length=99
     gene            <172575..>174728
                     /locus_tag="LDBPK_340490"
                     /db_xref="GeneID:13392623"
     mRNA            <172575..>174728
                     /locus_tag="LDBPK_340490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864166.1"
                     /db_xref="GeneID:13392623"
     CDS             172575..174728
                     /locus_tag="LDBPK_340490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864214.1"
                     /db_xref="GeneID:13392623"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BQK3"
                     /translation="MSYSAYQVAGPADPFRPTLEMCFRGHRQGVCSVGFQPALSPSPL
                     IPKVVSGGADGAVMLWDAKATTRTMRFMGHRGPVLAVACSPRANLLASGGHDGYVRLW
                     IPNTRRTTATYGLHAESADDRNSCGWRGHTGATRAVVFAQDGSDYLYTAGNDKAVKCW
                     DLNYASSSQHIGVGPGNKFVGSFAAQSSTGQHGTGHMNWVRTVAVQSAYTSSSFFHYI
                     ASGGDDHAICVWDTRTRAPVHALFDCSASVHSLSFHPDGYVLASGDASGAVNLFDLRH
                     TSSSSSAANSWGGAPAQRRFSSLLQHYRGAHAGGVQCVDFAPNGGWLFSAGNDSTAKL
                     WDVKQVYLYCTLQGHEGGPVKSCHFSEDGRWLATGGGTDKTVLVWRSGLAERAATRDS
                     TAETALTTVGNKDAALPEVIPPPKVSFGAEAPAVRFSSPMAPASRDVARRCKLRDDSF
                     RVQNGVERSPRTSASQAVSSGITNGCRGGGSDPHVGSRAAAGAANVSVGVAAAASLGR
                     PPLSSPTRKEQAGTPSASSSRGVAYAADAKAWNRDDAEKSSVAAHERSFERSEERLDY
                     LVASVAGSPGEVGNGHSRQQPVVEGDTTRGGANTLHEQESPLGSVDSSARSAVVAAEE
                     REQEALVAQERAYQRLQEDRITQQRLANLEEALASLAAYMQTQYLQQAKEMHETRVKS
                     RVQADKYDADLEDLKRLMARLAAPAADQASANGTA"
     gene            <179330..>187000
                     /locus_tag="LDBPK_340500"
                     /db_xref="GeneID:13392624"
     mRNA            <179330..>187000
                     /locus_tag="LDBPK_340500"
                     /product="calcium channel protein, putative"
                     /transcript_id="XM_003864167.1"
                     /db_xref="GeneID:13392624"
     CDS             179330..187000
                     /locus_tag="LDBPK_340500"
                     /codon_start=1
                     /product="calcium channel protein, putative"
                     /protein_id="XP_003864215.1"
                     /db_xref="GeneID:13392624"
                     /db_xref="GOA:E9BQK4"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:E9BQK4"
                     /translation="MEIPLARTQPIEKFFVEYNSAAAEREDDGQPRDDNEVLLMQFAE
                     YTDDDSFFSSSDTVIECDPQRLRSDPLRRRAVVSVHNTLQLRALTNGRVPEDMVWNNV
                     TRTSWLYQIHNRAIALQHSSFFIFPARWTPRVMVYNVMHHWLMEMFIFLMILGYAIFQ
                     ATWSRYTAPPGGMHKPDHIIWADVFYTCLLGFEIIARLFASGGILHKRAFFRSPWRWL
                     DTAVLVLSIMECTWWQDLWNFTAWRLIRTIKCLTYVPAPVRMKLLAKSLLRSTNRLIY
                     VTIFLTYFIFFFGLLGLQLFVGTLHSRCVNTLTGAVTSQVCRSVATGQYGFYWGHHCG
                     VFYTCQADAFPNPHYDFRSFDDIGHAMLSVFQIMTFQGWSELLQETNDGLAMMAFLYY
                     FFTILVCAWIVPSLYLGVFLEKMDKTSRLFVLKQLDFFDHMLTEQRQRMSSMVRLNDY
                     VERDENGFVSHYPAYTLQQQDDKRLTSDDSTSGSTDDKNMNAHRIKSHHRAIQATKWT
                     DEQRIQLQLALTRQRDVAEEAERKRQLQQAALGDLIVEEGGAGKRQGTGRRGASPAGA
                     ASGSATQTETSPQPTKERSEFALGGRVGAVQHHPAAYAIGDSHQSDLPFAVRQEVQAE
                     QLRFLDPYTNGASAAKNDMYNSAAALRTSIDQSRTAVPGGGAESATVLHSRPVSNARP
                     STRAPSAPSTSVMVAREAAGVVPHRRSTSVRGGTLSRASSMNGRGSLSRLHASMTQVP
                     QAPTQQEQTAYVINDPEGGDFDYAKTLGQKINIIRNIAHMFTEGYPRIISQYLWEHRM
                     MQHRYGLTPLSYTNKYEEEALRRLRQRRAQERREEREELRRSGMGHLIDDDEDEDDDS
                     LAEKPWMRQEGLVPGSMSPIRMARNIRENAPITVFNYIMYSFIIANAVFNASRFDTMP
                     DYWETGTFIAGVCFSVLFMLELLIRLLALGPGPFFTDIVILIEATFMVTSLFQLGYSR
                     ANTTSLFNWVRFLRLFRVIPCRPLRRVSRVLIHGFPDMVYALVFFTLYMFMWLLLGMS
                     FFGSRIGWIDYNTSDYTTRGTFETFSHAAYAVAQAFSVNRDQWLYLSWSGMRVRGSYT
                     VMYFIATVCVAFIFRFFFIAVMTCAWQAQQEKEDYYFMSGSSHGRRGRRSRFARLPFF
                     DFSVWRSFKHIHGGFDRRDVAPDEIYFLNEDMARQLRLVEAKDRYYREHYGQEKSEWS
                     DMGEGSQVGGSDMYGPDGALVNGPQYVNIGGRLYRQPSLPATEMGFSVVGTPQQRGQL
                     RFARHHRAVPATTYAAAQLQRPAGAHDALPDEVVGSRSLSRHSRRSMANPLLADRHSL
                     SPAHQGTSVGGPSVARVSDSLAEERAKNTNISLVPRLTKLGNARALVVAGDDEATADY
                     STPEGGVSDEDFEHLLLPGPRLRYKSTMDEGRRVFETCLDCNTHMQMPLRAPPGVAQR
                     TAEELHAEHCHMAAVRSSQQLVLNALIGYTRMQADHEVTPTKRMVEIVLGQAWSCGML
                     LFDTIENLSCMDLPEQERTWDRMLEALEMQQWLLGLHVGEEQVGRATLAYILANQQRQ
                     EAQVREKSYKNTWEDRVFFVLSPSNPVRRAVSAVVGSMWFEIAVLCVVYAASICLAVY
                     APDEGNRDFGGSYNSAKYKVLHILDDIFSIIFAVEMVLKWISMGVVLPVGRAYFWHRW
                     NIFDFFIVIISLVSWGRPDIFLRYLKVMRCFRILGPLRYWKWGSSSMSHVARAIWDSI
                     PTLANVCLLMLMNYIVWAIIFVSLFMDKFNYCSNASIVNGTQCVEEGYTWAPTQRNFR
                     NFYESLLTTFEISTGAEWIDVIYSAVDSRSALLSPLRNQRPYLGLVFIAYYYVSHFIF
                     FTLFISAVIYCYMLAKSATEDATGTTIEHQVWLRMQGMIFRLKPKVQLLPLDTRVSRL
                     VHFLISNRWFEAFMGLILVFNMLTMSLEWYQMSSTQKTTLDAFQYIWVVIFTLEVVLR
                     FVAHGLRFFTRRAYCWDLLIVVLSYIQIGLSTTATNRVPFNVNVLRMLRVGRVLHLVH
                     LVLPFSTHLTLFHEVLKASVPGLISVTFVYMIAVYVFAILGLHFLGYIVPFGGYIDDK
                     YNNFGTFVNALIMVFRLSTLQNWATMLRGSLDRGYYCARASKRCGPTDWAPVYYIPIV
                     ICFFLLLSTLYMAVVLDKYVAAVRIYSAVTRLDELRRFCRLWSKRDPNGTMWLPSAVL
                     PELLEELRLPLGVSDRRNRVEVMQLLREYNIPDHNGRVYYYEVLLPLARRVMAIAFLE
                     AADAHTAGSQAPRDIAWHLSERSLGALPASYGTVRPSSVTVAEHYAAALLQAAFRRDR
                     AMRDYYIAKSELWRRGRAVCVERGLPYDNFGFGKTPLAGPDPREEGMRRGFNIPKDAT
                     LANSAGGRVYADPVAARIAAMREAMGSHKRATDQEPPTLLPAVYRSAIYPEEKRFGPN
                     APGAIRRHERRDEKLERKRAQEEYERQMYERSTRGCPARTAGEQKDNETVTAEGAGDV
                     DVGLAYSKGTMEPHPAARGNQYNLDPMDVNYQPPLGTSPEELRQEKVDRRLNAAAAAA
                     TASATLGGISPSTTPEQY"
     gene            <188886..>191498
                     /locus_tag="LDBPK_340510"
                     /db_xref="GeneID:13392625"
     mRNA            <188886..>191498
                     /locus_tag="LDBPK_340510"
                     /product="importin beta-1 subunit, putative"
                     /transcript_id="XM_003864168.1"
                     /db_xref="GeneID:13392625"
     CDS             188886..191498
                     /locus_tag="LDBPK_340510"
                     /codon_start=1
                     /product="importin beta-1 subunit, putative"
                     /protein_id="XP_003864216.1"
                     /db_xref="GeneID:13392625"
                     /db_xref="GOA:E9BQK5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027140"
                     /db_xref="UniProtKB/TrEMBL:E9BQK5"
                     /translation="MANITDLLMALGNPEPSIRVPAETAVNNAKETDLATFMTTMLQE
                     FRDESKPTFARNMAGTLLKNAVAPSFREVAARHALEERWRALPADVRLHIKNEVLSTL
                     GSPNRDVRTVAANIVGSLARSELPSGEWPQLMGILVGAAQSASEQHQEAALTAIGYIC
                     EEGKDHEEVEGALKPSTTDVLSVIVQCMASTNEDVKLSATNALCNAMEYIHDNMDVPE
                     QRSYLVTALCETAKSCTTARTRERAMESLVKVAELYYSTLPDYIARLHEITTNAIFHD
                     EEAVGLQAIQFWISICELERDMKEGGDVQSSLNYSAQGLTFLVDICKQLLVQQEEDQT
                     EDDWNLSVAGGKLLQSLAEAVGIPIQRPVMDFVYANINSTEWRKREASVMAFGCIIGV
                     QETAAQEAIQDTVAQAVPGLMEYLRDSNEMVADTSAWVLALVCENFVDIFLQTPDLLQ
                     RLMNDVGPMIGGENARMGVRACHIINNIALAYEEEEDQQTNEISRYYGDLVVVLLHAI
                     DHGATNDFKSAAQETLNALVDAAANDCCSAYLIQLPQELLARMGPQLNALRQSSGDNI
                     EAEAMMGLLCGALSALARKLGQSFMPFLDASMQALIQVIELPTDYVQQEALVAIGSIA
                     YVAKEQLAPYLAKVIPHVLKYLQAFDEPDSIYGVVAAVGDLSLSCRLSLLPFESDIMN
                     TLYVNLTNTEVDRELKCSFLSCFSDFILNVLGSERFKPYMAALLPLVDRLFRASCEID
                     IRGDPEGEEYVMSLWETTASFYSSVTQCFKSSDVDALAPYLANILNFALHAATNAGEF
                     EETQMAALMVIGDMASVLRHVPDPQMRAQAKQALLADAVNGALNQALCSSTSEDNKKQ
                     IKWIRNQLSHLQRS"
     gene            <196588..>197361
                     /locus_tag="LDBPK_340520"
                     /db_xref="GeneID:13392626"
     mRNA            <196588..>197361
                     /locus_tag="LDBPK_340520"
                     /product="splicing factor ptsr1 interacting protein,
                     putative"
                     /transcript_id="XM_003864169.1"
                     /db_xref="GeneID:13392626"
     CDS             196588..197361
                     /locus_tag="LDBPK_340520"
                     /codon_start=1
                     /product="splicing factor ptsr1 interacting protein,
                     putative"
                     /protein_id="XP_003864217.1"
                     /db_xref="GeneID:13392626"
                     /db_xref="UniProtKB/TrEMBL:E9BQK6"
                     /translation="MDVIPPEYDPVTRERVYRQEWLEYFHYIGFEAAIRDYPAEYRAL
                     FPRGHHKPPAMPPPLPVGGTKSQKASTSATAANMFIADDDDKEVGKGSETEDDWSSLI
                     SSSSSSAASTPRDAPREDARAENVERTARDERSSRRQTSSRHDDRHHSSRRHRDRDSD
                     ERRRRHHSDEEERRHRHRHHSSRGSDYHHSTSSGTSRRRRRSGDRDNREDRRSSRVYS
                     SEESSRRYRRETTSGSSRTHAYEDRREDALRRRDNAYRR"
     gap             198486..198584
                     /estimated_length=99
     gene            <202867..>205572
                     /locus_tag="LDBPK_340530"
                     /db_xref="GeneID:13392627"
     mRNA            <202867..>205572
                     /locus_tag="LDBPK_340530"
                     /product="phosphoglycan beta 1,2 arabinosyltransferase,
                     (SCA like)"
                     /transcript_id="XM_003864170.1"
                     /db_xref="GeneID:13392627"
     CDS             202867..205572
                     /locus_tag="LDBPK_340530"
                     /codon_start=1
                     /product="phosphoglycan beta 1,2 arabinosyltransferase,
                     (SCA like)"
                     /protein_id="XP_003864218.1"
                     /db_xref="GeneID:13392627"
                     /db_xref="GOA:E9BQK7"
                     /db_xref="UniProtKB/TrEMBL:E9BQK7"
                     /translation="MQDTASPFPHHRTPATYQAGLHYQANGRESAAPLLTSSAGNAAN
                     GKRLSHWGRNVLRGFYHVKWHQRTQCAVVACLLWFFTLFVLLHTFLQVSGLTQSIYAV
                     FSRPTSGLQTLLEDELVIPSPVVPPNGAFCGLCTEGLVVFRPASAATSLATTPAQTET
                     VVCVETMEEAWLSASESEPLSSVRDCVARLYNLGLLQPPRTTITAVNDTCAAVRVTVQ
                     VLSGESEEADRNKCSSGFVAELQISSTEREKVEVHTQRFPSWPLCPVASPEAIDAKDG
                     HRGGSDGNHYIVPAYFATAAVRDTDADCDVPPPWRIDTIEDLDEVVLRFAGDAAQTTE
                     TSSLLASDLRCPTYFLTVNLGRFGRHHNQLQEILNGISLARRSNRTFILPPFVPALYM
                     SYLRLNPELLYGWNALRRNGHYCVLSYAEARPILRRLRERDGVVSMERVSFAATADLH
                     VLFNTTEEHDSYAWGSMPRVPGTDGAFVYDADEWFSMGVRRREEMTAHTASNTSSVPS
                     PLTFHEARPPSAEECSGFAGPAPNKSPTQWERIRRCTTAFLRTYGDGDGRRESSLASR
                     RQPRIVVISSVTAFHLRPTLTEMTRLLGLLRPSPTLTVEIGRYYRLYATQLQWPANTD
                     PKRSFLNVLQPFRYKSTIGVHVRRREFTCREEAEHPSATIIAMSEARYQFDGTGKNDS
                     AAAGRPITTVARLASDCGWNSQSLLHIYDTYASWMRSRQAQGLRRSRCFAHVQTSNKQ
                     VLRSYVAFDEQVGPIGSQLQAALQQRYNPLKKKRAANGYPPIYAAFYDHRPRKDLFQT
                     YQEILSRWEHSSADTQRADGEAVFDVASVPRTTDSLVEMLYPIAEQEALALGIDFFVL
                     GNTGVFRGNIISSVSINVCLRRLGRGLPCHGVLAGYYEMLYKGYM"
     gene            <207703..>212031
                     /locus_tag="LDBPK_340540"
                     /db_xref="GeneID:13392628"
     mRNA            <207703..>212031
                     /locus_tag="LDBPK_340540"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864171.1"
                     /db_xref="GeneID:13392628"
     CDS             207703..212031
                     /locus_tag="LDBPK_340540"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864219.1"
                     /db_xref="GeneID:13392628"
                     /db_xref="UniProtKB/TrEMBL:E9BQK8"
                     /translation="MNRGMIARAEVQSAYPDALPSAATVFSESTQQRRVVMPPTRYVV
                     VQRPATAHILPHASEASTRMDATTVAPESAARHSVELTSRCCSATSSHGNAEETCDVC
                     SASVASSNISLSRPASRRPRASPLRRRPSRSGSAEAVAGRKRAIGPIAAPVAATRESL
                     LEASKEAPSAVSEQPPPPRIMPSPSMNSTSDVTQHRASPSRMQGLFDFVLSSSSNSGA
                     GVEYNSLNTSCEWAKTSPGCAEGVSARAAGLPPREQKRSHTIASPFSLLKPMEGVFAP
                     SHGALYRDESVAPVDPFAAAVQKAGDPLVLRHTIDYLLSKSRRLERENQRLWWQAHSW
                     DPHRAVEPHEARPVAVPLAHRRLRKSSSPAEVVTRTPYAITSRAVAFTQTQHPPASKP
                     RVFVKRQPRLSQATGRSASCTSTSFLSRESPRHSSSGEGADAEEHVRANPGAHLCTAA
                     ADTPAPPSTESTETTATSAVSRTEAGVQCRPAARDAATDAREHRSPVHFGLASMAETA
                     GASTESQQRVSSSSHADASAQTELVVPLTSALLRTPEARHQALHHRLQGTASGDGKGD
                     AAATPIASTVRSRHSIYSERSLGVMATDATSLPPFPVQKQQVRSLSSCSSQAHVRGTS
                     QASGSSAPRGHYPTYSKQVQTASIQLPSLGEVEDAGGGGGGGDTLMVSTMDGTTSALS
                     SERTAVIELHTSPSYTRNTVRRLREYCNSLEAARQQLRRRLSRSVPNSHDVSAVALSR
                     VRSPSSLSHSHGQVPLSPLTTAAPTLSRPFFTSEYVDPEVDATLQDVGETTALETMIV
                     LHEDGAGTITKRVIDGSQSCVSSFAVRSPSPPSQRPAATMTSSLASQSPTPVVENAIS
                     WVRRYSPRAPCRMKPQQLLSHYLRGTHDTAVIAEEPRARRLSSSLRSDGSSSCCVPVV
                     HLGKPMRSASASSRNASDVNIHFPGAVPLAPSLPKSPPKQAPSTGRFVVPPTTPLEEG
                     DAEQLPPQSLPPRPHNHQTHAGASVSVSLAGCTAPGQFAGLQIGVTSSTTRTSSRVNS
                     QRFAVKGVRESVSPKEHSTRIRSKSGRGSVGSEALVSGKQTTSSASAAAASAPLWDPT
                     RHSLQSPSPVMLSTSTETSVAAELVVSDRLGTPVTTSGSEAGVRGASNDSVHGSRPIG
                     TSLITAVASASLSALSAPAPDSEEPLPPAETAVQPHIRSPLCRLHLEAQAVRCGRGGS
                     GDRRDLYTDSLHVSGSASPAPSTPRGSEENSGGRCKRSETTAFLDEEKREASAVSSAG
                     ARRVSVQLPVLENDVVSADGADSFHSTDAAVSPRSSAERVVSLLLPAQLEGSLLPQPQ
                     RPTSQRLISPSPPRGVDADDNAQNPRDGNTDLKAISAESIPKDAGIDSTSPRRHLVLP
                     QHRPPVAPPRVVVIPKNDESPSPARSSLSRSLHSLPSTLSDRHCDDASDDGDDEDGAL
                     WYSERF"
     gene            <213871..>215346
                     /locus_tag="LDBPK_340550"
                     /db_xref="GeneID:13392629"
     mRNA            <213871..>215346
                     /locus_tag="LDBPK_340550"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864172.1"
                     /db_xref="GeneID:13392629"
     CDS             213871..215346
                     /locus_tag="LDBPK_340550"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864220.1"
                     /db_xref="GeneID:13392629"
                     /db_xref="UniProtKB/TrEMBL:E9BQK9"
                     /translation="MVIQSEEGCTRCPSTAQVYEVPPTPKDESGKTLPADDARVLQRV
                     PPPPPPPAASTDSVTRKEPNLESEQRGVDEAHQAQHEATDNVEQKGSVAAANEDEEAA
                     EAKEPSLLADIIRNQEEGQQRYPTALSIDAAKDAPVEIGMGKDASPSAATAETHAKEK
                     PKSSSPPPPENVNDMNGKACKVDEASSAPKMPMVTTVAPEQVDGPMSSSVYKIPQHYA
                     SPALHKAEALHGISSEEVDGFINLITPEQQPQEAQEMDSNRIRLSPLGCPIQELSQVE
                     PISWSKASLLEGSPLHWETSHGADVSPSLYRSLRLGTDLLRQKDRANAFSVADKIGAA
                     AALSEFGSEEAEEEEQGVACGLGDDAEKPIAFTATSEVELEREAAEASSDEESTLSMD
                     KDRVYTMGNTDAEGRSQPTRSVESSVAPVAPIEAADKHMASSEQHATFAMLTAENFVW
                     TGAEAPRRMPPPPPYHHSDEARDAQLCSRSAPPSILSPPPA"
     gap             216862..216960
                     /estimated_length=99
     gene            <218546..>219715
                     /locus_tag="LDBPK_340560"
                     /db_xref="GeneID:13392630"
     mRNA            <218546..>219715
                     /locus_tag="LDBPK_340560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864173.1"
                     /db_xref="GeneID:13392630"
     CDS             218546..219715
                     /locus_tag="LDBPK_340560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864221.1"
                     /db_xref="GeneID:13392630"
                     /db_xref="GOA:E9BQL0"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BQL0"
                     /translation="MHSTPAKEAEAEGYMRSGKKHLEKKLFQFKANYGGAAEDFDKAA
                     RIYTNLRNYPKAREAWTQACEAHSKARNDFNAANSMEKLGDLASQYICDSQSTMSSGS
                     TASTTAQLSEHLFQDAIHAYEEASKLYGVATNGSKQASVLKKAADLISRSLVTAHYRR
                     PGTSGATTVDTAYLQKEYERIIPEVIELMERNWEVTESKPFDLPDIYRSYMLFHLRSG
                     DVEGAVQTEKRMIGVISTSPADGTYDDSKNLFRILNQPSNAAKVGLEIIVLCLSTSVD
                     DGYTWANIEMGRLGAVFGFCNSSEERAAAALLAAYAERDEDALQEALKTNACFNFLAA
                     DVSRMAKKLTLGGKGHSKATEASVAAAGGAERSAAPPSLSQAPVDASETDSEDLR"
     gene            <221812..>223677
                     /locus_tag="LDBPK_340570"
                     /db_xref="GeneID:13392631"
     mRNA            <221812..>223677
                     /locus_tag="LDBPK_340570"
                     /product="leucine rich repeat protein, putative"
                     /transcript_id="XM_003864174.1"
                     /db_xref="GeneID:13392631"
     CDS             221812..223677
                     /locus_tag="LDBPK_340570"
                     /codon_start=1
                     /product="leucine rich repeat protein, putative"
                     /protein_id="XP_003864222.1"
                     /db_xref="GeneID:13392631"
                     /db_xref="UniProtKB/TrEMBL:E9BQL1"
                     /translation="MADPAHTRDGFWEQQQQSVQMTRGVFEAMNNNSMQLLQMRVDTL
                     ERQVAMLSAQVMAAALPASFQAYPGVTYGMSPATSNVTQMTAMPTQMPANMYFYQPPG
                     MPAAAPANGAAADDGKASKQLEDELQRMGVLAYGGAAAGSTTSPEAAAAAATMTLMQN
                     NFVVSPTSGISAFPGVIAGVGNSNGAGPGIPFMPGAHEVALASSMMPGPPPASTSTKM
                     SNALLQKAFGFSDPAMNGAGGDGMNANMSSLQRSCAVTLDPLQSTNEKLEQICQQSKI
                     RVLCLKGCKGITSLNAISRLQNLWLLNLQGCSPCVDDNAVRMIAAHNTRLSRLNLCGC
                     DRVTDAQPLAQLSLMFDLNLSGTMIGTASLEAISHGCGQLSRLAINSCQQLTDVSSLK
                     NLSELKLLYCRYSENIDPATIANVLAGIGQNLLTLNVDGIRFRQLDLSNLPHVTALKN
                     FNCKDNTQLRDLDWLLSIPNAARAFESLEMLDVEGCESLVSFGMHITSLKRLKTVRLT
                     NTGITNEELSRISVCPALSVIHLEDCAGITNVDCLANVPTLTKVVLSMRMQHEDTKAN
                     GVAALRKTGAEIIFAAASNHHGQGGSAHYMTPTSRFAPSIPTTSPNTAAEAHAFP"
     gap             224431..224529
                     /estimated_length=99
     gene            <231865..>237507
                     /locus_tag="LDBPK_340580"
                     /db_xref="GeneID:13392632"
     mRNA            <231865..>237507
                     /locus_tag="LDBPK_340580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864175.1"
                     /db_xref="GeneID:13392632"
     CDS             231865..237507
                     /locus_tag="LDBPK_340580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864223.1"
                     /db_xref="GeneID:13392632"
                     /db_xref="UniProtKB/TrEMBL:E9BQL2"
                     /translation="MRTSAATRTAGKGVCSQHGSVAAKKKVPKDVFGGGVAGQSTQTR
                     SRRAEAVVRHVAQLPAFVAWAPGNAATTPSLVGQYLEFQVAEVAAQLNPIQQASNYER
                     LTLLLTELLQRDLVAGITPCAVQCGVLDLMHACVAAIAKGEVGIYDDQRSSGRETSLA
                     AAAAASVQYARSPSAAFGSASKSARQGGGGAVPIENLLPPLIEQPEKSLRDARDDTGA
                     AATEDERAAIAMEAWEHCMATAREATSAEDASMMPSATAVATMISGASCANAAHSCTS
                     AVPAEAPLVSIRSFPDALCALIERCTATPLVCLTLSDQQCQTTAVRDLLRALLTIMQR
                     IDGNAVAAVDCEIALASHSSSSGHHTPVAATAALDLQAVRLAALKGVSRVLSTYLDGA
                     DGSAQAPTKASETFTAGLDRLHILSVFEDVVHQWAHVLTVLQKGKGLIGASAGVGKGL
                     DVKPEDDLFGAAGSPQGRRGGKDGNGAAAQLHWVLRITYQIIAAEQREASRGSAKAAP
                     RVRLLPPLLVPVALRTLSLISTAIPLVCRAASYAQLCVDVLWGASLLAPSESSRQLMY
                     GSMGVAGLAGASNGSCEGEADVSRRAEASPPAMDLFLALLHQFNEGHSAAHCELRDDL
                     VCLFAFLLRCDTQYVEDELVAHRVAQSGTPLTSSESLSCLSASLPSAEVHATPLNLSV
                     ATVEAINAVAALLFETTCGAELTTTAHSATATAPAAFQSTDVDRGESAPVTLLSLDAA
                     RRHALRFQSIASSVARRRELLDFKIYGWQLLDAHYCWQLAHLTYREYVHCHATTGTVK
                     QVTGTDAGDGAVTAALWGIQLSHLGFLDVLLLYVDTRTDEAAVVAWTQGELLKLEVEA
                     WQLLTSMILFTQHLGAKSDGLQVRCHSPYSEKPSAAQDQQQGEDSPLPSVPVEAVDKH
                     HFGEEAEYSDSDMDSTGDKPGMLCGADVHFIAAGGVEVALHYLRTAPPEAEAVKRCAL
                     VTVAAIARASRSGEAHGRSGSYTDEEVALVQTALTQHAPSLVPFLVQLIQEVDVYVDA
                     FGVPAAVPPLISSYTASVAAKSPQCVGGHRAAREDSGIELAAAMPTHGGVRWNWLPQS
                     AAHAAFVAWSLLRCIGDVPLAEVGTVRELALPMMNANGIEEDDHDDEAKDTKTHNSHF
                     SVSVDTAAITAGASRRKSVARDRAPLRSFESADWQPHEEVDLSISNMSFSGSSMGPLE
                     VDGEDAVVIAHRRPAASSRAAGDGESAACSISCLSTPSHTRVLLRSVHSQALCIPDLF
                     AEHGGVHLLTSWMRHVMRLCLSARPEQQQQLLLRRSSGGAAPKLTKEEVANLEHYGDV
                     FLLLLDVLRAIVMGCKASEMQFVESGGVRGMLDLMEAYALAHGLIDQASRHVRLTARE
                     SCGSAAAGTADHKEQEGVLMYATTLLSDLLESCPRAIDAFATWRSCRIALSPLTPDVL
                     ECRMPSDDGIEAVQLLLCLWASEMPARKSGGAAQATPSGLRLLRLHLRPALRTALREE
                     YVCRLLHRRAKLGVLEAEAIRNFYRYLHSEAVPATTSQTPEEGVPDSVVLAYMEKLMS
                     RSSRCPAVVPEQQIALLIDGALGLCMKVYGCLSTVGFDLLRTAEAEALAVPSIGARLS
                     SLERSLLVQIAALPALCVDEISLAMAEVALEYDSLQAGADSESSEASRHASENAAAWR
                     PTSPDRRVLCAAAQEAAVRAGELDQLIEVGEQVQEARESQLYSRFLVTQLRQPVGRLA
                     DGRPGAVKGSWKTQRCLSTTRGSFVARNRNALALSAAELGARLSTRLAAEQLQRRQFN
                     GTQTGASVGEEQSWASPPSTAPSVLGSSRTPYATLMDSVNAAAHERLSATLFSIVGPP
                     HRPSVPLTQRHQQRQAMIARSLRKLPLDQSTPKGPHKP"
     gene            <239137..>241641
                     /locus_tag="LDBPK_340590"
                     /db_xref="GeneID:13392633"
     mRNA            <239137..>241641
                     /locus_tag="LDBPK_340590"
                     /product="GTP-binding protein, putative"
                     /transcript_id="XM_003864176.1"
                     /db_xref="GeneID:13392633"
     CDS             239137..241641
                     /locus_tag="LDBPK_340590"
                     /codon_start=1
                     /product="GTP-binding protein, putative"
                     /protein_id="XP_003864224.1"
                     /db_xref="GeneID:13392633"
                     /db_xref="GOA:E9BQL3"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQL3"
                     /translation="MKLCGVRSSGVSLTRSSDFPRFRAAHHGGAHTATRHQSLCGRRL
                     DSYMGAGKRWCFRPLLAEPRRYSNASSAFTTDAATAPAHGEGLYVSHYAMPEDARRLV
                     GTPQLLPRNPAEEVAFKKNLIRSFPQACIRNVSVVAHVDHGKTTLSDAMLRFSNLLPA
                     DGATGTFTDRLKVEKERGITIKAQTCSVLLTVRETGTQYLVNLIDTPGHVDFQYEVSR
                     SLCASEGAALLVDVRQGVEAQTMAQFYAALEQNLTILPVLTKMDSVMSDAEVEKTLLQ
                     LEDSTGLLSREVILTSAKSKRGIEQLFQHIIDKVPPPCGREGFSDMKQLPAMHPGSAD
                     RKKVEKELVPLRALLFDCWTSESSGMADGAASAPVSTASSVSSGTAPASGGQSVAKDG
                     IYGLIRVMDGTVTPGTTVTFFHSGKKHEVREVGIIHPTLHPTAALTAGMVGFVFFPGL
                     LKKDVFIGDTLCTLPTRKHTMRVVATGPPATASRTKPATAAETASSDDASGSGSSSVV
                     EPIPGFKTVQPVVFAGFYPDEGVYITQLREAVDLLCVNDPSVTVEQLQCPALGPGLQL
                     GFLGFLHMQVFKERLLMEFGQAVLVTPPQVQYMYVEQHGDPDDPAQRKPVSVSNWRWP
                     HEGVGAYLEPFVTATVLTPSEYLNEINSAALSAFRGEMQEMRVIDGARTLVRYRMPLA
                     DLARGFFSTVKSSSHGYATLEYDDLTYMTADLVKMDIVINKAHISALSTICLRHEANT
                     HARRIIGSLKEKLLRSSVDLPLQALVGSKIIARETVKAYRKDVTAKIHAGDISRKQKK
                     WNDQKKGKERMARRSVGTVTLDQSVLAAALGATTAR"
     gene            <242527..>242895
                     /locus_tag="LDBPK_340600"
                     /db_xref="GeneID:13392634"
     mRNA            <242527..>242895
                     /locus_tag="LDBPK_340600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864177.1"
                     /db_xref="GeneID:13392634"
     CDS             242527..242895
                     /locus_tag="LDBPK_340600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864225.1"
                     /db_xref="GeneID:13392634"
                     /db_xref="UniProtKB/TrEMBL:E9BQL4"
                     /translation="MQRPACVSFVRRMATASLVSAAACQAPARFSSDYVNKAAKKKLE
                     EGEDERWLEAEMDKNISTPEERYAHAREIEALKRMVSQLKEEHKDNLEEVKRDRNSEL
                     ESLKKEMTELQKKISKLTEK"
     gene            <243991..>247728
                     /locus_tag="LDBPK_340610"
                     /db_xref="GeneID:13392635"
     mRNA            <243991..>247728
                     /locus_tag="LDBPK_340610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864178.1"
                     /db_xref="GeneID:13392635"
     CDS             243991..247728
                     /locus_tag="LDBPK_340610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864226.1"
                     /db_xref="GeneID:13392635"
                     /db_xref="UniProtKB/TrEMBL:E9BQL5"
                     /translation="MSSHNSFHDAGGGHEHSLLLVLQATVKNSLWHLAFFPALRPSSH
                     IVSAVKAHSSTSSKAADNSVVVSALHSLALLEAVGYTEAGHTARRLWRAHAFGSTFSL
                     SQHLVSAEQCSWVDKLRVTALRHAEDLSSTLGSGEGVLATLLAEAQKLNKQDKQTTAC
                     DALFSELAHDYLEHIATATSATSTVHASKPVSSAESNLGVPRRRTASIFQYEVLPAQA
                     AAARQRRQWYEARLYAAVACSTSISTPGPLARLLVAYAHQGDRRLQVAAGTNLECYIG
                     GDHNGEKTKEGGNAAPVTSVATDTAAAALARVRLSGVVAGVVEYALCVARVRTAVAVA
                     ELRASASAVNASPGQPPPCTAPTSCAVAHVPHSAALLLSLITEECSYYQQTAPAGTGG
                     GEVGVTAAVLHAVQELLFTVVLGGGTQHMRNRPEPPAPPKRPGADGGGGASVTPVVMA
                     MSTTRGVTLPEADAIAQEFFPALVQQLGMEWVWSPLLRHLASLDKSQVSAEAIDARAG
                     STPVSSLSVRWSSHVLMDTILLSLSRKTYPQRLLNVLPGSYERLLSNLDLLPQIRPRG
                     DDGDDAGKGDAARRASGPLLFDMPAYYAEPASALVAYFQRAGVSGLRIEETERILTTA
                     TSIHAMVVRLRAQAPSRHDADGREDGADDRSGEELDGNGKSCVASLYYHNKTRATPHA
                     YALTHERVEHLITRYQGEVLLAAVVVHTQLRVPSQVQQLMRVLAPLFLKIHLAWRTHH
                     DGSSASWLLQPRTDPSVTGTTPSAARFSAEAAVLLDEVGYEFYPLEWLPAALAASTAT
                     SDSSVERLAFPYSLLAAVGHQFQLQLRGIPLGSSGDVTLRHPAGPRTSAVMPSVGGAA
                     LIASCRGGDEEETKSTAAAWRRTERFVTGLMQLCYLDPKTSSTELEGTLAVSSTRRVL
                     TTSGGSATLGSSGGGSSALGVRGSRANVIAAADVASHRLRSLVLQPAVMDAMWGSMEN
                     TAITRGNGASQRYGERREKRSRSVSASAEAQEHLRSMQQLLQEYGAASFDTTVEAADF
                     ALMIAQAFLPLSVGTSASLSSASGKAGPAASAGKKSEALLRAGLGWGSAVVGHAATKA
                     RVHMQLQQQQKGGVSSFSAALAHVYNSATVDTAWLARSALRYVPQRIWEKMCAHRAER
                     LALVHRHSKWVSRLLGDLPTASEAKQCDVGDAHRVDPLLVAQWTQWERVLEQLGLSEH
                     LEGSSAAAASAMPRLSPFSAEDITCAQWLWYSPYFAAEIAP"
     gene            <248733..>251270
                     /locus_tag="LDBPK_340620"
                     /db_xref="GeneID:13392636"
     mRNA            <248733..>251270
                     /locus_tag="LDBPK_340620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864179.1"
                     /db_xref="GeneID:13392636"
     CDS             248733..251270
                     /locus_tag="LDBPK_340620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864227.1"
                     /db_xref="GeneID:13392636"
                     /db_xref="UniProtKB/TrEMBL:E9BQL6"
                     /translation="MSSSHTERAVSRTQGVQGSTPTNAGSSKLGTLSVSELRTAMQQH
                     LRSTGALRELKTQLRGMVLAEILQQPKTARMLVHGASQSVPPSLGEGQRKLDDSKASA
                     AGSPGTPAIAIVSGRADHTLQTWSCGLADALVENHLRRTRRAMSLSIFSTEAEVPPFS
                     VSGAPAEEEQYLAHLFRQIDAGTSANPEDDILAPSPSHSMKSVLQRLVEDYMARQGLA
                     STAEVARHLHSCSTQTEAADCADSATNPLNSLECRLAAVDAKYALTFAQLKRTGGSGE
                     QPFFLRSEVERRLQQHKNDMHAQLRSEYEQKYNSFTRVKLQEARDEAEGRYRLLAQNK
                     TEELAEMERSLLVKLEQERQRLKMAWEDVHQQRAELERRQRDTIKQLADYDAAKQQSD
                     AELHSWKEKTRALQLQCAKWEELCGTRLMELDGARSREERRVEDIRRLQAEHAAELQL
                     KEEEIGRLRYRLRLVSRESDYSHSAAAAAAAASTGRNENTDTSTVPQAPPRTSTAPVD
                     PQQLYGLLLRAEEMHRNAAVQQQQKRWDAAWVAAAAAAAVSPAPATAAAAATPERVFA
                     VCRSSSPAPAPQAAVYPLPSSEGQVARRSPDRSESSDNQVAAASTPVAAIMSASTSAA
                     TPATSSPKVSSPAPTDTATAAKPPPSSADKPRESSASSKKSLSTRASVAPPSSSVSST
                     HPTPQKPTSVQDVEAQAAESLTSSSTRMSTSSSSVPSSTSAMPVQPSVHNADDDSKNK
                     TAATALLSSVTEEEQSGRDEVQSEEASARDSIAWLERNRRELLTEDLKRARSEGGVVS
                     PWKHFGGGSSGPQFGGGAAAADVDFNESFSSDDAALIHDSDEDDVEF"
     gene            <252957..>253910
                     /locus_tag="LDBPK_340630"
                     /db_xref="GeneID:13392637"
     mRNA            <252957..>253910
                     /locus_tag="LDBPK_340630"
                     /product="enoyl-[acyl-carrier-protein] reductase,
                     putative"
                     /transcript_id="XM_003864180.1"
                     /db_xref="GeneID:13392637"
     CDS             252957..253910
                     /locus_tag="LDBPK_340630"
                     /codon_start=1
                     /product="enoyl-[acyl-carrier-protein] reductase,
                     putative"
                     /protein_id="XP_003864228.1"
                     /db_xref="GeneID:13392637"
                     /db_xref="GOA:E9BQL7"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:E9BQL7"
                     /translation="MQANRVTSLFGVQYPIVQGGMVWCSGWRLASAVSNAGGLGLVGA
                     GSMSFDVFQHHVRRCKEAAKKPFGVNVPLSRDMAQYMDFIIEEKVPIVFTSAGSPKLW
                     TQKLQSHGIKVVHVVPSCKLALKCEAAGVNAVVAEGFEAGGHNGLEEITTMALVPQVR
                     KALAPEVPLLAAGGIASGEAMLAAMALGAEGVQVGTRFAVTQESSAAEEFKKRCTAAG
                     EGDTYLTLKQYMPTRVMLNDYGKEARRLSESGATKAQLKEFRGKGRTKKGMFDGDVTN
                     GELEIGQIVSACKDVPTAAEVVERMVKEFRTRNAQLAKMNL"
     gap             254942..255179
                     /estimated_length=238
     gap             255752..255850
                     /estimated_length=99
     gap             256839..256937
                     /estimated_length=99
     gap             259196..259294
                     /estimated_length=99
     gene            <262172..>269353
                     /locus_tag="LDBPK_340640"
                     /db_xref="GeneID:13392638"
     mRNA            <262172..>269353
                     /locus_tag="LDBPK_340640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864181.1"
                     /db_xref="GeneID:13392638"
     CDS             262172..269353
                     /locus_tag="LDBPK_340640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864229.1"
                     /db_xref="GeneID:13392638"
                     /db_xref="UniProtKB/TrEMBL:E9BQL8"
                     /translation="MESPPAQAVSGEQRARLLELEERQRQLKRLCEEALREEEQHQQI
                     LQQLEEHNTAAASSVGSFAGGSAGSFTGAAALHVRPFSPSAAAEPLDDLLTGEVQSFR
                     DPNSIVRDSSTGSVAAAPLLRGGSSSNPRNPSMDRPRTRLDSSYRPPTYPLPTASATQ
                     PPPPPRAMLYTASRRPREEGSRADAAAINGSIQPSISAPAMSSSLPVTKTWWHGEKGA
                     AEKRSGSNAAAAACTPAERVGAGYGAYAACSPPAAPAPLSPPPPPPPPERSRSRSPGC
                     SGPLVDRLWRSDVRHHHGIPPPPPPAPNAVEATVSPFSVLYSRTLGARAGLSPPPSRP
                     SRSSAPPLVSPDDVADNLPPPPPRAHSCAAASHNVQPSMENKYRRSRSFLNADPPLPP
                     PPPPPPPPTAHTDLGGDSILSTTSTERVIERWRHRLSCSDALGQRDGHYTSSGYDRSG
                     AAGQKPSITRPGTRVGVTLAERRTPQASAAPLLSVPYRESATREGVKVASRVPPPPPP
                     PPVSGTDPLSSPARYNEGRTEDESLPNRWETASLTPSLRSAEERRLRSYFAKPDGDVG
                     SSAPAHKDYASYSRQRVLGSRDGVKNARAALLETGGTASSTSAPAAARSEGSVSAWQQ
                     TSRAAEPPLHRRSTAAHFTSSAPSVTDVLPPTPAKAKPKKTVLHPYGLQQSQSSSLSP
                     PPEPSLRNAAARNGCGASRHRSGAPVPLFSALSAKHQRSTLSALNGSNLDSAWGNGGT
                     SLPAQSDVNGAAAAPAPHASVAASDSDYFDIGPEKEALLTLLQESTRGAPGSSAGVAF
                     PATSRSSSIQPWASSSVVTNVAGGGQSAEKALPYPPSARLSDSKQTQSFGAPPTMTTL
                     PPHNKDSARRHSNFDLSVGTPLPLGGSGKAAAGGAQHGNEVAAAQLQQKYDAAQTKAE
                     ALARHLVKAISDRKMLQGSVEQLEMLVEECNAEVGRLQQIVEQQHQDRATSLGVQAAL
                     RAKEREVAVYEDEIRRLNVVLNGHLTRTATAERVAQDSVQHGLVVKEAEVEAAMAEVG
                     MAHLAQREAEERASRLANELDTAVEQIQFLDERLAEMERAAAAARFQAMSGRITEEND
                     VNLDGGTVAPSHLSPAAHITMPPDEETRHWPPEARQAMAQLAAQAEGLLFKNAEGERH
                     ASMRLQHVENTCNELQRHLRQRGEEVERAREACEQLRQEKSALQTVGGLWYQQLREVK
                     EDAQLVSEMVRTSREDAEDVYLSSRMAEERAAVHCAAAAAASPLQPLPSPAPTDPATL
                     KKSAQFARQVMRDFHAVARFLSSLRTMNIGDSNGYQILQAIASGRHPAEALYTADDTA
                     TPKRLSELLRPNEATEAKRRVQEKKARVLRAVEQALIVEPVSAAAYVSVDTPHNRPSS
                     GATITLGLPPRAGGQPPTAEAEAEECEVPDALEDDLANDDEVEMEVVSSSLHPTRMGS
                     HSLRDGSNGMVHSDVRRRPASDSVTSLPLNRVPPTASASEASCAPSALEASPPPAPLA
                     SDGRPFCSTSFMGGNEAPSTTSTSRPTVAKAAPAPPTPLPSVSRPLRLSTTPSQPQPD
                     GKEENEEEAVAFSDEQSSPTCALSHTVLRADSMPIRGNGAGADFDMSSITLVSSPSMS
                     QQTFHQQTATVQQSSLPSTLAVTATPPADLTEGAPAARPNASVPLQVQQQHRSMPATQ
                     ESISPPSRLRSPTPNRVPAVWAEMHAEEDLITSPVERPKPSQSFADEPPPRVVCDGNT
                     QPVHLGSRPKDRSTTARPSSTPHPGSLSGTRYGFEAGDGEKTVAPPRHTGRLRRGASD
                     ESNDNEATLFFREPPRGEVQEVAAEPTSIPLQKQHSGVAVDLLSDGFAISSRRAPAAA
                     VAPAQDVSVSPDHTSVIEEEEADLEERVPSAGAAAKRLSLHLESPLKGVQSAASSVPA
                     VTRGTLKDSTMKKPSSSCTRSVVEDDEPSLSFLAPPPPLPPPPPVQPQVRPSPSQEHA
                     HGAPEVDALARTSPAEASVSGAGHSRAMEGNDGSVASIDNAPLSPSSLSGSFAGAPHR
                     MLHQPRRPSASDVGPSLSSVGGAFAPPRLQRSTGSSSSVEAQPLLCTVTPGPAAAVGA
                     TASVGQHSRSGARPLTASLPREHPCPEVTPALVEPQRPSPSARPVPAAMRTNPVTPGD
                     PVDSTAATAAGPSPLEEKTSPVPEKAEASRARLEGVTHVDDSLRCNSKVSANTMSETP
                     GSRLPSIASTAAPESPMHALEELSAALRLPGVMRSDTPGNVGSAVSPLAEPLQAAPVH
                     ARELPARAGNSAVPRSSPHEGASPAPLPGVNVDAPESNTLNLERASPRSAPPVAAQAP
                     PSTISTPRSRSGGREGPASVRNSTPTEPPVSDEAAARRREDVANILKRIKAKKEQEQK
                     RSSEVGTPTSPTWSESASSGTKDVDSPSM"
     gene            <271409..>273769
                     /locus_tag="LDBPK_340650"
                     /db_xref="GeneID:13392639"
     mRNA            <271409..>273769
                     /locus_tag="LDBPK_340650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864182.1"
                     /db_xref="GeneID:13392639"
     CDS             271409..273769
                     /locus_tag="LDBPK_340650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864230.1"
                     /db_xref="GeneID:13392639"
                     /db_xref="UniProtKB/TrEMBL:E9BQL9"
                     /translation="MQTKEKEFDEKIHQIHHTFQNAGEQLVVRDNIISHLKEELAGLR
                     AEVARIPKEYQEREEKLLLRVEAMMTELSEEQKRAHHSRRTAEEEVRAVRDSLQTAEQ
                     QLAQQQHMSDDLLRQLRASDKALQEEKQRHATALAESRCAYEAKLSELQRTFRSMEKQ
                     VAKSQSRLEDMEKDRCQQQAKLLELELSGRRRISSETVKAKELLTENEALRDEVEAVR
                     LSMARLLRLMSEVPVLSDYLQWNELSSEFVFLGYPTRYFDTSHRGRGTSSLSPSRRTG
                     SHGASPARRRAAAVAAGDDMSFDRPGPSSHSSGYYQDTNVSGISAGDTGVEDGVYAGV
                     AASLSKNVWLNGRWAQEMISIISAENNFTRLKRIKLLELEEAAQLSERLPSARDVLEC
                     RKPEHHYWIPYAVFMEAQKFKNKYYPKLPAMSHFSPFLIQLNKIWRAKLQDRLRIMQQ
                     QNYNQPQQPSQARRSATAESRFASRARTREGNLDDQGSSAVSRLTSRGCVAPLPRPGE
                     LFSEWARQEARMDEIHAEHHRLRREVRLHVSSQKGLQLFRLYDELVRGAHQTLGEVLR
                     LAEDLYDSAMAQRVSESEDRKRAASSALHEIKQQGQASAEMADLAEARDRLLCVVDHT
                     CQQVCDVGDSLSTRMMSYYSDLHQLIHMLHHHIRQARERSRHKTREQASSDGTRSGSS
                     TSSSTAPWSGRISSTVLSTEELQQRLRELLHGQYGTARGPGADADHAADAAAAPGAIS
                     SDALLKLAASVLDFGEEVRREVTHATAALRVVAEQGMREAAQCQGA"
     gene            <274835..>277969
                     /locus_tag="LDBPK_340660"
                     /db_xref="GeneID:13392640"
     mRNA            <274835..>277969
                     /locus_tag="LDBPK_340660"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864183.1"
                     /db_xref="GeneID:13392640"
     CDS             274835..277969
                     /locus_tag="LDBPK_340660"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864231.1"
                     /db_xref="GeneID:13392640"
                     /db_xref="UniProtKB/TrEMBL:E9BQM0"
                     /translation="MSVGSTSLPPLLPSGADLLVCIASYWPSATQGNGSGAVRRQQRL
                     PLAWIAASPAARVVAEQRHAWVVLPFTQIGTCPADAEVDGAASDGVENTFGSVLANAT
                     VQPRVLQVALKTDSADASATGLVSSSSKQTAHGSVVASVLSWLRRTGESLADVGHAVS
                     PVRPASLSFNGPASPPSTPLKTAKGRSSSAARGVKNAADAAGCCGAHIGGITVVLVSG
                     VHELDAAGAGAAFTEGRASSDGAAKQKGAFPTHGEGKPAALSPRLLFPSTTSCGGSVA
                     SMLSVPPNAAVYNGMAGGSREERMPSTTNSIFRAGAELHGDDGGADDETANDPKTATS
                     VYVVQQFSELRHRIREAQRQRASAAAVSSRGLLTTVWYRQVFVGTAEATDKALCGVSQ
                     WWLQRSIRRHELPTTASQAISLTHGSHSVRVSGSSYNEPRTLPPPLLHIKYVDDVFAD
                     LWWPRRFIMIVYHRLSQRTAHAPWAAKLFLLVWMILVVFVQTVLHGVLQVAPPLRASD
                     ERHSGSGNGTSHQCRVPPVDLISAFHKMGRVYGRRQLAALDVSHTGVRGTHLLACVLG
                     SVMTPPTTSEGEAAVAHGKGLWALDVAGCTQLRHRRGELYALSHMLDQLCSHAASRVA
                     ELSLREPSGTLAVADLLLSLSLRDGSRFASPSATGLALALFTHHGHLTWVCAAGSDVD
                     SAALRELGRYALLVEAAAATQQPQPPHSPMCTLRALDLTSALRVDDVNPMGYLTQLEQ
                     LLLPFTYVDDVGIGSLDGHTYAHDLSAMLALFTTAIAKEAPELPDDAQKSLQSTLDAL
                     QHLILIDDDGAGQADVHRGNPRKDLVEALHQKFRSHLYHLDLTYCLCVSSVKGLVRQQ
                     QLELLNLSQTRVNKFGLFGGTDPHDSSGSSASAAQPRRTPPLRLFIAEMCEHLSDLSG
                     LAHISTLECVIVRSGSLGDDGLRALCTPDMQRLQLMDLSYCDRLHHVGCLAQLPALET
                     LILDSTDVTPAEVKQLRSSRSLHTLSLRFCTEFAFIGRDLEKLEAVVGTFAALNRYLY
                     EDLAGDDELRKKTN"
     gene            <280065..>280994
                     /locus_tag="LDBPK_340670"
                     /db_xref="GeneID:13392641"
     mRNA            <280065..>280994
                     /locus_tag="LDBPK_340670"
                     /product="proteasome regulatory non-ATP-ase subunit 11,
                     putative"
                     /transcript_id="XM_003864184.1"
                     /db_xref="GeneID:13392641"
     CDS             280065..280994
                     /locus_tag="LDBPK_340670"
                     /codon_start=1
                     /product="proteasome regulatory non-ATP-ase subunit 11,
                     putative"
                     /protein_id="XP_003864232.1"
                     /db_xref="GeneID:13392641"
                     /db_xref="GOA:E9BQM1"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:E9BQM1"
                     /translation="MDPSAFGMMAGRGMGRQTEVRDARDTAETIQISSIALLKMLIHG
                     RAGVPLEVMGLMIGEEIDDYTIRVADVFSMPQTATGQSVEAVDPEYQVHMLDKLKLVG
                     RHENVVGWYHSHPGFGCWLSSEDVMTAAGYENLTPRSVSVVVDPIQSVRGKVVIDAFR
                     TIPQEIMAMRAMGEYVEPRQVTSNIGFLSKPSAVALSHNLNRQYYNLPVTFRKKNHEL
                     RLLLNVYRKGWQEGFKLEKAKVYQRETRTSIRELISLSKQAEKYITQGRDEDDLGNVG
                     QINAMSHLQMEAENVIHRNLNQSIGAMINAVVF"
     gene            <284074..>286869
                     /locus_tag="LDBPK_340680"
                     /db_xref="GeneID:13392642"
     mRNA            <284074..>286869
                     /locus_tag="LDBPK_340680"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864185.1"
                     /db_xref="GeneID:13392642"
     CDS             284074..286869
                     /locus_tag="LDBPK_340680"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864233.1"
                     /db_xref="GeneID:13392642"
                     /db_xref="UniProtKB/TrEMBL:E9BQM2"
                     /translation="MTQEWNTTLAASSALPAKPASMAVKVTGVVEEGHAQVATPASAL
                     PPNKRPERTGAPSTAADPSIPSPSAVPGPAHTSLRAKAAFPPGTVAAEAVTAAVAEGM
                     GSGSPRVPASYMFLMRSRDSEAMSPGSSPAPAATPHSVTLESPEFPSSRDSRASGRTT
                     TASGQAPGPTTNFHVDAAAPAAAVGKGAKQLPAPLTPAQETERAAKLEAMWPYALLQK
                     AIHHHESVPVVFRYRYSPDFEETIDENKKRQQQLDRALRKHHWLAGSRGLTHAERQEI
                     SRRFADPNALAHEWLYVWEQFERDIPRETLLVEDTPYHDASDALAAILSYVEYGYDRS
                     QQHVKKKLAAALADEKNGDAATTPAATAAASLGAGNSSSSPASRRETTLLEHFFSAST
                     AALKGAVVKMRASLPDFVGDPLLSVSGYNPALYHASLLFPTDPKARSEKIFSAVREVV
                     LASQQSFMGFPYQLLCEQVGTERLGLALEALERDQAEVDDLDEEAEAEKTAQVTPVDA
                     THEEGKVTASGSGASASIPIEKTAEAEPAVKEITTSMHSSLHGSRVLRIYHSFPSPTS
                     VTNRSGSDHRHRRHTVHVVDEWNVSSSSSRSSDAVPSSLSLNISPATTAPPPPSEASE
                     ESTEEKEQPVRKVGKQSAAVLDVLPAHCLSEEARRRKETVARLRRERRRRRRKQLPLL
                     VGEPRSHEFAAFLDIVRSRVIAKQVREERKEMEQRRRERVQQVVKRQCEQWGSAPASR
                     QGSRPSSRPVPSASLDMMKQTEEDPLAPTAQPADTAMAPRKLFHEDVEGSAYLIPTRS
                     ASATIEPPSRSPRSLLSSTSMREVSVSPEMRGMRIRLFFDDKRNVPVVVVNKLFRLFT
                     MPGLRGFTSSDDDTTEALNEETAAKAATAHPSAPARKSGAGRAGSLEKSVLLLIQVQF
                     SLFLQEDAEVRWKWWKL"
     gene            <289208..>295474
                     /locus_tag="LDBPK_340690"
                     /db_xref="GeneID:13392643"
     mRNA            <289208..>295474
                     /locus_tag="LDBPK_340690"
                     /product="ATP-binding cassette protein subfamily C, member
                     8, putative"
                     /transcript_id="XM_003864186.1"
                     /db_xref="GeneID:13392643"
     CDS             289208..295474
                     /locus_tag="LDBPK_340690"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily C, member
                     8, putative"
                     /protein_id="XP_003864234.1"
                     /db_xref="GeneID:13392643"
                     /db_xref="GOA:E9BQM3"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQM3"
                     /translation="MGKAPAMPSSTLTGAEVRVSRSRATFLVHGVLRRIPGYAFFLIH
                     LCFVHILWGQLVDQFFNATITFTSANVTKTDLAKEAFIRVCNRICRSVDQTLLHGLVD
                     VLKTKGGTGATGALAASREILAFLWKSPSSMVLFFGLAFICLNSVLAALRLFTGFLSS
                     LTALCRSRRQLERSGSRKPVPLHITVRYGNGYDSMLRFALAAVELAWFMSYPVLNSTE
                     AAKSAADKTRRVPGATEPTYASLRQLQVRHQAIASFQIEASLLLPPQLFDSTADAIAA
                     GAFVIIFVKVVLGVVVALDAQRLFHALVGVRPLFIPNGWERCPVCGALWKRSRKATNA
                     VHLCPNIFTATPLLSGCSPGMTASDTEEEEDMRGQVLGTVRRGVGDRRRVGPPTEAAH
                     RPGDAFPNPNTASFASLVTDSWLSPLMNFTLLSPLNTFSPPPLSSITDDGRGHWRALL
                     RVVDRLPRLPRSLRTRDTIDEPAWTLWQRRHEPAARGEVRWLERSFMAITEPIRRVLL
                     HAFAVFFLPPSARGADTRHGEWGPVRSGSSLFRVFLRHPSGRQFVLVCVPLKLTQDLL
                     SLLAPRVVKSLVAFLKEVSTSNISVRQNYLGRGLLICLSLILVVSLQALFFQLYLTHL
                     YASCLKSASALKTLLLRQSLATPLAYTGGGRGGGGKRAPMSPSASDIPHSPTRPSEKN
                     DGRVKDALSLSTAIPTAEEVTTTATLSREGEVMSLLTVDITNCADCLIFLHNVWGHPF
                     VIISSLMSMYTYVGLFSTLATFAALIALIPLNRSSAARVRTAQQQAKNNESRLSDLTA
                     ALSSMRTVKSMALEECLVGRVEEARVRESDGTKLVGQAESVAAAQTEVTTLLVALVCC
                     GSYLLTGGVMEAAVLVPTMAALQVMRFPVWTLPHLYSQVSRGYTSMLRIERFLSELEA
                     GENASTAYVEHRLRQQNGEGAARDVQPSVAVAVRAGEVRCERGTFAWNTQAAVADQIA
                     FDNALSCNSPKGSRGYTRSPNAASKESDRRGEEDAPSSSMLSAYSSPRESGSRAVVLH
                     GITLNIFPGEFVVVHGPTGCGKSALLLSMLGELYVMPNGSHATSTRSTTVASSETRAS
                     SDSQGFQVGGRVVYCAEVPWLRQGTMRENIRLVSDDVPESATEREWYNRVLEACALKN
                     DIKALAKGDRTMVGEGGSKLSGGQRARVALARAVYRYSETDVFIFDDVLSALDVEVQK
                     HIIANLFHGLLCAGAGSSSAAQRRTKTIVLATHAAVSLLMPDRVLHLWPDGTLHEDMT
                     HQAPTEDQVHQQKSAWRNATAAAATKEQRRSIQYQAAGAAAADLSTRQNDSTFPPSTK
                     SKPVAETSPKSSSAPSVRPPATGIDSLLPRAADLRRLFIEYIGGGRLLWFFVLSVSMQ
                     LFRTLMDNWLGVYISLYDKRNAAYETILRSTKSQRARKFMLDMLSLVVLRGDKATPAP
                     PPPPVVPVFTIFGVPVVWRNPFVLDTVVAQFLGTYAFIGLSAALLSMIRTDYFFRSYQ
                     RMADALQLHAVRKLFKAPVSYFDRIPSSRLLQILSRDQEVVDRALGESVQLIFLTILQ
                     LFGMVCFNAIHFGPFIAVLPISALLFYHLTVRFLSFTKQVRALEGVLQSRSVAVMKDA
                     VNGAITIRAFGSVLQNQLVQEMNEALDAVHVAANAGLTADRWVALRLEFVALALTSAL
                     ALLSVLTVCLSATTSAGSAAFAGLGIISSMTASRSLSMLCRRFGMFQNQFVSAEQLLR
                     LEEEIPEEDTPAAAEGCSDDESSASEQRAATEPDTCLLLDVRHLCAKYQPQLPWVLSD
                     ICFTLRPGECVGLIGRTGNGKSSLFNALLGLMDVVEGEIRIPGALFSSSPKSKARQLN
                     AIHLPQHELRKNYFQLVSQEPLLLQGTCRSNLILGLDDGSAASREASGEPRVTVDAEA
                     LDVRLSAVLRKVALDELLEPSYAVPAPGQPAVTGSDGEVASSATRDAAESASDSTASP
                     TSTVDVATRALDHVVTAGGSNLSAGQRQLLCLARAILHRPHVVLLDEVSSRVDRRTDD
                     LIQRVIKEEMLCRGGKDNGDSSAVKSGVLLIAHRLETIMSLCDSVIVIEKGRCVAHLS
                     KEEVNCLEDLESYL"
     gap             302983..303726
                     /estimated_length=744
     gene            complement(<303727..>305145)
                     /locus_tag="LDBPK_340700"
                     /db_xref="GeneID:13392644"
     mRNA            complement(<303727..>305145)
                     /locus_tag="LDBPK_340700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864187.1"
                     /db_xref="GeneID:13392644"
     CDS             complement(<303727..305145)
                     /locus_tag="LDBPK_340700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864235.1"
                     /db_xref="GeneID:13392644"
                     /db_xref="UniProtKB/TrEMBL:E9BQM4"
                     /translation="MSFLSNINPAFPQLQAGQVVAYDYLHAAKTWQWTLGTVREIKDY
                     TAVVQQWGLHTGDIDTLRSILLKEVDTENGRMKNYHDMLAIAREKLASIRRSNEDRVS
                     HVRGHFDKAREKVELIDEVDLRKVTAQAAPSPVAVAVLKAVWAVAKCDPTAVEFYEWA
                     DVQLEYRKPAALDEIAKTDVLAKLYPSAESLQQSLEQDPKLNYKAAARDSPVVASLHA
                     WVITALAYQQAYNLLAHDKRIQEQNDAIAAAIAGMKACRAKIAKLKDELSSKDTAALP
                     GQVTSFTRTSVLVTIPLSAVISPVNVDTDVKRCVLTKDEVEQIPIDAKITRYAQKQKL
                     AITGSHLLDQYAAATTTHIYVTELEDRLFFFQHYMASALRDAQTAAVDAHQRLAVSLH
                     ELEAFRQKRHDAKKARAAEPELADADGVEPSSGPTSSRSPTGRAAPRGQSAAPRGTAS
                     QQHKLLGPAYQSIDPATIANEPL"
     gap             305321..305419
                     /estimated_length=99
     gene            complement(<308079..>310217)
                     /locus_tag="LDBPK_340710"
                     /db_xref="GeneID:13392645"
     mRNA            complement(<308079..>310217)
                     /locus_tag="LDBPK_340710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864188.1"
                     /db_xref="GeneID:13392645"
     CDS             complement(308079..310217)
                     /locus_tag="LDBPK_340710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864236.1"
                     /db_xref="GeneID:13392645"
                     /db_xref="UniProtKB/TrEMBL:E9BQM5"
                     /translation="MKACRAKIAKLKDELSSKDTAALPGQVTSFTRTSVLVTIPLSAV
                     ISPVNVDTGVKGCVLTKDEVEQILFEAKATRFQLKSRMNSIACRYVEAAAELHTLSLY
                     TAELEKKRLYLQEHYFSSIIRSGEAEAKWERTEDTQKEIDRLNALVAELQKHDERWEP
                     DYEAVSVATSHVKKYPGAEWAYLIAERFEEVRAAFASDTALAVHVDPNFVQHIKFTPE
                     CDQLCVRCEITHPAKMTGTEVDERISQMPTRLMNYIYKNRDAPKTGLDRAVADICNAL
                     GIDDHKFAGLGFDEFVTQLAGFDYLGDKDAYESEIGDLLMLLDKINNENRSLQYTLEK
                     SAERFKKQAAVLQRDQDALTLRNADLADEIDRLQNLVEKLKDLADTQGAQLEHYHMQH
                     QQAQQLRAHRNLSPIPPTAEEPLYAVTIDELNAQKALCDKEKQRADALQKQLDDKEVA
                     LNQLQSQLREVRCRNNDLDLQLQLAAELSEKQKKILTAFHQKRRSAHDARADEPELAA
                     ADGVSTRNASARSRGRPPAHINPAAEAVDPVTIAAEPLYAVTLDEYKAKQTALENAVE
                     VACAAEETVKEKLRENSDLMVELEKVRDQAYEMDRRRQEDGAAMEGELLVVLMELKKL
                     KGINDALLALLRDKECEVKELRYHNELWVDPTGDKKQVVTRHTKIFDGNWERIVRERP
                     EALFAAFVIDSGNACHVPGDNIKQVSFDHD"
     gap             310353..313287
                     /estimated_length=2935
     gap             313396..315782
                     /estimated_length=2387
     gene            complement(<315785..>316738)
                     /locus_tag="LDBPK_340720"
                     /db_xref="GeneID:13392646"
     mRNA            complement(<315785..>316738)
                     /locus_tag="LDBPK_340720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864189.1"
                     /db_xref="GeneID:13392646"
     CDS             complement(<315785..316738)
                     /locus_tag="LDBPK_340720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864237.1"
                     /db_xref="GeneID:13392646"
                     /db_xref="UniProtKB/TrEMBL:E9BQM6"
                     /translation="MSFLSNINPAFPQLQAGQVVAYDYLHAAKTWQWTLGTVREIKDY
                     TAVVQQWGLHTGDIDTLRSILLKEVDTENGRMKNYHDMLAIAREKLASIRRSNEDRVS
                     HVRGHFDKAREKVELIDEVDLRKVTAQAAPSPVAVAVLKGVWAVAKCDPTAVEFYEWA
                     DVQLEYRKPAALDEIAKTDVLAKLYPSAESLQQSLEQDPKLNYKAAARDSPVVASLHA
                     WVITALAYQQAYNLLAHDKRIQEQNDAIAAAIAGMKACRAKIAKLKDELSSKDTAALP
                     GQVTSFTRTSVLVTIPLSAVISPVNVDTDVKRCVLTKDEVEQ"
     gap             316912..317010
                     /estimated_length=99
     gene            <320599..>321447
                     /locus_tag="LDBPK_340730"
                     /db_xref="GeneID:13392647"
     mRNA            <320599..>321447
                     /locus_tag="LDBPK_340730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864190.1"
                     /db_xref="GeneID:13392647"
     CDS             320599..321447
                     /locus_tag="LDBPK_340730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864238.1"
                     /db_xref="GeneID:13392647"
                     /db_xref="InterPro:IPR019351"
                     /db_xref="UniProtKB/TrEMBL:E9BQM7"
                     /translation="MHEYPLNDAALEAFLRQLPQHFFYLHCFHHFHISVLCSSQSAFV
                     LASRGLSCGAWKTWSVSFFPHSFLSFALRMKRVIKNGTPGPRQAYMNKRKYDPNRYKQ
                     EKDRVSRQTEFVMASLCCRRCCEIIQWKVDYGKYASQEQSRRCNLCRDNKVIHAYHRI
                     CQQCAEREAVCAKCQKHPAASATNTEADVPSADSDQESPEGRVEYLEKLREPSKYAFV
                     DVAPDEEELQRLTGLNTRVLQQRLRKRREAENRESLGSLRERERRTVLRKATTQTDAS
                     DSDENL"
     gene            <321804..>322286
                     /locus_tag="LDBPK_340740"
                     /db_xref="GeneID:13392648"
     mRNA            <321804..>322286
                     /locus_tag="LDBPK_340740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864191.1"
                     /db_xref="GeneID:13392648"
     CDS             321804..322286
                     /locus_tag="LDBPK_340740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864239.1"
                     /db_xref="GeneID:13392648"
                     /db_xref="InterPro:IPR019184"
                     /db_xref="UniProtKB/TrEMBL:E9BQM8"
                     /translation="MPTSGSTTGGASFPFHLQLLTSIGCAAIWWIVTLGLLIFKALYL
                     PFPPAALPMEVVASFLVLLVNAFGVFIGMRGNKMESTSAIVISAVLLSIAAVGAIYYM
                     WLQTYVLMMDLAFSATYLGINGVAILLGFWATQSVARLAQVPVFKLEVESGRSEKKKN
                     "
     gene            <322824..>325130
                     /locus_tag="LDBPK_340750"
                     /db_xref="GeneID:13392649"
     mRNA            <322824..>325130
                     /locus_tag="LDBPK_340750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864192.1"
                     /db_xref="GeneID:13392649"
     CDS             322824..325130
                     /locus_tag="LDBPK_340750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864240.1"
                     /db_xref="GeneID:13392649"
                     /db_xref="UniProtKB/TrEMBL:E9BQM9"
                     /translation="MGSVLQTFEDGLELTSILPAIKYPLGTHTISKLSAHLEASAGEV
                     SAKELRQLASNISLSPENLEYYDAALSTPGVVAAIRCCLQLADNSELVAFARPFWRGC
                     ERALQVSRGLSSQVTQIAADELAFRLSTSNNKEIFFDLTLMESLPLEQKEMEGLVKQL
                     QSATEELKEADLVGLLERIAAPRNSQRYAAWGAAVQKALIEKGGVSDSNCFDVFVRLM
                     LTGTIIEDSICRQICQASGHLGSERIVELLNARRDSDSASCSSSSSLQDVEAALQRCI
                     RMRLEQSQPKTPTEEYLEWVLCLSFFSREEASFLLSRAVASGRLAGELSAKETAVVCN
                     IMISTGVFLISLLPAIRRSVERNELSQLTSVHALYILQRSGIKASPALLKKAIGRAGA
                     RLVTACAPKGNVDDDLSPRDRALLIAGLCFVEDEQQPVLLRRIVKSQELSLSAAMYFL
                     SHAGQTTSSNRWVRKVVLGRVLRSVSSCRAEDLCLVLSALSDLGVRDAVAFQRVLEEL
                     KRKTPRTQDVVVAAKAARNLRLTPLLEQSELIESLGHIANVSSDDILALLSCSTAKQR
                     ESFLLFPDVVAALNRISLADSTTSDLVLLFTFLPSQGSKRAEVVAELQAREPIERGAL
                     SADDVIAAFESVASSQDMESLGRVLIRAAQNCEESHLMRLLRCASRHSKVPKGFFRIA
                     GKPIISAANEKRLSLVNATAWLNFYVDNQIRDDSVGRSLLSLLSSSQLRSPSPFYQAY
                     CRGARFYGVSVKKSRAKKRLSDFSLLTP"
     gene            <325649..>327109
                     /locus_tag="LDBPK_340760"
                     /db_xref="GeneID:13392650"
     mRNA            <325649..>327109
                     /locus_tag="LDBPK_340760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864193.1"
                     /db_xref="GeneID:13392650"
     CDS             325649..327109
                     /locus_tag="LDBPK_340760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864241.1"
                     /db_xref="GeneID:13392650"
                     /db_xref="GOA:E9BQN0"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:E9BQN0"
                     /translation="MRPEAAAAELRRLLPLLSFTGRRTGAATHSVASLVVSTAYSATA
                     ARSVTNHSRDCPVLSKKLPLSLIGKESSFAARPCLSCVRERVHYVSSVSFCHYFEKKC
                     AEAQHHQNGASSNGVVGTAALPNLLLEAIERSYGSVNAFKDSVALHSTGAMSPGRLWI
                     VYTPPISGSEHGAVSLLNLPACRVPLVHGLWPLAVINMTEKRLCEQIACRSGKGGDAV
                     DADNAPAWCHAARTPKTLGALATTEEGNDRAGSVAQVRLSSIQSAIAEEALSAMNWKF
                     VEMQLTSALAYYSSKVRKQTQREHRKEREHVAAVRAMSQLKDSGAVIHATDWVTITSS
                     NSFVASPASEPSLSAAAAVTSSSSAKTENSALGEANTQTAAVAVPSAEATATNTASNS
                     AQPADNTAAGAAAAEPRIVQQADGTWEYHYNNGSVTKAYPDGTKVFQTESWTTTVFVN
                     GDTLFEYPNNTSILDRADGVRVTTYADGTKKEERLK"
     gene            <328747..>329379
                     /locus_tag="LDBPK_340770"
                     /db_xref="GeneID:13392651"
     mRNA            <328747..>329379
                     /locus_tag="LDBPK_340770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864194.1"
                     /db_xref="GeneID:13392651"
     CDS             328747..329379
                     /locus_tag="LDBPK_340770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864242.1"
                     /db_xref="GeneID:13392651"
                     /db_xref="GOA:E9BQN1"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:E9BQN1"
                     /translation="MRFALEYVEREASRSKRATALAALNYGYKKANDARQPGGCPVAL
                     ATIVDNTHASLLNLGDCGLVIVRQGKLLYRTEIQQHSFNCPYQLPEDPPSAGEQAKIE
                     VRAGDVFLCMSDGVLDNVELDRLLEHLGEVPATGCRNVAEAIGQEAFRNGQDRRYFSP
                     FARHAEEAGYRYTGGKLDDITALVAQVTADSEEGTANCPPLITMLLNLDK"
     gene            <330405..>331811
                     /locus_tag="LDBPK_340780"
                     /db_xref="GeneID:13392652"
     mRNA            <330405..>331811
                     /locus_tag="LDBPK_340780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864195.1"
                     /db_xref="GeneID:13392652"
     CDS             330405..331811
                     /locus_tag="LDBPK_340780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864243.1"
                     /db_xref="GeneID:13392652"
                     /db_xref="GOA:E9BQN2"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR027193"
                     /db_xref="UniProtKB/TrEMBL:E9BQN2"
                     /translation="MESKLSSALRICDKCRTYADLCRTFEAKVSPIVEQALQSPLVKA
                     PRDHTTPDECSPRVAELREALCTRLGVDKATPAEDDVWFLIYRTVSNFAERQQRKRSR
                     DQDGTPLSTLVTNCFVLLCTRTLPQLDHMKLRWGFLKNERAKLESSDAYTHSNASERR
                     KLQLNATSVLSVFSERAHKHFFTFVWMLCVEKAGEAALHVHLLHRLGSVVLPHLTNPL
                     VLADYLTGCFSSGGIISILSLQGLFLLMLDHGLEYPNYYEQLYSLLTPDVFASRHRYE
                     LFRLLDLSMTSLRVPSYIAASVIKRVAQVSLMAPAPTLYFSLPFLRKVLQYHPNCLAL
                     IHRSSREAVIPDDMADQDADTFTAQSAKAQAMRDTAALFDGRDPFDDRAKLLETHALS
                     STLWELTALERHFMPVVPLMVSAFSSTAEDKTPLRYEKSYGRLFTAEVTRAIDSHNLP
                     TIAYEAPSEADPTDLLSF"
     gene            <332970..>334379
                     /locus_tag="LDBPK_340790"
                     /db_xref="GeneID:13392653"
     mRNA            <332970..>334379
                     /locus_tag="LDBPK_340790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864196.1"
                     /db_xref="GeneID:13392653"
     CDS             332970..334379
                     /locus_tag="LDBPK_340790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864244.1"
                     /db_xref="GeneID:13392653"
                     /db_xref="UniProtKB/TrEMBL:E9BQN3"
                     /translation="MQPPAWIEQLRQDAKTTEKSISYDIKVYDELSWRRKRFTFDKEL
                     WDPMRMSSILRNRLCLGNEDTEYTVIGEAFAFPDREDSPIVNEPQRACTLLWDHNSPT
                     EKVMIQLSEHFPPLLWHTVKPTLGALKKVFSEFLDVDAEHMKKYLPYYEEVQNRIETQ
                     MDEKLIGTLSPSHMKNKFIEDMRKRDPRSVELDYPNEHSIFLGLTPHFRVTEDQLMKK
                     NPFVFGWPMLLSDGNEYLEDTPLRMAAFRTVYSKSLLMFHTRLDLQVDHRQSHLPGDD
                     VDDILLEMPIFCSINYPTNTRLCGGRPLVQRFNQVMGTSYPLGMPVDVLATFARENTV
                     KGERELLEELKFLTAASQKAPELERVFRVSEDQLSSNKIIGQLAYTIVYLALVNYPKF
                     AEDIFKVYWKHPSDLVRVACAKGAHIAERQDLVEQLIQAEPEGRCKTMLTATMHLTTD
                     THPAKAAHSERKRIERNLQ"
     gene            <336536..>337945
                     /locus_tag="LDBPK_340800"
                     /db_xref="GeneID:13392654"
     mRNA            <336536..>337945
                     /locus_tag="LDBPK_340800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864197.1"
                     /db_xref="GeneID:13392654"
     CDS             336536..337945
                     /locus_tag="LDBPK_340800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864245.1"
                     /db_xref="GeneID:13392654"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BQN4"
                     /translation="MSQLGRPHTPYDWGTGVRVRVQRACQAPYFSVFREENTRQADTV
                     YEGRLGRAGAGAYPAIQDDGLRLLYFPYRNAAPVHCITAEAADVAAETVTLVGATGTM
                     GKFVAEQYLRRGVSVTVLARDIAKAKSLFLPIADGQREQNRLASMGYRQLSGTAEKRE
                     LTASLHYRDSRREDRHVLRYEFRNSRSVGGPSAGSANASCDQRFALELVEGDVGSTQD
                     LEFSMRHASVVFYLAAALEEASGPALRADDRLSSSAAWWSPGSWFGSGRRFGGFLHAL
                     DACRRVDAHFVALTPLWVHGSCLSPLYWYRRLLTYPRGYCKAVQLQEQTLLSQSGSPG
                     ARCSLGADELEERQPGGDWGCWWRSRFSDLPDDILIKSRSPVRFSLFRLSDVVFPSFN
                     ERIVASKNNRVDDGLHVKSIQQGDLDARLLANVLVKSIGLCNSVVESRIDIGGRLRGG
                     VDMRDANAIFDLFEQLRNE"
     gene            <338902..>339540
                     /locus_tag="LDBPK_340810"
                     /db_xref="GeneID:13392655"
     mRNA            <338902..>339540
                     /locus_tag="LDBPK_340810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864198.1"
                     /db_xref="GeneID:13392655"
     CDS             338902..339540
                     /locus_tag="LDBPK_340810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864246.1"
                     /db_xref="GeneID:13392655"
                     /db_xref="UniProtKB/TrEMBL:E9BQN5"
                     /translation="MSFLASRRRNRYDDEASNAAYMDNEPFHVLPPERSATGNSSQSD
                     SSTYGSHRTAGDGSGKCDMLSMQHVMNMTESLQKEQEDREAREKVDKASEAERMRQVR
                     NAQWEAVKKRMSQRAIPLHTVRAYDSEDDEEEVELKSVHTALSALVPSLTEERATRCG
                     GFQAAETMPERFCHFVYNWLMYFVYAFSASALPGMDASKGADSREYFDRRVR"
     gap             343856..345054
                     /estimated_length=1199
     gap             348583..348681
                     /estimated_length=99
     gene            <348855..>349589
                     /locus_tag="LDBPK_340830"
                     /db_xref="GeneID:13392656"
     mRNA            <348855..>349589
                     /locus_tag="LDBPK_340830"
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /transcript_id="XM_003864199.1"
                     /db_xref="GeneID:13392656"
     CDS             348855..349589
                     /locus_tag="LDBPK_340830"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /protein_id="XP_003864247.1"
                     /db_xref="GeneID:13392656"
                     /db_xref="GOA:E9BQN6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BQN6"
                     /translation="MASSTSPSSSTVPQTLIEKLLTVRGASAQRQVLIKEEDIRVVLE
                     TVREIFITQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYSNYLFLGDYVDRGK
                     QSVETIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVF
                     NTMPVCCVISEKIICMHGGLSPDLTDLTAINEILRPCDVPDRGILCDLLWADPENERR
                     DDRPAVLLQDCVPRELLSSARQPRVR"
     gap             350766..350864
                     /estimated_length=99
     gene            <353914..>354366
                     /locus_tag="LDBPK_340840"
                     /db_xref="GeneID:13392657"
     mRNA            <353914..>354366
                     /locus_tag="LDBPK_340840"
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /transcript_id="XM_003864200.1"
                     /db_xref="GeneID:13392657"
     CDS             353914..>354366
                     /locus_tag="LDBPK_340840"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /protein_id="XP_003864248.1"
                     /db_xref="GeneID:13392657"
                     /db_xref="GOA:E9BQN7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BQN7"
                     /translation="MSESVFPLVQSIVEKMLTGGDNRFQRQILIKEEEIRAVLRAVRE
                     VFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIYEKCGFPPYSNYLFLGDYVDRGKHSVE
                     TIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKA"
     gap             354367..354465
                     /estimated_length=99
     gap             355239..355337
                     /estimated_length=99
     gene            <358945..>359430
                     /locus_tag="LDBPK_340850"
                     /db_xref="GeneID:13392658"
     mRNA            <358945..>359430
                     /locus_tag="LDBPK_340850"
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /transcript_id="XM_003864201.1"
                     /db_xref="GeneID:13392658"
     CDS             358945..>359430
                     /locus_tag="LDBPK_340850"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /protein_id="XP_003864249.1"
                     /db_xref="GeneID:13392658"
                     /db_xref="GOA:E9BQN8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BQN8"
                     /translation="MSNAAILPMVQTLIEKMLTVKGNRMQRQILIKEEEIRAVLTEVR
                     EIFMSQPMLLEIRPPVRVCGDTHGQYYDLLRIFEKCGFPPYSNYLFLGDYVDRGKHSV
                     ETIVLQFCYKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTM
                     PV"
     gap             359433..359531
                     /estimated_length=99
     gap             360096..360194
                     /estimated_length=99
     gap             361713..362395
                     /estimated_length=683
     gap             363442..363743
                     /estimated_length=302
     gene            <366648..>367025
                     /locus_tag="LDBPK_340860"
                     /db_xref="GeneID:13392659"
     mRNA            <366648..>367025
                     /locus_tag="LDBPK_340860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864202.1"
                     /db_xref="GeneID:13392659"
     CDS             366648..367025
                     /locus_tag="LDBPK_340860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864250.1"
                     /db_xref="GeneID:13392659"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="UniProtKB/TrEMBL:E9BQN9"
                     /translation="MPAQPTASSGNTAREKRCGSHKKNDLSIECSLRLPLPDTASANV
                     LWRVLKADPSLAGTVKEVYWWSEDPSQRTVAVTIQASSKRDLRSAVGSLLDQAKLVVR
                     TLRVYPPNTAAATTVADAGLSTV"
     gap             367823..367921
                     /estimated_length=99
     gene            <368216..>368935
                     /locus_tag="LDBPK_340870"
                     /db_xref="GeneID:13392660"
     mRNA            <368216..>368935
                     /locus_tag="LDBPK_340870"
                     /product="elongation factor 1-beta"
                     /transcript_id="XM_003864203.1"
                     /db_xref="GeneID:13392660"
     CDS             368216..368935
                     /locus_tag="LDBPK_340870"
                     /codon_start=1
                     /product="elongation factor 1-beta"
                     /protein_id="XP_003864251.1"
                     /db_xref="GeneID:13392660"
                     /db_xref="GOA:E9BQP0"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:E9BQP0"
                     /translation="MSLKDVSKKAAELESKLGGKLFLGGAKPTAEDVKVFNDLLGANH
                     VNLYRWAKNMATYTEGERKAWGGPVRVAAPELRMPAPAAAKAVRSDAAAEKRAAPKAA
                     AVAPPSAAAAEEDDDDIDLFGETTEEEKAALEAKKAKDAEKKKAKKDVIAKSSILFDI
                     KAWDDTIDLEALAQKLHAIQRDGLIWGDHKLVPVAFGVKKLQQLIVIEDDKVSGDDLE
                     EMIMGFEEEVQSMDIVAWNKI"
     gap             369091..370469
                     /estimated_length=1379
     gene            <372806..>373039
                     /locus_tag="LDBPK_340880"
                     /db_xref="GeneID:13392661"
     mRNA            <372806..>373039
                     /locus_tag="LDBPK_340880"
                     /product="25 Kd elongation factor 1-beta, putative"
                     /transcript_id="XM_003864204.1"
                     /db_xref="GeneID:13392661"
     CDS             372806..373039
                     /locus_tag="LDBPK_340880"
                     /codon_start=1
                     /product="25 Kd elongation factor 1-beta, putative"
                     /protein_id="XP_003864252.1"
                     /db_xref="GeneID:13392661"
                     /db_xref="GOA:E9BQP1"
                     /db_xref="UniProtKB/TrEMBL:E9BQP1"
                     /translation="MPPANVRDIKQARAAVDELEKALAGHLFLGGAKPAKEDVDKFYE
                     MFGEHNIAFYRWVRNMASFTESERKSWGLPETP"
     gap             376216..376601
                     /estimated_length=386
     gene            <379966..>380856
                     /locus_tag="LDBPK_340900"
                     /db_xref="GeneID:13392662"
     mRNA            <379966..>380856
                     /locus_tag="LDBPK_340900"
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /transcript_id="XM_003864205.1"
                     /db_xref="GeneID:13392662"
     CDS             379966..380856
                     /locus_tag="LDBPK_340900"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase PP1,
                     putative"
                     /protein_id="XP_003864253.1"
                     /db_xref="GeneID:13392662"
                     /db_xref="GOA:E9BQP2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BQP2"
                     /translation="MTPEDASIYTLVTSILAEWRSGVTLLKEDIIRLILRRVRPILMS
                     QPMLVRTEAPINVCGDIHGQITDLVEIFKAGGLPPHSRYLFLGDYVDRGKYGTEVITV
                     LLGLKVLYPKRIYVLRGNHETDSICRIYGFFDEVKRRFNVRLFKEFTDVFNCLPVAAL
                     IEEIALCMHGGLSPELRHLRQIEQIYRPLLVPDEGLACDLLWSDPEEGSSGWQPSERG
                     VSFTFGEDVVKRMCDSLGIDIVLRAHQVVDEGYSFFAGRRLVTIFSASNYCGEFTNSG
                     AMMLMDENCMCSFQIFKPEY"
     gene            <382483..>382767
                     /locus_tag="LDBPK_340910"
                     /db_xref="GeneID:13392663"
     mRNA            <382483..>382767
                     /locus_tag="LDBPK_340910"
                     /product="60S ribosomal protein L13a, putative"
                     /transcript_id="XM_003864206.1"
                     /db_xref="GeneID:13392663"
     CDS             382483..>382767
                     /locus_tag="LDBPK_340910"
                     /codon_start=1
                     /product="60S ribosomal protein L13a, putative"
                     /protein_id="XP_003864254.1"
                     /db_xref="GeneID:13392663"
                     /db_xref="GOA:E9BQP3"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:E9BQP3"
                     /translation="MAFPSRKDASRAQRKSAKKHRPEIIVIDLKDHVLGRAAAVVAKQ
                     LLLGKKITVVRCEQLNIAGTEIRNKIKYLQYLRKRKLTNPTKGPFHHRAPS"
     gap             382769..382830
                     /estimated_length=62
     gene            <384066..>385748
                     /locus_tag="LDBPK_340920"
                     /db_xref="GeneID:13392664"
     mRNA            <384066..>385748
                     /locus_tag="LDBPK_340920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864207.1"
                     /db_xref="GeneID:13392664"
     CDS             384066..385748
                     /locus_tag="LDBPK_340920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864255.1"
                     /db_xref="GeneID:13392664"
                     /db_xref="UniProtKB/TrEMBL:E9BQP4"
                     /translation="MHRIIIIFHGSAVQLHRMPKEPQPSRPYAAPLSVPYAKPSGSLV
                     PTASSPTAATAVARAAAANTAGGGAAPAAGGHRPARLTINNFSSFRARVKKLPPDANV
                     KAALHTQLFQFPERVCFGCVKCRRDNVESDSVAIDLKNRIMLCAACFTRIIRPRTYTP
                     SRVVPFPSLLSWLNYKPSHVMEMPNDVLERPAEAVAPSGERMAAPMLAGGDRATNLGK
                     LPAIAMSIAAGGRSRGGDAVGGRRGGPTIDEALAQGSAGTPVGTHPCLRVWGVCQHGE
                     TCLFRNAPADLCVAYLMGLCRGRSSPIGGAPVGGGGGGRPSGNRNNNRHGHGGQHQQH
                     HKHHHHSQGGRNARRDRGTITAGGVQTCRLLHQEVYDLPDVSDPPPRERFEGDLEDKD
                     GAWAAWVRRRRDSPNSAEWQLWHNGPLEQLFRAYVPARRRPVPRQPRKKLKVAPAAEA
                     SAAVAELVEEGERNVEDEEGAQTAEDELTTPLADEGGAMGDEEDGEEEDEGNADANDD
                     TVSEEAVGREAEDEPAPAPVPAPATKLNLMDIMSALKGIRKDPQEKADDEEE"
     gene            <387094..>389886
                     /locus_tag="LDBPK_340930"
                     /db_xref="GeneID:13392665"
     mRNA            <387094..>389886
                     /locus_tag="LDBPK_340930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864208.1"
                     /db_xref="GeneID:13392665"
     CDS             387094..389886
                     /locus_tag="LDBPK_340930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864256.1"
                     /db_xref="GeneID:13392665"
                     /db_xref="UniProtKB/TrEMBL:E9BQP5"
                     /translation="MPPLVRIADAESTSSRSSCAASYGAREDVDDGAKAVISGTVSPA
                     LARELSLLSSDDLIQRIHRFSRSNFVAAQRPLLYAHLKEFMKPQRLAYASTKTVQDHL
                     QVANAADMHETCIELYHAAREHMPAAALMLRTPCAPLTNGSVTGAGQPDARGHVGIST
                     ASGSGTNLAADAAVLVSAFVVDSAYATQRTSELTRLASYCVTQLLAPLHAEGHDAATG
                     DASPAAAKVLRSLAVRTPREVATELSLVRCLWRALCLAEYYKCAEATSTQAVKGCKEQ
                     ALADALAILDACRQVASVRREAAVAVLAAAANGQPSWHEHSSSSTTTPALSERQSSEL
                     LAEALNFVRYASLDDDGEFAFYQFCKEERILWSPQPLSWSVRRETSDAASSLSSAAGA
                     GGANLLAYSEDEVQVFYAALIDTCAAGRLVPEALLYFTEARRLLGCPPLADGEDIGAE
                     TVLLLGTEDGRGPRVSSVAAATTFKTSREAVDAVPRALPPATSAASAASSDLGMSAPL
                     SPPSHPVTVSSGVHGGKVGFSTATAGFALTELLLHRLLSMLQAAKENHHVVRLARALI
                     AAGAVSQIKAHMWTVLLISAGAVRAADVVLAVYSYALERLASPTGSDGSSGRGYTTAE
                     VCTLEYLLQTSLNALSKCQLPRYEQDYLQPARDTQVLHCTDEFYYSCLLQEAHNSMCP
                     AQRAAEVLARMEEAKVPMTTPIVSRLLKLYLRVEAPEFITVYRHAVDDLGLPLRSVWA
                     DQLLLWADRRRYFLSADDREYIVQQLLRSRRVSTVADLQPLLGGLRTHFALLYYDHTH
                     AAREQFLRDGSVPVEQPTVTDSRAHFLMTRPMSVQRGIMARAGTSWVCNGAGGEELVE
                     EETKRHGILPRMLGDAPRRTLHAGIAELSETPLLFPISDGTAGAGDSERLHDRALRVY
                     LADVLDGLQRSSNWVI"
     gap             390205..390303
                     /estimated_length=99
     gap             391231..391240
                     /estimated_length=10
     gene            <391766..>392245
                     /locus_tag="LDBPK_340940"
                     /db_xref="GeneID:13392666"
     mRNA            <391766..>392245
                     /locus_tag="LDBPK_340940"
                     /product="DNA-directed RNA polymerase subunit, putative"
                     /transcript_id="XM_003864209.1"
                     /db_xref="GeneID:13392666"
     CDS             391766..392245
                     /locus_tag="LDBPK_340940"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase subunit, putative"
                     /protein_id="XP_003864257.1"
                     /db_xref="GeneID:13392666"
                     /db_xref="GOA:E9BQP6"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="UniProtKB/TrEMBL:E9BQP6"
                     /translation="MSDHEDEDDLLSLNLGGDRDEGDSGSDIRHSGADEEDEEGGEQL
                     PEDVAANVILSGNAQAAKGARARGINERVTSAVMTKYERARVLGTRALQISMNAPVAV
                     ALEGETDPLTIAVKELRERRTPLIIRRVLPDNTYEDWSVSELLVDFDRPADERYTNI"
     gap             393208..393306
                     /estimated_length=99
     gene            <396977..>397846
                     /locus_tag="LDBPK_340950"
                     /db_xref="GeneID:13392667"
     mRNA            <396977..>397846
                     /locus_tag="LDBPK_340950"
                     /product="ubiquitin-conjugating enzyme e2, putative"
                     /transcript_id="XM_003864210.1"
                     /db_xref="GeneID:13392667"
     CDS             396977..397846
                     /locus_tag="LDBPK_340950"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme e2, putative"
                     /protein_id="XP_003864258.1"
                     /db_xref="GeneID:13392667"
                     /db_xref="GOA:E9BQP7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:E9BQP7"
                     /translation="MTAPTAQCLKRLQIELRKLNMEWELPFKVGADPQNMLRCYFVMD
                     GPADTPYEGGRYVGLIEIPSDYPFKPPSVQMCTPSGRLKTGMQICLSNSSYHPENWSP
                     MWGLRTILIALVSFFVSEEPTTGSMSATAEERRRYAANSRKYNVKRLHAVYKRVLPEA
                     FAADTAFIENGGTSPKDEGSSASDEDATEAEEAPAGAEPEVAAQESSTSHETVVAPAR
                     KTPGNGKAGAADSEAATGAAASKWSRHHHHHPHKKSITGAVAQRGGQLQWRRYASLIV
                     LIAIGLGLLRQLM"
     gene            <398717..>399220
                     /locus_tag="LDBPK_340960"
                     /db_xref="GeneID:13392668"
     mRNA            <398717..>399220
                     /locus_tag="LDBPK_340960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864211.1"
                     /db_xref="GeneID:13392668"
     CDS             398717..399220
                     /locus_tag="LDBPK_340960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864259.1"
                     /db_xref="GeneID:13392668"
                     /db_xref="UniProtKB/TrEMBL:E9BQP8"
                     /translation="MILLVPMQFAYTFGSSWEWIHPLSFLCSLPTSLTTKEESVIGKD
                     KKMMRRVCSNTVRRNGGSMAKLVESKAVVQPSLVESRRHLEPMSVWYLASWTCVWWYS
                     FFFWLPVLWADMIVPSFVYNKLPVIHFIQEKRAEQKLRRVLDETYTQWSTELEASHIT
                     DAIARTF"
     gene            <401177..>403252
                     /locus_tag="LDBPK_340970"
                     /db_xref="GeneID:13392669"
     mRNA            <401177..>403252
                     /locus_tag="LDBPK_340970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864212.1"
                     /db_xref="GeneID:13392669"
     CDS             401177..403252
                     /locus_tag="LDBPK_340970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864260.1"
                     /db_xref="GeneID:13392669"
                     /db_xref="UniProtKB/TrEMBL:E9BQP9"
                     /translation="MTSFNSLGGGAGGPAEAVTRLQEVLRDICATERRQEKTWLNVQP
                     CVLNAVKLLAATAQMYAERVRQLEGVLQHLQQYTTVLVQDREVKEERYRLDAAAHREE
                     ADELWKRLLRLEAQQQVPSLQIDQRASEAFKASCEAAVEARVAPLQQELQGLRHQLKA
                     LALSHPYSSLYNRHVRSSSVASNSSALTVRDDYYAGGDGVAASQRRHHSADSSSSTSS
                     LSSPASSTASSLGRHEQRHRRGRVATTSAPTFTPRALAPATAAASPSTQMMMREVRRL
                     RRQWQQFLQSVPAALAQGKGPCGAGLRRRDISGSPSRRLSRLTSKDGRRDLAGGLNDV
                     TRANGEGVGSINGNPPQPFRVPAHHPPSSPTDAMLPKYSSGPTRAHSGARAAEPSTAL
                     PASGRRVRWYWLGDAHSHFSTATRRAENDLAAAKPLSERPQPALSGASPALPWTECHA
                     FDGRTDCWYSLGTWATHRRHLREVERAVEEGASRNSGDVRLGWLKWTSSLVSWPDTST
                     MLVHRAGIYMVRVCLVRHCASASLCSGAGRAESVGRDCGSGGALALCMNGVAVAGLRE
                     VVTHALLYTHSAASPAEAAAPWWATRGRSRSTCASAGNYCSAVDGVAHSPACASPGGS
                     PSRRRFHGDIADATQRQRPCCEPAQLHTNTLTACLFLPAGAMLQVRCRGLHNTKTIHE
                     AFCELEYVV"
     gene            <404313..>404636
                     /locus_tag="LDBPK_340980"
                     /db_xref="GeneID:13392670"
     mRNA            <404313..>404636
                     /locus_tag="LDBPK_340980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864213.1"
                     /db_xref="GeneID:13392670"
     CDS             404313..404636
                     /locus_tag="LDBPK_340980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864261.1"
                     /db_xref="GeneID:13392670"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ0"
                     /translation="MGQSNGAALAKDTIASEQFLKYQEARHRIVHRAFVKCVVPSSKG
                     KDDGYDLTPEERMCVEEFAILYAGFAKKEFLHFSSLYEQYQRDQYEKMRLEVMQQQAR
                     KDIQH"
     gene            <406844..>409852
                     /locus_tag="LDBPK_340990"
                     /db_xref="GeneID:13392671"
     mRNA            <406844..>409852
                     /locus_tag="LDBPK_340990"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_003864214.1"
                     /db_xref="GeneID:13392671"
     CDS             406844..409852
                     /locus_tag="LDBPK_340990"
                     /codon_start=1
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_003864262.1"
                     /db_xref="GeneID:13392671"
                     /db_xref="GOA:E9BQQ1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ1"
                     /translation="MRAKIDDENSSVAVTLLPSAQVEPLASSQPPTRTGAVGTMVNTD
                     VIDARGNDAESSGGGSAPSSMATTTTINAVFYNPSAQLPTPPPLHRNSSSPAPMQHLQ
                     HEEPQRLRAVPYFPASCESDSNEEPLFQHPPPAKPRAPLRPAPQSGRLWGAVSATPSS
                     AGFVSGGTAPYASLLHTSSVPAVADTESSSTTAGHGLVVGCETSNHCLPASIKAHPPA
                     SATSPASIHGGYSDSVSDSTATTTVGNHSSGGRGLRRPPLMTGPNGAAVPLASPMLSG
                     PQGRWVRSSGDESSSGFATLAVPATPANLGDTVLVAEPPTPTKQRRTIHTGMGNTVSL
                     SCGGIGAAPRLSTSAAASTGTCASAAAATSAAAVAGGASPKPSLRIAAPFRGLGYNPA
                     ANSVSAPASRATTSSMSTAPPPPSFKCYRREGSRKRSADVLSQFSALDLDETPATPFA
                     QTGTSRFTSINHNGNGHNAFPSQPSPSTAVYRGAGGGSNAISTVSPLTIDYATPVALS
                     QQIGGSNAFSQVLLHPSQDVLDMSQAETECSNFLARRILKEYNEVRLLGSGSFGTVSL
                     FKEISSGEYVAVKMSPPLRTPEMERRYRRERSVMGMVRGLPHVVQLSAAWEEGRVPRM
                     YLQLEYCPGGSVASVANAKQSRNEPWSEAEVKVFLAHMSIALDALHRANIAHVDFKPD
                     NVLVDKDGAYKLSDFGCSVLLDERGRPRPETRNGYGSLARGQRAGWVGGVACANPNGG
                     PAVHTGAGVGAGGLGSSLDFNNWNEGNELSTMSIDEGDCRYLCADMLNEKQHFKAGDM
                     FSLGMSLFELMSGQPLPRNGDQFLALRRRVPVEVLRRRGYSADLVELVVALLRSDPPQ
                     RPTARQVLQYLRLSSEELQLLSSASAMKRWTESAESFLQLQEEERQQPPLGKDGVLAA
                     TVDALRCVSALMEASMWLFTTTQQDVHRLAAPANAGKGEDEEDERHRQQTQQPQPQPL
                     LQLPRGQQLEDLPMSPIQCDEACTPTALNY"
     gene            <412204..>414909
                     /locus_tag="LDBPK_341000"
                     /db_xref="GeneID:13392672"
     mRNA            <412204..>414909
                     /locus_tag="LDBPK_341000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864215.1"
                     /db_xref="GeneID:13392672"
     CDS             412204..414909
                     /locus_tag="LDBPK_341000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864263.1"
                     /db_xref="GeneID:13392672"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ2"
                     /translation="MLDSPPALYASQEPVSAGPQAEAAEIMGSTPARHEMPFYPVLIE
                     VAGSMDDAIVRDVTQRLRRYRNRYQPLLRCMFTLVATAVPEARLFGDDSAAALEAQPN
                     PTTAAAGQLFTAPKNAVSVNKIHPLVSRFYPHQLLCAQQKSRSDYTTGVEPAALPGAP
                     SGALQPCWMDDPATAALSGVTTAADCHDRAVRRVEDFMAYHFLPLAMTHNCSPPEAIS
                     TSAKAFVLRHYVNEASRTSSFLLADPFYASASVPADAVAGAAIIDPRAEQLEAYAADL
                     SRIGVTLSCIIFTHCYVDGASGLAELIESFPAARVVSGIPLGPAGTTEDVQLSPRLRL
                     RTVRVPAFSPECLLAEIYFCDMLKGLCTGVLWSTDAAPRCDLLQWSAFPRETGHVPTL
                     PPSSINSDSGDRDAALAHTHEMLKKYLFDAYFSPLCASVSEPSRPSGRAAKSARTEEA
                     LANQEEQMEEATLESEGLEQVVLLPTHGGYNNVTSQLDLYWAVYLGDLTRMKHSRAVI
                     DALATTAEAFASYNRRLPPLPHPPSFDTSRVVHLRQLLALLRPEQRATCLAQLPADMQ
                     HALRYSFDPSAAHSALGDASNASRRQFASFSSYVNLVDVRDANDYHALHLCGAVNVPM
                     SFPGVAYGARRAELWLQCVIVPFQPIVALCATEEQRAELSRRLSALSPESRVHVFTLA
                     DLSDALKFPPRHSTRGGQATATELPWREVSCDVPTSVSADVPLPRNLLWIQRDDALAN
                     LTSYEDLTAAEPTDTRVVLDVRTPYEFKNGSHQHSVHVGLAQLCAMVVEDVVEASRPL
                     SQWHCGSSPRLADAYVKIIHTAALTARLPVVWQEASLSDVVIYCAGGYRSLIASSLLQ
                     RAIEASATPAWRKLHISNVSGGAFQIMTQRPDLWQVKDRSVVCIS"
     gap             418097..418343
                     /estimated_length=247
     gene            <418436..>419071
                     /locus_tag="LDBPK_341010"
                     /db_xref="GeneID:13392673"
     mRNA            <418436..>419071
                     /locus_tag="LDBPK_341010"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864216.1"
                     /db_xref="GeneID:13392673"
     CDS             418436..419071
                     /locus_tag="LDBPK_341010"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864264.1"
                     /db_xref="GeneID:13392673"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ3"
                     /translation="MQYIASTVIYAVIQFIAFLLVLVGTPIDVFRGNDPPFFERHFCI
                     TLWGGKINCSDTTYLFTSDEIWDDCPGRRDRFRAAQALAVISIFLYGTAFVLGVLLLF
                     CCSIFRWVCLVLNIVGIFTLGTVWAAMVVTYYKDEGESCPNLNSDFIYGNGFYLFLVA
                     WCLDIINIAVLLLPCQERGSAASEKSELEEEHEPEAVRMQEPTQQEGEETK"
     gap             419347..419934
                     /estimated_length=588
     gap             420078..424179
                     /estimated_length=4102
     gap             424800..424898
                     /estimated_length=99
     gap             425202..425300
                     /estimated_length=99
     gene            <425622..>426134
                     /locus_tag="LDBPK_341020"
                     /db_xref="GeneID:13392674"
     mRNA            <425622..>426134
                     /locus_tag="LDBPK_341020"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864217.1"
                     /db_xref="GeneID:13392674"
     CDS             425622..426134
                     /locus_tag="LDBPK_341020"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864265.1"
                     /db_xref="GeneID:13392674"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ4"
                     /translation="MFRDDTEGMYGNTPCITLWGFQFDCYSVSYDNRSDHFWGGCHGR
                     RDRFRAAQAFAILSVVVYGTAFVLGLFAVCWCPFFRWVCLILNIVGILTLCIVWASMV
                     VTYYKDEGESCPRVGFFFAYGVGFALFLVAWCLDIINIFLLMIRCEDQKFGESGNPEP
                     STRHGEEEMK"
     gap             426393..426798
                     /estimated_length=406
     gap             428064..428162
                     /estimated_length=99
     gene            <430366..>430977
                     /locus_tag="LDBPK_341040"
                     /db_xref="GeneID:13392675"
     mRNA            <430366..>430977
                     /locus_tag="LDBPK_341040"
                     /product="amastin-like protein"
                     /transcript_id="XM_003864218.1"
                     /db_xref="GeneID:13392675"
     CDS             430366..430977
                     /locus_tag="LDBPK_341040"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003864266.1"
                     /db_xref="GeneID:13392675"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ5"
                     /translation="MSHSFCRVGIAIYCILQLIAFIFILAGTLIDQFRVQNVDVLSNS
                     PCLTIWGFKDKCISLKWSVLTKDLWKGCPQRLKRFNAAEALSIAAVLISALACLIGFV
                     MLCCCRCLRWLCLILNILATLCGCAVTALMIDAFYNNHEEGLQQYNNSCYALRQNGSV
                     IRPSAIVDGNPVATHYNYGAGFAIYIVGWGLCFINIFFLMLPC"
     gene            <437524..>438105
                     /locus_tag="LDBPK_341050"
                     /db_xref="GeneID:13392676"
     mRNA            <437524..>438105
                     /locus_tag="LDBPK_341050"
                     /product="amastin-like protein"
                     /transcript_id="XM_003864219.1"
                     /db_xref="GeneID:13392676"
     CDS             437524..438105
                     /locus_tag="LDBPK_341050"
                     /codon_start=1
                     /product="amastin-like protein"
                     /protein_id="XP_003864267.1"
                     /db_xref="GeneID:13392676"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ6"
                     /translation="MGCISGIIFGILQFVALLFIAVGTPLAMYMPLNDNALHIHNGYC
                     ISLWGIRDRCLILLYSVSPNDVWAECNGRVGRFKTAQVCAIAGAVILAASMLGSFLDA
                     CCCYCIKYVCVLLNLLAAALLAVSWGCMLDCYVHNQGSHIVGNVDVCTQMRNFTGVDN
                     AHPEGMQLGAGFALLIAAFVISFVNIFVMFIPC"
     gap             439104..439202
                     /estimated_length=99
     gap             440022..440120
                     /estimated_length=99
     gene            <448008..>452033
                     /locus_tag="LDBPK_341060"
                     /db_xref="GeneID:13392677"
     mRNA            <448008..>452033
                     /locus_tag="LDBPK_341060"
                     /product="p-glycoprotein"
                     /transcript_id="XM_003864220.1"
                     /db_xref="GeneID:13392677"
     CDS             448008..452033
                     /locus_tag="LDBPK_341060"
                     /codon_start=1
                     /product="p-glycoprotein"
                     /protein_id="XP_003864268.1"
                     /db_xref="GeneID:13392677"
                     /db_xref="GOA:E9BQQ7"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ7"
                     /translation="MPEGSETGASAKGGSVFEWEDRQGPFSPNQPIAEGLAERGDCGD
                     HNDYRCGSTSQMREVINMSHTYDVYVDEGKLEPVNRLAGQSESTHGGSSYSSHNPLFS
                     AKEEVKRAAVHESVSPIAIFRYADTADRVLMIVGTIFAVCSGAGTPLFSFIFGRIATD
                     LMSGVGSVELSAAKTSLIMVYVGIGMFVACGGHVLCWTVAASRQEGRIRLNFFRAVLR
                     QDIGWHDEHSPGELTARMTGDTRVIQNGINDKLSQGIMNGAMGIIGYIAGFVFSWELT
                     LVMVGMMPFIIVMAAIIGNIVSKMTESSRKHFAKAGSLATEVMENIRTVQVFGREDYE
                     LQRFAEAVLYAQDRGIRKEFAGNLSAAVIMALVYLSYTIAFFFGSYLVEWGRRDMADI
                     ISTFLAVLMGSFGLGFVAPSATAFTESRAAAYEIFKAIDRVPPVDIDAGGVPVTGFKQ
                     SIEFRNVRFSYPTRPDMILFRDLNLTIKCGQKVAFSGSSGCGKSSMIGLIQRFYDPVG
                     GAVLCDGVDMRELCLHDWRDQIGIVSQEPNLFAGTMMENVRVGKPNATEEEVIEACRQ
                     ANVHDTIMSLPDQYNTPVGAVGSQLSGGQKQRIAIARALVKRPPVLLLDEATSALDRK
                     SEMEVQRSLDQLMQRGGMTVIVIAHRLATIRNVDCIYYVKYDGAEGSKITESGTFDEL
                     MELGGEFAAMARIQGVSTGDARSGARGQDGGKANDFLNVILDEAALAQLDEEAPRTAR
                     QKVPIEELAKWEVNGVSVGFRRLMGMNKDKSWAVALGILGSAVGGAARPTSTILMGYM
                     LRVLGEYSVNKNVEQLRSGTNLYAPLFIVFAVANFLGWVLHGFYGYAGEHLTTKIRVL
                     LFRQIMRQDMNFFDIPGRDAGTLAGMLSGDCEAVHQLWGPSIGLKVQTVCIVASGIVV
                     SFIYQWKLALVALACMPLLIGCSLAERMMMNGYTKSKEGDTSDTIVTEALSSVRTVTS
                     FNMKADRVEAFEATLRVEVPRSVKKGIIAGSIYGATQFIYYSAYALCFWYGSKLIDRG
                     EAQFTDVMIASMSILFGAQNAGEAGAFATKLADAECSAKRVFSVIDRVPDVDIEQSGD
                     KDLGKGCDVDFRKVQFIYSARPKQVVLASVNLRFGDGMANGLMGQTGCGKSTIIQMLA
                     RFYDRRSGLICVNGKDLSSLDIAEWRRNISVVLQEPNLFSGTVRENIRYAREDATDEE
                     VEEAARLAHIHWEIMKWPDGYNTEVGYKGSALSGGQKQRVAIARGLLRRPKLLLLDEA
                     TSALDSVTEAKVQEGINVYQAKYGVTSVSIAHRLTTIRHCDQIILLDSGHIIEQGSHE
                     ELMALGGEYMMRYDLYTSASS"
     gene            <455681..>459799
                     /locus_tag="LDBPK_341070"
                     /db_xref="GeneID:13392678"
     mRNA            <455681..>459799
                     /locus_tag="LDBPK_341070"
                     /product="myosin IB heavy chain, putative"
                     /transcript_id="XM_003864221.1"
                     /db_xref="GeneID:13392678"
     CDS             455681..459799
                     /locus_tag="LDBPK_341070"
                     /codon_start=1
                     /product="myosin IB heavy chain, putative"
                     /protein_id="XP_003864269.1"
                     /db_xref="GeneID:13392678"
                     /db_xref="GOA:E9BQQ8"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ8"
                     /translation="MASDYKQRETVGVEDLVLLPQISEKAITDDLAVRHREDLIYTSI
                     GSVLLVVNPFKDIQGLYNDAHMQFYRHSGRLSGVRYALLEGQEPGDAALGGPHIFALA
                     EETYRSMVSEEENQCVIISGESGAGKTEASKHIMQYISAVSGNTKDMQRVKRIILESN
                     PLLEAFGNAKTLRNDNSSRFGKFLEIYFDIRGGPVGGHLSHFLLEKSRVSSQQAGECN
                     FHIFYQVCAGAAAELHGDGSGLQPSRVGKGGNRKGAAAAWDDDDNDGGGHAPIAWREV
                     FEEMRMHRGGSSSNIGQSQSFASSSPFSAYYPWKFLRPSLGSGQHAEEFTPRVGIDDL
                     RGWRETLIAMDAMGMAAQDQVSVIKVLCLVLHLGELDFVAPEEGGALAAGQNPCTVAN
                     PEELAFVAQQLGVDASALLKALTWRKLQMGATEVVFSPLDAQQCRSTRDAVAKVLYEG
                     VFEFIVSSVNTAFGDAPHALMLGVLDIYGFEIFAKNGFEQFCINYVNEKLQQIFIELT
                     LRVEQEDYVREHIPWEDIKYFDNQVVCDLIESDRPPGLFALMDDVCITMAKEEESVAD
                     RKLLDKLGMAYSSHPNFLRSERGFIVKHYAGDVEYSTDGFVGRNKDRLGADVVEVLSK
                     SQAHFLLEILTEVLADGLTSAVPSSTRTGGSRRACATAGFKIRQQAADLVRTLKQCTP
                     HYVRTIKSNDVKRANFFDEARVLHQVKYLGLLENVRVRRAGYSYRQYFDKFLKRFKYT
                     CPSTYPRPFRGTDKAACEAILAYLQDEQGVLPPDSFAIGTSKVFIRQPEHVLALEQSR
                     EAAFHALSVTIQRAWRRYTQCKQLLCLKAKLDRTYTRHRKTRRADSVFRAYEGIYVET
                     DTVLAVPSPAAGGGTSAVPRALSNRLTVALDAILQFDPIAVAWRSFWTPGEAGQPRKK
                     FFFNALTREMVWERPRELDPPRVVFSCAVDRVVNWATAKTAKEFIFLTTHDVLYMVRE
                     TPTSTEALPPSSQPPSSSAKHSKHAAAAVKEKQSVAMTLTPCFTLQKRIDLRLLTQVA
                     VTTMADTVLVVRVLPVQAPYRPVTDTVKTKAGPSKCETCSRAATPALRRANCPSCGRL
                     CCVRHCLTYARPLPTITGQAAPVRVCPACVVGEPLEPVEDMVLLTSYRTELAGTLCAR
                     YQERMGNPLPLFVSDSIPFSKWTPAPSPPKMKRTHRLAKPSAGRGGEAGEGQPLVIGG
                     SYEVTLTCTVTDDPLANDTVLIGAAPPAPMTAAASADGHSGAKGKRKGKEAFDDEVAY
                     TVPPGTPPVLRVVAPRGITGEQIRRMEAIREERRKAAAARRRREEEEEREREAQRERE
                     REAEHRRVVQERKKAKAAEAARMEAERANRERAAAERREEAARVVAERARRR"
     gene            <460514..>462364
                     /locus_tag="LDBPK_341080"
                     /db_xref="GeneID:13392679"
     mRNA            <460514..>462364
                     /locus_tag="LDBPK_341080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864222.1"
                     /db_xref="GeneID:13392679"
     CDS             460514..462364
                     /locus_tag="LDBPK_341080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864270.1"
                     /db_xref="GeneID:13392679"
                     /db_xref="UniProtKB/TrEMBL:E9BQQ9"
                     /translation="MASSSLSLSSAPCSSCVVGTLPDLLKRAMTQGRHGGITAYLATE
                     LPHNQQSSKDGCQVRTGNACASAESPVMYAVFEDARSCCRWTVELAMAKAIGDDDTGD
                     AWWANPEHLSAIDATAAAEALPSDPHQQEKSPATLCSSRITAMRYYMKPDTWTQTLLS
                     HEGEPARESRTAGEVPYSGSATTGGVTSSDPRGCNSDVHVHHQATPSLLSIASSVVTA
                     TATEEASSLSAASSPLHGLPLHQLIEQHSALVRRLVQVLAPQRQTIPHVIRELCTTRV
                     TSPSSGVVSRVCVLPSTDSSNAEPMQYTERDVAAAVEQLTSSHPRQPRLRELKSDGYL
                     LMNLEGFVDGKTRHKAVNRAYPALALHWPASAQQMDAMERYVDRDVVLDTRKRHPELS
                     GEGSDKKQGQKRDRSRSSTSSNASGAEEDGAHKARVTDCTSAPPSPPLGMTASPKRTA
                     QTSSSRRFFQSLREYPRSLEHGNLHAWARSTAAQQALDCLQAATTLTQSSASTADVSS
                     DAATLGPLPITKEEDVEVLRCQYDALAAAESVLEKQLRAYSDTVQELRGWYRGDLCTQ
                     QFRCELEAWLRTQEESRAVLTDLYAQMHAVRYSLQRDLSNYLHLHALGVL"
     gene            <463227..>464597
                     /locus_tag="LDBPK_341090"
                     /db_xref="GeneID:13392680"
     mRNA            <463227..>464597
                     /locus_tag="LDBPK_341090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864223.1"
                     /db_xref="GeneID:13392680"
     CDS             463227..464597
                     /locus_tag="LDBPK_341090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864271.1"
                     /db_xref="GeneID:13392680"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BQR0"
                     /translation="MSADQRVTECGGSNGASTALPPLTPHTIGGKSNEALCDDHQDVA
                     PPPYSMESAIGLSVPLYQPHAPAPGAVIDPDMVEDHVSFLRTVRAFHDYKRQALAARE
                     MRCTNFRKLQDQHRDLLCIDLDKILEKYLECIEVNSAFFDAICEASEELFDSYWPEGT
                     TVFMKEVPPPTPLDMNKVFSTLRQFVRDWSAEGVAERDCVYKPILDTLDRCFPNRGER
                     ENVRVLIPGAGLCRLSVELALRGFFAQANEFSYHMLIAGHYIQNHVFESCQHKIYPYS
                     DSTCNLVNRADQFAEVQIPDLCASEAIDALRDKGLSFGQLSMVAGDFTEVYAKPHQHK
                     TWSVVATCFFIDTAHNIIEYLVIIYNLLVPGGYWVNVGPLLYHFADSADDMSIELSLG
                     EVLTVAQRIGFVLNGPPSFIDTTYTNNQRSMKQLVYRCAFFVLQRPLADKQTEQMDRS
                     VEAKVT"
     gene            <468399..>469154
                     /locus_tag="LDBPK_341100"
                     /db_xref="GeneID:13392681"
     mRNA            <468399..>469154
                     /locus_tag="LDBPK_341100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864224.1"
                     /db_xref="GeneID:13392681"
     CDS             468399..469154
                     /locus_tag="LDBPK_341100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864272.1"
                     /db_xref="GeneID:13392681"
                     /db_xref="GOA:E9BQR1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BQR1"
                     /translation="MGNLKHRLSAFYPHLTSKEYKFLVEDPSGSTGGGGAASSAARSG
                     AAARHGGAADGCGGSTRGPTTSSLALAASSARPSNLSVDEGGDTAHIDGALPGEGVAS
                     GAGGSHTAGARAGLDVDQLWDLINSFQQLQRTFGAAQAGQAEGQNAQNTRSAFNASFD
                     AYLVSAHGNQGIRSADIGFDAVGEAFRIYDPHNTHYVEEEVLSCIMARVGFGELTEEE
                     LAVLVSTADFDGDGRISLEDFRRLVSMKGRFKK"
     gene            <470576..>471304
                     /locus_tag="LDBPK_341110"
                     /db_xref="GeneID:13392682"
     mRNA            <470576..>471304
                     /locus_tag="LDBPK_341110"
                     /product="uracil phosphoribosyltransferase, putative"
                     /transcript_id="XM_003864225.1"
                     /db_xref="GeneID:13392682"
     CDS             470576..471304
                     /locus_tag="LDBPK_341110"
                     /codon_start=1
                     /product="uracil phosphoribosyltransferase, putative"
                     /protein_id="XP_003864273.1"
                     /db_xref="GeneID:13392682"
                     /db_xref="GOA:E9BQR2"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:E9BQR2"
                     /translation="MSQQEGTSPTDRESTMQILNMFPGHLHLLPQTPQLHFLFTVIRD
                     VETQRTDFIFYSERIIRLILEAALCLIPVKPFNVITPVGAVYRGVRPDDRGIIGVSIM
                     RAGESMERVLREMCPGVRIGKILVQRDETSTDKTPDARFTYSKLPTDVASRRVLLLDP
                     MCATGGSVIKATEILINEYGVLEENIIFLNLISAPAGIRKYLARFPKIQIVTAAIDDD
                     LDENRYILPGLGDFGDRYFGTISE"
     gene            <473630..>475732
                     /locus_tag="LDBPK_341120"
                     /db_xref="GeneID:13392683"
     mRNA            <473630..>475732
                     /locus_tag="LDBPK_341120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864226.1"
                     /db_xref="GeneID:13392683"
     CDS             473630..475732
                     /locus_tag="LDBPK_341120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864274.1"
                     /db_xref="GeneID:13392683"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BQR3"
                     /translation="MSSSSAHSTAPASGTDGAESKKPMTDQNSGDLYPFLQELQEDFP
                     VNGGELPIGELLMLLSAKKPDVFARLDGFFETARQVSGLDETMALKWKEKGNAEYKRR
                     LHQQAALSYTNGLLCAETPETLAVLLNNRSTVFFDEHRYADACVDADRAVQYQPTYWK
                     ALQRRGRSLVELGFTELGQKDIEASKQESSDAANSPADMAKVFGEATSGISAACLPPR
                     AHVNGEVRIERSAKGRGLVAASRLTEGPVLEEAPYAIVARTEALLSVCSYCLQHSACL
                     YHGDEYRQHHLKSRGFFCSPACAKAAWEHYGQHESHHPFFLCCPNDALLAYRMILGMR
                     AYPDLAELSASPELDPVTENDFGANHIRTLEGSFSRELQSNAAVGGCESIVATIGFYV
                     GALTEPEAEQLRKAQRQILLNAVDVTCMMRTTAAPSEANSSTLLQTNTVVARLGKAVY
                     AIGALFNHACDPNCYVSFEGNPQGSCARLIVRAIRPVMEGEELTVSYGGISCFSFHSM
                     RHRLQTLRDRYGFFCGCRSCRNQVDEPVPTAEKDKYIQASDYYQKGRRLVRERNYATA
                     VTVLLQSYEIVMRYICPPPHPPQWMLIKTHDALAQAYFHLEQRDKCVEHLQEALRLNI
                     EIHKNDNRAELINEHTRLAFLAVSPAEKKVHADKAVELLRRFYAPSSMLDLQIAYVES
                     SLKAEPDTPEAVATATKT"
     gene            <479904..>481775
                     /locus_tag="LDBPK_341130"
                     /db_xref="GeneID:13392684"
     mRNA            <479904..>481775
                     /locus_tag="LDBPK_341130"
                     /product="mitochondrial ATP-dependent zinc
                     metallopeptidase, putative"
                     /transcript_id="XM_003864227.1"
                     /db_xref="GeneID:13392684"
     CDS             479904..481775
                     /locus_tag="LDBPK_341130"
                     /codon_start=1
                     /product="mitochondrial ATP-dependent zinc
                     metallopeptidase, putative"
                     /protein_id="XP_003864275.1"
                     /db_xref="GeneID:13392684"
                     /db_xref="GOA:E9BQR4"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQR4"
                     /translation="MLPQRSPTDAVQRAYTMSPQERVLIAQIAARARLQRTWRHLGIL
                     SVLLSALIGYRWYTAQARLDADVSNYKAVVVDVPGHTAVYVDDNGKLIGVRNFIDFAT
                     FEKTCDPEKDVLIQFSTYYPWIPMLLLCLLPVLAVVNAGFNGSARMITMAAQAEKSRF
                     TFKREMSVSTRLKDVAGLTEAKHEVVEVIDFLKHPGRYQTLGAKLPKGVLLDGPPGVG
                     KTLLAKAVAGEAMVPFVSCSGSEFEEVYVGVGAQRVRELFREAHNCKPCVVFIDEIDA
                     FGRKRRSDGNGSSRGTLNAFLAALDGFKDASGIMVLAATNRADILDNALTRSGRFDRK
                     ISLEKPSYKDRVAIALVHLQPLHLDPSSSLQNYAEMVAALTPGCSGADIFNVCNEAAI
                     QAAREDKEYVGAPHFHLAVERVLVGLEKSAVKYTPHEKERLAYHEAGIVVLNWFQSDT
                     DPVIKSTILPRGRHRTGVTQKLPQNIYISTQERLLQRIVGRLGGYVSEEHFFSDVSTS
                     AAEDLQMATSMARDMVCVYGMDPVHIGHMGFELDRDDTLQKPFGPEKENAVDIAVETI
                     VQSCLKRARALMLEHLNHTRIIAGLLLKQETLNAHEMWFALGDRPVMTKEFRTYLES"
     gene            complement(482133..482206)
                     /locus_tag="LDBPK_34tRNA1"
                     /db_xref="GeneID:13392685"
     tRNA            complement(482133..482206)
                     /locus_tag="LDBPK_34tRNA1"
                     /product="tRNA-Val"
                     /db_xref="GeneID:13392685"
     gene            482431..482504
                     /locus_tag="LDBPK_34tRNA2"
                     /db_xref="GeneID:13387465"
     tRNA            482431..482504
                     /locus_tag="LDBPK_34tRNA2"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:13387465"
     gene            482561..482633
                     /locus_tag="LDBPK_34tRNA3"
                     /db_xref="GeneID:13387466"
     tRNA            482561..482633
                     /locus_tag="LDBPK_34tRNA3"
                     /product="tRNA-Met"
                     /db_xref="GeneID:13387466"
     gene            complement(482667..482746)
                     /locus_tag="LDBPK_34tRNA4"
                     /db_xref="GeneID:13387467"
     tRNA            complement(482667..482746)
                     /locus_tag="LDBPK_34tRNA4"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:13387467"
     gene            482821..482901
                     /locus_tag="LDBPK_34tRNA5"
                     /db_xref="GeneID:13387468"
     tRNA            482821..482901
                     /locus_tag="LDBPK_34tRNA5"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:13387468"
     gene            complement(<483843..>486920)
                     /locus_tag="LDBPK_341140"
                     /db_xref="GeneID:13387469"
     mRNA            complement(<483843..>486920)
                     /locus_tag="LDBPK_341140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864228.1"
                     /db_xref="GeneID:13387469"
     CDS             complement(483843..486920)
                     /locus_tag="LDBPK_341140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864276.1"
                     /db_xref="GeneID:13387469"
                     /db_xref="GOA:E9BQR5"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BQR5"
                     /translation="MKYGQSRASGSAPPSSNAANSSDRTKLMQVLRVVAQHSRVFATA
                     QCVYVRRRVTAIGKLIHITVRSLYFPDEFSFYLDTVVRFLFSVYYIPFLAMVVALTHA
                     AIERIVWVLVIPVTQEMERRPFSTSRVSTLVYGLGSIASRMTPFATLAVAVATVGHKV
                     MNCVAEAMVDAYTTQRDMDYPLLRARLRFTVKKKSRLVICGVVSANLAVVLALLCHTN
                     AFVEWSGREPWVTAAVWTVLVIQICFVLTTVLREAPLENTTLNCSGVFRLIDRRRCQV
                     QTQLRNDVEVRPGACPPPFPQPVENTFSSSSSSISVASPRLARCGGGGEATAVGGSGD
                     VSLLHSLSDAKPLAATQASVSATAENVCNLIDSSASQAFVTYVEDDWWRHHIHTMRYI
                     GFFMVIFFTIGFAVVRGPVFGLTSGVMILTCLNAPHLFGCMALSISAAVTCILRSYAW
                     LLRHPDALLPILMIATPYQLLLISAFLYFRQHPLLCLMLVWVNMLLAARAIDLAREFD
                     VTVNGSVLWKYADSGVPLPPALASVLEDVHEKQYYYPDVMSLDMLIDIRRMKILYAGG
                     AEVRLKRQVVIPPGALRRYLFEYHFYAYTLPRLLSLQSPGYFSGSKFRTMRVVLRFIS
                     VTLLLLYALLMSGLLVQAAFPQLRPLPVRVAAAADNSYLTFDHIVVRLHLLSQNASRR
                     AAEVNASNVALEGYLSGVPVAASSAFMWHNITSAENEDFYPQLCTRQYGETSVWELAL
                     LALAPYLFNVEEFNTMLRFLNVHMGSDWVIQPRHGASCVPGDSNHQPTGWSDFYEVYS
                     EKRDTSVIAVRGTDMFSFTDFLFNTNVFFEVVLYQLMTTMIPGTVVVPKDLIVDLLRT
                     ASLPADSYGDVYETWAELTRSGNHSLRRCQQNNFRRDFFADLYNHIAYVGSRPTHPRH
                     LLLTGHSLGGAVAAIVAAQMRVKAVAFSAPGIALARKKFNLPLRSINENIMTVVSSND
                     IVPAVGEHGGELHHVECLAATRELCHAMEFMIGSLWRSCSSVRSRFPSIKDVV"
     gap             488658..488756
                     /estimated_length=99
     gap             489719..489817
                     /estimated_length=99
     gap             491258..493262
                     /estimated_length=2005
     gene            complement(<493496..>494167)
                     /locus_tag="LDBPK_341150"
                     /db_xref="GeneID:13392686"
     mRNA            complement(<493496..>494167)
                     /locus_tag="LDBPK_341150"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864229.1"
                     /db_xref="GeneID:13392686"
     CDS             complement(493496..494167)
                     /locus_tag="LDBPK_341150"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864277.1"
                     /db_xref="GeneID:13392686"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQR6"
                     /translation="MACSIGMVLYVILQLIAFLLVLVGTPIDMFRGTIAEIAFSHFCL
                     TLWGAKWGCSNSSYFLTSDQLWANCTGRRNRFRAAQALAVISIFLYGAAFVLGVLLLF
                     CCSIFRWVCLVLNIVGIFTLGIVWAAMVLTFYTDEGVTCERLIIGTRYGAGFVLFLVA
                     WCLDIINIFLLMIRCDDQKLVSTANPGVYTTGGEEVKWRRRWASYFGSAGFSPQTPSW
                     RSRRS"
     gene            complement(<495306..>496310)
                     /locus_tag="LDBPK_341160"
                     /db_xref="GeneID:13392687"
     mRNA            complement(<495306..>496310)
                     /locus_tag="LDBPK_341160"
                     /product="tuzin-like protein"
                     /transcript_id="XM_003864230.1"
                     /db_xref="GeneID:13392687"
     CDS             complement(495306..496310)
                     /locus_tag="LDBPK_341160"
                     /codon_start=1
                     /product="tuzin-like protein"
                     /protein_id="XP_003864278.1"
                     /db_xref="GeneID:13392687"
                     /db_xref="UniProtKB/TrEMBL:E9BQR7"
                     /translation="MVVYLWAVAKTSRASPFHPHRLCVVRGGGTAGVAQRPQEAVRGQ
                     RGRGREAAFVTRQPHAPHRQRAAAGATPSRHWLVDVPRAADEQLPAPLHVAAGTAARA
                     TRATWRSSRSSYLAAAGGGADLTAGKGGSRAVCVCVGARAGRHWREGAVGARPARGDW
                     QAALRAGEGHEALLRPGQAQGHHELCSRHACGALRPHDEPTRPRAAAERGGGHAFRPA
                     IQNLPKAARWPQGEGALATAGGDLVRRTDEQASAYTQHAIDAASLNRFFDGMGARSSD
                     VDELLAAVHHGRVSAARCTNARLLEAVRCSLAKGVRLFRSTPFRPALVGQSRTYGVAA
                     "
     gene            complement(<499466..>503761)
                     /locus_tag="LDBPK_341170"
                     /db_xref="GeneID:13392688"
     mRNA            complement(<499466..>503761)
                     /locus_tag="LDBPK_341170"
                     /product="dihydroxyacetonephosphate acyltransferase"
                     /transcript_id="XM_003864231.1"
                     /db_xref="GeneID:13392688"
     CDS             complement(499466..503761)
                     /locus_tag="LDBPK_341170"
                     /codon_start=1
                     /product="dihydroxyacetonephosphate acyltransferase"
                     /protein_id="XP_003864279.1"
                     /db_xref="GeneID:13392688"
                     /db_xref="GOA:E9BQR8"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR022284"
                     /db_xref="UniProtKB/TrEMBL:E9BQR8"
                     /translation="MSFPPPRLALPEECKQVVLVAPIDGLTAACACAIATSPLVPLNC
                     RVLVDGITVKSSSPSSGNDSLHTARSSAETAATTRDFMSTVQRVEAKLRASRATRRDI
                     SVTHMTQFYYGGVSPKAEEIGPMLHRIHLLGSGALGETSFTASSTDVSSGSGGSCGVP
                     RVADSLFVLVLSAQSLSPDTESGLKAYDILLRRLWSAAGASQASETASQQTRVRGSLI
                     ILADDVYRTAACAMLSSIAKEVATAVDWVVLLTYSYAMDPPALEFGATEVAVQAASGI
                     SHGGTLPVLCAANALGVLRHFPVSRSEPATITPVDVALNAAFLGYIWLCHGELPECVE
                     CAAEMQYCGSSPASSHAAAAAEAATAMPAPPAQCVTRHRMGSFAVAESRKPGEASLVW
                     GMMGEYLMSYYGRFADQISAAFPVAGVLTPAPILQFPFSVADLVNFGPEPRAAAYALE
                     GWRAYQQRQRIMEEKVGNAEAAQALKAYVTQMDSVVSYIERTARVAAVRDKTSAAFAA
                     SRRRTASSSFSVPPYRLDDFNVALYHSLLRRLTSHHTLMPYHQCVALVEVDWEAYVSV
                     IARAVLEHLARCVLRSSSGLQHVGSRSHAPPVADSASVVSIVRDPPVVSAPAEPAPAS
                     AAVSSPTKPEAAASAAEAPFAFPEPRRYFTNDFVYRGAERIPPFPSLLHKYFDCFVFL
                     HRAGMTANGWRSDMTPGMTPQVLTSIIAQPNIQRLMTALAAKDGASKKDVEARAKSLL
                     LQCGDALNHVHCRALGLMIRAIFRSIYGRVDVNNGAYERLHRYFAMPRVAVVFVPLHR
                     SYIDFLILSEVLALMRLPLPHIVAGENFLSMGVLATLMRGSGALFMRRSFRDDPLYAA
                     LLKEYVRHLVRARRPLEFFIEGTRSRTGKTMAPKLGLLKFVCDTFYEPGQQELDDVLI
                     MPVSLSYDEVLEATTHAKELLGVPKPKENPTNMLKARSLLERMHGNINIHIGEPVSLR
                     SLKEHPQQCPLPLQPKGEQLRDLAAPAAATASVCKTIDTTPSIAKGSSITPIPLLATV
                     AWHLVYKLQRNTVITPASMVAAVVECLGPYYCTATTTLKEGIDTTAAAAIPLEKVHQG
                     VKWLRRRLRERGAQLSVEASELSPAGVVTQALTNLYRYIHITDEMSGVTYHPDSVVTR
                     IAVNISTNQLIHVCMDEALVAVVAQAFGSATTPHSPPSGADGAMLCGVRSVKADVLSS
                     QTQLLQRLLSAEFPNYAEAAPMSFASWLECTISQLQQCVEEHTVSSQLSGADTHGGTV
                     VHLPVTQYYYFLLQLICPHVEALYTVLVAASALLATYPGKPLGAAEVVTATQRACGIL
                     YAEHKLRYVVAANKETLQHYYESLIALSLLQIKRVPVTTAPGQSKVSRRVVAYTVGLL
                     GQEAALARLKVLSTQIKALWWHPSAAEGVTIDKAAIQERVLAVYRELTQPSKM"
     gene            complement(<507882..>509552)
                     /locus_tag="LDBPK_341180"
                     /db_xref="GeneID:13392689"
     mRNA            complement(<507882..>509552)
                     /locus_tag="LDBPK_341180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864232.1"
                     /db_xref="GeneID:13392689"
     CDS             complement(507882..509552)
                     /locus_tag="LDBPK_341180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864280.1"
                     /db_xref="GeneID:13392689"
                     /db_xref="UniProtKB/TrEMBL:E9BQR9"
                     /translation="MHSTPPPETDVNGLASARKRPRSPAVADSLGLPLRGLPRHTPPV
                     LLTNADAALSDATAAGWSTVQQRFAAAQWRRGCFYLSLQAPSEPPASSRPRRSAPTGA
                     PGEEEATAIGAAEAKAAVAARYIQPHPWKVLRSIHGGSALRTVFLPRVKGALVPPAAF
                     LPAFLAPPAMVQLETWNTYWEAYSTCCADELEGLSKQLEAPPSTAGYRRVLLTVSAPA
                     FPSLSTPPTIATSSATTASSAHNHLPVLKGGPPLSVFPSWGKDSKVAEPQMHSSLFSL
                     SSPSVLPSRPLPHSHEASVSSCSHSYSYTSHSRSSGDAVSAVKAAHADDCIAALSFLP
                     CVLDDLLYHYAHRFGAVEHLETRESSASAGAPSTATARVIVSVQFTTAEAAGVFLRWA
                     DGVSVADIIASYRRDTQASVTLSEGHLSPARSEKVVGALASDGATGLAMEETTKPQGE
                     LDCGDAAWWDALEEASRRQRLCLIAKPAPHDPRRITAKLLLGPNVMVSTPLVKSLFTG
                     LFDTTCMEYRAELRAFCIEFANKKECRLALHALQCSLWRVFGVSLIFT"
     gene            complement(<510743..>512350)
                     /locus_tag="LDBPK_341190"
                     /db_xref="GeneID:13392690"
     mRNA            complement(<510743..>512350)
                     /locus_tag="LDBPK_341190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864233.1"
                     /db_xref="GeneID:13392690"
     CDS             complement(510743..512350)
                     /locus_tag="LDBPK_341190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864281.1"
                     /db_xref="GeneID:13392690"
                     /db_xref="GOA:E9BQS0"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:E9BQS0"
                     /translation="MSARMQFPLSQRRHTNIAVVRYSKNGVKLEIACYKNKVISYRSG
                     TESRLDEVLQVERIFANVARGYLASEKEIQTVFGSEMTEAEAIKYMLDHGELQVAQQE
                     RTAEVDEMFKDIAVIISQKCINTKTQRPFPPQVVEQALRSIGAAVKLDQSVKKQALGL
                     IHLLIDSGILPIARANMKIRCTTTSEAALEKLRGWCRDNEADVVSDSVTGSTSGGGNG
                     NFGHALLLLMQPNLFRDLDHFVKEALPSGSTIHMVEAAVTEVGDSDVLFDVNAVSHAN
                     AQPGLAEEKATTAGSRRAAAAPSSSSAGGVSGGRSDGRGGGTGMSSNLGQGADNASSG
                     QHHSDGEGKRGRTSKAKGATRRGHRGRQRNDSDDDDLLDSGTDGAADGGLGVDHDIAV
                     GLQQLGLDPSHDLQDDSDDDGGRGRGGRGKRKKNASGTGGGPYQSQGAGGRKAGGGAA
                     AVEDDDNDGKGKKGRKNAKSKKVAAAKKAKPGAEGAFSDSDEELMGNRKQRAKKQQET
                     QMQQGGNDWHEEDFDYGEDEEAEEQLN"
     gene            complement(<513731..>514528)
                     /locus_tag="LDBPK_341200"
                     /db_xref="GeneID:13392691"
     mRNA            complement(<513731..>514528)
                     /locus_tag="LDBPK_341200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864234.1"
                     /db_xref="GeneID:13392691"
     CDS             complement(513731..514528)
                     /locus_tag="LDBPK_341200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864282.1"
                     /db_xref="GeneID:13392691"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR010441"
                     /db_xref="UniProtKB/TrEMBL:E9BQS1"
                     /translation="MASVPFTEEDLHELYTWVDEIPISRQKRNIARDFADGCSVAEIL
                     KFFFPKLVDLHNYVPAMSRAKKLDNWNTLNAKVLRKLYFEVPPEEVEDIVAAVPGAIE
                     RFLRALRVKVAQIKARREEMLMMGEIQAHENAHYVDPSPSQPQPREGGHARDGGASAA
                     TAHRESGRPSSPAAPAGRTASSRGSSSAGPQAPPRQTQPQRQPTPPSVNEVASLTQVL
                     REKDYTIQELRETVAILSEKIVKLEELVRVKDEKLNQYRQKFGRVPA"
     gene            complement(<515663..>523318)
                     /locus_tag="LDBPK_341210"
                     /db_xref="GeneID:13392692"
     mRNA            complement(<515663..>523318)
                     /locus_tag="LDBPK_341210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864235.1"
                     /db_xref="GeneID:13392692"
     CDS             complement(515663..523318)
                     /locus_tag="LDBPK_341210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864283.1"
                     /db_xref="GeneID:13392692"
                     /db_xref="UniProtKB/TrEMBL:E9BQS2"
                     /translation="MNLSPPRLPRLGGHKSAPTCNSSTAPSSNTHTPAVLANVDSANV
                     TRSSDRMDRPHIDVGYDNDGVPLASHSSSSFSGGGATGMGAGLSQQPTPSSKLTSAHP
                     SSSAPADAWKSSMRNEVLCGKPLRQSSPETSAAVPRENLYNIVEEEEDIDMDYADEES
                     AQACKGSGSGSGTTHPQHRYPIMMPGSGVARVAVPPIPVMSAIAAPASPVSVCSSIAT
                     DTPRSILRQSGAGGGRTPRSNSRRISFVGVSPPRPDEHRCRRDGDEESGDDSDDYESA
                     EPSLRYDIATLAMSATSTPPRHSRKVHSRDPSLHDGHHHSHEHGEGDSDRASIPVPAS
                     QQQQKRTSPSLSPERPRLSSRSPTHSPPRDSGSGYTISAGPPLSAAVTAPSAPPPPEE
                     EGDVITLDAAPQHCALDEQHLLKSSKRGGDQRRAKSPSMGANGRDEDVLTQPHNRSEA
                     SGGSHGAVVVRRLPPRQRWPSEAYQDEPPTEVSKTQRAHRSRRERLDPDADMGSSSSR
                     CSSDMDSNFTGSDGSLPVRYASPLKPHQDEYRGSSYQPTSSSPPALACTASVGIAGAP
                     PTGHPSPHRLSTSASKDRDGTSSARSREKSLTPRSPPSLTQRDDTDEPIRGSSDHDHH
                     HRRSSRGAETRSGLPAEAGEALPTPHSRARGMRVGVEMRGPYTHAGAAASHPRREASY
                     SPSTITDHSSGQSVADDLSGSVPAAPAQGARREPKNYQQQHEVVPSALSAATAAAPPK
                     RSEDRKVEKAVVAEEPQVYVDPLLLERRHRHELARQELPSHVERHSPSAGATRDSPHA
                     GKSQPHRRHSGLHARRRSPGSRTAAQQQPATFESVSLRDIIMRYDSPETKSRCGTPST
                     QFTARAILRLPSDVRQLQLQHSGDGDDDDAAHALTPGAVALEASVASSSLLSSGGVPA
                     DELFWDEPTPTSRASSRSPPPVSPRSSSTLAPNTPDRHKVLRKKLVVVVRRKKNGSAP
                     SENDPVVQMSLLPFKEGTAALLKANASLQGSPQQRRAHSSGTPAAAAAPALEKLIDKV
                     ERGGSASVSSRCLSRASEHQGQRPRELSQRRDGCDDHAGENEISVEDRMRFRHALSVL
                     SSRSVSPRASVSPSTTSKAGRSQRSRTRSPDSQNNASNDRARPRRRSGSASEDSVSHT
                     GDAALRRSSGRRHRSHVAAVSETAAASICATWPPQRRSARSVSRHSDEKSARRSDGGH
                     RHKSRRRHSHERVAHSTAERRRHSLSGASMPGAPCCATQNDEFYGAADMAKDVAALFP
                     SPLQERIGITPMSVPLLPRLVLRAELGALPQGQYAHRPHSNIDAVQHTDGSWSASDGE
                     DEHTMRRITDSASVGRRSRPLMLQFSSGTQTDRATGVSHAFGSARSGMPLLAATPVQR
                     AAAIGPTEGTRDSAHPGKPVGTSVPTVGAGVAASSLASACNAAGDAVFNEEMVLAVEE
                     RAANSPLVEDASATESPASFVKRATSPAAAAAAKPFTDSNSRILSGSSSGAAIGRGEA
                     AVFGGNVGASRAAYAPLFSATSAHVAATSSRSVAQDLGTVAPAMMDATNSVPLFVPPL
                     TVDNVSLLSHDWQSTLRERSSKAKRSAMESFLIASAEAGAVATAAAAAAAASSPPLYL
                     ADPTATDVNPSEVCAGGCGGLTVAALGAEAPSEWQRQTRPAQARQVLAVEEFYGRSVA
                     SAAVANVPRSAHALPPRSGPQSFLEIKRDVRQRSGSPRLVAQREPEQQQAKRSPPFSA
                     PSEKKSMQGKSAMPVGSVSKSCAASKSRDGVEERSTSARKHSRRRRCRASPERRANSN
                     GDQLTDALNVETLSTVAADSPCKSSSSAEKINMAGDVTGVVGVSPQPLSTESLSAPPT
                     LGEAKQKAQQSDQTSSSSSRSCSAVGNGTAANAAVAAATDGVGARSAPPLPPPPFFSI
                     VEAAAESRALRSVEKAAEKRHGNHQRDERLKHFSRYSPSPSSSEASQSPSSRRRKTSN
                     KHKKAKHDGDEQKKRQRGHGRHGRHSRSCTRSLSGQTCDAAAAEIDNDSDVDSNLTTS
                     MEFQLSRLRLLREAAVFTKSPPSAAVDASRRSTRKKDKADGKAARKAAAAKDEHHRHR
                     NRSSKEKRKRSSKKAAKRRSKSPAATTGSRLSDGADRKKKKREKAYHRSTSPPKPGPL
                     PPPPSHQRSRALYGEEAAAGAAASLSDAASRYRRGASDYSPRADGAAFASTCPYFTDG
                     SIYRGGQEEDAEAPYARHRAAARTEADSETLYERYLRRPHTSPLRGQRPHVTSAAAGW
                     ADGFRPAYRPASRPAATVEDPSVWHRSYSNPSRPSTRWNDYVRDAERGATSRSSSSPY
                     THAHHSRSLAQRRRSSDAGTTTAGERGRGSGAEVGSPNSEQPASGTYSASYTSRRRQT
                     GEFDDIDVAPIRQYFNDHVQVGTDDRSGGEQYGTTSAFEWHHSQSAASNHAPMARPWL
                     SNNYERSRAAATKKHVSVDDLLVSTPPNDGDEGYVPDNTNDLSRARQCQRRGTRVPPL
                     PPPPSPPQPSPPQASTPPSAAPTDTVLAAIPRSGALPILSEHTVTDAQTAEDFVQGVR
                     EIISSLQQYRNSA"
     gene            complement(<524111..>525592)
                     /locus_tag="LDBPK_341220"
                     /db_xref="GeneID:13392693"
     mRNA            complement(<524111..>525592)
                     /locus_tag="LDBPK_341220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864236.1"
                     /db_xref="GeneID:13392693"
     CDS             complement(524111..525592)
                     /locus_tag="LDBPK_341220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864284.1"
                     /db_xref="GeneID:13392693"
                     /db_xref="GOA:E9BQS3"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:E9BQS3"
                     /translation="MSDHWAPYERAWAQDPHHLHRSVCLSALIAEADRAVAAALVNLS
                     REYDATILCGSHHAPAEQHVTSAEDEGEYHQRCVDSPDSNASLDWRQLYCSLCLIQAP
                     MVRCSRPAFRQVCRAWGARVSYTHMLIAESFVKSPHARHAEFARYEGEDRLVVQLAAK
                     SGPAAAQAAVLLRPYCDGIDLNCGCPQRWAMKEGIGSALLDQPERVADMVRSIRNAMP
                     DGSTASTIVGNGCEYGSCTSTVPPFLPCVVKMRIKDDLRRSVDFARQCEAAGVSWLTV
                     HGRTPTCHPSAAVQFEAVKLIRENLSVPVVLNGGVTDVSTAMEAALRTGCGGLMSANG
                     LLDNPAMFYCGASRAAAEAEMSFATSRRGRPPRTCDPASSPAETAAPGVFSEVFSPVQ
                     PVSFLWAPDRSNAEAGLLRYTVPDMWQAAVTPREVISDFMRAAIRTDLMVPTTVQQVL
                     RMARLYVSPAERSHIALLRSNLSVLNALQEIGAYVESGRIACE"
     gene            complement(<526311..>527468)
                     /locus_tag="LDBPK_341230"
                     /db_xref="GeneID:13392694"
     mRNA            complement(<526311..>527468)
                     /locus_tag="LDBPK_341230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864237.1"
                     /db_xref="GeneID:13392694"
     CDS             complement(526311..527468)
                     /locus_tag="LDBPK_341230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864285.1"
                     /db_xref="GeneID:13392694"
                     /db_xref="UniProtKB/TrEMBL:E9BQS4"
                     /translation="MSSFWGRYPATMQNQQPMQNKSQQQDASFRLATGATAAAFPGSF
                     DASPETSARSLTLAETAELAALQRQHEQPFVVPVTQVLHKLGGVHITVRETHNPTITI
                     AYNRVMEEIDALVSEHEQRLARLPLSSSLSFSSQALIAGQSTLASATVLINSGIVEGG
                     ASVAGSRGENTAERLARNSNTAGLPAPQQLPRALLQSVDLRQALPSPASPMSPLRSVS
                     GVGSPTSDATAATWGRSGAGCSSDCGDAWTLGRDEVGMVLSVRLLSKEVTRWRMAHER
                     PLAEWRFPIIRTSNERLIRPRTQNSVATGAAGSAAVDGTEANRHDYRGEGGARSVPAE
                     LTLVNDPAQVHHVLEFILKSSYQTTSMETFTDFTSGELVFDAHVQEKHRFT"
     gene            complement(<528973..>529587)
                     /locus_tag="LDBPK_341240"
                     /db_xref="GeneID:13392695"
     mRNA            complement(<528973..>529587)
                     /locus_tag="LDBPK_341240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864238.1"
                     /db_xref="GeneID:13392695"
     CDS             complement(528973..529587)
                     /locus_tag="LDBPK_341240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864286.1"
                     /db_xref="GeneID:13392695"
                     /db_xref="InterPro:IPR003746"
                     /db_xref="UniProtKB/TrEMBL:E9BQS5"
                     /translation="MHATRVCLHRMFPCLVQVQPGKYLLTVHAKPSARASAFAAPLTP
                     ALTEADLRIAAPPVEGQANAELLRYLGELIERGFRAMTADYAEYVKGTSYATVLAADA
                     AASATAAQLAKSRSGGDKKSGKKGKSRNVAAASFASSSMPHSGAGGAQQPEESNTPPS
                     AAAFSDRIEVSLVRGGTSRAKTVLVMFPGTRAQLTAVLEKESRE"
     gene            complement(<530986..>532338)
                     /locus_tag="LDBPK_341250"
                     /db_xref="GeneID:13392696"
     mRNA            complement(<530986..>532338)
                     /locus_tag="LDBPK_341250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864239.1"
                     /db_xref="GeneID:13392696"
     CDS             complement(530986..532338)
                     /locus_tag="LDBPK_341250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864287.1"
                     /db_xref="GeneID:13392696"
                     /db_xref="UniProtKB/TrEMBL:E9BQS6"
                     /translation="MRRTLHRLLLNVSGESPDFRAKPGIRNLLLDVQQSPYKEQFKDY
                     WSTPVPFADREYGEKPKLGEPIPTRRAATTILVGHNKHIDPAKVAAGEDNDYKVLMMY
                     RESKGQYVKDQFVLPSFPVSLEDTSEDWDKVLRRRGVTTQWADLHHRLAAMRALFAQT
                     NLLLIPKEGGVVAEVEGPPGPRRWFLICNQYPKAMRQLMDVLELPMESTLSQLMPFRT
                     IVTPTTETFRFANLSYVVTLNKIPDVQYTLSTVGEKLVWVSPMEALARFNAGIMNMPT
                     PNVIALSELHNECPTFADVTKKTNRDAPRTVQPVLFHHGQEKVATVLLPGDMFHPETT
                     PEDRASKYVRRFAYEKDFPFGVRAVFDERPATAEEEAQVLEPEKPALLEEANDMDMVY
                     SSIPYPKWQRVPQEGKTAYPVPQYNFQEGRESDEGLIPLRRDHMGRKPVDLYSSPHEK
                     "
     gap             535174..535272
                     /estimated_length=99
     gap             537111..537209
                     /estimated_length=99
     gene            complement(<537967..>539964)
                     /locus_tag="LDBPK_341260"
                     /db_xref="GeneID:13392697"
     mRNA            complement(<537967..>539964)
                     /locus_tag="LDBPK_341260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864240.1"
                     /db_xref="GeneID:13392697"
     CDS             complement(537967..539964)
                     /locus_tag="LDBPK_341260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864288.1"
                     /db_xref="GeneID:13392697"
                     /db_xref="GOA:E9BQS7"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9BQS7"
                     /translation="MQTPTSSLLNRDAADSSFISQVVYENEALKIELESLREKLESTG
                     LLKLDDLRCENESLKAEVAKLRVQLTEKANQLDLHRASNDRFSNINESLHELLTQVQE
                     QRTELAEMKDTTREKEERIAHLTAELMQSEEALKEATQRASLASEEAKKISAAAAEKE
                     RLQSQLNQVKAEMETLRLKSTQEAIELQNQRREAEEQLLSAKEDAVAKYALWERKVNS
                     QQQEIKECRETEARAQQQLIDLQAKMEVLKAECSQLREANADLLQKQQVSATMESQRI
                     DLNAPEVKAHVEKMVMHATEGMERRLREQVDQNTSLISRLALMQQESRATTRPKDTSS
                     QGIQLMKERVSMLNCRNDARTTMQRRMAELLSNDELNKKDIERLLEEMLDFQEETVQE
                     NRTLLLIKDIESEERERKLGQELKRVKNENASLMKQLQELAVEGFQRDRSNMPNTSGG
                     GGTSEPSAGDAGSSTAPAALTGGVKPSASPENERGNYQFLGSSPPVMKTEEVRGPAYP
                     DPLNTSYNTLHQDSRTPPMMHPTVNCAPMPSQQMPVYQRPPAASPYQQPPQQREPKHP
                     PQSYTGDLWSNAPARPTAAPAPNAQRTATMMAAGYADPYRYPSDAPQNKPGAQPPWAP
                     RVSGNEPDRNRNTRVQCPACTFEQQGTNRQCEICQATLQLN"
     gap             541646..541744
                     /estimated_length=99
     gene            complement(<542694..>543524)
                     /locus_tag="LDBPK_341270"
                     /db_xref="GeneID:13392698"
     mRNA            complement(<542694..>543524)
                     /locus_tag="LDBPK_341270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864241.1"
                     /db_xref="GeneID:13392698"
     CDS             complement(542694..543524)
                     /locus_tag="LDBPK_341270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864289.1"
                     /db_xref="GeneID:13392698"
                     /db_xref="UniProtKB/TrEMBL:E9BQS8"
                     /translation="MSADHLRVMQRCCRTTTTAALLFLLSALLFHHCPVDSSNGSTDV
                     KAYRVSRPVFAAAQLRQCAQLQDLGNYGVNLNLFAPKTVYLNGEYFCAESAPAQYRCR
                     CGVATTCKPMLDPWERDIGSCDCCSSWMIGCFVILGVFSAISVFGAVYVVGCQGKWWC
                     DGYATLKTALIPRRGPAVSCPPSRPLPQNLFRGYASADFTNVEAFPEMPVSAVTAPTS
                     PQVNTPGVDDPNHGAVFGSEAEYGEARVRYPLLPPELRHANVAAAGESRAPDFATRAV
                     "
     gene            complement(<543981..>545756)
                     /locus_tag="LDBPK_341280"
                     /db_xref="GeneID:13392699"
     mRNA            complement(<543981..>545756)
                     /locus_tag="LDBPK_341280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864242.1"
                     /db_xref="GeneID:13392699"
     CDS             complement(543981..545756)
                     /locus_tag="LDBPK_341280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864290.1"
                     /db_xref="GeneID:13392699"
                     /db_xref="UniProtKB/TrEMBL:E9BQS9"
                     /translation="MPGVGERATSSDTAAPCKRVGNDVDPLLPHVCTSAQPLHPFPSI
                     EYFEAARRAALVQAERRAKAHRWSSTEPTMGSGEAAATASVLLNGLVPSGSLLAQRTY
                     RHDYEGHRCKEHMGATAAAPPGDAAEQTVGSLLKDSPKTPPPSPQLIFPSPVLLRAVA
                     QLVLTLQASASTSAARFTLAQYRDVQLLPWRRSLHEAKEPAASSAPRRFHEAVVVSVL
                     PQVVADCVASRARAAPGQTRSSLSASVEDGNSATLYALTPSAGPSALMGTQGAKRARE
                     EAQGETTQEGKAVSAASAAIVPGAVLCERLSTTNEAPRAQTALVRYAAVCADAFERWV
                     PPIGKRDASPPPTPSTASCVPETFLYEEESAWMTDGIFYPLFSLPLKPLAEPAVVAGG
                     NAPAGENNSSGQSTANVTFVKTSAFLFLSFLVHRSWCAHVHSAVTQAMAAHQLPSKIK
                     QRAGSLGLTFTGTHVTRLPPVHEVRRSPQYEWRSALVYRVHGEREAERAASNAVCRIE
                     GDEGVRGAALAIGIAAESLLCGPALWQLTVLVVNRNAQLQWCMHRTSLATCVGADSAA
                     TSLPHDAHKDILEGSGTLDDLLQRL"
     gene            complement(<546750..>552224)
                     /locus_tag="LDBPK_341290"
                     /db_xref="GeneID:13392700"
     mRNA            complement(<546750..>552224)
                     /locus_tag="LDBPK_341290"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_003864243.1"
                     /db_xref="GeneID:13392700"
     CDS             complement(546750..552224)
                     /locus_tag="LDBPK_341290"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_003864291.1"
                     /db_xref="GeneID:13392700"
                     /db_xref="GOA:E9BQT0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQT0"
                     /translation="MRAFPHCLIRSHDFSAAAAVSTVRDSLLCLCSRPWHVQVSHTRQ
                     WDCGTCVPLTLATSARHVANGGAGTARELANNRALSPSLSSAAPRYRSRECGSIGSRA
                     SPQPRRVARCRAKTSTSSPAKVVDSLAAKPPASRAASLASLLHRLGTVESSNTQGQQP
                     TLPVSSAQRASRSLPMPFSSTESEAPAALGSPTPVPRRGSGDSLDNSAAASEPSRASN
                     SQQRHPNGSAEAHSSGDPQAQQSTSSAIRRQKVPMVQLQSDRRGRLRKPSASRMRSLP
                     GGNLADAAGVSPLAVDRGAEERVVAMLRSDHQQADPDAEFVMPEPSMRHVPHSQLLRC
                     VLELPLNGRCHGEDTAEKEVFAIGQSRKAKVARALCFMHAEQLLDHYMSTRATPLSSR
                     TGASPAPPPLEERALPPRPKTPKPHDYRSWDEYVDASAAYVQALAARVRQEACTREEV
                     PRSGHPVADRATELLRRHPKRYCRPTVLHELNGSIRDASSLMTVAHLEKTVFVATLAL
                     DPQTGLTATGVAKNTKTAKRQCAAHALCILRLLQEDAEGRQGADGTGRSRRRGAQKGT
                     RSKKDVSHHPSAPLESVLRQMQPAYRKLVQYHHLLFGKASLTPQTTFTKQSSTTSGST
                     STTVYRCHLTLNGLSCDGTGINRFEAERAAMETAMANLMLYDKRIQAVQAFVNAHPSI
                     SPESIPSAALPAELVVELQTQLRPVTEQQAATEGATGRSGCDDGSDSAGDCGDRARGM
                     SERTLLRLSERAFATDPSYAAQMLHDILHLRRDPVYLTQFHPRRSTLAMATVKAQVLD
                     AVQRHRVAVVCGTTGCGKTTQVPQYILDYEIEHGRGGSCNILVTQPRRLSAFSVAERI
                     AQERLSTVGKDVGYAVRLDSRPGRHITVCTTGVLLQIFSTHPDLEHVSHLIIDEVHER
                     DINCDVILALVKQLLTRNSRLRVVLMSATMQADVFARYFDADTPVVQVEGAVYPVAIR
                     YLEDIASEAATAQFYSPAFDAVSSREQGHQVEQQEKTPTKSVSLAMPTTTASQRVNRR
                     KLLKTDYNLVAYLVHRAVQVDLQNNTEGKSILVFLPGWKELTSAMAAIKEYQGPYALS
                     AAESRLHIILLHSTVDSAKQRECFMPAPSGTVKVVLATNIAESGITIDDVAVVIDTGL
                     IKTTTWESRPTATYHQHVTTGTGASSSSGSPTFAHVPLDKVAVNCGAGGGSGGDAVAP
                     APVFSTQLTLGYASQANCTQRKGRAGRTQGGVCYRLFTKELWESLPAFPEADIHRVPL
                     MQVLLKLLSLGHANPKETLQTFLEPPSNTNVDASMEVLRGIGAIGKKDRLTPLGEYLA
                     LLPCDPRIGKMILVGTVLRCLDSVLTVAACTDVCPYATSRDVAAEARKKRYLLSCGSQ
                     SDHISFLNAYNAFCANGEKDDFAALNLLHTGNLRVISKYKVQYRDILRHAGLISPQDE
                     FGRDSERVDSTDAVPCPEHGHLGNDGGTVEDTAIHSEGGKATASAVDSSAQGAPASGS
                     APLSYPGTLCVDTNALSRHSFDVALVKACVCAALFPNVALLRPPSKALSSMQRLRAAR
                     KVELRTKHFASIKPAKDSVCRRVDGSRGDEVPDRDEVLSQLTLDSRAATADSATSSTS
                     PDRPVPALFYVFQDVFGLREPRRDFLTSLSAVSLWALLLFGASESTTEYNAELSICVV
                     DGWIALHIDRATYALVTQLRQSLFECLRGKYNNPQDPRNNSALETVTAVCRRLLKAPV
                     LEMAAAKSPDTAGSAAAGRQQSPWQLVDMGSIVDPLVHLRHGDFGDGRAAAVAGEDAL
                     LDLDSDDDGDDDEDLPNFNPVDGDDDDDDKSSTAHGGRIK"
     gene            complement(<553266..>553643)
                     /locus_tag="LDBPK_341300"
                     /db_xref="GeneID:13392701"
     mRNA            complement(<553266..>553643)
                     /locus_tag="LDBPK_341300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864244.1"
                     /db_xref="GeneID:13392701"
     CDS             complement(553266..553643)
                     /locus_tag="LDBPK_341300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864292.1"
                     /db_xref="GeneID:13392701"
                     /db_xref="UniProtKB/TrEMBL:E9BQT1"
                     /translation="MLRVEQNQARVLKDQEDRGMYYEQNSNVHTFDTISVGLYSQRST
                     LYHTMSAERLRNLKVFLMVFSTVVTCAYLYYRYMINPDWAYVERPMNMLGSRVMAVRE
                     QRWKHLTEAQRLDALCKEKGESA"
     gene            complement(<554865..>556292)
                     /locus_tag="LDBPK_341310"
                     /db_xref="GeneID:13392702"
     mRNA            complement(<554865..>556292)
                     /locus_tag="LDBPK_341310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864245.1"
                     /db_xref="GeneID:13392702"
     CDS             complement(554865..556292)
                     /locus_tag="LDBPK_341310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864293.1"
                     /db_xref="GeneID:13392702"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:E9BQT2"
                     /translation="MANVRLAKIGDSASSRPTIVVEKSTAIPPRLPRIGPPAILRLPP
                     QLVIHCFCFCNLQTLGVLCRVSVRMNVLVARQGAELWLAAAQRRRIPISDSACAREEL
                     RKALVHRARERQAEEAYYEAEIARMEERLSARAQYIYAQNIDVDRTLKTNGGPPTAAA
                     ANPQPFWLRQKRTLQARAGATAGSADTAPTALSQSADMCAKLQTEIEALEEVKRACEC
                     RLNLQEELLLQHDAQLRQWQSLLLPCKMSSPKSSLAPASAGAAAASFNTKNESAAAVA
                     SSLLLVSAAQVDEFERRMARLVLNGPVSTSSASITHASPGESSLPVVLRRGVENFGSL
                     ELVLRAVKRMEPTNDLDPANRDTVTTGNNMNTATAATAAEAASFEGAARAAAKRWGAF
                     QKICPINEEYENARLFLKAQASRAVPAPTAHLHTNTDGRSPANNDEQLQQQPSPKPTP
                     ALLRLSDFVRRAEAMSDAQVLQKWM"
     gene            complement(<558848..>561142)
                     /locus_tag="LDBPK_341320"
                     /db_xref="GeneID:13392703"
     mRNA            complement(<558848..>561142)
                     /locus_tag="LDBPK_341320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864246.1"
                     /db_xref="GeneID:13392703"
     CDS             complement(558848..561142)
                     /locus_tag="LDBPK_341320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864294.1"
                     /db_xref="GeneID:13392703"
                     /db_xref="GOA:E9BQT3"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:E9BQT3"
                     /translation="MQGTNLPPEQRWKKEEAPRAPLWARAAVIIIEVIIWLVTLGTVK
                     RVKALEVLFHYSPHWRKRDRAEASIKGALRTGMGAARRLARPLLRIETEFSTESSSGD
                     SGDVLTPLTATAYRETLKRRQQVNARIRSCLRDIPVDDLQAPFLVNACTWNVDQQAPP
                     LYEDAFLSWLIGQELTDEVKRYQDHKQAVLAYGGSLSKPHYPTGSSTMRSRKASANAG
                     FSDDPRSPKRTTAEDFRLADQQRAAAILEREWQWIETKFPDLFLISLQEVEMTGTALV
                     RESTQRSWEWADAIIETLAAASDRTIDYKKVQVVQLVGLVLIVLIQAKHVDYVSHVRL
                     SLTRTGTLSVLGNKGSVAMRVTIYGKRFLFISAHFVAHKHNEKRRTSNYQAALKDIRF
                     DMPVWSDDETEVLQTFLNAKEVLNHSIGHSSVQGNSAWDRLFSFGHSAFRTSFTTAAE
                     ARVLDEHDYVFFLGDLNSRLHALPSPLIKESVVRGEYDNLLCHDELRQLMVSGEAFDG
                     FQEQWISFPPTYRYDRGTDVFDTSRKRRDPAWCDRVLFRVLENDTVTATSQEEISAEA
                     PESSGSFEPPLHDLQSSSLLKCDSLTSGVWMSLEELESKHLSPNAAALTRAVSAGSSS
                     VTSSEDLACERSLSRDVQNTADAPQNDFDSADKPFQYPSASLPCRAPTHAVWEQRRCA
                     PTFCAARRPRGLLESSSSGEVLAMPTRFPMVTNHIHPLEYTYVSSLRQSDHRPVRARF
                     EVKVIAIEPALVSKIVKEVQQVIN"
     gene            complement(<564345..>569117)
                     /locus_tag="LDBPK_341330"
                     /db_xref="GeneID:13392704"
     mRNA            complement(<564345..>569117)
                     /locus_tag="LDBPK_341330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864247.1"
                     /db_xref="GeneID:13392704"
     CDS             complement(564345..569117)
                     /locus_tag="LDBPK_341330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864295.1"
                     /db_xref="GeneID:13392704"
                     /db_xref="GOA:E9BQT4"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9BQT4"
                     /translation="MEGFAVMSDAAADAPMKEKDAHLTNLIIEKRAAARQIEGLKAEI
                     ADLRAQLQRATSRGVLPYDEGLSPTPAKEKAALKNTPTEEISIWNAELIHTVEQLQRS
                     LIQLEADSEAQLITLTDRLNQMRKENERLLHENDSLKARIGDDVLRQRQTNRIEVAFE
                     RCRIAARVRAAGLQRLEAAEANLMEAHDDVYHVQRWDAMLLPQRDVSFVFHFVSNVTY
                     PLGDIEELIMRVYQQFLFHSSSCCRGYRVGFYKSMEVFAFQAPSDALLFAKECHEQLV
                     RLSWFSCIENMPSFSTIAENNKVLYKGPRIHTCIFTCSPESYVDPVSGKYAFFGPEVV
                     EAVQAAIEQCPIGEIVVNEKWSQLMCMQSRMREDRSAPTESNVAELRECLGPMWNVVG
                     LPGAHHIIASILPSGLRSRRGVEASVLYPSRKYPCLEMKDSASVVRMVVKRMKGMLPD
                     TFEGPEEGRQKSNGGGDVILQQMRRRANFWHDAVAKVPLHTSTQQPNTEFSDSAAKLL
                     ELFVVQKENSNLVALYRKTEAASAALERNMMESEDRFEIRKHKTLHPSETAYICTIDT
                     GDESIWKRLLLKSISDEQFESIQNTIRGDVHNAAKVHFGFLMSGNYSDVFTYVFREVE
                     QALAFVSEMYIKVNRTGTKYAHTSLGKGRDIFLFRAGVASGPMTSIYRNLENGVLKCT
                     GPAIRLSGTLCDLAKSGEILAMEDVIRSFYSKKENLLDTQYIVNQRPQFIGSHDAPAV
                     VHSVLPKPFAYRHKQLRSFGKAAMQNKNLYLPYRSVLAALTLRRDELPRQGVLDMMEQ
                     QQRRLELGEMARMCAEDNYERGWQVSTATISPLRSPWLLLCQPQAEEQSENVPARRRS
                     VRFRTMEEVEADLMYVRRSTKPLAFLYCDVAGAGAIARSVAPPLLRLVWAHYNYIVQS
                     AVRNFSGYVAKTNSTTSYLVVFEEPTMALEAARQIQLEMVGSMWPEELRVLESTLHVK
                     DIKSRTVLFNGPRPQIAVHVSDQYTWCFISPSSSPAALTRDASSKATREDGTDGGSPT
                     AETLSVVHIRGVGVVETFVLGLHAHGGEIRLSRSLLNAVGAHPSGKLLLAQLKMELVV
                     TPGVIHSVEGAKGKSSTTTEETEKIQGNSEPKAVKANVFAEECVASVPRRLEGRLALI
                     LPSTSTAFGVAKRTEAALAMATASAAEGNAESTSGEDDGAVPADDTGKLESATPAAVT
                     TETTGLASATLPRAIVLPAAMMAQHAWLVEPEESFNPLPAASHSDWSTVTPQPANSLN
                     DLGFLEETSRIRAALQELLKMFPSAQLLAQAVEGAPDESASELPAEHQADSSTNAVAG
                     GAPGKKTSTENRSSTKIPAPPTSLSAARGSVNLTPRSKEAALSKASATSSAARVATRA
                     AAVGQYALFMDFSKYLITVLLNALEIGADQRSPPALPLPRCGQSSKITAVGPPPISSD
                     SDLSGPPGGSAGSTSQKNSRSAVSGRIHGTSFRAIECSSSGSARESCFSSLPGISPPN
                     WRLLNKSPAGARASLTSSSLSRESEPQEMGASDSLCEGFKVSPERPFLSALDYLDGAC
                     RTLAQLSGIELGKLAKIPAAPLSKSKTFPFRSSSARRH"
     gene            complement(<569468..>571114)
                     /locus_tag="LDBPK_341340"
                     /db_xref="GeneID:13392705"
     mRNA            complement(<569468..>571114)
                     /locus_tag="LDBPK_341340"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864248.1"
                     /db_xref="GeneID:13392705"
     CDS             complement(569468..571114)
                     /locus_tag="LDBPK_341340"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864296.1"
                     /db_xref="GeneID:13392705"
                     /db_xref="GOA:E9BQT5"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:E9BQT5"
                     /translation="MMQTLRQQPGHLKIMGMDSEWFRDLPLAVVQFATSSHCFVLHIS
                     FFDGRILPAAVKEALCDPSIIKCGVGVSGDVSRLQKEQNITIQSVLDVAQYSALFGLH
                     QGAQSNLKVLAKSVANLSIEKDKMITRSNWELPLSDSRVNYAAEDALASYLVGRAVML
                     KASEVTNMSAHTFDAAQWLQRTSSKAAMELKKLQREVLKSEAEKGKKACPVSKSSGGD
                     VLPAHFRSGTKVRVLDRNGKFIFECSSGRAKFYVMEKNLAVITKHEKSDTRKALEIQL
                     LFDPKVKTRLCIHHALGVCELKNQCPFAHGVSELQAKAAALVDSQIPSCACCLGTKGL
                     LRHAITPPSFRKFMPPPQRQALDDDYLPVCKQCNSTLRLYYDEEMKRCYTQAEESNTI
                     MYDLKVVAKCSLYARLLLDADRLANMPANRREELQQFVKQNWKSTLFEDFNPGFEIHE
                     PVEQNTSFLERLGKIVPGDTRAKVTMAVLVGDDQEKARQFNKRWRDYCFGTCGMMEKK
                     SNHMSYNDWKAYRAHKGEPQADDDEDDTPQKDYSKIRQGY"
     gene            complement(<572580..>572858)
                     /locus_tag="LDBPK_341350"
                     /db_xref="GeneID:13392706"
     mRNA            complement(<572580..>572858)
                     /locus_tag="LDBPK_341350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864249.1"
                     /db_xref="GeneID:13392706"
     CDS             complement(572580..572858)
                     /locus_tag="LDBPK_341350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864297.1"
                     /db_xref="GeneID:13392706"
                     /db_xref="UniProtKB/TrEMBL:E9BQT6"
                     /translation="MELQEVDHLLEELTALLVSQESGRDDAAIEPAILNAVADYVEGV
                     DSTGAGLEQLRQALEAAVGEDGNSAKQRMKAAGCGRAIRLLRDAVSQA"
     gene            complement(<573337..>574413)
                     /locus_tag="LDBPK_341360"
                     /db_xref="GeneID:13392707"
     mRNA            complement(<573337..>574413)
                     /locus_tag="LDBPK_341360"
                     /product="NLI-interacting factor, putative"
                     /transcript_id="XM_003864250.1"
                     /db_xref="GeneID:13392707"
     CDS             complement(573337..574413)
                     /locus_tag="LDBPK_341360"
                     /codon_start=1
                     /product="NLI-interacting factor, putative"
                     /protein_id="XP_003864298.1"
                     /db_xref="GeneID:13392707"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BQT7"
                     /translation="MHARSLLRQQTSAAALQPLRSVVAIGLRQEFDPHWPLPLPPPLP
                     MNKQKHTLVLDIDETLIHTYAMGLHDDSKDRTRDPALQGVSLIDYNVLLRPHLKEFLE
                     EVNQLFEVVFWTAGTASYCCAVLDALEQQVMQLPRSFYSHVELAKESHKMKSSTSHTN
                     FYALSRTQTLEQQGYMKYLPMLGRKMSSVVMLDDNVRSFPLTPRNGIRIDAFDPDDRV
                     LQRYMFALRRVQEEKPHEMEDALVQCLQQGQQEIARLEKDRALLDVLPVLRAVAQVPA
                     GQDVTKELDHWRDLDYVRCDDFMETMNVRSAVRQQILGVTLPERRSTPIPAQKLSFMN
                     SGFLESANAEMTLHHTRSARHSKL"
     gene            complement(<575153..>578926)
                     /locus_tag="LDBPK_341370"
                     /db_xref="GeneID:13392708"
     mRNA            complement(<575153..>578926)
                     /locus_tag="LDBPK_341370"
                     /product="mitochondrial DNA polymerase I protein A,
                     putative"
                     /transcript_id="XM_003864251.1"
                     /db_xref="GeneID:13392708"
     CDS             complement(575153..578926)
                     /locus_tag="LDBPK_341370"
                     /codon_start=1
                     /product="mitochondrial DNA polymerase I protein A,
                     putative"
                     /protein_id="XP_003864299.1"
                     /db_xref="GeneID:13392708"
                     /db_xref="GOA:E9BQT8"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:E9BQT8"
                     /translation="MDPFQRTADVPRHAFRIVPMTHLTSTTGAKPSESTWSFPDGSAS
                     SSSAIGALPFGGLAAGVLQSDTAAWIQSRFHKLPESEETTRNLQKWRQFGLQIGSAAA
                     SQPSPPPEQQQPQATARLRPEESADDKDGVQLLHECRQNGAAAPALLSHSGPSSTRIH
                     AWRIADASSKERAAVNSAHDDYYVFVSDDDERGANGGSAACQRQTEATPPHSAPRTRI
                     PGPALVTLPEHAPDTSDVAGTDAIFRLQVELAKLSEKVQHSTEEQRCGPPRRNGSVSG
                     DGGSSMWAAKRGGGKKRKRDAKTTHNDDGNEEAEANVGSERVETGAVMQDQSASSSGA
                     RSKPTARRRDGAGTNTAAGTSGAKRKPKTRKRGGGDAILPGALGPSVCATPAPRTLFS
                     LTSSEAVGGAMAELQGGPTAAAMVSVPYIYLQESAEELFSDVRRALNDPDRIQAPPLF
                     VGVSALSSNSNAAAALASVETRTNFTYYSSGAKTAKRRVSCCFSSLDPVRSHQHVELV
                     LIRWKDDMYALPAQTVGLAFLCRVLIELPGVELITFNAQVLLVALLAYCKGTLWSNCV
                     SDVRVMAWMAQLHVASTLSKAPSAVRALAGGGSAAAADGASDADTSVLYDYSQLLLHV
                     CGGKLPPTVQLESMSNAGCFSHSTINLAEGIGTAAAAAAAAAAAAPAPPLTSAQCQLA
                     HQVYYLATVYRSLYGLLGSKGLLQAFLRQEKRIALLLALLKYNGMRVDLHEVHRYQKS
                     CEAEMARQRQLASKLVPELGEDFNIQSHDQCRRALYEVLQLGKYLLKSGNGEAVGATG
                     LTITKGGRLSTAEDTLRALARHHEFPACLLRYRKVSKLMQTYIEGMMGYAVVHSSAQA
                     SPAPCLDSVNAETGASESTKGQQQAHGNDEGAKAVSPLFIREAVDVNGDSPFVDRQLH
                     TSSSGYSAGSAEPMPARNQRSSREEASATPAGEVILPARGYATLHPNFLQEGTDTGRL
                     SCVEPNLQNLPRNGIAAAVAGNDAEEDGEEDLLGFRRCFVATGGCVLLSIDYEQIELR
                     VLAHLCGDAALVDALTTSADIHRAIAEVVFKKKPVSTEERSLAKRVVFGVLYGAGPKT
                     LATHMGVTVDRALHITSLLTNAFPGIDAYHRRVIEEARANGFVRTLSGRLRYLPDIRS
                     TVLSRRSYAERQAFNSVVQGSAADVMKMAMLAVSKEVLQRYDRSDVSLLSQIHDEMVF
                     MVRKELLPMVVPLVSSAMSHAMQLLVPLSVTAKFGDSLGNLQEWSVEHDLGVM"
     gene            complement(<580780..>586374)
                     /locus_tag="LDBPK_341380"
                     /db_xref="GeneID:13392709"
     mRNA            complement(<580780..>586374)
                     /locus_tag="LDBPK_341380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864252.1"
                     /db_xref="GeneID:13392709"
     CDS             complement(580780..586374)
                     /locus_tag="LDBPK_341380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864300.1"
                     /db_xref="GeneID:13392709"
                     /db_xref="GOA:E9BQT9"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="UniProtKB/TrEMBL:E9BQT9"
                     /translation="MSELLYAVVNGAYLFLVLQLLFLLVVVWQNVVAASLLFLFVSLS
                     CLEAVRWGALESGKQQNQSLNAEVVVVSPSTAELSRRENDGGTEVFVSALYATHEPPA
                     LDGCRASCYRCTPPPPREERSSVAIASWMGCDGDLASPGMGPPSTSREREPCRDAGNV
                     SSGPYSPIQNGADDTLIYFPTASDGPNTERLIAENVRTQGDQDDAQAEMQHGQRGAPV
                     SQSQMRVQSFYPAPRSGWVFATAIISLATVCTSVVLFGLLYSSVQVDSSLAGAVLPGW
                     ATTPAAKLLLTVCVGIQVDSSNPKLRFCGATACLSVVSLTSWCLLLCRALGRCVQGAP
                     KAASSVVAGARVTATSRWSRVRVGWNTALRLFAGVVTSAPYSLGWVGAAGVGQGTALG
                     LLSLAVVMMVLLLSSSVGQLQRQRVGHPRQRLWVPYTCMLLCLWEVQMIVLLPPVQNS
                     LKATSVWARHGRWLAAVGAVPAASQSSMLRWRIVQAIGLWWAGTEFVCYRTAAPATSQ
                     VTSFKGGQKLRALLLRGLAQRDENQWSRAVNQQRAAHCKLQQLRLERDAYLHRPSRAG
                     SNHWWRHAQRDGSHRSVHAPFGSNVSHCCWLCRDGPQHLPTSVGGGRRDGHECNPTLF
                     HNGPAPSSAAGVHVHDTRWTAAAVGSSSLYSNTSVYDCLAGMRASWQYSENASAQPSP
                     ASAESDSAAVLITTTTAVVLGESAAEPLKRHDPEVEPSLYMWQGWARAPTRSPCRDEG
                     DGDEDDNDVRHSSCGACSNGEHRAYWWGPPPSHSSAHSPCTFSVTTSGPRTGHSRLHG
                     AAYANATPRQDESGGGCSSARWPSMIHGTSVDISAVDHASSFAEEAAHHRPSVWPEDS
                     ARPEEVRAEHAPVSLSMVGAEETPRAADVRPPASSLLARLRGRARWVAHKVVELLRDY
                     LRRHTVPLPAEVENSATECPAGPRTDAAHPQRQRRRQPMEKAVECTQPAFASAASLTT
                     AEGITSPPGICLGAPSSAVSRREVVHLPSLWRLLELYAVQYWSSLCALLMLSQFAVCG
                     TVVNLAPSFSSIVYALLQRPWPPLWYWRLQMLFSVLALLAKGTARVYLLAMGPSVSLA
                     TCRWLSVLLLRVDVGAPSALVASLPSPSPSAMFGSESHRDMWVDLVLSGCVVTAVAIQ
                     WAVVYPDHCVFGNCKGEPDTTASVSAAAFASLEPTGSPTREARQDKPHRGVAELWGSC
                     KLHLHCWSVHRCGAGADYYAAQLFFDGLSLALFGWAYYAIVPEDTATSEGNLLHAVQQ
                     NHLPGIFVATALGLVVVLFLERILYVLHALFAKYVLHFFLAAVYHVLYVLWRTAQESK
                     GGSGATASAATTASVSLLLSAKLASLWCGALQLRHGYALHHLHDPFTIKTDLLHWLGH
                     VSFRAVPFLMELRVMLDWSFSATTLKVQHWMLLEDIHHTVYRRYVDMHDLYHTSRYHG
                     RHFPYLVRLYQGVLGFTVILFVLFFPLFWYSTFSPQVRASHVTAWTTEVALARMSSLP
                     LFSADAAVRPSSFHAAATLSLGDASVGAAGLLRFAAVTDTWQTVHVASCSIRMWSYTP
                     AALQELVDLLGKRTEVVTLLVRHRVTRDRASDATMTTVGLEESYALPPTSQALLAEAL
                     KAWRAMDDAGSAGTAEYSASAWDPVVVPLPLLYSPYVLSYGTGVSFLSGATMRRANCS
                     LTLHRMGRYRGFSCVKCAEGDQSSPAASTFAAATAADPAGSSQIASGAEIHEMSTPLT
                     FVVASNHVAIVQSSFSLIPNVGVIALYTSFVLVMSSYIRGCFAGDAHRVVLLQLANPE
                     PVTELLRYLYLARSSANDGQVGDLALEQLLFVELLDLLRSPERLLRLGGRRVDDYAYS
                     TYRQALYDATRRPFAPPDEGRG"
     gene            complement(<586998..>588038)
                     /locus_tag="LDBPK_341390"
                     /db_xref="GeneID:13392710"
     mRNA            complement(<586998..>588038)
                     /locus_tag="LDBPK_341390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864253.1"
                     /db_xref="GeneID:13392710"
     CDS             complement(586998..588038)
                     /locus_tag="LDBPK_341390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864301.1"
                     /db_xref="GeneID:13392710"
                     /db_xref="UniProtKB/TrEMBL:E9BQU0"
                     /translation="MWGFEAYAEGLSTTPNIHGAHLTGVAPQEGEAAPLAPPRYLWKK
                     NRNNYLFDAQGKLLGAAEAHSPTIWRTHHAFSGRCALVNPTAPVTGGAAAQSFGAPGW
                     AEQAWTAYQSWSVGFRLSSTTTDEPHILLSVAPAYFPNLVSATGEIRKADAATLASLP
                     CAPSAEEEVIYNKRMLETPLIWEEPYALSVECTTHGVFLWSDHWGIFGRKIADRCLEA
                     RQDNVRQSGIATLPSPDPSPSSAAAGEELALVAYDAALRLRWNAAGPGSKSSTDGGSA
                     RAVAPTLSVELKTSGDAAAGGAAPTCEEKVGEELWQHLIDLPLSLDEVACKAAFRPYV
                     TLMEGGDAVELL"
     gene            complement(<589428..>591587)
                     /locus_tag="LDBPK_341400"
                     /db_xref="GeneID:13392711"
     mRNA            complement(<589428..>591587)
                     /locus_tag="LDBPK_341400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864254.1"
                     /db_xref="GeneID:13392711"
     CDS             complement(589428..591587)
                     /locus_tag="LDBPK_341400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864302.1"
                     /db_xref="GeneID:13392711"
                     /db_xref="UniProtKB/TrEMBL:E9BQU1"
                     /translation="MRARVRRRALQALVESLCAGESKIPTMKWRRQYLKTPGIGPTAV
                     SAIANHIQGLPVVVSGSVAPAPQPLEKRPRHHIRTLDMRALHAGDDGFVEMMSALLGD
                     TLIENAIFAGNNITDDGVRRLVSHIHRYNSTPTVNSGTSAAAAAETAGGSVSQKTLPC
                     KLKLLALTDNFITSEGIATFTTVAPLFLSLEQLEVGRGQSAGGGDVDDVRDTLSAQHI
                     AALSTYIQRTPKLVTFLYKGNGNYYARNGFTPDGMTAFVDAVVGGSALKELYLQECFS
                     TKPGMVGPLTVQAPRGGKKAVTAEPDDSWAPEKLLQPMQALATALNASSSNLSTLILR
                     FPLSDEAVQALSIGLAQAPHLLDLSLRGCDLSSKALGVIGDALCTNKVLRMLDVSYQS
                     NTIAHPAFMAELRSSSKRRMSFISTMGYTAAEMARHDLSSGGSEVPSREERQHPLLPI
                     IRSLHKNRSLSQLVMLGVNISTDDIEELCACIERSGNRTLTEVWYTRAGSDALDMKLE
                     DFLASNRQRGAGGSAAAGGGAFGCSSLGSTYGALALPVSRSSGTLFPDAAVLSDSSES
                     PTKSTKERYSSVRNRKGDIPHGLVPSLVSIPHHPLHNGGNPTMSDRGGLADVMNGDRR
                     TPPSSLESTQTALKAVTVNTKMNAATFAAESASPSQVAVSLLCNGCDASVVRLSSTLR
                     MNGGDKSCLSLHSGDITDDAGTAPYHSQMPPERRKKQ"
     gene            complement(<593265..>594344)
                     /locus_tag="LDBPK_341410"
                     /db_xref="GeneID:13392712"
     mRNA            complement(<593265..>594344)
                     /locus_tag="LDBPK_341410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864255.1"
                     /db_xref="GeneID:13392712"
     CDS             complement(593265..594344)
                     /locus_tag="LDBPK_341410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864303.1"
                     /db_xref="GeneID:13392712"
                     /db_xref="GOA:E9BQU2"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="UniProtKB/TrEMBL:E9BQU2"
                     /translation="MYRCTRVYCGVLAVLVGELKKVPAYVFYKAREGAKTYVDSASKA
                     IEFLKGEDPNEDPVMRGKRRQHRELYQAVLREQASKAQEDAAQRRANLSWKEKLQLSF
                     KEARESVAQMTSAKAGVMALLQHCTASHTAEVALEQGIDVKNVQMVFEKAAANNSVGV
                     EEIVVGYIDAPGASHEEVMAFAEKLHKVCPVAKSMHIEWRQGSADSRRHEDGSVRRAD
                     GLHCEMEQAASGVEWAERRTGGHLGGPSSAADAALTTSVESMPAGMPGSRRAHSSMSS
                     WAARGGGSGSLRDDEDELHFPGFERRGAAWDSTRYGSSRAKEPSTETSASSYPPPPPE
                     STSAATTQPGACSSDPASSSPSPKP"
     gap             595957..596055
                     /estimated_length=99
     gene            complement(<596421..>599285)
                     /locus_tag="LDBPK_341420"
                     /db_xref="GeneID:13392713"
     mRNA            complement(<596421..>599285)
                     /locus_tag="LDBPK_341420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864256.1"
                     /db_xref="GeneID:13392713"
     CDS             complement(596421..599285)
                     /locus_tag="LDBPK_341420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864304.1"
                     /db_xref="GeneID:13392713"
                     /db_xref="UniProtKB/TrEMBL:E9BQU3"
                     /translation="MESTSYCRSPKGRRASTAPAEDTDSKPQSPNAKPQPGVSASASR
                     PRSSGAKGTNSQSQLGGRSSSRARAASSIRSSSPASRVITSPQKRRRQVSSSLPPVRV
                     RGKKGSGRAKMEMSKITADALASINHSLFIKTNLSAKQMSSRVMKEYLQAHRAGAHKI
                     ESQSAEERQIIWQSFVDASYLPHSHEIQRLVSYVQLMESRCQQKLQHAQTVTSCALNS
                     IQQLLQRVTDVGTQVRKDTDVLAEKPDVLLSSAGAEVWSRSGVKAGSAASAAMHALGS
                     PVRDVCGLDAMLSDPHPPAFRISQADRDERERLNRIFNSVLESIGADENERRVSGSSS
                     STSPTTQAANGSPTQFTKECPPLMMGSRDDEGSTPSTQSSSPVSPSTRRQSCQDDLEC
                     VDEKRNDTALSDRQAERTQYVLELQQKLDAVGVAFVQLMNRVQVQHQQYQHTIAAQKS
                     VLDAQATRLKLADDVLRDTAAQGAIEALSAVALAQQLSLELRERMEISERNMNAALKA
                     LIGQSAEVCFDNGILQEYSSLATKKENCLSAFMSQMERQVVEQADVLWKARQGVAKIW
                     QLRLQWQLPHSRVAASESGASVREPEGAAGNLAPLPPPYKARLEECDRAILLTFLERL
                     TMHCPDATAHLIAALDEHDAFCVTHPKETAASREDLARTTAVLQLIRKLDEEGRLHCS
                     AQHTGEALSVRLRRLVEQHDAFIDFNEAYARALVRQADAERRQYTPDAVAFFDSRTPV
                     PGLESGTASRRLAPVKAQAMFEGHSNTAASCSEAAATSDAESTKNSPSRPAMPYLSLW
                     TRKQRELRARQCETGAMNAGVGSNTVGAIVGYLERRTPHLAAATEAAASSAALFESAP
                     SSTPPRLHTELSASAPTCVSAGLPLPPVPPRKGLASYVLSTYGSTPESTEGDAGTKRQ
                     QHTQQAERTAKAEKHKAVMPFRDGDHQFIHRGREIFMQLD"
     gene            complement(<601404..>603758)
                     /locus_tag="LDBPK_341430"
                     /db_xref="GeneID:13392714"
     mRNA            complement(<601404..>603758)
                     /locus_tag="LDBPK_341430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864257.1"
                     /db_xref="GeneID:13392714"
     CDS             complement(601404..603758)
                     /locus_tag="LDBPK_341430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864305.1"
                     /db_xref="GeneID:13392714"
                     /db_xref="UniProtKB/TrEMBL:E9BQU4"
                     /translation="MRSLICRRAAVDFGVGVGASPIAQSRGIYSFHRLTRAHALGWAS
                     SSFFRGFPIEQGGRRGYGTTASLLKQHQPTNAGASAASSRTSGQASRKQPRQKAAADY
                     GAAEAVVEPELDTVTAAASLPLAASSSEAVVETEIRTASSVPRHVSRQVAAGRPKAVK
                     RGRRKQEAAATSATRCASTPSANSASSPSTVSSRKGPNDAATTIPPLEPPASPLVAGE
                     DGIIVATSSSRGKKPGRRGSAGSLLSSDAAGSAAAGLEPTVTVAANAAHTAALTPSSL
                     LGSPQPVYYTHNMMDTTPRTEEQRVAERCSITKLIMVSGSVSFLSTTLPRSEGPLKMY
                     VKDLNRAQAPTHASVRAPGQDAAHSQRNAATSTGQESGGSDHIAAGTHTLPAISEKQF
                     LELWQRLCAEQLATNTVCIHVREMEQLVPPLHLQLPALTDADKSESVDAPAVPSGETT
                     ASTQREGKTRGRRGRRRGSARAANPFTAPASTSAPPTPPLPALSPVERILALQAWKKE
                     AVRRAEETQARYLVPAHYHAITRVRFHDPHQTDLTVAMGSGWCKSIASVLRAIVRSMP
                     QDRRGADSGSSDSDSSASWLTAEGEEDDGDNTVPPFEMPDPSVYSSEVATQAADDAPA
                     PEQPGFLTSPYTVKPLLTVCASCVPRREAWIGTCAPGPSATSACGAESEWSPYSVRAV
                     PTVPRYSTRITIMLEHDDMDPSDLVSLAEISTTRKSSSSSGAEMHQSRDRQHDASVSG
                     RGVSATGLRSAVPNGKSLSSDEKGHPAPKKPLHLYCLVQDAGEY"
     gene            complement(<606078..>607298)
                     /locus_tag="LDBPK_341440"
                     /db_xref="GeneID:13392715"
     mRNA            complement(<606078..>607298)
                     /locus_tag="LDBPK_341440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864258.1"
                     /db_xref="GeneID:13392715"
     CDS             complement(606078..607298)
                     /locus_tag="LDBPK_341440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864306.1"
                     /db_xref="GeneID:13392715"
                     /db_xref="GOA:E9BQU5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQU5"
                     /translation="MFQALMRRKFVVSLEVSNRDSAYEWMLRWLSRQKSFKVQQMSVL
                     TRTASFDHSSSDRTQAECLFGPCPNQRHYFFYEGRPLTLTRRRRDNVSPGYNDEIFET
                     LEFTTIGTRATVLQKIVMEAQQFAEQEDSDHTVVYMNGGSSWTRQSRPRSRRAIESVV
                     LPEGMSEFILADVKKFLNSSSFYRQLGVPYRRGYLLHGPPGCGKTSFVMALAGELRLS
                     ISLLNLSNRNLNDESLTSLLNEARVDTIVLLEDIDRAFSNECNVTMSGLLNALDGVGA
                     QEGRLVFMTTNHVERLDAALIRPGRADVKIEVGLLDVNQSQRMYRKFFPKATEDMVEA
                     FGREFPPHVISAAQLQSHLFFHRDDAVAATAALPAFISSCRAFDASIEQMRSEKARLQ
                     RSLPRAPLLGIDTE"
     gene            complement(<608029..>611994)
                     /locus_tag="LDBPK_341450"
                     /db_xref="GeneID:13392716"
     mRNA            complement(<608029..>611994)
                     /locus_tag="LDBPK_341450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864259.1"
                     /db_xref="GeneID:13392716"
     CDS             complement(608029..611994)
                     /locus_tag="LDBPK_341450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864307.1"
                     /db_xref="GeneID:13392716"
                     /db_xref="UniProtKB/TrEMBL:E9BQU6"
                     /translation="MSSRVDESALTISSTKELVTAHPGACAVVYQAVCAEAIHVVFAL
                     YALSQSGVAELGNELRRCRTAMSERWRSPVEVVHRFAPQCHVGSSSLFQRTSSHDGTP
                     ARPQSQDSGEQLHVLSSSTEARGCITHASLYGLLTAAHLLRCSTWTAASLVQGVWIKG
                     HSALAQAPQLLAQARAAEELRTRESGWCATALVQFTEWLLLSLSPHFPSSLMSTLPSR
                     ALSVAEVERTATDCRDVGLGIWPPVPSAADGALRDDSMSAARQRTVFVADPLPLYFPF
                     LLNGKECSRAFAPAPWQPSRVSDALESGCAHRWLLDDLPRWCAQVALEEQSKRWHRTS
                     LLRSALERWRARRGLRVVAHLSYAAASARVEEPHSPAVAADSFSPLPQTRAPLYAGVR
                     KVVEGALSSPLELDDALEAAPLSYTIATQTMAGTPRIDKVDSGSSGEPPARGFRGVLA
                     ADVSTIADDTAPPPSIPSQDTQRASLSAAEVFAYTGRADAAASASKTRRLDSVLRGEL
                     AMQELPSRNMGVEEHTSTLNEECGQNQPERQRKTPPQKGRGGAEDALATSTPASTSSS
                     KRGPSADASRFSAASDLTASSAPALSAREAKQEELARVMVRRRENTVLRQAFLHWRDR
                     RLYEALAARLIQTQQRELTRARCWAQWRCRLAAMLQREKEMRDVARCDVYTEQKALQY
                     FRALLRRWKTAALVRRFRISTSGHRVLRAWECSTRFSQAQRAIQHQLIGARRVKWQVW
                     TRWQERRQECVADRHRARKHGAATLLLMRDACVRRQTSRVATSQRNTILLKRVLQRWA
                     LQCAIATRLRSFIESRQPHRTLVRQAWQTWRSQWLERQLRREQEHRLRAFRVARLAEV
                     CFARWVQRWRRETHIRACVARQQRRHVLRPLFLKWQQRMQVCFIVRQAQEELALKVSE
                     QLCGRRILRTWRRRAVQHAAGRRGLLEALMNADADLFLRLNRLARTFYHWRAHGFVLR
                     RYHLDRRRGLPIAAYGAAGMRSGRGCEAVFSIAGRTGVGHHSEADVGKEDCENFADPA
                     TTPLLPPPPSSAASPPVPPGRSRRGRLGYARRAPTRSVVSVRSPKRLPACRSNATSVR
                     QSTSAAAAARHEPTSAWRGSRDEEGCAAALAAPHGGPRVVLCKQLAVPPRRRTLALQR
                     QLLATQLQQRPLFSRDACVRAGGCSSRSTPPPRPVFSEPPYSTSASPRRTTRPRTPPP
                     SSTPNQHWHSNLSGSDTESPGPRRSRTATPLFTARDARCALRSPRSAALVESPHSSPP
                     QPRQSHSGAHVRGNNDCATLGLGSASANSAHRLLGQMEQLLRRIRILEAGYPAQATAA
                     V"
     gene            complement(<613369..>615090)
                     /locus_tag="LDBPK_341460"
                     /db_xref="GeneID:13392717"
     mRNA            complement(<613369..>615090)
                     /locus_tag="LDBPK_341460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864260.1"
                     /db_xref="GeneID:13392717"
     CDS             complement(613369..615090)
                     /locus_tag="LDBPK_341460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864308.1"
                     /db_xref="GeneID:13392717"
                     /db_xref="UniProtKB/TrEMBL:E9BQU7"
                     /translation="MAAARQEMADLLREVQKLQKELQPVRSAVTALQKREADTPNAAA
                     AGASLKKVATRLESVKQKYKPYLTRLQELLLDEVPSYLQQTPLLAADVESLEHRPGGA
                     PRGTCNAANERLTAGSSSSVTKNTSDDAAHLLQQVCPPSTPHLLQPENLRFTHQQLRL
                     RAEMVEYLIETNRVDIAEHLVREYGLPLQWFPRLVLLHRERIFGAAADRVESSQTAPP
                     TGAAAGATVAAVAAGHSRSLPASSASPPVTPATRPRVAAVPPKSPIQLSLTASPKSSV
                     AGIPTPSLPRSPAPQPTPASSVVASTPVGQHLSRSAPSPASSAHSPPTPQQQQRESGA
                     ASVFPSQAPSNTGTAGAATAPATMPDLVARVVSTAMYLKDEYLDRMVLERTLEQHLGT
                     APSSESASATSTRGNSTPPPSSATPLERYKACVLSRIANIPRHHLHTQSGDDVFDSAI
                     MNIIEDLLVYGLQKWAEVDAVTAADAEEASAESRKKAELQRTLTTDTLLTPQEMLLAD
                     KVWSEEILLLKRPTRFYCVESGLTTDDGAASALAMPRARTSGEVVSKCVAINHDALDA
                     TVGIFIT"
     gene            complement(<616195..>624030)
                     /locus_tag="LDBPK_341470"
                     /db_xref="GeneID:13392718"
     mRNA            complement(<616195..>624030)
                     /locus_tag="LDBPK_341470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864261.1"
                     /db_xref="GeneID:13392718"
     CDS             complement(616195..624030)
                     /locus_tag="LDBPK_341470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864309.1"
                     /db_xref="GeneID:13392718"
                     /db_xref="UniProtKB/TrEMBL:E9BQU8"
                     /translation="MALLAKVCRDGVVSDAFTHEIKERFSAPMEVTVAPPAAALGPAT
                     APAIVPQAITTALQTGAQWQATVAPQSTLAGVSIISAAPAAAASAAYSTLARAGEPKQ
                     QQERRRLQVEQASEFLQTLLLCDSGYNNSEAPPVGNPASSQWTESVEEVKGLHAAVAA
                     VAVSAASNLISFLKTSITANSQASDSEASSSSLFIDNRRKRSDKSLLLLAAQCLYVLS
                     RHFQLTTSVVKEALDLMDALYVLLKNSLQNRVTPLSAFRDNVDTCCLNTLIWLCVFSI
                     VNMVAVWKKLRSSTGELRLNELIQSSVAVSIEATVSALRGKLRESVQPPNTGAGGGLH
                     GGALTDAHRGGGGERLLGGSGGSRAASSASAAVYTWQVLVDSYLSVLALAEGCLLRAK
                     GSEQGYDKALDAFLGARMASLSSPHAAATPASVAVHRGKVTKRMVELAPVPRTLSIPL
                     GLLYIAPYEMMSYLFDEMLPLLRHLSELEVATHRRYCEQLEELPRLPSFVRGGSAVNR
                     GGSVAALEAYYGYQQRGAVQHSRPEETNGEEAWLLKVTRTGAAGEVVGEPFTSEMAHL
                     LEALAICLQHLPPEVLNPDLDSDCAATFFIFKNFVKHMRQVFATQRSNASSAAVGTGG
                     GDSSGAIGGFGAVWENYTLKLMTKFLEVMAMIGRNPQYTQRVVVLLTDAQTECGEMQW
                     HSLVSQALECAGLNSGVIGASGAVGSDGGAASVTALAAAAQKSSGGSATSGAADGDDM
                     YALLSTVPGVNGVPRALHRQFTRAYARKCQRHYIASFFLLLRQLFGHPTLRPIVSAHM
                     NLALALAFLSAPQQSQVMLGSTLSLISALITNAADAQLVWSFLEQRRLLQQSSVCTQQ
                     RTHAGGGSASPAVYDRFTASSSASATGQREPAVHEEALSIIGHCQCECTQGTYDITIG
                     FLNLATALFQHDQPSMAALPVYNTVTHFISHEMLRGVLKRMFARPHERYTVMALASAA
                     LRQALLVRFRSSESARTAVLPFATIMAINKAPTDVVGEVLKLILDASDAPYELLSHHR
                     AAVRQAMRLLITAIQAAREQKIELLLFDNRTTLNTDLAVRVLGMCSLHDTLMTKTTLQ
                     LLVLFPFDTANQAAHYWAGLTHKYAAVLDSFAQLLHPLNTAPVVVQAPPELAQLDFEP
                     SELVPGWSAALLTETKSLLLDLLMQHADVTEPSLTAWMGGFYGEELSRRDRWGQPSVS
                     AAAQAASAHGGAADGDGTAGEPRWWRTTLLTSVVEGACDCEVEHAHPALAVKYVKLLY
                     LLRANRLYGSLVIRPFLESVCQTLFLRLQHYRASQCTPVALSKYAYVLKLLALEACYT
                     YRTAPESLRLAQNTTITSIAVEVLLSLLHPFGSGSGALAGGGAAAPSDCEYTAMEDSG
                     VRSLHEVDGYNSDTHASAPSKRDADEGKERQWNGDVAVMSRDAAVDITSWLPQALQVL
                     PTFPEKLPAVAGGLSHLVPAATDGVVQYDMTSLYSAIQAEQARANKPPMTMSELRDRL
                     RPFIAANDCFFSYAAGVSFVEGWCQLVSVSCSVVKGLSVSRLRSFALCILRGLDATTR
                     LTAAAQEQVAVRLCHCLSTVMAHLRQTVCASVALSLTVPQNAEAEAALYNQCSGDYPG
                     VQGSGCAPLDAARATSYLHGRYERRTVPRVSAQPMTVTTVPAHGRGGEGEVIIGKRRP
                     RDESRHVTRQHWSGQGGAMRGNASVGIGKPFATHAGELTNFFSAANRSQLAQALLQQR
                     GAERSGAESASVAGEQSTTRASWSRSGVADATLLLEPLVRALVHWGTRIATIRAELYL
                     SLLCLAETPGVNLDDVAVWRFQRALLDVVCTDIFSSSGSSAGGRGESCRSESTVAVQR
                     HNGLNGAAPANGSDSGAAALPLQAQQAVALLVALLQASAPIRDEFCNPDAGSGDGLGK
                     WALRCATALLQSADHAVCNFFASNGAQVGALLWHLRSAFDVVSVISLSHSSQVLHSGL
                     LHSCLSMRAWQYSTLVVLGYSQANPSFDGVPSRSLVEQNKEVLQHLLLGVVRWVNLLL
                     SSLGDAATLLYDVQKFIRENRQLIDHVFIAPAAVSSTIAGSARLSASHLKLCAELSDC
                     LRALSCSVLAVDCRSLVDGMALAELLSMLSSDDVWRRGPTELYGFADVDSGEGGLGGA
                     AGGASVASPAAAGAAVPDRNDDNGREDVKGVLAKLAATTGTAAAHAVSAAERGRDVVA
                     LTVRNLAHLLLNTEYGQRSSEDVGVFIPYADSTPMLRHSAEKRQLVAKIVRHVAQSLV
                     QTSTSEVREFRLECYLYALHAMVCLLHSFVLPMTPAGPSQKQSSYPTSLPEDFVRYLS
                     ELPLGEFADTLRQAQEAVYQLREFNTDYRGGLRASRVAANAWVIGASSAGPHTLSNSA
                     LVANASGAASTADQRAAVSSTPSNAPSSPPATVHGGGGISDAFNMPSTPGLLPAADGR
                     LGGRDIETGPQSSAAAELAPASSARHKSHSGGPLSSTAASHSGETGQDPNTTVAFDLD
                     GSSSRPPHAQGQNDASARPGAASAASNIQAPLLPAMADGAKLDPDVTLWELLPERGGA
                     YEGEWTRLYDSATAHDVRGTVVGGGMDSVGIHSAPLQWKDVLNVENEVRQVKIAIANA
                     LRATTGAMSIVRKHA"
     gene            complement(<626125..>627099)
                     /locus_tag="LDBPK_341480"
                     /db_xref="GeneID:13392719"
     mRNA            complement(<626125..>627099)
                     /locus_tag="LDBPK_341480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864262.1"
                     /db_xref="GeneID:13392719"
     CDS             complement(626125..627099)
                     /locus_tag="LDBPK_341480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864310.1"
                     /db_xref="GeneID:13392719"
                     /db_xref="UniProtKB/TrEMBL:E9BQU9"
                     /translation="MFRAHRPAGPSCGRLSGPSSSSESSRRAVKPEGQPKRGRSPCED
                     EVAFKTLQAHKLDAQSRLRQQIEVLSGLESNVLDFYYTHMVRFEPLLELASQVSPSAA
                     MVPAAARDAVLGGEFAELFPELKSTTTLTDTCDESATLSTREPAPSPPATVPAKTRYY
                     YDSALMRLYREAAFQEKNLAHRYACEKARVAATELSVQHDIIDGSLAEQLRTEHEEQQ
                     ALSKLIGSLAEVTAQSAAHQQSLQATDERIREIEKAREACLARKTVLEAKKQEQMDSV
                     EHIKEEVVAFRRCVEAAARELERRRLINRSLEDEIGRRRAALKRRKKE"
     gene            complement(<628168..>632076)
                     /locus_tag="LDBPK_341490"
                     /db_xref="GeneID:13392720"
     mRNA            complement(<628168..>632076)
                     /locus_tag="LDBPK_341490"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864263.1"
                     /db_xref="GeneID:13392720"
     CDS             complement(628168..632076)
                     /locus_tag="LDBPK_341490"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864311.1"
                     /db_xref="GeneID:13392720"
                     /db_xref="UniProtKB/TrEMBL:E9BQV0"
                     /translation="MEPEKCEASAAAAAGSETPPQAHTIRDPIDPRQELVSPSSNNDS
                     YYHSLRAEDQSRGVLSSLPSSANASASTYGPGQADFGVSKGHTAAFQQPQGRAEHTVK
                     GSFNHANPKAPQQRMQGSTPLTPPPPTSTVKTVNCIYTPLHLDSQLLASPWPGYGWPA
                     VHAPSPTRAGGASAAVPLASYWNANSSPMPYPSGSPTAYNSGCRIISPSIQSLRLVPP
                     HQQHGNDGASPAQLSFSNLGHDNSFLAASSSFASPSSLGVVHSTILDAPLQVSLMPPP
                     YRGDRPLFSFGNSIMQSAPFTHTLPTSTSRGRSIYLDAMMELAHHKSEVDNPLAAVGS
                     GASYGHDTNPLRGSGITSSFGDVAAAGGPSDAHLCSFAVSASSEDVSVSNTEILVGMG
                     NVDWRRLERPSPGNSSLVDQVTARSGIQRTGSLGSHANTLDNESDGIDFGDEGEDGTE
                     KARQSFNRTPEALASTGRGTQAAVAVATAADLGQAASQTFGEASLPAPLEHTAHPDGA
                     KGKEGGFSLPASALACSDGSGTMAAAASVTALSRGRACEIATPLVNLPLRPSIGPTSP
                     ASASAVATAGRAIYDLHLFTPSPVDQGVHVFGTMRDSATRNSPSEQSTSTLSLIPAVG
                     VWQASPAIMSAWHSSNLTPTTALSTAHALRDLLEMLRLLQSDIENVGNQLSVYEQMVR
                     RWIRNTLSMLLLLTTELEHSVALAVMEVPEGAADQAAAYTRLQVDIAAAAASCNEPLH
                     ATIDAVKREQANLEPVLLTTMLARGAIVSLLQFLERPYVTARAQSGATTATTRMLNGM
                     CAPSKQCGGRGPYGPAAPAVTPLTPERIEELMDNKILQEELNINWPQFRSSYNRQVLR
                     YLCLRVLYVALSRDDSSVGDVATEQQGCCTTTDADAPATASTALETVVSAWVEGQVLQ
                     WTAQQPAITLQHRHATPTDSKLDDADGAAVREGLCGELPSFERIAEVFSVFGESEGWR
                     WWYNLLGDAMSCNLHVRDSRRIYDYVEKQLMDSPAAPAVAVRTALSLHEVKAKEVEVE
                     LEKVECRLSAMEESGKAQRVNILQHILRRIFVLSLVSSVQRTLGKDTPVSGAQLATYV
                     QLQRKSLEDVEAQLSAHHTECTVHSKHIRTFVSLFPDTASAAQAPTQSRQWALSKSAA
                     MSGMRTHTNQPQHGPFSRSSPDLQADDTPLQWNCPTVASLAVLLARPRPDSDAMHRRE
                     GFPAATAADANTEGSEEDRTRAAAALARDVATRLVATVQSLCALLQSDVDVTESHQAY
                     CASPAKMSAPSTRALRRLQASLSEANHCIRVCITSLHTVD"
     gene            complement(<635447..>649834)
                     /locus_tag="LDBPK_341500"
                     /db_xref="GeneID:13392721"
     mRNA            complement(<635447..>649834)
                     /locus_tag="LDBPK_341500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864264.1"
                     /db_xref="GeneID:13392721"
     CDS             complement(635447..649834)
                     /locus_tag="LDBPK_341500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864312.1"
                     /db_xref="GeneID:13392721"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:E9BQV1"
                     /translation="MFNKLVADLLTSHLGEYFENIDREHVKVSVWNGLVHMRNLKVRQ
                     DALRFLDVPVCVLMGTIEELTIVIPWTRLRSESVVVQIRKAQLILADKETAGYSIDQD
                     VREARARKIRELAATDEALLMAFREDLSQASNSAPAPTSVPPPTADAADSSDSNFTAR
                     LKASILNNIRVEVEEVWVHYTSCVACAAPGGDDVVSGGVVGEASTLKPPQGHPPHSMR
                     SPPSPSAHIDASVPLSAQQASLSFQIKEIKTRGCNERFEPAFVAPGERVARQLISFRG
                     LAASLRTSTSNERELSLLKPFDVAVELAYQPVYTDVSTPQYMAAVRMDDACSCTITSE
                     RCTTCYGLVQYLVHVRQRQALRRLRPIGERLRANPRAWWRYTLDAVRQQVQNNRTAAL
                     ASAGKLTPFSWLAYTSMKQKRDRYMRLYLRQQRISLRATGWLEPLTVDEHVELVALED
                     ELSIDVLKLGKRLAMRRVGVERVEYEKLLREKRAAASAGETDTPSPVRPSAPPAQLLA
                     TVVKGGWFSFWRSGSQPTASASVRASGAADDGLSEEARAELRELVQLMTAEQWTDAQR
                     AVIAQELGMSPEEAKALSRSDTSLTASTPDPATANLSKKPIRHRGVPSCVVFLHAKEL
                     RVELQSRALRAPSTPSLIRGKVAASTTAPETLAQVALHTLQAGVEWGGVSAASGSALG
                     AAYYWGAMERFSITAASLAAPETRQFTHAPTEEVIFAICRTGVQQDGSKSDLSCPLRS
                     TSGAGSPRTSAANVAEREASVHQSRFRTFSPLESCWSIVPDECHRHAAVKVEWTARSA
                     QQLTSRASALHCVRVGLALVHVVIDVVPLRHLSDFLFTVMWPERALSHSAASDSVGDA
                     QVYTSPSIDANVDGDFTALAMPVSPRMTYAEQRCATDEDARLVVLRRRVEQQRSIDWS
                     VAVDAVRISLSEVPQVQGCELALTQLCLRNDAVHRLQLQGRLRREVSENHSNASTSPT
                     TTATAAAALGSLDTDWIDCFHVRMAAARLSVFFPRNDPSADGPLSIERGVLLPDTAIA
                     AVVERSLLGRCHPNLPQWSLRMSSSDAVSLTWSRTSLSVLTTACTMLTDLAASVELNI
                     QERGARQMGAAQSPESEAVYMCRVRVLPHTTGKRFWPAAHARQGAAGDVDDDAPPHAA
                     DELESRYKQLHPFSAARQHSTLAAAVSLPQRVSVRLGVCVVYHAQRSTFPAQYYTLQD
                     GCTHVLLDGENDSGGTAAASVTAGPCVHLYVSQGGRNHEEALASGYRDAKRLLLDKLK
                     VPPALLENAFWLKRAVNAWLEKGNAVEGDNNAPSQEQVRKALSRVLAHTQAVPCRYVA
                     FQCASDAEARAFATALRRCCVSEATPPLLLRPSVQARYGTAVSAPELRKQPLYGVTVS
                     FPSLRMTCEGSEPAVCLHALETNSDSADACRSPRRDAVLSFTPFLLRHDCYRDKQSYE
                     LSVATSVALCARFGGNAAHDSDVKLFDVSVPSSSSTNDISGSRTAGDSIAFFMRFVHY
                     RRPSPLPSSRRCTMRVGPSARMCLRAGPTLLECGEAFWDTIGLLTNRLFGAEVIAGYP
                     WWRSLGSDEDTRKEEVGEGADVSSRITTNVEVGWGGASECGGNALCTHVDVTAPALQV
                     NVDLEGAADEPMVSRDIPVLRFKALGPVLEWRTTEACDHVRMTAESPQLQWCCPSATG
                     AVPGKANWVTLMQPDGASTPSESRADSAKLSVDWKRHRLPPMLSFSDWLCGRDGGGED
                     VEGACVMGIRDQQELKLELRRVRLLFLYPLLMHLLGSIREGLVERASAVVVREPCWFC
                     AGALLCPPLSWRAPEKATAAVSWTHVRKSVTLKSVVLQTPRQVDWLAQAVTSAPLPSP
                     APHLLLAAAHLLFTDRVQVPASSSTSDQSPAATAVDIVYDIHSSDMFISHAQPSSGAP
                     FQWRFPSWHVNIAHSVFDARCLWAAGGPRRKSFVVVLPSRTESCVLRCSSADLTHVMD
                     VVHANFFRPTAFGKEMESDAVDASSPASLLKAVAEESTWTLSVKGAATLCISTSRSNS
                     SHSGGQSMQCLLRLNDATASAVRSASGELSCSFAAQQVWLGCGAPSTATSDLPESDGL
                     CILQVAPLHSAAATPAASLRVQCSWRWLVTPKVDSTSATGTAALPERAVFLSVESFGA
                     VTATVNGEAVVILRAMVVDDRQLRASLLRYMDQAPPSASRARTPTPSHESSGGNASDG
                     RAKQVGRIRLQHLECRIPCSAVPAYSPSSAAPTPSTPALVLSCAISRVQVELCKNPNA
                     SYAMVRVARLVRCVLEDTSSGGSVVTAIPLALEQPTEWRAPVAAFPRPRRHASPHARV
                     ASGSPMGPPKPKDASLLDELFGELPAAKHDSALPTKAASPESDVFYVALENAPMQCKV
                     ILDLQPLWLFAPSMMHAAAMLDGVCTQVKLCAAARLRDSAAPASPHSIITTATSALHR
                     SYALQLQSGRIALLVGETEVAVSATPGYPSVSLEAAILRAVDEQEMLVIVTEAASVSW
                     NSVIQERECFDGAQTVLHLQSISISAIQGMQNGTVLVERFGIRVQRQLMQSGQSFESS
                     AAGATGGIEEWRLGMDALHLTLTQLHYTALLRVALQQTSFLAAIMKYFSSASQSIAAA
                     AAATAPDLTATAAPQKSQQHRNRQTNSPSKARCFLFHLSSLRLRVHAGNGDDGSGHQT
                     AVYFELSDLNAAYYAGQHNWSGIADADDDLNERGVSLRLVVTLASCLLGTENVIPTLA
                     VTAASCRAATRAARKSCSLRVVQEEQTKAYRGALQAGQVTVTVEAVPMMAWVDLLYTP
                     YLQVTVPGYQSAKERLVQQDLWLSEDLLLSERTPLRVTNKLYSLVYLYGNGHTIHMNA
                     SRHGKLIFLEEGVTLRIMNATVCMTALSIEAYVAAGNGSYVVIDPETCSVVPPPSALE
                     RDAADVVRSAVLQMDHQRRTAAEESTKAVEEVASPRWQRFIGEVQVELRIPEPRSVAG
                     TASMLCASTGHASTTWAQRTLVLYTDMNLCLVNSRSAATDEDELTGAFDLAHAGVRSE
                     YCAQHGGTAVDTSDLVSDWAMKVLMTEEKRRRTGGPAGLPVRLDTIHVSASTGVEVRV
                     RYSDAVFVARAVRHAQAAASRWQDAVRRDVWSGLSSLHRGWDAVGADSEASVGSLVQA
                     RHSRSGGEARNVLAASAGADTTVATVLLQIPYVSLFIIDDSQDNDTPLFCFYANEIHT
                     PQCALESLHTSAELRFVLQLEYYELSRSQWAPVLEPVEVKVSFSSRKNASVMDLYDRK
                     GYARLSTRMSSVKLCFSSEMLRNVRQLLLLRDMFESAGVDALAMRGTSDGGVASASVF
                     HAFKMVQTIGLDVVVQLPEYVENPQGVQRRASDSHDDDAASTRARVLHVGQEWEFNLP
                     RYRGKELPLEHQKIIVQQQQQQERPSTAPASKACGAVITLASVGVQRVTMGTSGPLQR
                     YILADVSVPLERQGQKQVLLHTLVTFTNRLSMPLLQVVVDAPGTYDAVGVVPPASSQC
                     VPVQVLRRRVALALGNFAEVSTSSPALTQMQLDADSIVSLGMSYDSLPCLAGTVFLCV
                     CSSVHGSRSSASRGSDAGGVARIAVGKNFVVLSGQPGKTYFLLRIQAAARQPADVLRH
                     PSLSPLRSVIVTAEAVVTIRNAVGVPLTVTLLTRRTQPGRRISLLDTSPDTAVYTCVC
                     SVAVGVDGSYGATEMDPLEDVCLSVSLQQPNGVTLAQWPTAPAAGIPTAQHPPACVHA
                     PLDKTRRDTKLVLVDPVTNETLVLAIKYAQREVTLYCRHWIFNQTDVPVQLADTTRPH
                     HGDTERCIVPIAGLSGRTERTATVSPWKFNARGGGTQLAAVHTGPFLYHSLQAELCHK
                     DKSHAGSKGLFLRLLEPTEAGTSGGAAQALWSEWSSQPLLVHEAAEVQVIVCASRQKR
                     GAVWVLSCRVEMGHQASVRAYSDTRVVSIFPRWVLVNKSPYALRFSQHSSSGGYHPPA
                     PTAQAAPFTKTVVSTLVAPAMADGRVEPLFSFAMCDDKVHNIEQCLWSPPFAIHTVEE
                     QYVNLVYQTRGSLAEHWPQTSARAGQRAAQGVVDRLPPLRPEDILEVGEELFVRREEA
                     KVFNVRTYEHKGCMMCVQVEEAVQPPLVLENRTSFTVCFRQRGGRRVSTVFPRRRKAW
                     TWDAPPAAGRLPAEVELWVLTDGVDGTANSAQEATPAAAASCVLNFDPQQIGCRSSTV
                     DAFQCELDVGDSATGASSLLFVRVRGVHGISYAVSITMEPTVDVYRTLPFPQLSLALH
                     LASMYVLCRTTGKREGQLQDMLLLAIQPVDFSFVQGARVSNGASRPSATGSYEDANEG
                     DVQQIQLRFRSFQVDDERPSAKQRVVAQLVDDRESGFQIERKLLRITPILYCSVVAAW
                     LTPVELHIEDGFITAMMGYVEEVVSSWEALRPSSSCKRIDSASAAQACQALLFPWQVR
                     LERELIAAKQHFAKAQEDSGQTLRHRRRSSVPLWSRVVAIQRLLVDPLLVSLSLYRSP
                     GAADDPLWKLAGAASLLIGSTQDSRLQWDAVQRRNVCDTIWHLAFLYRDSYVKQMKGQ
                     YMSLVNIMGLDTVRSLVSDLLHPFGDEHTNRRGGDNGGRGAVRRQKQRVPCRRAANLL
                     LDHGTGGTRSFSRGAATSLRRASLASASAGRVSDDMREMEEAFSATTSWLLRVPERVV
                     QVSSQRTATVAEVARSYAWHDFMAVAQTPEIRAFGGCALAHALAEMRWTPRYSLQRTE
                     GSGRRQSASDFVRATLDSCRRGAEGCALPQVDCSRCAELEALREARLRSRERTPLPHP
                     VHDGFLTWEEFAHHINWYEFVDMCSDEEVRTYAPLVCQGASEASCNVCILTAL"
     gap             652631..653243
                     /estimated_length=613
     gene            complement(<653246..>653545)
                     /locus_tag="LDBPK_341510"
                     /db_xref="GeneID:13392722"
     mRNA            complement(<653246..>653545)
                     /locus_tag="LDBPK_341510"
                     /product="d-isomer specific 2-hydroxyacid
                     dehydrogenase-protein"
                     /transcript_id="XM_003864265.1"
                     /db_xref="GeneID:13392722"
     CDS             complement(<653246..653545)
                     /locus_tag="LDBPK_341510"
                     /codon_start=1
                     /product="d-isomer specific 2-hydroxyacid
                     dehydrogenase-protein"
                     /protein_id="XP_003864313.1"
                     /db_xref="GeneID:13392722"
                     /db_xref="UniProtKB/TrEMBL:E9BQV2"
                     /translation="MAPTICVCVDDDLCGAVCDVLKQLEGRISAIVCGTDVSCFASVK
                     ADNDGIFMVVSGSCAHAVIKDLCDDYDKEERRVKLIYSLSAGVDAYKLSELKQELS"
     gene            complement(<654908..>655741)
                     /locus_tag="LDBPK_341520"
                     /db_xref="GeneID:13392723"
     mRNA            complement(<654908..>655741)
                     /locus_tag="LDBPK_341520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864266.1"
                     /db_xref="GeneID:13392723"
     CDS             complement(654908..655741)
                     /locus_tag="LDBPK_341520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864314.1"
                     /db_xref="GeneID:13392723"
                     /db_xref="UniProtKB/TrEMBL:E9BQV3"
                     /translation="MPVLETGEQSVKSAYHCATLLDNWDEDRRQFGQPVPATSGTGDF
                     DPSTTYNASYKSLTAAQTAEAKPPGCFAAEAPRMLLFHHGDIGNIETYCYATSELALP
                     DRKRQVYTNDEVLDMPGVSTRRNKTAALQRSTMGFTVSCSGHGGTLTNGFCADEVSAA
                     VQREVAYLQSMASTMLSTRYSTGDAQTSTSDSGGERAAANSGSKYAPPRLLPMGRVAE
                     RERLLTTKNVSIDATGVYVFDNLEAYPLTSSQCVGKMTKSCDNPMHKTCLRVHYMEDD
                     Y"
     gene            complement(<656712..>658442)
                     /locus_tag="LDBPK_341530"
                     /db_xref="GeneID:13392724"
     mRNA            complement(<656712..>658442)
                     /locus_tag="LDBPK_341530"
                     /product="tyrosine phosphatase isoform, putative"
                     /transcript_id="XM_003864267.1"
                     /db_xref="GeneID:13392724"
     CDS             complement(656712..658442)
                     /locus_tag="LDBPK_341530"
                     /codon_start=1
                     /product="tyrosine phosphatase isoform, putative"
                     /protein_id="XP_003864315.1"
                     /db_xref="GeneID:13392724"
                     /db_xref="GOA:E9BQV4"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR014020"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029023"
                     /db_xref="UniProtKB/TrEMBL:E9BQV4"
                     /translation="MNSELVDMTPQVPTTLCEKVEHYLRDRTRYLHVQNEIPQEVTNE
                     LAMVNNYYVSVANPQDMRFTNPGETTVDYVCRIVYNFFLSLYVQAALLVPTLLFLLFI
                     AVRTHHSPMFLLVYSTVIDIEVLSMWAYERGARFAARFWWELAWLIVGLIVTSIHALS
                     PANVLCVLLLVVHWMFMARITVIQVSRALRVFCASERRCYIAEGVVLDMAYITRNVIA
                     MGWPARGTEALYRNPWNEVVHFLRRKYARLSSHVITLCSERCTAPFPRQSTYPVDDHN
                     PAEVPLMISFCCEVADYVMADPYRRAVAVHCKGGKGRTGTMICAYLMYCGQCRSADAA
                     MRHFSLLRSRIGAQKLQGVQTPSQERYVRYFERLINEQPGMIIPSHPRRVRRLVLHNI
                     PPLWVRRGVEHLWMTVIVKPCTERRVVYLTNRTVTFNAAVPDSRTYNWRTQIKDLFHN
                     DEEVVYQEANEMDATESGCTGYLPDARSFRVMGAAGATLELAFPDEIPAVDGDVCFKF
                     FYYKNNPNPLRPPVQFWIHTGLETHSTIRLERRDLDGAFKDTRGDRYPAEFAVELVLE
                     DAPGGYTARE"
     gene            complement(<661884..>664871)
                     /locus_tag="LDBPK_341540"
                     /db_xref="GeneID:13392725"
     mRNA            complement(<661884..>664871)
                     /locus_tag="LDBPK_341540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864268.1"
                     /db_xref="GeneID:13392725"
     CDS             complement(661884..664871)
                     /locus_tag="LDBPK_341540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864316.1"
                     /db_xref="GeneID:13392725"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BQV5"
                     /translation="MRVLYGTPLPPGLVAPTRGELRLRIDQLILDDEVINHSPLVQLF
                     EAPDSASAVAATDVGGAETATASFSRSPNHFVVPVDYCSVGPIFWGETRPSAQGQPAT
                     PQLRRGPVTMVYPIKMAATQFGAYLERMTESPQQGVQLDVFVPSSYSGRPPVTVGRCR
                     ITLDTLQPGHPVKGWFPVMHRRARLSAAEADLSKYVELAVGKVKLTVTVEYYPSSRQP
                     SAEPTAATKHKRHEGKDGGHVPLPRAKTRRSHRHPGRTGEDAAHPPTETSSTSTETAA
                     AESPVSSLLSPAARETARRRGRHSGHVGHHGTALLRDKSAVTHQLLQQGLRLRAQMEA
                     AARGLSLDNFDSSTDMTVNRHRGVGHGHVSFEDVGTGVLADDADEDISDGSGVVYTSA
                     DSDEEKFALQMQKDAEARDRRGIQQQQQSTVPSSSPAAPAAVGQHLVRSSAVGAASET
                     AVEVLPIANDGSVHGTRAAVELCFSNFSFAQTSLTADLHKIRINVRLSSDITTLEPSS
                     GPLSSFVHPVPVQQPFICLLFDVCSFFEDHSKLVVEAYKVMSELELDNENDGWDVQGP
                     RHVAKEELLGLSVIGLYRQSRAVVFRDPVADTSNVFAQLDVRVRPHGVNHSTATSTVL
                     DAPAQQQQHQHQASWNVVRGTINSSLRTPASDAVPPSSIAACASDTRPAKENAVSVSK
                     HKSSTERGHVQDASAGEEASSIAGIYPPHVSHSPVGNSSSSTTRELRRLRVVVYSAAE
                     LPRVAVAQGRGHGAVTGSGVGHFPIISARPRSIPEAGVEGVTSYAEPNSFVTIEEVYR
                     VAETWCTKSKTAAPTSRGASAPSSSRQSIHNWYVDEARGGFYDRSAVAKESSNPSYNY
                     EVTLQLPEMTVPTGNGTAAAAVTHGLADVLDELQLAVWHSDLSRQTFAASGTIVTNGG
                     AGSGHSRSRGTGVRQQEEHFWECAAYMGTCRVDLRPLRYLKTLDGYYRVVCERTPGSA
                     VGPTSTDVESNTIGYVRLSVSLQ"
     gene            complement(<667885..>669453)
                     /locus_tag="LDBPK_341550"
                     /db_xref="GeneID:13392726"
     mRNA            complement(<667885..>669453)
                     /locus_tag="LDBPK_341550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864269.1"
                     /db_xref="GeneID:13392726"
     CDS             complement(667885..669453)
                     /locus_tag="LDBPK_341550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864317.1"
                     /db_xref="GeneID:13392726"
                     /db_xref="GOA:E9BQV6"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR025952"
                     /db_xref="UniProtKB/TrEMBL:E9BQV6"
                     /translation="MSVTDSFPTQQTPSGALQQEATERMTIQNGPMQYDQEMHFHTYD
                     VYRHGKRQIHTRSVGYSSDGDLVMMREDYSEPSDVDNGFVLKRTEISDPAVLDPRARR
                     PLTDKELHSKKKIHLNRPRYKKYPGIRAPKNRKVRNRLLNDFFAHELAREVLVKAQKW
                     RALNPDEPETSVGPSFADLPKAVMHAFDLEGEEQLLEFERLRVHPDMLGPQLRNVRAP
                     PDPDSPEGRFQGLNTRLRGELQHALNSEFLTQQIEDLEVHFSAFIKDGSKSPESLVFH
                     FRDGYGRLICHGVAAYYQLVSESRTVMDGSGTKLTYVSLPKTRRQGVRAVNPPHVPLM
                     LVLKRNRRNLPAKHSLSAQTTPQIAPTPDMVASPPALGLEGDSTSKEAGVDDAEVMSP
                     LDLNAPAMPNVRAQPTSHSGLVGRGKATNGHATGAQRIDSGGKNPTVFRTVHLKLPTA
                     DPLPFYIPMLRLTLSVEQQEDAVEQLEAASAGVSPDLGPFTPPLTATQRKKLRKAERV
                     RSADASQDDYSTRR"
     gene            complement(<671053..>673170)
                     /locus_tag="LDBPK_341560"
                     /db_xref="GeneID:13392727"
     mRNA            complement(<671053..>673170)
                     /locus_tag="LDBPK_341560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864270.1"
                     /db_xref="GeneID:13392727"
     CDS             complement(671053..673170)
                     /locus_tag="LDBPK_341560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864318.1"
                     /db_xref="GeneID:13392727"
                     /db_xref="UniProtKB/TrEMBL:E9BQV7"
                     /translation="MSPCAATALRCARRCSSTLSLNSVPNKEEALSSLQTRLSGESVQ
                     SSTPRSDDETANLATSIVELLQYRRQITSVYTGLLADRRVQYRDELLLSSLGSTQADM
                     QVLLRRLLASPPEAAASATQIAQEAPPQMTPDAVRRLKETWTRINGVATHSRDAATRQ
                     AYFSEVRDCYATLICSGLLRTESEVRLILSEMRNTDLIEPDASFYEVLFVALWCLDDV
                     RESTVATGKHRAAGSRQTPEIVAGEVRQLRRSVVGDLAGYYMGHALAQLSTSRAPIAS
                     AAPMHTAVRPETWEVFFATLANTQPAPKLMDLWWKRLLEWLDEQVPLVSARTSVGALN
                     KGASAAKGAPVPYQAAHAVLAWCAQSREMEKALNYFNAVNQRGVTLHATTMPHISLPA
                     ELVEDFTRAGCLTSPSTHTSVQQLQLALLVKLMVSTKSVKMDGGLRALVVRDVQRQVS
                     PDVLYTAPWEVINDFIAGLSVPSAMQLLRRCSSSPAAATASSTLSEKRSSSDDGACDD
                     EATVGSATKGEGGREIPFFVWASLLRRCCREHLQDEAESLFVFLRKKFSVTATEKREL
                     IEIMMRMYTTMHPADFPSAMDVFLQHVLRTPEGEPTVKPDTVLYGLLVKGADSRNAAM
                     MVFLEACAAGVALTEELFEALMGSTQYKTVASLSRKLPHDYAASSLDAQLKIPANADA
                     HLRREEALRARGKPLYDSTGDVG"
     gene            complement(<674003..>675187)
                     /locus_tag="LDBPK_341570"
                     /db_xref="GeneID:13392728"
     mRNA            complement(<674003..>675187)
                     /locus_tag="LDBPK_341570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864271.1"
                     /db_xref="GeneID:13392728"
     CDS             complement(674003..675187)
                     /locus_tag="LDBPK_341570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864319.1"
                     /db_xref="GeneID:13392728"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:E9BQV8"
                     /translation="MRRRVGVGHVLQERQQQQRMADLGAQITAERVGQIEDQLEELQA
                     QLKALAQNHKSEITEDPVVRARFRQLADSLGVDLISSKKNVFADALGLGDFYYQLASR
                     TVEVCMRERKFCGAYVPLQRVQFFVQKAYDASSLLGGNAQNCHHALQHSSGSGSSKCG
                     RRDEGKQIVISEADILTALSKLSVLGAGYNVVKLGGVSYIQTTPDGARGGDHVLLLNY
                     VLGLQKEKIERAKQAAVEEQRKSAPMASEGSTRATAVGGSGHRSGVGAAYALGAHPFD
                     LGKGKDSETNVSLSFSQQCVAVRESQVASGLHWETHRARAALKRMVQEGTVWVEESQD
                     KSGGRVTTAGARGGSPAKSKAILSSTEEVKEVWKRKHTRMAEAADKKDVVYWFVSLTS
                     HG"
     gene            complement(<676025..>679030)
                     /locus_tag="LDBPK_341580"
                     /db_xref="GeneID:13392729"
     mRNA            complement(<676025..>679030)
                     /locus_tag="LDBPK_341580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864272.1"
                     /db_xref="GeneID:13392729"
     CDS             complement(676025..679030)
                     /locus_tag="LDBPK_341580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864320.1"
                     /db_xref="GeneID:13392729"
                     /db_xref="UniProtKB/TrEMBL:E9BQV9"
                     /translation="MLPLRATPVRKAPVIVLEEANRAHTIETAASTYSELEASPAPVT
                     WGSESTSASPSPASGASHHSFHPIRKTFARSVAPTTKAVKHSAQASTIASPPASGTQL
                     LSASTRESSSPPAPPSPLCGIIDFYRGSSPSPHRPTQYAGGDPRESEQAELKSAAGSR
                     AGPESPSLSSSRASEMFCRRPAPARSYMEDLLAMTDEDGNGALPQVETAPAMRDSSGV
                     GHDSTSPSPRVIGLALDNSPVVPEMWEETSSSAPTSSTGVSDGFEKAEESQLRHRSVS
                     VARIHFSSASPNSPLPAQLTASPMKWRRSVKGSPPSQANASDVPQRSAAMIQEKHASS
                     PMADTKAAWSATMFATKARVGLNRNSRSGDFVHREAVERVLRFPADTTQEEVARIDYV
                     DNEKDGKGAKIASAASQAAPVVSDDVAGHCSGQSRVQRSPYVAPPLSSRRLSGFPASP
                     PVGTERHVMIPSCASSEASVRRGTWFDGLGGGLVSAPRETRTDSASPSVHRFLGCSAP
                     YFPMNRWNVAPPLLRRVEEEVAASEPHQPPNCSAKKPSVRALLARLYPFPSASARRGA
                     GSGIVSHDKRYASQMSQRTADAPPPRWNASTKIHCDPLTGGIELACASKRHSSVRHGG
                     RSGSSDDYVSERPISSPRRRSRSAPAQAPLHTRASLLRLEATKARKAADAALHEEVAS
                     PPFHPTVAPHSARICRDKLRELKSSHVAGVAAGAAAAAPAPGTQLEQASRTEKSESAA
                     KAWHGTSRQDIVGDAAVVADVSVSSSEEVDAVATARAKGPSCPLVATLPARQPPLPQV
                     AELWGASSIDGARMYADAAALRERRQATQHRWLQERKPEEQPHMQMHPRRGASSCAAR
                     QPTEDLGCPKPPRPQVSAATDRISTSTQCDLLPSERTAGPEKMAAPGFDLQLGATPVS
                     VGAEHAPLTAGLPMATHTALQRVDMYSTTPTDALKTRATSLERQHRVEDQLLELETGR
                     RRRLGMLRHLASTRDSLTGELLFKPFTGR"
     gene            complement(<681103..>682161)
                     /locus_tag="LDBPK_341590"
                     /db_xref="GeneID:13392730"
     mRNA            complement(<681103..>682161)
                     /locus_tag="LDBPK_341590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864273.1"
                     /db_xref="GeneID:13392730"
     CDS             complement(681103..682161)
                     /locus_tag="LDBPK_341590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864321.1"
                     /db_xref="GeneID:13392730"
                     /db_xref="GOA:E9BQW0"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="UniProtKB/TrEMBL:E9BQW0"
                     /translation="MPSLPKKVPPPPKEPGTHTNAEVKEALHARALRRTVLVTAVVFL
                     LLACLAVVSNTARKTVGDTRKPKMVMIVAKGLSPMSVGRALRSNKSPFMRLLSKAGGQ
                     FATIAAKSTANPLVNLLTGSATISADTLVNTTSILGWLKSQDKHTIVAAPSAYWSLGA
                     AGTSPCPQVGLLDTECSGQKCPETKESAYCNAFRKYITCDDCAQLYNDEILLGFEKMI
                     NHSADALYFQLSKLAEAEVNNPELAVQERSEVNLLDSTVGRIALALSRRTSEEAENWL
                     MIVTSDGANAEMAAPLLMVVYTKGELVQLSDIAEDANTADVANTIKYWFKSSNVNTSR
                     LLGICTDGEKVENCKSTT"
     gene            complement(<687889..>690300)
                     /locus_tag="LDBPK_341600"
                     /db_xref="GeneID:13392731"
     mRNA            complement(<687889..>690300)
                     /locus_tag="LDBPK_341600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864274.1"
                     /db_xref="GeneID:13392731"
     CDS             complement(687889..690300)
                     /locus_tag="LDBPK_341600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864322.1"
                     /db_xref="GeneID:13392731"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:E9BQW1"
                     /translation="MSESAETSASLAERHADPMDMEAVEEELNVGKLEQLDDEANSKL
                     FNHSRAEVERLRNLTPDMIRNMDSHIEYAVDAFFANRIADCEATLRSRMSEDPLAVCG
                     AGLIAFVRCGLSMEQAQADIALELLTRSSALATQVMSREKSMLSRGFSKVFQRNKETE
                     GNWLSAAEFRAKTMHAESQALRCFVFVLQQSVSALVKAGLALNRANSSYKSLYMELEH
                     RYKAKYGGKETVKTSQHKPAAAEEGDSDVNSPLRSPSWLTARHASLEQSAALETLGLD
                     RNSVHCVEFGLGAMKLALSILPDNVRAVLRFIGVEGDRQEGLKLVRQCFKSDTLLSPF
                     ASALLLALYGMLPATSAFLVDSYLPVAHEVRTEVLQKEKMRESILHLWLDGRIERLTR
                     SVDLSISKLNNCLAIASNSQLLAAMPQLRDFVLYDQWFNYAIVHQWKRASRCLEILSK
                     TSKWANAVYQYTQACCLEMLEMEWAEGIENPDGALDFPLEDLNRILGSSEEKVGLTFS
                     DVSTRKAIAETITQLYWEAAQRKPVTLGGKPNHNDQFVLKRMEEILVSHGITPSTVVA
                     KKKLGEPLEPVPEGLIIRNIVPLPAYEKCLIAGIAHQYPAERKEKMVALIDAYLLREP
                     VQCNTPLSDYVDSMRERSKGKATSRSLAFSSKAASEGSPVSREVASPAASPNPHEPRA
                     SLPENYRLLCLCVYKSMLLANSESKKDRQAALEVIKAIRDTPQYKDRQWSLSYAQAFA
                     LYDKAYIAYRDESLEAAESIMNQLHKQYDSAHYYMHAKMDLKAHLASYHLQEERQARA
                     AKLTK"
     gene            complement(<692960..>694489)
                     /locus_tag="LDBPK_341610"
                     /db_xref="GeneID:13392732"
     mRNA            complement(<692960..>694489)
                     /locus_tag="LDBPK_341610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864275.1"
                     /db_xref="GeneID:13392732"
     CDS             complement(692960..694489)
                     /locus_tag="LDBPK_341610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864323.1"
                     /db_xref="GeneID:13392732"
                     /db_xref="UniProtKB/TrEMBL:E9BQW2"
                     /translation="MSVDAMTPSFEGTAIKVYHEPPQQLALSNHNLHGFTRRVETGDV
                     PLRLDVIPDDAYVDYGTNLPKLNTEKEEVGDHREASVLTAAGRTRDPGDLSSEVADSV
                     TQYSNASLHGGETSIEGNGWNIEDASVDPQVGSPTRHHTDPLSSANLNQHLHELSRGP
                     APLRVENIAASGVPYLQRQRNASTTTVLPETTAASLMVESSEVDAMSTSEVASLSRIR
                     PAKLTSVGDTMDDMWSTTSTRGFDTMYLGTGGTKDETLHALSKENLRQLRHQLESGET
                     PLRPEVLAGLSTMVQAMTQTKSAKSASTAVEPAMTEGRSKLVDSAACLGSSLQSFADA
                     RGPFLLASANLTKDGDASAAAGMSFRRTLMDMPAREACDGRAHDSSDYPNEEFLRSPH
                     VDVSDRDVDEEGAVDEVEAENADEEEDPLHVKTSTSDDSCEGQNESVFNMTEDDGVDD
                     MSDPAAMSRHMRELFKLVQEGRQDQSHLLQLVLEQRSVIQYLQSTVKDLEAELSALKK
                     H"
     gene            complement(<696983..>697381)
                     /locus_tag="LDBPK_341620"
                     /old_locus_tag="LDBPK_341630"
                     /db_xref="GeneID:13392733"
     mRNA            complement(<696983..>697381)
                     /locus_tag="LDBPK_341620"
                     /old_locus_tag="LDBPK_341630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_024473487.1"
                     /db_xref="GeneID:13392733"
     mRNA            complement(<696983..>697381)
                     /locus_tag="LDBPK_341620"
                     /old_locus_tag="LDBPK_341630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864276.1"
                     /db_xref="GeneID:13392733"
     CDS             complement(696983..697381)
                     /locus_tag="LDBPK_341620"
                     /old_locus_tag="LDBPK_341630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_024329257.1"
                     /db_xref="GeneID:13392733"
                     /db_xref="InterPro:IPR008907"
                     /db_xref="UniProtKB/TrEMBL:E9BQW3"
                     /translation="MDNSHFSKMLKECKIIGKSFTSTDADLLFSKVKAKEARKISFTE
                     FKEKAIPEIAAKMKKTPADIEAMIANAAPKSSGTKADTVRFHDDKSTYTGAAKQGGPT
                     NVDRNAGSLAGVVDRRQETIDNRGTTAKQI"
     CDS             complement(696983..697381)
                     /locus_tag="LDBPK_341620"
                     /old_locus_tag="LDBPK_341630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864324.1"
                     /db_xref="GeneID:13392733"
                     /db_xref="InterPro:IPR008907"
                     /db_xref="UniProtKB/TrEMBL:E9BQW3"
                     /translation="MDNSHFSKMLKECKIIGKSFTSTDADLLFSKVKAKEARKISFTE
                     FKEKAIPEIAAKMKKTPADIEAMIANAAPKSSGTKADTVRFHDDKSTYTGAAKQGGPT
                     NVDRNAGSLAGVVDRRQETIDNRGTTAKQI"
     gene            complement(<698203..>701409)
                     /locus_tag="LDBPK_341640"
                     /db_xref="GeneID:13392734"
     mRNA            complement(<698203..>701409)
                     /locus_tag="LDBPK_341640"
                     /product="kinesin, putative"
                     /transcript_id="XM_003864278.1"
                     /db_xref="GeneID:13392734"
     CDS             complement(698203..701409)
                     /locus_tag="LDBPK_341640"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003864326.1"
                     /db_xref="GeneID:13392734"
                     /db_xref="GOA:E9BQW5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BQW5"
                     /translation="MGNDDKRGDSQSPPRRTRQVAWMPPDVSASPIHLSTPSAHRDPI
                     ASSGAFATEEAVKEGERCFGRIRVVVRCRPLQPDTEADHSSECVRIKGDEVIVCDKAM
                     QKEGRCYRFDRVLPAEADQVTTFAEIAPLVEHVLDGFHATVFAYGQTGSGKTHTMDGL
                     RYASNSQQRKAIVPDVDGTEVQQHGIMPRVIQLLFDRARERQCATVFESTEAQHDAET
                     LDDGVEYTFRCSFYQIYNEKITDLLRGTGIPGDVGEATASSLSSSSALTKLKMGARSK
                     RGVGDGDLRVRWHKGDVFKVENLFICTCDSPAEMREMLFSGIRQKVVSSHLLNHRSSR
                     SHCVFTIYVESRARQKGELLNRSELSLVDLAGSEKIGLLSHNPSARLVKESIDINTSL
                     LALGKVITALSSGPAPAAAELKRKNLGLAPRARGGAEQQAATRHIPYRDSKLTMLLKH
                     ALGGNSLTTMIACISPSDRYVDETTSTLLYAGRAKNIRNEPHVNEDATTVLIRQLREE
                     IAQLKAELGYYREMAANSLVEREGRVNACECCCGAVYKDPPRSVDPSSLTARGTTEDI
                     AMVQEVDQLADSLVAACGMLTNLMQVNAQLREFYDAVRDRQDAAERREAELNAENLAL
                     RERLAVLEDIVLQDEDLGEVKEDNMIGNGDASDADEKLNNSPPGARASKSDKKRGRSR
                     ALEETLAVAKESSAAPALGRLADDSACGGKMADSSAEGASSSHRLASSSTAVGQPATA
                     TKEDCESNSPVLAPPDNEAVASPVRKIAPGSSTTVKQLSIALRGVPNGSPPFEDATLK
                     GPADRESSRKCAMDDEGRRRLHGHKKRTEKKRNGLANRLKEYEAQYRTPHTIETYADY
                     YKQPARSQSLAAVVPGVPAIRASEAVAPHVTATLQDMKMTVSKLPKAVVREYVPASLL
                     RPGLFGCLAFGGGDSEKALFEQNRSSREARLRALQQRQQELYRQVRLAVHGLRSEDPA
                     SGVSPPPSASATSSAASAPQRPNSTSNIPGTAGKREEMISSRSGFAHLSCEPALAYAL
                     QAVNRTATGPYHEPSMRQRPRAPSDSMKRLMRYMERDR"
     gene            complement(<702282..>704609)
                     /locus_tag="LDBPK_341650"
                     /db_xref="GeneID:13392736"
     mRNA            complement(<702282..>704609)
                     /locus_tag="LDBPK_341650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864279.1"
                     /db_xref="GeneID:13392736"
     CDS             complement(702282..704609)
                     /locus_tag="LDBPK_341650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864327.1"
                     /db_xref="GeneID:13392736"
                     /db_xref="GOA:E9BQW6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQW6"
                     /translation="MPRPRTTSAYPLQRSTVLCAQSLSVFSHLIITTRTIVQSNMTGG
                     VRSLLDQFETRTLITRLRRNRNGNYYRFRQKLWLSQEALEKELTEITYSPVERHPFAL
                     LPQRETPRQVFACEGRGGTMLLEAVHAEARGASASESSPTPAAVSLLPHQSKRCDAND
                     SLDFMASLLRADQSVSSKIITEADVEGTVLESARFRARQILASDLTCNAVAASPSTSV
                     SLRNPAESTDAAGTSWSALGLDPLISSAAEQLYGPVPTRLQARLLPALLNEDHNDVLF
                     NGVTGSGKTSALVLGLLQGIRSEAAGMNVLVATNTINAMRLHDTVKALCRRAGGGVVV
                     DRPAEDYSWLFLGTYREDYESYYEHLRRGLRRATGPARLFITTADVMCQLLFEKKMEF
                     EDFGYLRRVYVDDIGAQVPLLPESAPVAVVRERLRNPLAAELLLGTLHQLPGPHVRSV
                     LQLGMVSADVDGKLKDHLQALCMKPVAQTTVLSTVRIPSTVHCLFSFYLGHREDRFSY
                     LVRLLWNARETIPGRAVLFVPDAEDVLRARLRLRGLGADVKIFSEVHGGGEFKGDWKF
                     LLLKESEAFGVDLPLVSHVFITFAPTSWQRFLHMCGRTGRMGNVGWVYVVSDKQDAKS
                     VRDVAEALSVDFCNHVISDDLQQARPADVERFTKQPELYGLDPQFAVRQHYTVQAENP
                     DMAYRKREFFSKPAIKQFQMEDYTSISIKQRRFDHARQLSQDVERNPSIVLNMQKRGL
                     LDAHLKPTKTLKRYMDLKTHREAPDPFQKERKRRQ"
     gene            complement(<705679..>706179)
                     /locus_tag="LDBPK_341660"
                     /db_xref="GeneID:13392737"
     mRNA            complement(<705679..>706179)
                     /locus_tag="LDBPK_341660"
                     /product="ubiquitin-conjugating enzyme, putative"
                     /transcript_id="XM_003864280.1"
                     /db_xref="GeneID:13392737"
     CDS             complement(705679..706179)
                     /locus_tag="LDBPK_341660"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme, putative"
                     /protein_id="XP_003864328.1"
                     /db_xref="GeneID:13392737"
                     /db_xref="GOA:E9BQW7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:E9BQW7"
                     /translation="MSVRTVRRANMDFARLKELANSGSPTISAVDMADENGATAHGDA
                     FHWRIRVMPPAESVYHGTTYDILFTLSQEDYPFKPPAVRVLTRIFNPMVSEDGAVCEG
                     LLHNDDWKPTTPVADVVGHVVKAIFLDYKTYAVLNETAAGVMVTATPEEFKKHVQRTR
                     ASDAST"
     gap             711453..713107
                     /estimated_length=1655
     gap             713501..713594
                     /estimated_length=94
     gap             714871..714969
                     /estimated_length=99
     gene            complement(<717420..>718199)
                     /locus_tag="LDBPK_341670"
                     /db_xref="GeneID:13392738"
     mRNA            complement(<717420..>718199)
                     /locus_tag="LDBPK_341670"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864281.1"
                     /db_xref="GeneID:13392738"
     CDS             complement(717420..718199)
                     /locus_tag="LDBPK_341670"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864329.1"
                     /db_xref="GeneID:13392738"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQW8"
                     /translation="MSDTVCVHVQRQQISPCQALAHLRSRLAPRQFSGAVSAPPSSTH
                     PMASLSCLCRSFCSHVEKTCSSVTVLLYVILQFIAFLLVLVATPIDMFRLKKLYQYPH
                     PNPCYTLWGAKFDCSSSTYSVKLSMMWSPCPSRRNLFRLAQVFAVISIFLYGAAFILG
                     LIVLRCCPWLRWVCLVLNIAGMATLCIVWAAMVVTYYKDVPQRCMPLHFFVNYGAGFG
                     LCLVAWCLDIINIGLLLLPLRVRDPGKIGKSVPSPRPGDEK"
     gap             718548..718780
                     /estimated_length=233
     gap             718885..719614
                     /estimated_length=730
     gap             720087..720250
                     /estimated_length=164
     gap             721490..722839
                     /estimated_length=1350
     gap             723780..723942
                     /estimated_length=163
     gene            complement(<724932..>725564)
                     /locus_tag="LDBPK_341690"
                     /db_xref="GeneID:13392739"
     mRNA            complement(<724932..>725564)
                     /locus_tag="LDBPK_341690"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864282.1"
                     /db_xref="GeneID:13392739"
     CDS             complement(724932..725564)
                     /locus_tag="LDBPK_341690"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864330.1"
                     /db_xref="GeneID:13392739"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQW9"
                     /translation="MSGLPFPSLRCLPAVPLDYKRTLILYVVLQFVAFILLLVGTPLD
                     IFRSNPAGMSKTLICITLWGFKNDCSSLHSDLTLDDIFHYCPDRLRRFRALQIFVIVS
                     IVVYGAAFIAGFTLLFCFAVLRLTCMALNIVGSVILCVAIVIVAATFSKDDGQNCRRL
                     SSIGYRLGASFFLFVVAWILDIINMIILLLPYTDTESAVDKKAEPPTAQE"
     gap             726203..726301
                     /estimated_length=99
     gap             727270..727368
                     /estimated_length=99
     gap             728207..728305
                     /estimated_length=99
     gene            complement(<728956..>729774)
                     /locus_tag="LDBPK_341700"
                     /db_xref="GeneID:13392740"
     mRNA            complement(<728956..>729774)
                     /locus_tag="LDBPK_341700"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864283.1"
                     /db_xref="GeneID:13392740"
     CDS             complement(728956..729774)
                     /locus_tag="LDBPK_341700"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864331.1"
                     /db_xref="GeneID:13392740"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQX0"
                     /translation="MAPSVPLILYVVLQFVAFFFVLVGTPIDMFRSSNSSVFVGQCIT
                     LWGFKRDCFSLNYVRTVDVSFEKCPSRIARFRLAQGCAIISIFVYGAAFILGLILLFC
                     CSLLRWVCLVLNVVGMVTSCVVWAAMAVTYNKTDDRACLPVKTLGRYGAAFVLFVLAW
                     ILDVINIFLHRVATPRLSTALPSDPPPAYRLLSPRPPCCVVLPPPHPCRCLCRLPRRR
                     PSHSLALVRCRPWRPVYPSFSTWSSSSWRSSSCWWERRLTCSAAATAVFSLASA"
     gap             729808..729906
                     /estimated_length=99
     gap             730496..730594
                     /estimated_length=99
     gap             731672..731731
                     /estimated_length=60
     gap             731897..732500
                     /estimated_length=604
     gap             734594..735005
                     /estimated_length=412
     gap             736360..736519
                     /estimated_length=160
     gap             738041..738139
                     /estimated_length=99
     gap             739538..739636
                     /estimated_length=99
     gap             740332..740365
                     /estimated_length=34
     gene            complement(<740366..>740641)
                     /locus_tag="LDBPK_341720"
                     /db_xref="GeneID:13392741"
     mRNA            complement(<740366..>740641)
                     /locus_tag="LDBPK_341720"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864284.1"
                     /db_xref="GeneID:13392741"
     CDS             complement(<740366..740641)
                     /locus_tag="LDBPK_341720"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864332.1"
                     /db_xref="GeneID:13392741"
                     /db_xref="UniProtKB/TrEMBL:E9BQX1"
                     /translation="MCVQVCARACGCVPVYMRMCVCERVSPGSVEGCVHWWRSMLTCC
                     GSRPRRPRPGATQTPSVLPLCAALRSPTPFAAVPSPWMLGPCAPAAHL"
     gap             741930..742028
                     /estimated_length=99
     gap             743171..743269
                     /estimated_length=99
     gene            complement(<743270..>743830)
                     /locus_tag="LDBPK_341730"
                     /db_xref="GeneID:13392742"
     mRNA            complement(<743270..>743830)
                     /locus_tag="LDBPK_341730"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864285.1"
                     /db_xref="GeneID:13392742"
     CDS             complement(<743270..743830)
                     /locus_tag="LDBPK_341730"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864333.1"
                     /db_xref="GeneID:13392742"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BQX2"
                     /translation="MAYNITVIVYVVVQFAAFLLVLAGTPLDIFRGVAPEILGHRMVC
                     ITLFGMKVDCYNKTYLETTEELWAECLNRLNRFHAAQAFAIISILVYFAAFTFGLLLL
                     FCCPCLRWVCLALNVAGILTLCVVWAAMVVTYYTDDSADCVKAKDEFTFGIGFDLLMT
                     AWCLDIINMIVMLCYAVINHAVKENET"
     gap             744312..744410
                     /estimated_length=99
     gap             746680..746778
                     /estimated_length=99
     gene            complement(<747156..>750200)
                     /locus_tag="LDBPK_341740"
                     /db_xref="GeneID:13392743"
     mRNA            complement(<747156..>750200)
                     /locus_tag="LDBPK_341740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864286.1"
                     /db_xref="GeneID:13392743"
     CDS             complement(747156..750200)
                     /locus_tag="LDBPK_341740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864334.1"
                     /db_xref="GeneID:13392743"
                     /db_xref="GOA:E9BQX3"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQX3"
                     /translation="MMQSPPPYVPFVEYVLKAIEHPPYMYVAKLAACCTMLFLTRENP
                     ELLQELCHKWAIRFAQDRFRLIRHIRKRASYCMNSLDLALHVGCDAKDSSEDTSDDGC
                     AAQSSDDHSDKRDVAAGMSCCDPDKSVEHLLSILNTLVPMYFSWNWHRADYVIQINKE
                     YEVYVREYVLPMCVDLAPNEGADDVVHTPWLLPPHTYLEPTESLLSVDTFTSTVAPRP
                     CVDSPRRPSYIASTLVGGTALNKHGIVSASGSPMAGNAKMDGLNFPSLQQHFTSTSVS
                     KGKPSDAIVATPLPKLSPTFGETLGNDAASTSSPSMMPVSADACNTATRSGFTHIMSP
                     NVMSARAFNAAAVYGLRFLTLSNYRKALQSNTKGLVIVFHAKYSAKSNEVIDMFQKIT
                     AKRLLDPMPTIAVVYAVAEPELSSLYKVSWFPTIVYIPPILHRQHCHQHPNPGAYTRA
                     DGATPLPTLSAPKALAKASTHSTQAPLVKFRCGHSPVVDAGSPALPHNEEVASRRTNG
                     RSGTASQGTTATPGTDDVARSPQNTSMGPRRSTPTRSQGKAYKIVSDVDAASGRHTSA
                     SPSSRPDAPSLVVQWADKRTTASPPTPTEILFSTPVGKSARNEFVTTPPQFSSRSSTG
                     ANSSIQGGSVEDGVQPLGEDSGGAERDSLEGILDGGDYVIYPLDGVQTVPALVEWISS
                     RGASVPRLRKMKEFFTCIKKIRQEEKFKRYRELHSAVVTLRRLQGIKDDLSVTGSGGN
                     GSTHTHLSSTPSHQQLPDQPLFIFLGGGMAAGKTTAVAALAKSSWWESHKEQSVVVNA
                     DEFKLPLECEMSLSEAHTHSTRAAENLLVKAINQGRSIVLDGTMMWKPFVQQVVAMVR
                     DAHLTLFKQGPGYNKKTQIEQYFVAEKARQPALPMPYKIMFLGITVEVETAVPRGFLR
                     KFQTNRGVPISMQLRSFKLFAENFTDYVRMVDETTLFNNNIFVKLEKGELPPVLAECS
                     NTTNGQLVVHDDAAFQQFLRQQQINDDADNVLELYPATPVAH"
     gene            complement(<753336..>754169)
                     /locus_tag="LDBPK_341750"
                     /db_xref="GeneID:13392744"
     mRNA            complement(<753336..>754169)
                     /locus_tag="LDBPK_341750"
                     /product="pyroglutamyl-peptidase I (PGP), putative"
                     /transcript_id="XM_003864287.1"
                     /db_xref="GeneID:13392744"
     CDS             complement(753336..754169)
                     /locus_tag="LDBPK_341750"
                     /codon_start=1
                     /product="pyroglutamyl-peptidase I (PGP), putative"
                     /protein_id="XP_003864335.1"
                     /db_xref="GeneID:13392744"
                     /db_xref="InterPro:IPR016125"
                     /db_xref="UniProtKB/TrEMBL:E9BQX4"
                     /translation="MLHSKAGIVVFITGYGPFATVKVNPSSDIALRVVENLKRHPDVA
                     EMRYTELDVSVTTVAAYFEKVEREIADIIAEHGAGKVKILLCHLGVHNDTTGLIRIEV
                     QGYNELFASVPDVDGKVLNHEPIVPEDGTIEVFHESWFGKAGSPQLEKLERLIQQVND
                     TIAESWHHSVTGAVTKNEVTPSDADRKGMVMPAFQAPSWAISRNAGRYLCNCALYHAL
                     RLQEKNPGIVYGVFIHVVDPIRGKTESEGGPIVAYNPTTMVQSVQVQRFMHGLLSLMT
                     T"
     gap             755489..755848
                     /estimated_length=360
     gene            complement(<756088..>756567)
                     /locus_tag="LDBPK_341760"
                     /db_xref="GeneID:13392745"
     mRNA            complement(<756088..>756567)
                     /locus_tag="LDBPK_341760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864288.1"
                     /db_xref="GeneID:13392745"
     CDS             complement(756088..756567)
                     /locus_tag="LDBPK_341760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864336.1"
                     /db_xref="GeneID:13392745"
                     /db_xref="UniProtKB/TrEMBL:E9BQX5"
                     /translation="MFRCAVFGATMVRRSGAAAARNPPTRAAALKDATSDAVAGCSAP
                     NTHVDTSLQYAQEEIHATFVRVEKAPATQHHLPKFLFQGRRGSSSSEYYVSRSNPGHP
                     DTVAELLGAGRADPEWMWLKLLCFLCVSSTFGTTLYSYCFAEHMKYFKDEPWSPFRH"
     gene            complement(<758384..>760273)
                     /locus_tag="LDBPK_341770"
                     /db_xref="GeneID:13392746"
     mRNA            complement(<758384..>760273)
                     /locus_tag="LDBPK_341770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864289.1"
                     /db_xref="GeneID:13392746"
     CDS             complement(758384..760273)
                     /locus_tag="LDBPK_341770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864337.1"
                     /db_xref="GeneID:13392746"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:E9BQX6"
                     /translation="MITDAEFWQEIRRSMSGGECIFSSMLALIHARQSAIDAHVTTPE
                     REVHKLTTWGQKHHDEVTGRVFTSEQKREMEMEAREKEARLKEIEKPLELNKAFRAGR
                     VAEDTPVYGVSSSTMCVLQQVMMFAVPIYVLRYNVPAMSMSWNTSCFIDRQSKQLITF
                     GSGHGVKVPQHLRGRGCVAGDGFFAILTNQDEVWSSGGLKVSSSSIDGPTALGREDAM
                     TGIAGKTLMLVGHGQRLAIVTRAFTVRSLSALSNPIRSIMPHRHVRFLDVGYGEDYYM
                     VGTDSIVYKTTASKRAVSTPRRVMTLCRTPVSRIASGMGFLLIIDQNGHLLSFGRNKK
                     GQLGNGEVQDARRKPYFQKKLTHHYFVQVSAGDCHSLALTSNGIVYGAGSNESGQLGL
                     GRGLKQVCKFTPIPLGNDVRCIGIAAGPAGSMFYCDNGRVLTCGLNDSMQLGLETSEK
                     IVFEPTPIAVIFNGVESYTLDFGGFCRPEGDGRAPPADMPGAVGEEGGISSSSPAMVG
                     ALYRNKTSSNRASQEMTVINFSETPGNNTTNANNTSEQNANAAPTETEQRGENSGKHE
                     DHQPVEDNISANNSTVERQKEKGKPKTRHDGNAHNGGNGDAVKGRRKDKTRKEKPKCG
                     CCTVV"
     gene            complement(<761868..>765602)
                     /locus_tag="LDBPK_341780"
                     /db_xref="GeneID:13392747"
     mRNA            complement(<761868..>765602)
                     /locus_tag="LDBPK_341780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864290.1"
                     /db_xref="GeneID:13392747"
     CDS             complement(761868..765602)
                     /locus_tag="LDBPK_341780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864338.1"
                     /db_xref="GeneID:13392747"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BQX7"
                     /translation="MKGVSQRGLRGSSLALSRSNRTSKEQRGRGQNSVPRCAATSPSP
                     RTAAALVPPTTQQLQHAPLVAFTQWNEAAMEALRNGEGDSSRRILSALLPVLEARLHA
                     MQCKPSAHTSSTAIESWRLAHALTLNNYGCQLRRDGLTGEALRQFLRAKQVETLVFGK
                     PSCSTMLNLSAVLLSSGAAEEALAISKECVMAAQDGEPILFITALHNLAVALGQQTSE
                     RERKAALPTMLQALREAQSALGEQHATTLMLKEKCGLTSGWISQDRGPEAGPEVAAPV
                     PAVESPSVHGTLHGNSAAQSPSPAPLTAQEIARAALHTLDFGEPVHAHPAAHAVAALD
                     AAEPANGDSNGWVQDAYPASSLRPSPNADARSQSYAGRATEDNQDSLLSPPRQSTHLD
                     SVTDVDAVRATHLRMPLVESALPKPLQVSSRQSSAAASVDQQCLNSVNLSGMQRSVAI
                     APLETVLQEPFQTASLVMSRSVPNLVGPAGPIRDLYKMDSADGKRGPVFLRFSLPPRL
                     PAASTVSLPLRKVAPQGAAAGPSGASAEGRRRKPSPATMPPSVSKWSGDSNLESSTAA
                     TLITEMPTAGDVKTVDKGERPFSKTGGRATLPSAPQRSLFGCSGSLYARRTVRREAEK
                     QEERAYRVQREAEKKAAEAETAFQLALQKIQCRTQNTAAVTIQHAWRQWWSAVGRTRR
                     DVQLQRLEELQRRRRERLALGFVAGKMPGRSGKVTIPPPPSQQHGHVGGYVVPAIVLR
                     CCRKWLANTVCVRHVAKSHRSLVDGRLHEADVRRGVCRIQALWRGSIVRHRRAEHQQQ
                     PQLDGENACVIAVSAAYRRRAEAELLEYAALVVQQAYRSYRARQLRRRLYAAKHNRPA
                     AVIQRWLRCTLADQRNRGVDSRTIRVRDAAARTIQRVWRGYVGRVAFRMRELRLRMGH
                     AGVYPFALEAGIGTARRLAAIDDREGRAAKHISAKTSTPPSPAAVKRAGARPCSGKPD
                     SFAAGKAALDLNCTAALVDAYAADCLQRSGEVYRLRDAERDRYHIGLYVDVRATRERQ
                     AWQESLRLRSTEVLRRRAAMDTRIHEEQRAFTEHRAALAIQRAYRAWRRMQEDKGRNT
                     DFLYYSRALYQQQELGSLAARKQRQRDTARAIALYGDSAMAMRAERVKAAEELALVAD
                     CNGPASSSSGPNGVIAAPRKGAMKISSYAERMARKQQRQEQEAMQRRDEVLVALTYPH
                     DMAHAREGPDECAARTGTTYEHPYYIPYVNEEHCRTLGID"
     gene            complement(<773380..>774630)
                     /locus_tag="LDBPK_341790"
                     /db_xref="GeneID:13392748"
     mRNA            complement(<773380..>774630)
                     /locus_tag="LDBPK_341790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864291.1"
                     /db_xref="GeneID:13392748"
     CDS             complement(773380..774630)
                     /locus_tag="LDBPK_341790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864339.1"
                     /db_xref="GeneID:13392748"
                     /db_xref="UniProtKB/TrEMBL:E9BQX8"
                     /translation="MHGISIRSATPPRRHNASLSAESELTVLTAGVSLAHEETCTRKV
                     ACTVFNRTPADGAPRCKSNSSLTTVAVLSADLSPRQRRCGTSFASSILAECDSPCGSP
                     RVHLTRPFSSRGSFAKPVLCGSVPSTGAPSLKAADGALANRSSSGLHGVSPSLSVTLS
                     EAEEDVTVTSAESVSATASVEPLATPGSIVLAANDARPSSSPSFTYFPSSGGGVPQES
                     SASTSDKANAVGSVPAFRLSSVPGIRDGCGAIVNNNISTEHKFFEPLQLDAAGHLFSP
                     LQRFSSAHTSQRASCVAALEPRAFDFGGAPVEHKDVTIACPLSNVHHGKLCEIVKQQL
                     LLHACLVSIARERDEGEDLQRRGNFTLEKVQLQQQRRRCRCLLSIMWLLWSVFLRLPL
                     RFLKRVLTTSVGELRKILLLTQES"
     gene            complement(<779787..>782198)
                     /locus_tag="LDBPK_341800"
                     /db_xref="GeneID:13392749"
     mRNA            complement(<779787..>782198)
                     /locus_tag="LDBPK_341800"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003864292.1"
                     /db_xref="GeneID:13392749"
     CDS             complement(779787..782198)
                     /locus_tag="LDBPK_341800"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003864340.1"
                     /db_xref="GeneID:13392749"
                     /db_xref="GOA:E9BQX9"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BQX9"
                     /translation="MIGHGTWEAAVESAADSKKKGGGFQSFNLEKPLLDAILKQGFSV
                     PTPIQRKAIPPMLQGNDVVAMARTGSGKTAAFLIPMLNTLKAHAKIVGIRGLVLSPTR
                     ELSLQILRNGFALNKFLDLRFAALVGGDSMDQQFELLASNPDVVVATPGRLLHIMEEA
                     SLHLTSVRCLVLDEADRLFELGLQPQIGAIMQKLPESCQRALFSATMPTVLAEFTSAG
                     LHNPVVIRLDSEMKLSDQLKQSAFLVRNDEKVAALIVLLKRVLHVGEAAANNAQALIF
                     VESKFHVEFLQMILTHYSISTSAVHGQMDQEARRLAVRSFAKRETSVMVVTDVAARGL
                     DLPLLDNVVNFSFPFNPKLFVHRVGRVARAGRSGTAYSIMTFEDFPYYIDLLQFIGRP
                     LQSAPVPGDLLFTPDNGCYGRLPEEDIQLELDFLKRLHENDVEVRSMARVVENAHKKF
                     NRTKKKPTHEAIQEARKPQYAFDRTPLHPMLLERVGSTRVRADEARFDLKRFKPKELF
                     LEIGSKEKLFEIRPPETAQSLARSADAEGGATKRGAASAAPPAKQLSFAEQMLQRAQE
                     RRKREREVGSSTSVNSDDAVMNLVTQPREAALGQEESMETGAYRDENFFMDLERRDTL
                     NNAHYSLKDATMDMTAETAEEAAQQRQVFAWSKKKNRYVQMHVNDAKALLRGVKNEAG
                     KAINYKSKLQAYSKWMKKSNMRIQDVGEEEDLVPLKRAKAAALSSQPQDGDVGNGDDD
                     FVDISDPNQGKKLRIGRKQKRLPKDGHVRSFEEMAARRRKAEKEKSRLARKNQRSGSG
                     KKKSK"
     gene            complement(<782941..>783888)
                     /locus_tag="LDBPK_341810"
                     /db_xref="GeneID:13392750"
     mRNA            complement(<782941..>783888)
                     /locus_tag="LDBPK_341810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864293.1"
                     /db_xref="GeneID:13392750"
     CDS             complement(782941..783888)
                     /locus_tag="LDBPK_341810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864341.1"
                     /db_xref="GeneID:13392750"
                     /db_xref="UniProtKB/TrEMBL:E9BQY0"
                     /translation="MSCAQVDMSDTQAAPSRAKSRRTCAVYFGATTFVEIDDDPSTIT
                     LEELCEAFGTPWESGMHVKHRATGRVVVTLPFEPLPTLEEVSDVIIKAESTTATTHTG
                     DLTVPTAYDNAEEDVDGAEEGETTYAVVYDLVTPTPPGDNGDSELAAAVAAAGLSENL
                     SADSDGASNIGETMRKLVELGAAELLTAEPLSVSQARREYNPPDAPGLLRRIVYPASE
                     YSPYRLDRDPLYDGKLSLYRSPAVTASFASGPSPVSCTGSHALPTQDFGEGGLYTSYL
                     DSYDLSCPMREPFVRSFAAGKAALVMPLSDEEHHRIFGT"
     gene            complement(<785565..>788951)
                     /locus_tag="LDBPK_341820"
                     /db_xref="GeneID:13392751"
     mRNA            complement(<785565..>788951)
                     /locus_tag="LDBPK_341820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864294.1"
                     /db_xref="GeneID:13392751"
     CDS             complement(785565..788951)
                     /locus_tag="LDBPK_341820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864342.1"
                     /db_xref="GeneID:13392751"
                     /db_xref="GOA:E9BQY1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="UniProtKB/TrEMBL:E9BQY1"
                     /translation="MAAASSNCQGEGLQHFHSTGRSPASEHLELREGIYDNITGQVNV
                     VKEVDKLRKVGAIDRINEGEAVNSKSLPYSDTVTPSSSDPNVLKLPALQQNRRLAVDL
                     AFDDDAPSAWALLRRVTHNVWMSLKMTRLFLSLAWADIKTRTCSYCLGFFSVLIVVLL
                     CVLMISILVHMPILFLRLSEETHGEFDLVIGPGSVMSKATGINYTRIKELFPESDPNY
                     GYSAPRFLDMYMARTARSCPDKNVTQMWYNADGSVCDDIDLCMNGCFSNGTAAVDLMA
                     IDATAEARMGFGKDYNETTLNEGELILSHRAAVLMGGVDVGDTIILYGDAQLNIQFAF
                     ANLTHNDSSNVMMPFKVVSIIHEYYRKFPGVDTFVVVSFQTFLHDVAKGLAPGTSTAA
                     VEGVANTNPSDCASAVYFIMNPEARLKAYGLTSYNSIRRNVVAWASGVLSSLGFMQVS
                     RSTPQLRGLYATRLFSVFVGLIMSVILLALALLSVVLIYTLLTVGIETKTYELGIQRM
                     IGLTKENLIFLVLANAYAFTLPAWVIGLAAGQGTYTGARIAFAKLVEVQLPMLVTRAS
                     LGWATVAGLGIPIVASFFPILSLVTQRLPDAINTSRGRNSGVIYKIQRDDSTQWNGAM
                     LVLGLLFFAFGFVIYYLFPTALIAMNLNLIFYIFFGVLIGLLAGLVLLAMNFERVAQT
                     CISYLLLFWESRAVFSFMQKSLSAHRRRNRKTSLMYALSLAFVIFITVVVQIQLVSFE
                     YSSRQRMGCELYVETKGLTMEEYWIIEEIIEHQMETGIISAYTYDYKSSALTSLKGAR
                     IYSIGRVRSSVTVLKPLPPNYFEVMDRTYLHVDNYQSIVGRYGLVRALYSSEGLYRGI
                     LSSGAADTLGVGSADGAVLLEIRTVQNATSNAEAVRRATIRPVATLDTAPAITTSKYT
                     HAQGDVVLSIPGLFRHLNESRVSVLNGNVEKIRLRMSDPNWYDFIGDLLTGSIAAVGH
                     TVTVTNIRDATSDMATAGKVLNLFFIVAEIMILVICFFSLMSSMTTNVLDSSKEIGVL
                     LCLGMSHFQVYRVYVWEAFVLVVSSGVMGLIVGLVVAYTMQLQNILFTQLPLPFPFPY
                     IQLAILVVMGLVSALASSISPVAYLLGLPSVTHILRRTIH"
     gene            complement(<795478..>801354)
                     /locus_tag="LDBPK_341830"
                     /db_xref="GeneID:13392752"
     mRNA            complement(<795478..>801354)
                     /locus_tag="LDBPK_341830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864295.1"
                     /db_xref="GeneID:13392752"
     CDS             complement(795478..801354)
                     /locus_tag="LDBPK_341830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864343.1"
                     /db_xref="GeneID:13392752"
                     /db_xref="UniProtKB/TrEMBL:E9BQY2"
                     /translation="MYTSGPFQKKLRPSAPAATTARTSSSAKNVSTLPLLSGAGDTST
                     TSPPPPQSASLKSLRQCESSSSLSPIRTHAALMPLSPEEVARARHVVMDPLAALRRCL
                     QYVCSHPEVYGDDVRGLLDREVMHVVRLKASEVSLTNGERPLLVDPLESTGVRQAARA
                     LTGVPALPTIPAQATVSNGAVPGSVSAGDLFGYGSVSFLPASSVGFSALLQDSRAEWP
                     RADQAGSCRYSDGRKTFFGGFPSMSSSPAVPHLSQDESIQWNETLPPSCTPANPRGIR
                     NIALESVRNDEAVKSSAFSEDIAMDGGATSSDETRQASPPLPHGGACEVHGRFNPQDQ
                     IAALALHEGTRNSLSAAPPSAVCAADGTVLLVDQQGYEVTYLRAQLQQLEAAFNSKCV
                     RLHELEVENRQLAEKMKTSEEATARWAAQHHAMKGQVEVMRRELDGWKDRANDAVTAA
                     TRKNKQQNQRAKQIVYSQLSDAKQEIVRLGQLWRETERALQETRRAFENTEKEAVAAH
                     NHLTDVFHYLERLERRIARRDVYVSLCERRQRSLEEKYEKLRWGYEELSTLDGRYSYV
                     DYMLTTRPLWSVYMFVRLARHQGDYVALENPMEVQQRLLLMVGQAEKGREVSPEAAAA
                     TLAAMEPLYGLIFSRSPQGGRLVAQEYDFRLVFRTMVDETTADLSRRGRSKQLRTTLH
                     GSVACRVIRWHERYSIDYLRGQDDDPESAELHRKCVPLLTLASVLLPLRSRTGAILMQ
                     SPPVEAAAPSAEVTDSTAAEPASTAEEERVHTLLSTTSNKRHYNEGTIRFVLRCFWKE
                     RLSAFSQQMNARVNAVNAKRTSKRELEGTEQNGKTENRLSPTGECLPAVYENSDRADE
                     SDDDEDDVGVNQTFLAALVDFSTRFASQQAGSGIAAHTKPGVPPSKATLLNVRGVLTR
                     GASDAKLGGRVAAHIPSPGSKAALDSVWDSGRIFFAVVLQPGRSAATKQDAASPTSET
                     PTPEEVSILAEEAREMLAALYYYTLEYKDLDPDFRLFYLVAHQMVPEMVAVNFFAGLE
                     AFQLESVALLEWRLQCLSAGMHSGATCTAAGQPSSSPAMPKKVEDPLMALTRVVDVID
                     DALLDGEEEDIETDSDGDGYGSILPFHARAETQVHPSTASSATTGQRQEGRMEDSCTA
                     ETHSSALPVSQRTRELRLLHNIRAYLLERRGFMQGEQGAERGDGDAGVGDNAENPTGA
                     RLAAFSFGEAPPEWTALEERVLNILGPHTQLLDAFRHQYRKQKGEDVAQAKGKPMKPG
                     KELDHLRRRRSERKSRHETAKYLSATRGFLAEEDVLALVQRHCLATYAVSCCGTPRFS
                     LLRSLFGRSSDRGRDSSSVLDQYAIVGHLPLTGLHLQRLRFALSLDQPSHLIRPSALF
                     SVDPVTKSNSHFYDAYLTIVLDVFEQQQSFLMHSVLRCCAARHELYAAEGAEDCDGLI
                     PIACLKKGLTDAFSTISGTSQHALAVLNHLVRYDELLRLEDEVRFEQFTDAPLLLNVP
                     PRHGRGCFTADGEGSVKQGPGNAADQGKWNLREEADSCSLLNIAFAFRMSYIVWGEVS
                     AGTAEALVHRIVKLAVPVCCSDAVPGDAVWAVRAAAVNKDATVVEEFPEWDIFDRITR
                     QQYARALMRMQKGHNGDANPLRRTLSALQTELLQPASILSSRARVGASMSLSPGAVDV
                     DALYPDVASVWTTKKVLAEAQKHMERAAAAVPAKGAGGSGKGRKKRHLSQPRKSLSSV
                     QTAANGNGSAGEGEQLPDYGLLSLVRALGFAPPLSTSVPGVGGAAANKKGGGRKSAKK
                     SGASKSRACPETTIPAYLQQEYSENLSVQLQDLAARVAALTPSDLNRFPEDMSVDGDV
                     GVNMEGATPSANSLSVSNRSGDAPTPGSGPSRVQSVSFARGSLQSTSQSKLHKKVTVE
                     TPLDGKRDSSEPHALAPTWVPLFPGSSSALDNVGAPLSSSMPMDVSKLYAICAALSMT
                     "
     gene            complement(<802817..>803974)
                     /locus_tag="LDBPK_341840"
                     /db_xref="GeneID:13392753"
     mRNA            complement(<802817..>803974)
                     /locus_tag="LDBPK_341840"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003864296.1"
                     /db_xref="GeneID:13392753"
     CDS             complement(802817..803974)
                     /locus_tag="LDBPK_341840"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003864344.1"
                     /db_xref="GeneID:13392753"
                     /db_xref="GOA:E9BQY3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BQY3"
                     /translation="MPPKLKPLPAKKSTLPPELPEESDELTVGNIRVGPRGVEFTGEG
                     DLQVRRPDLNFENLKRVRQLGQGTQGNVSMYVTADKSVFAVKKITIPVTLDTRTRQTV
                     AAELRNIFSAQSNEYTVNLYNAFYRNRALRLVMEYMDWGNIDELIAEKVKIPPTVCGY
                     IASQMLHALAVLHTKSNIVTEPNQHKSLRQIHRDIKPANVLLSTTGCVKLADFGIATS
                     AETIGVNSFVGTATYMSPERIQGRRYSTPSDIWSVGVVVAQMLLGHYPFSSVSKGFMA
                     LLREINSVEKYPLMDETGCSQETQDFIDSCLRQDPDDRSSAFELLESPWIKYCEEHGK
                     AEMVALLASLGDRNRQYREDDALQAASRETSSLSLPRDTSETCKADNPLGM"
     gene            complement(<806427..>809468)
                     /locus_tag="LDBPK_341850"
                     /db_xref="GeneID:13392754"
     mRNA            complement(<806427..>809468)
                     /locus_tag="LDBPK_341850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864297.1"
                     /db_xref="GeneID:13392754"
     CDS             complement(806427..809468)
                     /locus_tag="LDBPK_341850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864345.1"
                     /db_xref="GeneID:13392754"
                     /db_xref="UniProtKB/TrEMBL:E9BQY4"
                     /translation="MRRRLGLSVLAEHHPERTAGPRAHIAAFFVSLRWQSNCGSGACS
                     TSHGTARQSANASPREPTETAASAESVATKTVIPDHMAVDWSGGSSYYFSEEENARLS
                     RLHTPLASDRESGGAHGAVSITCPNSTSMDGKRKDGAAAPASRAVIHGVARSFSIDLT
                     IPPLRREEVERWKLDGHMFRKCINARKPFAHGSQRIHQLLPSTAMVTYLGPDMRKIDQ
                     VHRQKGYFTPSEVAEVFIPLVPTFPVESRHVMATVPPEILRQIEKVAGSTSTLAQVVF
                     EHYPMLFHYTPNRYRPAVVQLNSEFWFVRQHPGYGKADRALSQFRSHALMDFDAPDTA
                     DDASGVEPLYAASEKAAAEVVPSLRRQANSTSQRKPWSVEMLAVLVRNLPRVPTPECS
                     SQDMTSRKVLSSSDGKPLVRERYRPLNLVQWINGFPPDDLAFVKKKREASVVQLITQY
                     VHVFQLMSLKKGDHNLFVEGHVLLSGGAGSKWKADVVDPPASAASAMADINNGDEASL
                     AREAGQEEAAMASWWSVDSADAPKDSGNAAHATKATALGNAKSTLDDRERVFKQAVTE
                     ELIGLDSLVEDRRGVGTELDSERDAMVFGEDADEAGPIAQGEDDDGEVDQHRGNSDDI
                     YRGGRGNHDPDSPSLPHERYSQSQRAPARGASMDAVTAFGLPLEEIYIRRLPPDVAPR
                     SLSDLDETTSPDPDLLSIAASFLASPPSLQSPTADCFFRRCRRKRWRVVNAVDEVWRW
                     VAVERLYAGFTVEQRSHLRERYRGLVGFLRYHGKVFELSGDLMYVIAHDPRGTVAPIP
                     PMERAFRYAHRVVLPEDFDDNPDRSASLLGEAERKKFVRVLGEGAIPSFRRHLLLLDP
                     DNPLMQHEVLYDEIANLLPDHPVPYIEMMAKLPPVMRAALPQVLNLAASKRIDVYVEK
                     GRTMIRKKTAAQPGGAPAASRPQTSVEEAIAELLQLPIGEDGISIKALVGMHLSVPAA
                     NTLSDHFGSVGRAVRMLPQYFEVWEDDSVARKRIVMVRLRH"
     gap             810875..810973
                     /estimated_length=99
     gap             812330..812814
                     /estimated_length=485
     gene            complement(<812967..>815225)
                     /locus_tag="LDBPK_341860"
                     /db_xref="GeneID:13392755"
     mRNA            complement(<812967..>815225)
                     /locus_tag="LDBPK_341860"
                     /product="cardiolipin synthetase, putative"
                     /transcript_id="XM_003864298.1"
                     /db_xref="GeneID:13392755"
     CDS             complement(812967..815225)
                     /locus_tag="LDBPK_341860"
                     /codon_start=1
                     /product="cardiolipin synthetase, putative"
                     /protein_id="XP_003864346.1"
                     /db_xref="GeneID:13392755"
                     /db_xref="GOA:E9BQY5"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:E9BQY5"
                     /translation="MAVGAPSPLCKGLSLFERLQQRRVQLYTSANIKNKVRQAFLSAV
                     AAYEQLLAAATKALEPSSQFLALSAATALPPSQPSPAASGSADACGAAAFYLDKMQHT
                     FEEAKRYYNSTPFDQRWDDILSSLAVLGRISHGNVVVPFHDSAKAFESMWAAVKEAKE
                     RVHWQTYICKDDFIGQGTVRRLVEARRRGCDTELLYDCGGNISGRARLTEELKQCGAK
                     VIPYRPFFRSVATYFIKGLDWKRSPGLRNHRKILLVDARQGFCGGLNVGNEYCGKAAG
                     GTGKFRDTHCGVIGPAAAHLAEVYRDTKQPHPWKYGWRRWRQIASQQITRRVKQGRMR
                     MERNELYRAFQEERGRSGRRLQDVPSASMKAMRGRWNKQKNQLLTLMQWSRSGLSSDS
                     VLDREAVRHTQGQESLRAGGKQVTLREEAAASCATSAESGPKVTNHVPGSFVVKDAND
                     GTTTSASPPPSELSTSASGKHAKAPLASPAEVPSSGGKLNSARNSAMRRKLLAARREA
                     LSRATDLPHKRAYTDMLRRIPILDTEPVPEAQMYLRHRESMTQVLSCNPRYRDYSIQY
                     AFWQVTRKCHRRIWITTPYYLPTRKLFSALVQAARRGVDVRLLAGSNQTTDPWFMWHA
                     SNYITERLLRAGVKIYEFQGQQIMHAKTVVVDSVWSSIGSYNWDLMSNRNLEVCLCHL
                     DLEVAHSMETQFLRDLAQSVEVRLEDHKQRSLWLRFTSWLFYNFVFLLDRITFRSFAN
                     EDIVDAPGSPCD"
     gene            complement(<816966..>817886)
                     /locus_tag="LDBPK_341870"
                     /db_xref="GeneID:13392756"
     mRNA            complement(<816966..>817886)
                     /locus_tag="LDBPK_341870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864299.1"
                     /db_xref="GeneID:13392756"
     CDS             complement(816966..817886)
                     /locus_tag="LDBPK_341870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864347.1"
                     /db_xref="GeneID:13392756"
                     /db_xref="UniProtKB/TrEMBL:E9BQY6"
                     /translation="MSLWPFRTGNDDRFQTSSGPSGADDIYATMRQGGLPPHSYGVEV
                     DSYLEWRWRRGFLQSVFPVTCYGAVAGFCVGFRQSRIEGRYVGRYRIMWRYTSTFAAV
                     GLLTSAFHHLLVVRNRYHDKFYYPIVAGTAGAVVLSLASQMGTIGQSMFVGAFLGVLY
                     GLGCYGTTYYHRRRLRVFLHEQRVRQVPIHKVSPELQPMYRAFLYDNRPLEEEDKKSR
                     EAVTLSRSVDDTRLDAHTFMSNMTPEVFDWVNFPDWWPLKWPMQTEEEQMLLERQRNE
                     EIERRKNTFLETEDAGLLKRKNRAKKYRDL"
     gene            complement(<819282..>819524)
                     /locus_tag="LDBPK_341880"
                     /db_xref="GeneID:13392757"
     mRNA            complement(<819282..>819524)
                     /locus_tag="LDBPK_341880"
                     /product="ubiquitin-like protein"
                     /transcript_id="XM_003864300.1"
                     /db_xref="GeneID:13392757"
     CDS             complement(819282..819524)
                     /locus_tag="LDBPK_341880"
                     /codon_start=1
                     /product="ubiquitin-like protein"
                     /protein_id="XP_003864348.1"
                     /db_xref="GeneID:13392757"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BQY7"
                     /translation="MTFSFSVISTTGQRISISVLGPDNTVGDIKAKLEETEGIPQKMI
                     MLVHSGRKLEDNATLEECNIHAGVTINMVLALRAGR"
     gene            complement(<820957..>821427)
                     /locus_tag="LDBPK_341890"
                     /db_xref="GeneID:13392758"
     mRNA            complement(<820957..>821427)
                     /locus_tag="LDBPK_341890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864301.1"
                     /db_xref="GeneID:13392758"
     CDS             complement(820957..821427)
                     /locus_tag="LDBPK_341890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864349.1"
                     /db_xref="GeneID:13392758"
                     /db_xref="UniProtKB/TrEMBL:E9BQY8"
                     /translation="MLRNLVRYVGLVLVLLFFIASGIEKLAAPSVGAAFLAKSNFPRM
                     LAKMGVKLSPSEYIHVVRTAGVMCVSFSLFILLGVGRSFFSFLMATGMIITTVAFYVD
                     LDYPFETPEENVQHILKNASLVGALLFVTGSGHRSRRYNQARVASDSNRAKKNN"
     gene            complement(<822597..>823328)
                     /locus_tag="LDBPK_341900"
                     /db_xref="GeneID:13392759"
     mRNA            complement(<822597..>823328)
                     /locus_tag="LDBPK_341900"
                     /product="NAD dependent deacetylase, putative"
                     /transcript_id="XM_003864302.1"
                     /db_xref="GeneID:13392759"
     CDS             complement(822597..823328)
                     /locus_tag="LDBPK_341900"
                     /codon_start=1
                     /product="NAD dependent deacetylase, putative"
                     /protein_id="XP_003864350.1"
                     /db_xref="GeneID:13392759"
                     /db_xref="GOA:E9BQY9"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR027546"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:E9BQY9"
                     /translation="MKACRCITILTGAGISAESGISTFRDSDGLWCNHNVEDVASPDA
                     FIRNPALVQLFYNERRRNLLLSSVKPNKAHIALAKLEEELSGKGKVVIVTQNVDNLHE
                     RAGSKNVLHMHGELLKVRCAATGNVFEWQKDIVGDVDRCPDCGLLGTLRPHIVWFGEM
                     PLCMDEIESILSKTDLFVAIGTSGNVYPAAGFVKRAQFYGATTLELNLQEGSNSTLFQ
                     ESIYGKASDIVPAWVDRVLKESSKK"
     gap             825177..825561
                     /estimated_length=385
     gene            complement(<827566..>831969)
                     /locus_tag="LDBPK_341910"
                     /db_xref="GeneID:13392760"
     mRNA            complement(<827566..>831969)
                     /locus_tag="LDBPK_341910"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003864303.1"
                     /db_xref="GeneID:13392760"
     CDS             complement(827566..831969)
                     /locus_tag="LDBPK_341910"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003864351.1"
                     /db_xref="GeneID:13392760"
                     /db_xref="GOA:E9BQZ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ0"
                     /translation="MPQDARLQPFSLVGIEATVRPEQRRWSAGKRSGTHGRPLERFFL
                     FLFLAALALCSVCCSQASSAPFHPARHIVADEALSNAPSARSVALRYTFPGSSLALLV
                     TEGGHLHAYDLERGQHAWCADAGGDMVTVTIDLPPSKEAALRDPLALPFLVRGNSLFT
                     RVPFFTYTPLESMDATERLEGLPQSLRPYFFMNISTLLRRQTLFLGGTDVYVTTSVQV
                     ADLDASTGRPVGGLETPSQAFCGSNATRSPPRGDSTTESHRVPHNELLPLLHIVRYNI
                     VLHVVRPGEYSWSICLSQLRMSPRAVVQPRFPSPFSAHSAADTSSAAPEDDSEHTPRF
                     FSQFMRNMFDYDDEHVVNVAYRRAADQQANPTPAARTSTAVLMRNLQRTHTQAADYIS
                     RVVSVHQVNESHVSLRSVHDGTTAWTSALPHVAREPSGDGTGSTTSSSNATSTVIAAY
                     VWVSGADEIFRVPVLRLAFGSVVEEAEQLRISMETDARGAVPTGLPRLTSASLAGALV
                     PATHAAGRLQLWTLMQSGDSGRGRCRDGGACGEWATDDVEADEREETELAAYYHQCTW
                     WETPPVSWPLLAGAFNGESGAVTFQAIDSATSSRTVAGTSGVYSTENPPLGFDSSGAV
                     VKTGLAWRTAAFISFHVLCLAGSIAFLCAGVPPRGQLQRAWAQADRNRDRVSHTSSSH
                     QPSTQLVPQDLLSPHGGRGTPFSLIMDSFSMDTLGLGTLPTASVSMATVSLPHSDDSL
                     QELMRHHQLGHLSRSPPRSPWVYPAPEQVRSLTYEESEKMLPVTATPATTTTTKGTAT
                     SSKAGFGMTPSTARQKAKTSETPVKRAAALPSSPADSAAADKAAASASNSSSDDDTVD
                     IDLGERWWLRAQFLPRQHASAPALDETFSDRGSSYSRSQANTGTEEEGKLFQLHFKVL
                     EKIGFGGEGSVFCVEHRVTHARYAIKVIHIHEKDEERVVQEAVLHSSFDNANVVRFYF
                     CWIEDIAVSTANRLELCHRDEDGLDATSLAYSDNSLMVSTSGNTNGHSTDHDTASKAG
                     DTYHMLFIQMEYFPRGTLADWLRLRSGFFRLEVLRYMKQIGEGLAYLHNQDVVHHDLK
                     PTNIFVSNDNVLKIGDFGLAKRRGNANGSAGDLASNVAGGQEERSVVGGSPLYSSPEQ
                     TRGEPVNKPSDIFSLGIIAVEMLCTFTTLHERIRILTDAHQLILPEELEAEFPDEAQL
                     IKSMLAANPLQRPPIRKLLRQISKLIVALEAQESDEEAEKPPPPSPLDGAEHSESRNG
                     NDEAATVALVDDSASALAAATATGKFGNTPLSTSVTAASSSCGRSVAADLASGSHVDS
                     FPSPLGEQKSRVALLPVLHSEAATGISAAAASHMPATTSAHDSNAASTGTHVTRLGDS
                     LASLHASTMVKRGNTYHHRRRGSASPNMEAEIGRLHICEMVATGSASRKEFFANDPYG
                     LPNTPVMYTEDADLSTILKHDLQDRTVSAPD"
     gene            complement(<833766..>835241)
                     /locus_tag="LDBPK_341920"
                     /db_xref="GeneID:13392761"
     mRNA            complement(<833766..>835241)
                     /locus_tag="LDBPK_341920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864304.1"
                     /db_xref="GeneID:13392761"
     CDS             complement(833766..835241)
                     /locus_tag="LDBPK_341920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864352.1"
                     /db_xref="GeneID:13392761"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ1"
                     /translation="MAANSQSSAVDLLRFLAISLAVHADAICCAVDDVEAAIVELSTN
                     DELLEALENELAALLDRQRRLHVTRSMIALSQDERRRGMELRRCWRPSTQQHGNKRIQ
                     TSRTPSSRSASLKRGTPRHPGEALSMDLSADEPQQEYGASAVPTRGLSTATSSTAPCT
                     ESDADSVDAQVERLKARIMHLDRYSLRGKLLHLESQKNAVKEIDLEELVARVVDPFEF
                     PASVRALWCSAASPRSTGSQASSCAPLTGASHRRSRSGDITLAQHATGKGGVVNHTNI
                     DLLLARACQRLSGRAADALEALASTNVSEASAAAHLLGCMVYAAELDSSGSTDLAAVQ
                     QLQTMPRDTLSHLYDQCVRNSVCEAKLDGRCFGVRGTVLAAQDFNALPAEWATSQSLS
                     HVPLDEILPPVRHLLSPRFSFADVAELKQLQEKRVTLQEKLVKLLVDGQEKDAELLRD
                     IAGSQRDRAVAAARLAMAEMSPASTSAHAWKTMVLVRDDER"
     gene            complement(<836521..>838218)
                     /locus_tag="LDBPK_341930"
                     /db_xref="GeneID:13392762"
     mRNA            complement(<836521..>838218)
                     /locus_tag="LDBPK_341930"
                     /product="8-oxoguanine DNA glycosylase, putative"
                     /transcript_id="XM_003864305.1"
                     /db_xref="GeneID:13392762"
     CDS             complement(836521..838218)
                     /locus_tag="LDBPK_341930"
                     /codon_start=1
                     /product="8-oxoguanine DNA glycosylase, putative"
                     /protein_id="XP_003864353.1"
                     /db_xref="GeneID:13392762"
                     /db_xref="GOA:E9BQZ2"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR012904"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ2"
                     /translation="MTTSSMAARHSWRVLTSSLKAKVSLQMTLCGGQCFHWYRTPRGT
                     FVGAIGDGVFELREVQCSAKLKKQELQRTAPQPPVPARARRRHAASAPASTLEAAVGE
                     SDCCPCCWIEYRRLWPLAQPVRLSGKGRTSPLSSSLRHTGASSAPAVWESDEEMLSRY
                     LSLDVDLDQLWQEWTDSPETRKHPLVEYLVGNRLHREFLRSGHGQRVCEHDEAQANLY
                     IPIRHVRQDLHSCLFSFLCSQNNNVTRITGMIYALSRTYGDHLCDVQLATGEVQEPRK
                     SAADTRSKVPQTQFQSDAAATRRDAIASPSLRSHSSSTNSAEWLSVYSFPSLEQLAAA
                     TEDTLRNLGFGYRSKYIVEAVNFIRTQLPPQALQDKKAVKGKMHSPPHLIQQHGACYR
                     NGFYSAVLSHHNYHHQHQRDMLLLLPGVGRKVADCVALFALNRTHIVPVDTHMAQVAV
                     EYLAAPSAAAAVGRKRSRPGCLLSEEEAQSPDNLLLEWRKQAEALKVKKGASPATVKA
                     IEEGRSSAASLLRASRKTPVPPLYERHHNVIQDAFWKLFGNYAGWAHSILFYYRLRK"
     gene            complement(<839089..>843726)
                     /locus_tag="LDBPK_341940"
                     /db_xref="GeneID:13392763"
     mRNA            complement(<839089..>843726)
                     /locus_tag="LDBPK_341940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864306.1"
                     /db_xref="GeneID:13392763"
     CDS             complement(839089..843726)
                     /locus_tag="LDBPK_341940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864354.1"
                     /db_xref="GeneID:13392763"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ3"
                     /translation="MNASSLLLTPSAVPRQESSAASYLTSSPLLVDVVPFEASLQRLL
                     YEKVSTDEQMCSYSVQQAYRGLLYGVRATTLTLTGAGIGAANHEPALAPSKEGETHRD
                     AALSAATATDACVLRGWQAVLYRMALVATRSAADLECAIFLSTRILCDPATAHGQGNE
                     RPCCTHEWTQALLQGLPLRGFVMGSSEHKELDDRFVRLVHANRRYQLGFLLILSNTLR
                     MLASGHVEGQRLCAEHTELFTGIAQSMVPAVASYVEESMRESALHAARRTDAGGAAPP
                     PSRLTVELNHLVVHCVYWLTTDVLLAHMDAEADSSVDTKEAALKPRRQKKRPPVLDRD
                     LPACLWGCVTMVRNALRRGFRWLAEEFDHRGPRTAATPATALLSAVSKQLEDVFTDVV
                     KHQELLQYSLLNATREFNGASSHNAQSLTEMVWAHTLQMCFLVRNLTGVWVAVHGGLG
                     VPTTSAGLVLPAYRDVLMFMASALLRVPTLHDAKENERTTFMATDAALSACLALVAAA
                     PTTTLQAELWATDSGVTQQIHALLVQRALRYRNERVLRLASLLSRAVLDAAVRSGALA
                     GFAADSSDQLLELLESEDDAASRCVGELLCVSILEHPYRLIPALFRMLEHGSTATRRH
                     VLEVLCNLPDLVSEQRAAEEDTAEERPSRSSAPDTVAPWFGGHSKSIGARRRHVLRLL
                     AENLLLRLPDEELCVRLLSSSLFAKVHPDDVLLPLLHLCVQRDDTGRKQSAALSALTS
                     VVTAHTDTAETYLLLLQCGYQCQSAANGGTLSAVVAPGGIKRNTDGVDSEQNPTMVRR
                     PTPQTPGDILSQALLYSADGIAGSAHDLSSTPAALPTTAAEMDPSSSEARAGNWRRKE
                     AQLQTALLTLTDRWVRAAAASWTYACHSLPLLQFLARQANRGAGDGTADYASDSGDPV
                     VEWVQWAMKYMVRLTASLTGLVNDDLSPAAQARLNKMHLRAIWDTFFARASATEGPPD
                     DRWARIACRAGGTGSGADAGASARLHALLLPLLCLRSCAPKTFAVADATFVTEAVDSP
                     EEEDDDDDVATIVRRLWRVLWRGVTMEAKSDATIFAAYPEIQRVALEVVCRFPARLFF
                     HAWTRWTAAQAKDNEPSNASNSPDGELSSSRLFAYRVYLFGVSSYLAAASVQTASRHS
                     DPSASTAAPLSADHGSYLASDLQVVLEYRATLERLLTVTLPQWLMEEEGDISVNLSSS
                     QQGNSVGEAGEAGPGIPINQGSSEKAEAMKQRLCVAAIDAAAVVGVVTLSKADGFPTS
                     SSLPTSGNGYTSALYALCNSLLETPLTGLAKAYRDAEKRETSEELPRYDDAGSETDWA
                     RQLARFQLCIRVHQCVLNAISLHPAHAKGLLLCWFRGFLRPIVELSNAACRSVVGRER
                     HECRAAVDACSVIFQAVLMARKIGSPTAPALTNSAEDKSSASSSLLFRLAWEEREALV
                     SFSLGCVRFTASAAVQIVGVRLLSAVLVAAPELFLSMDGMNTQMVTSTPSTRMGFSSS
                     PWCALEDGQRLLSSAASALQPIALMHPDRPTRVLADEVLRMLEKAATASGT"
     gap             846442..846540
                     /estimated_length=99
     gap             847197..847295
                     /estimated_length=99
     gap             849913..850562
                     /estimated_length=650
     gap             851645..851743
                     /estimated_length=99
     gene            complement(<852482..>856630)
                     /locus_tag="LDBPK_341950"
                     /db_xref="GeneID:13392764"
     mRNA            complement(<852482..>856630)
                     /locus_tag="LDBPK_341950"
                     /product="dual specificity protein phosphatase, putative"
                     /transcript_id="XM_003864307.1"
                     /db_xref="GeneID:13392764"
     CDS             complement(852482..856630)
                     /locus_tag="LDBPK_341950"
                     /codon_start=1
                     /product="dual specificity protein phosphatase, putative"
                     /protein_id="XP_003864355.1"
                     /db_xref="GeneID:13392764"
                     /db_xref="GOA:E9BQZ4"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ4"
                     /translation="MYEVLDALRSSSVGLLFLNHPEVSFSNRSCVICIPDFHQDETID
                     GYRLRAAYNAGTIGRSYFATRDVAALSSRCTPPHGSSDSLSDDAARGPVFRILKVISF
                     VLRRRLLEEITAEQRVLVNIVHQNVLQISDVLNDEAKENMIVITNYHAKGNIGNYAGR
                     LSHDSDKLRRILTEVAVGLRILHSHRVYHHNLKLDNVLENGEGHFCIADAGFWRLFAV
                     QCPEDLVFNGELACLPPEVFDPEGPYATGEVNVVSDEGAAGVAAVDIWGFGVLMYRLA
                     YGCDPVEIAECSYAQVHERLMGFDLSFPPRPHWSFAYDIEDAIRLCLQKVPSKRPSVL
                     RLLQHPFFKHSLVVGTSSLMRKMSMTSSFAFGGQMVGSFGDRTMSAPGLRGASMSSMA
                     VPNYRTQQRNGFQVDAFLGEGRFSETMMVHLRRNHSKQFAFKIIYKSILKRLQAPGRE
                     KWAREMRRQLVFSRKVDHPNVMRFIDIVEDKKVNCFVVQDYMSGGSIEAVPPVKGDSS
                     SPTLQDFLVDVLAGLVHLHDNGVAHLSLLPTNIFFCEHTLHYCIADFGPLFVTADALA
                     DSIAEGAPLYALPAWVRRHSPLHGPSVDMFCVGLLAASVLPELFDTVWAELLDSEKNR
                     TFAVDAVLTAVRKQRAQLTPALVSFIEDALEGRFQDARAALKHTYFRNLSFAQNLPKT
                     IVEVTEEELQSAVHSKPETRDEARMLEVLAQDPFQESQMLSSAGDATLHGSESCTEAS
                     VIAGATGEKPTVLVFEGENLLCGQCSAELTVALYQCSDCDGYIRCGKCSVGNYHKDGH
                     ELVPFLIHTIEHSRDGANKAVLAQPSTVPDVHALETLEMTANFPVGSLTAHLVAQRAA
                     ERSIAVRSTGGGSITKGMFGDMESVVRLPDDISEQSISVNINCRSFISFRGLGGMPGG
                     GLNLGSGANNSNTGFNTVGFPHGRADPVTPKDFGSLCLPPPTRLSLMKGKEARKLALP
                     KAEEIEDDDWQQELERCRTSNHSELLLYNYGLDEVPPEVYDPPLLQVVVLDISQNNLR
                     SLPHELSFLIHLRKLVVSYNKLTELPDSLGNLSELESLDASHNALVDLPQTFIYLSSL
                     TSAALDYNNFSSIPDSLLDIVAPPLCSSASNVMENFAMSTTQVNGARMASLVGNTAVS
                     LVGGSSVSNSKTVIMSPKLKVIYLAANDSLTTLPLRERLQRFDDLTIALDNEPSLYKD
                     YYEKNLDTELPNITVNWNKLYPDEIVPYLYCGSLRSAQSQMVYRKLNITYLLTVGRQL
                     VPVPPEGGHHKVIVVDDIPGANIRMSFQEAVNFIEESQSKKSGCLVHCFAGLSRSATT
                     VIAYLMIKRGMRLDEAYLVTKKGRPAILPNKGFFDQLVELDKELYPKPNRPLDIESLG
                     RSAN"
     gene            complement(<862086..>863387)
                     /locus_tag="LDBPK_341960"
                     /db_xref="GeneID:13392765"
     mRNA            complement(<862086..>863387)
                     /locus_tag="LDBPK_341960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864308.1"
                     /db_xref="GeneID:13392765"
     CDS             complement(862086..863387)
                     /locus_tag="LDBPK_341960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864356.1"
                     /db_xref="GeneID:13392765"
                     /db_xref="GOA:E9BQZ5"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ5"
                     /translation="MCRSTPSAVQLLGALFAVACLVHTSLAYPYGRSSAVTELTPASL
                     HAFVNTHKPVVILFYAPWCGHCKQFHPEYERFAESVKGTIRVGAIDADKNADIGQQFG
                     VRGFPTIKYWKSGTKSVSSSQEYQGQRTAAALQSLVVEGISSSKVMTVTTAEQMKQAA
                     RDAPKKMIGVLLSAKNKVPPMFSVMGMSPKLKELPLVFAGSSSPEKGVAKALGVSQLP
                     MIGVLRYTPAEGDAEEKFEMVPYAKKAIAYEPVARFFLDCAEKECSAGTEAPMNSVSL
                     DEDESQHQTREAARQSSVALPVEPVEYTPKVISLFCAPQTRKIRGQSPLCVFSLSEHV
                     NLDNVHQYFKNDPLLFFEASQHKEELLQQLQADFGVQIASTGEAMTSLAGSIVVLRHS
                     KPTTVRYALLENIDSDDDLQAALQRILNGEVHLRSERVGAA"
     gene            complement(<868472..>871336)
                     /locus_tag="LDBPK_341970"
                     /db_xref="GeneID:13392766"
     mRNA            complement(<868472..>871336)
                     /locus_tag="LDBPK_341970"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864309.1"
                     /db_xref="GeneID:13392766"
     CDS             complement(868472..871336)
                     /locus_tag="LDBPK_341970"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864357.1"
                     /db_xref="GeneID:13392766"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ6"
                     /translation="MPKNAGGQALSRQSAHHSLQGVSPSPFADDLNSHGDSAAVPDSD
                     YHSSWFAEWPPAAAVASSSPALLLCNHGGAEALVLCAAASGVPRQWTSGAAVGNQEAM
                     HAVTQPPLKLASTFQAGEVDAVCCTDAPQRASEERRGAVSALHACSRARSPPHVFTSN
                     TGSGVTPVAAAGAERVLFDDDDDFTDISTASARCRTLQPGPEAAPAAHCAAVDAVAHT
                     PPRHRDIRASPLLAPNRGGTGGCESTDCSSSGHFAVHYAATSVSSCATPNASVLSVVA
                     AVGASGESLDAVVPRGCGPAKEGLTTQVIEDSAENSPAAAKAAQMEGTPRAPTTSAGT
                     NGSLSAFKTPMTSPLRQGLFLRLLSTHAATATHTPTARPCSSGVLPPNAGSLATPTPL
                     HRAHRWRGGNATPGWESLAEITGFPTPVKLSPIPTKGYSAYPELVATAAAAAGAATLT
                     STPRASGSPSPVVSAVQGDAHECDDGKLDAATPTAMANAFGAAEDARASRSQTAGVSF
                     SEGGGVPPLSDGSIADYLSSAHSISTIGSECSVSPIRVRARQTTRVWTPHPSEVSQQQ
                     HPTPPPSSIEDQSSRFLSDFPSSAAVQPPPPQRQQPSVLRASPIFGAVHVFPCDHALS
                     AHKSPPRTALHPERAAEEVSEDLTAMSLVVTEVQAQPSHQQPQKLFRPDAATGDLALL
                     HRSADHSAGGWATPRCVADTLNLGTPTVSMIQSPAQALGESCCSLFMLPATQYIHTLP
                     IRGLQRRNPPVAHAAQHAGLAVEGVGGESGRIAFANEARHNRRRQTQHPVLMSPALSD
                     GEEENCTPSSTVALCLAKPPPPRVQASPLVSLDASQSLEAEQPLFSKPEKAQCDASVQ
                     WGTSFTTFLWSRAVHQEPRRLDCSARRAPRCASSFARQLQRSSSSKGPATPPQAYQRP
                     HLGLSSTKDTSRSVEVSYVRYRPTFTATSNSATRFIDSWL"
     gene            complement(<872698..>875196)
                     /locus_tag="LDBPK_341980"
                     /db_xref="GeneID:13392767"
     mRNA            complement(<872698..>875196)
                     /locus_tag="LDBPK_341980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864310.1"
                     /db_xref="GeneID:13392767"
     CDS             complement(872698..875196)
                     /locus_tag="LDBPK_341980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864358.1"
                     /db_xref="GeneID:13392767"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ7"
                     /translation="MLRQLPLRRFRLFSSSLRATHSTSVDATIPRVRTHRHDAAASTP
                     VTDSTLLKKKPSKAATASPSSAPFLTDYRTEKAQRRWSNASRATQAVESTPSRTGPSH
                     STASVPSRSSPTSSSAAARPLLKRTMQAKNKVVVLHPEGSQVITLDMSIEVPAPAAGA
                     AAPLQPKRGTTTVSKSMAREEKETAAKTLGRIRLLFAPPRSSGQSSKRVTKDKIFAEC
                     PTVRAFCRSSDLAGMAEEDGPLAAPGATSVVLPSLDETALFTELNPELPNRVFWKHAR
                     VLCVNETIVCVLYNVPTVVSITSPGIPYVGLPLACADVSLLFASKESLCYEWCVLSEA
                     SASTRSANDDDAAFRVVGTAPTFTPTSDLQGKEMMLRVSLDPATGLWTEMRLPSVVRQ
                     LPPPVPRWQETTTPVNYPAFRVVTYNILYDDFCTSKSSKAKIYPFATDDILDLENRKV
                     RIVQELLAYHTDIVCLQECGRDVFQSYFLPVMRACGYDGVYCNKSGSVKEGCGFLFRE
                     SRFQLVQHASVPLNFQTLSTMFPELAGRVGACPELEEALSAVTSIGARVVLRESTSDK
                     EIVVGNTHLFYHANACHIRVLQAYMLLHWLSDATLISPGGDAATSPSPSLANRARPRR
                     PLVMCGDFNCTHATGAYRLLTTGQVEADHPSWDKGRLFWWGCARLLGYDADDLVELLG
                     KDAKLPHATVARKDCKRPRKTSAETAAPTPADPAEIPAEASNETQAQEDPAQGEGGER
                     VITKVFHEALYGPQVRLQDAYHRTDLSLPWTNFTLTFREVIDYIFFSEDSLEVLRTVP
                     IPSEAELTENFALPNKKYPSDHVALVADLAFTTQ"
     gene            complement(<876149..>876622)
                     /locus_tag="LDBPK_341990"
                     /db_xref="GeneID:13392768"
     mRNA            complement(<876149..>876622)
                     /locus_tag="LDBPK_341990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864311.1"
                     /db_xref="GeneID:13392768"
     CDS             complement(876149..876622)
                     /locus_tag="LDBPK_341990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864359.1"
                     /db_xref="GeneID:13392768"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ8"
                     /translation="MVAVTTLLQWFSFFSLATLQKPFLPVVKDVLVYVCMSGALLYLV
                     TIVLAFGLADKEMEQYLTQTARAAVPDGMSTKGNAVLVPFSYEAFVSASVTVSVVAAL
                     AVLLCCSFVLQVAWDGMVTCVAPMVALTVNTVKPKCWDTAEDYRGKVPPPPEAAT"
     gene            complement(<877597..>881145)
                     /locus_tag="LDBPK_342000"
                     /db_xref="GeneID:13392769"
     mRNA            complement(<877597..>881145)
                     /locus_tag="LDBPK_342000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864312.1"
                     /db_xref="GeneID:13392769"
     CDS             complement(877597..881145)
                     /locus_tag="LDBPK_342000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864360.1"
                     /db_xref="GeneID:13392769"
                     /db_xref="GOA:E9BQZ9"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BQZ9"
                     /translation="MNPLLARDYEVPKKPIFLLEGRDVVQSTEASAFVSNSVTDSVMY
                     STNGNLGLRHLSEVERVGFKTEVLMNGLYHEEPTDISEYMGIPRTNQVGASICTVDFD
                     CMLDGESGTLSSIPSRKLSLDDGAYRSHCSDVMSADGGLIFDTKYVRTVGLSDLSTWG
                     AQVCYSDFRLGAKGSPVSVGSDTKIGFCNCVAGSGAPHSLSVDSMSDGALQIHSSHVT
                     HCSHSDLNYRIELVVLISIDQECWDVAHQQMDHVHQCSLTSDKEVTTFTEVECVVKYG
                     DTYRPLQAEVEGTAWIRESESDTTSPFSRDRYNVSAGGGGGGARDGASSYSNTESKEH
                     GNGDRDGGSNSAFLRPGSWHYHTFHSSNKAQKSYVIKKRFMMPLTPETVPDSVVLTFR
                     ACHKRDHAEQRPRALPTIEEMIADQKAALQLFWKTFDADVKLQDELSPSRSSLPFVYN
                     AFRMFMVSHGLEGGLSRSGLSAAGDGLQFNLSEYIYYGLYYLLTQPEACLRLLKSVYH
                     MLPQSRKYARVLAMNHGAVFPLNTISGVHSTHAANVSNARFHVNAEIGFLIALYDEAA
                     ESISAEDRLLLLELMMESARIWPQCGEWQDDHTVFRLDNIAGTDEYNSNASGNFYVNI
                     SARRHIASAFSFLDRQREHLTEEQLNSVFASLGMSRHEMAELQAVGDGIVVPQRHERL
                     GVYMVHDNFDTLIDWGNERAMHPLHLNYHPIHIYRRKLIDVPEVLLGMLLYPDEFDQR
                     DFQQNFEYYLPLCTFDSPESLFVMVHALCRARSNFSQPMPLLRSLANIDLDNIVYSAE
                     GGLHFSAMASTLPGLIFGCGGVQLSRKGLQVHPILPARIERYSFTIKWRGAVLRVLVD
                     RANITYDLLAGASLRFIHGTPGERIHLHTGFGRCPETTHLAIPRTSQSQVAQFDGVVL
                     LSDCLFDNLLEYSYRSWYKTLETLFDTYRVLHNRPIPSLTPEEFIEKVVYQHEDGEIS
                     FSGIDQILQRRGLCLELGTPEDAEIVETRYGLANAKLAEMTEMVVMSPPPVNAGLFRL
                     LKGLVENGVALAVVSYSRTLKQLLASNPQLARLFVASIDGEEAYDWKIKGQPHLDLYM
                     RAAEKIHVDINRCLVISHHLDRGFNAKEMSKFRMFIDVEDPFVSSRFLSSPYPSLTPE
                     ESKETGRDNPVVCRLELSRIPSSIDELEDMVDGRKM"
     gene            complement(<885143..>890974)
                     /locus_tag="LDBPK_342010"
                     /db_xref="GeneID:13392770"
     mRNA            complement(<885143..>890974)
                     /locus_tag="LDBPK_342010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864313.1"
                     /db_xref="GeneID:13392770"
     CDS             complement(885143..890974)
                     /locus_tag="LDBPK_342010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864361.1"
                     /db_xref="GeneID:13392770"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:E9BR00"
                     /translation="MSSASPPPPQRGDAVQVQLVNADGSTIAQRPIHIEELLQQKDHT
                     VDIGAGIALRLEALNAEQDYSDDNDTSAPDDSADDEEGTTGSVEGAGAREEPASAAAP
                     PPGTRATMDWYDVLDALRREQLDVKRNAAEVGDAMRKSGEGEGRLVTRHLNELRSAAT
                     PLKWFSNAAGLEGKAIAADDAAGSVPPPGASRREVWASLAPAKKNAHPHNYKLLRYVS
                     YMPVLDYRRFRPTALTFHAAASYLSRKDRGQRLLVYGGVSFGARTVEHELYEFSMLTG
                     NWRRIEGRQLVPAGHYGHTMTVVESFDRVVVVGGIGPGGAAVSREKRQAWGTDPLCAP
                     RYRCLCPLLHCRTEQAATTLARAGGTAAPLPLSVSPVSTGFVSLLFDMNLSDQTWRAI
                     QPATQFPLAYHTTVHFGKELFVFGGLTDDLRVSGQLLAINSATYAVRRIQTSAGSSSR
                     GRQGVAPGDGAGEAHSGSDLDECEAAGPGPRFLHTAVRYGPYMIVYGGYDAQNEVLGD
                     CWAFDMANERWEQLRCRGEAAGRAGHECCVVGSRMLVTGGFESSLDEVGIAASPVTTV
                     MELNLVPTVHGEHMWRSEVGIHPPLPPLAFTRCAPCGDEHSFLLFGGLTKLARHRSRS
                     RSVGKRSASAKRCAAASTEEESDVDVDSHPASHKVSERGASLAARNGLWKRLAPFDDG
                     LVLTFPEKRQRSKGAKDEPVVNALGIEVVPDELPEHFKTFVRRQEDFVRKKDAAAAET
                     IRKTTLEEQEEMEPMLYLTDDEIELLLHRSEECCVAFAERYKMNTLPSNVPDREERVH
                     LIEECISESRQVRDVMRSMKGSVPGVTAVKSKTHRKRAGQKFEDYAAAKPFRRVVVMH
                     LLESINQHLSRMHRLNKALRTVDWPEKEGFLAAVGDMQNSVHAVSRAINGVLNKYIQQ
                     RVESLMKGVDKHKEVMRLLTQVVEKNLHDKIWGIEAARDEKRQKHQRARAAVETPGQP
                     TAAATQAARQRRTPSAAARSGSSSPAARRGHTVRSRSLGGGYHADESKAVVHMMDREW
                     HDLLNRARMVEKCAGRLRHYCEEGAVTSDTAPLSALPPPPAPPPQQPSVEGPLSLPLA
                     PQQTPSLMIQVQPSLQAPTLAPGGSMAPPVCLPTGVPLAGLLTSEAPVVPPVAAPAST
                     AGEAGAARPREIIIQRSNELRMTTATVAEEVRKAALDFQAALTQAAAALPPTSSANAL
                     SATTTVSHPTAAPPRTTLGADVVAHTTPAPQLPVPAVMSSHTTTAAATPGPTLPFRSS
                     PSGASSSSSSGSSRSSSSSGSSGPAAAAVKRGPSLQLPSVGHLPSAMAAPLESTGFVQ
                     LQQPVTASLGASTEAPLANVQQPQLTLAATSSHDGATGASHGSRNANTTSAEPAQVST
                     VQGHAVYLSALRPILAAKESLQQLQDKVALIRLNEWDASDLAGAPQDVKVEKLYRRLS
                     KLLTGVAQSVTATFLAKAGARPPRLRPAPVSVGPPPHRSRGKKSTGKARTSGPSTKRA
                     TQSKSLTSVAEACATPASAVFSQALFSSAGGDKGDSSRKGDGAAAWTLPSAADGNVGD
                     ALRLMPLPPPAHNQVDDADDGWLSKRSRPTYDEAAGVPLVSHEALLRDVRPAVVPAAA
                     AFTSAAGPSAVEVHAVYPDARTVPNASATSLLCGSVAPPAIAAGPWAPTVSSGQTSGT
                     APVATAAPVVALSVVPKVVMPAGANDVSTDESGAAYTTQSPLRRRRSTIADLAQLRHL
                     SQSRLDDGSFGGGTTSSGDGVDPVTRDPVTNITRGNFVVNAEYLSRVAPHALLAATTA
                     EIKLQGGAGGMQQAWSDIDEDYFYFGRPVGKRVATAETVVSGPPYISNRPRGGVGVSP
                     PVGTVVGSPRVNAELAASSMRGIPGVTPASTTLGTRSSRARDSSSGRRVSDHYLSSTA
                     SQLLKLHAARPVVRKSGTKHSFFTPGELHLMQARERLRSKSSM"
     gene            complement(<891915..>894332)
                     /locus_tag="LDBPK_342030"
                     /db_xref="GeneID:13392771"
     mRNA            complement(<891915..>894332)
                     /locus_tag="LDBPK_342030"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_003864314.1"
                     /db_xref="GeneID:13392771"
     CDS             complement(891915..894332)
                     /locus_tag="LDBPK_342030"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_003864362.1"
                     /db_xref="GeneID:13392771"
                     /db_xref="GOA:E9BR01"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR01"
                     /translation="MLSWVKTHMLLHPALHRLALLFFLYCGKSCTLPTAHLMALKRVR
                     EEAAENGEAGLGDTLVSQLPKKRPEVAVCTSSSALSPFTRQPFSARYRQLLQSRQRLP
                     VFEKRHLIQETVRTNSVTLLVGETGSGKTTQVPHFLAELQDTFTGVIACTQPRRIAAI
                     SVATRVAEEMDVPLGAHVGYHVRFDSRQCDATRVLYMTDGMLLREAFTDSDLQKYSVV
                     VVDEAHERTIDTDVVLGLLKRLLTRRPLFRLVVMSATLDVAKIQSYFPGAPLVHVSGR
                     MHDVDVLYMPHPVRDYVEATVSCVLQLHEREPAGDILCFLTGEAEIERAVAALHQALG
                     SSSAAASKEQEAPVQGRGKDLTLFNTPADDLARPTEVVVLPLYGSLSLQEQQKVFATY
                     PPNTRKIVVATNIAETSVTIDGIVYVVDCGYQKQSLYNSEARVDYLLPAVISKASAEQ
                     RKGRAGRTRPGKCFRLFTSADFATFPDQTHPEILRTNIVNTVLLLLTLGVANPCEFPF
                     IDPPSDQGMSDAFYQLLYFGAVDDGLQLTDFGRRMAVFPVDVCLARMLLMAPKHGCGA
                     DAAVVAAMLEAGNAFSRPPSRLAEAREAHARFDDADGDHVVLFRVFHAYFKNQQNGKR
                     FCYENYLRHQTLQQAVQVYNQLRRLMSQLTIPVQSTYIPEREYVDTVALRKAVLEGFF
                     TQVAFLTPVAPITHTAGADPTTRVYRTVRDALSVTLHRQSVLAATHKSRALPTWIVFD
                     RLEVQGDSGTFIRTASAVEVGWLLDVSDFYTDLSEIPDGEIAQVLRRAREAESSVHAG
                     KAERESV"
     gene            complement(<895366..>896991)
                     /locus_tag="LDBPK_342040"
                     /db_xref="GeneID:13392772"
     mRNA            complement(<895366..>896991)
                     /locus_tag="LDBPK_342040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864315.1"
                     /db_xref="GeneID:13392772"
     CDS             complement(895366..896991)
                     /locus_tag="LDBPK_342040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864363.1"
                     /db_xref="GeneID:13392772"
                     /db_xref="GOA:E9BR02"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR02"
                     /translation="MSEMQEALKKKEAWDRHLESTLLQLSYFYTSRIEPVEASYNYNV
                     FRPTWFAESIKQKMPFVTFLGPFSSGKSSFLNYLLQGDYLMTGPQPVTDKFTVVMYGE
                     QFQQIPGRVLMADSRLPYRGLSQFGDAFAEFFAGVVVPHPILRCVSFIDTPGILEASG
                     DMHSRRYDYIEVCRWFVEKSDLVFFLFDPTKLDAGPELRQVFSKALLHEESKIRIVMN
                     KADSVRAQELMRVYGSLYWNLSNLVHSTEPPRLYVSSFWDKPYHDGTDHALFEKEKED
                     LLYELIVTIPLQSLDRRVTSMMRRASDVLLFALICASYRTRLPAVFGKNKAKERFYEE
                     YETIVKDLASRYHTSENSFPTCADVRAFLTRVDSKDFPDIEKLEKRGWIKLLKSTIDV
                     DLPRLLQPLKEYSMSDPREQRDAIKLQRKYMQQRASAAPPARAATVASLGGNDPPSAT
                     PKAVVSPPPAAAPAAGSVSSTTDTQAQMLTMMLQMLAAQQQQQQASSPSTGQASPGAA
                     TTASNDQMELTMQSIMAMLQQQMQQQQSQQQQR"
     gene            complement(<898759..>901011)
                     /locus_tag="LDBPK_342050"
                     /db_xref="GeneID:13392773"
     mRNA            complement(<898759..>901011)
                     /locus_tag="LDBPK_342050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864316.1"
                     /db_xref="GeneID:13392773"
     CDS             complement(898759..901011)
                     /locus_tag="LDBPK_342050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864364.1"
                     /db_xref="GeneID:13392773"
                     /db_xref="UniProtKB/TrEMBL:E9BR03"
                     /translation="MVALVASWDTYLVPSAQLACSTKASAQARAGVGQSTCAFTSEAS
                     PFRYHLTDACPIFTASEQDSSDQVSPTTSGPDSAGGTPADVPATLSSSSLLWLLTLVS
                     RNVELLRAAAHLFLQFNAQFAALVESNAVMVNALRARHQHQLDSLLEVTDNHAATDMI
                     VDSAVTERVVLQQQQELDAAERRCAEAEQRLEAELQETFWRFLTTSAPDAVAAANRKQ
                     QSLGWANGGDGAGAGGSPYRAEVDVSRFAEVRKVASSNPRRCNTAVAPFSPVRLVPVR
                     TIKLSNEVSDASAAAAASWTRSPSKRSQDSALQPIILDISPVSALSRCLGCCSGTQLG
                     AIASSVSSAAEEHLLRLAHTRHSVLLFIGSESAAMDVMQSCKAPELLLGAGHSCRDRF
                     QPLANHPVLRVLFTTRLWGANVVLLWNPAQDATLAAAAQAVVEDALELAYAWDADMFS
                     VAVLEGARLPSYVGAGGLSALATGASSTSAAFFASQAVSMEVLRQLRNGVTRELLDTA
                     GTRRARRWQGTATWMQQGIGSTAAATAGTHMCPRAVGVLYASQSAQQEQENQLQHQEV
                     SCAASSVRPNAASPLRGDNSIVSVTSSSFLFSPTSPAGAFRGPCITFNTPLAIRAFLP
                     LAEEYFIPEQPSLVRGSSRGGGDLHRGVSEVASSTTLYQEGGGVRGLLRRPASATATE
                     DDDASFSSEKDARFSPASLSATSAPASSPAIDAMRPSGSGVEAGLHRQPEMTLESLIQ
                     YAFGDLAEIL"
     gene            complement(<902959..>903954)
                     /locus_tag="LDBPK_342060"
                     /db_xref="GeneID:13392774"
     mRNA            complement(<902959..>903954)
                     /locus_tag="LDBPK_342060"
                     /product="G-actin binding protein, putative"
                     /transcript_id="XM_003864317.1"
                     /db_xref="GeneID:13392774"
     CDS             complement(902959..903954)
                     /locus_tag="LDBPK_342060"
                     /codon_start=1
                     /product="G-actin binding protein, putative"
                     /protein_id="XP_003864365.1"
                     /db_xref="GeneID:13392774"
                     /db_xref="GOA:E9BR04"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR028458"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:E9BR04"
                     /translation="MLHIDFCIAADVQAALEESGKPNTATVAVPIIIEKEVLKLLAPP
                     VCSSDGGFEYDLNATRKLLDAKGATAAYIVVRTAPSTQYVVIYVSDATSAKNRMLYST
                     GLSRVVEATPHAQKRTVQISSVSELLPTLFEAESKKVREALMTESERHHAAIARMEVA
                     PQPVVLPGVAVQITTEADDVLSQLAGGAVEVATFKIAAEQLQLDKTVAQLNGNLDQVK
                     SILTDADPRFVLLRYPSPKTHLAEAVMVYVCPPTCSPKIKIQYASSAAAFREQALRHK
                     IQLAHKVETDTPATLAEDVRSAFEPFPPAGARKTQDQSPSCPPTSWAPKGHRMLI"
     gene            complement(<904816..>906723)
                     /locus_tag="LDBPK_342070"
                     /pseudo
                     /db_xref="GeneID:13392775"
     mRNA            complement(<904816..>906723)
                     /locus_tag="LDBPK_342070"
                     /product="hypothetical protein, conserved"
                     /note="contains an internal stop codon"
                     /pseudo
                     /db_xref="GeneID:13392775"
     misc_feature    complement(<904816..>906723)
                     /locus_tag="LDBPK_342070"
                     /note="contains an internal stop codon; hypothetical
                     protein, conserved"
                     /pseudo
                     /db_xref="GeneID:13392775"
                     /db_xref="UniProtKB/TrEMBL:E9BR05"
     gene            complement(<907778..>908029)
                     /locus_tag="LDBPK_342080"
                     /db_xref="GeneID:13392776"
     mRNA            complement(<907778..>908029)
                     /locus_tag="LDBPK_342080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864319.1"
                     /db_xref="GeneID:13392776"
     CDS             complement(907778..908029)
                     /locus_tag="LDBPK_342080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864367.1"
                     /db_xref="GeneID:13392776"
                     /db_xref="UniProtKB/TrEMBL:E9BR06"
                     /translation="MLQRTTLRCYSALLGQATPVLLGSKGGTPKRKKNPMQLRRKTYG
                     LHFKERYLKLEEWYFCPLCAEPKKQGEWCRREDCRQIKP"
     gene            complement(<909107..>909505)
                     /locus_tag="LDBPK_342090"
                     /db_xref="GeneID:13392777"
     mRNA            complement(<909107..>909505)
                     /locus_tag="LDBPK_342090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864320.1"
                     /db_xref="GeneID:13392777"
     CDS             complement(909107..909505)
                     /locus_tag="LDBPK_342090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864368.1"
                     /db_xref="GeneID:13392777"
                     /db_xref="UniProtKB/TrEMBL:E9BR07"
                     /translation="MAVLDYLFYAGVLLLAHALYMAYSIREQLQASHHSHGHIPAISF
                     GGHNVSITAMMVPITLEVLAGTLLGIAGFAHRHKMQDARLCDVTKYLRYDNQMNSGVG
                     FIHFNHRGTVACKRDELKEECKPLVQKKKE"
     gene            complement(<910454..>910885)
                     /locus_tag="LDBPK_342100"
                     /db_xref="GeneID:13392778"
     mRNA            complement(<910454..>910885)
                     /locus_tag="LDBPK_342100"
                     /product="clathrin coat assembly protein AP17, putative"
                     /transcript_id="XM_003864321.1"
                     /db_xref="GeneID:13392778"
     CDS             complement(910454..910885)
                     /locus_tag="LDBPK_342100"
                     /codon_start=1
                     /product="clathrin coat assembly protein AP17, putative"
                     /protein_id="XP_003864369.1"
                     /db_xref="GeneID:13392778"
                     /db_xref="GOA:E9BR08"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:E9BR08"
                     /translation="MIHFILLQNRMGKTRLAKFYIPVDDAGQAQIKRQVHVIVNTRDT
                     RATNFVSYESIKLVYRRYAGLFFILGIDQEDNDLMYVELIHLLVEVLDMFFKDVCELD
                     LIFNFHKVFMIIDEMIMGGEIQEVSRPVILNRLQELEISSK"
     gene            complement(<912132..>914804)
                     /locus_tag="LDBPK_342110"
                     /db_xref="GeneID:13392779"
     mRNA            complement(<912132..>914804)
                     /locus_tag="LDBPK_342110"
                     /product="asparaginyl-tRNA synthetase, putative"
                     /transcript_id="XM_003864322.1"
                     /db_xref="GeneID:13392779"
     CDS             complement(912132..914804)
                     /locus_tag="LDBPK_342110"
                     /codon_start=1
                     /product="asparaginyl-tRNA synthetase, putative"
                     /protein_id="XP_003864370.1"
                     /db_xref="GeneID:13392779"
                     /db_xref="GOA:E9BR09"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007639"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:E9BR09"
                     /translation="MHAKALARLRMHHAARQRMFSVGMWRALWVVAKLTMAEKEAPGW
                     QSTIQVNLAMITEKPHALASPMMASSVRPAVDEAPSFATTSPPLAPGRGFTELSCSVL
                     VPVSLEPPLPATSLPWRDRGLRTGTCASSSSALVLTAASSLPSSLRQHWSSCTTLSRC
                     PFFSLALPLCLLRHRRTLPPHHHHRSPRLPLHTPCRTIAIQLHSVLLFKASGSKGPRA
                     ESERTMENEQQRTAAVAQLKAVVGLDDRGAKDLSSKPERVADVLAFFAQHSIDEASPR
                     EQKVMLFNVWTKVKKPEHRDPVTAFILDGKLDSTQKVDAAIRFVNAAGSDVVDTAAML
                     AECGVGVTVSREDVEKAVAAALVAEDVAALKTKWDKNPNMMLGQMRRVAALRWADVEH
                     VRAALERQVPGLIKDVIVEAKPAAAKKEAAAMPKKEVESCRQNSNFKDVAQGLPRSPI
                     GELPSHKEGACVYVVGWAHRVRHQSRMSFVVLRDGTGFIQCVFDGSTEPFHRESCVAI
                     RGTLRHEPKAKSELQPPMELHVNEYAVVGDSDGTIETVITAESSVDKLYDQRHVVVRG
                     TLASSVLKVRHELLRVFREHFWSHQYYEVTPPTLVQTQVEGGSTLFEVLYYGEKAYLT
                     QSSQLYLESVTASLGNVYCCMPSYRAERSKTKRHLSEFTHLEAEYDVCSFEDLLNHLE
                     GMFCTVIRTVIERVGDLVAMLNPSQLIDPNGNVRDPANYKFTPKRPFRRLRYADAIQF
                     CNENGILNTETGKPFEFGEDITDQPERAMVAKLGEFVFMTHFPASMKSFYMQRDPDDP
                     TLTESVDVLAPGIGEVLGGSMRMYKYDELLDAYKREGLDASTYYWYTDQRRYGGAPHG
                     GFGLGVERLLVWMLNLDSVKDACLYPRYMGRCKP"
     gene            complement(<915946..>916566)
                     /locus_tag="LDBPK_342120"
                     /db_xref="GeneID:13392780"
     mRNA            complement(<915946..>916566)
                     /locus_tag="LDBPK_342120"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864323.1"
                     /db_xref="GeneID:13392780"
     CDS             complement(915946..916566)
                     /locus_tag="LDBPK_342120"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864371.1"
                     /db_xref="GeneID:13392780"
                     /db_xref="UniProtKB/TrEMBL:E9BR10"
                     /translation="MSHIHHTYHGRAGSSITTLSCSSLAAQGSEKQRQYGQRCALLRE
                     ERYRRGSICALENNEWAELSIVCADELAVEWWREDARKSNNAGPTEPRPTRYTYRYRA
                     GTTVSVLPVGQSTEALNGSLTAAVGTVNAEENQLRLWEWENRADLQEWELGERQEMAQ
                     AMQSILVAQRELELAHLEAACRRVMNGTTALDWTSYPRYDRPELLS"
     gap             917839..917937
                     /estimated_length=99
     gene            complement(<918856..>920151)
                     /locus_tag="LDBPK_342130"
                     /db_xref="GeneID:13392781"
     mRNA            complement(<918856..>920151)
                     /locus_tag="LDBPK_342130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864324.1"
                     /db_xref="GeneID:13392781"
     CDS             complement(918856..920151)
                     /locus_tag="LDBPK_342130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864372.1"
                     /db_xref="GeneID:13392781"
                     /db_xref="InterPro:IPR019152"
                     /db_xref="UniProtKB/TrEMBL:E9BR11"
                     /translation="MSTMAASRSDTPAPVHEMSMERLRREYVSLKSTSYSLTVEESHL
                     IRKIETLREESVRAVLNAEMKEEQVSNQLFRRLDGAEKEVQRYQTLLKEEESETESLS
                     RRIKEMRSQQTEVENALEERQEYLLMNLQRKLLDMARKKTAVEQELMAERQKYLDVLV
                     TRLNMLRGRGVGSSTESSVTIHSQPSPAEANTVPVEKHLDVPLPTAAASHTSTPLLRT
                     GVPLGDNHSMLPAEKSQEDAYTDAGLPLPLVLSPAAAAQKKPKDSATLNASRGNTNST
                     SGRLSASTTPRSADLTPRSSHSSETHHAVAALERKLNQLLLEQAAAMQRTSATEKQCA
                     VLTAKLHAVQEATFLDRARASKMKEELEKARTRLSEMKANDRGGIPFSPLDDTSVMSG
                     SNASFDNSSSAVLSSLSLRERTRELLSSVPQPNANERPC"
     gene            complement(<921976..>923073)
                     /locus_tag="LDBPK_342140"
                     /db_xref="GeneID:13392782"
     mRNA            complement(<921976..>923073)
                     /locus_tag="LDBPK_342140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864325.1"
                     /db_xref="GeneID:13392782"
     CDS             complement(921976..923073)
                     /locus_tag="LDBPK_342140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864373.1"
                     /db_xref="GeneID:13392782"
                     /db_xref="GOA:E9BR12"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BR12"
                     /translation="MSAEGDMDGVAYGGTLGSTLDPDEGEEELASYLVPRLATYAPST
                     SPLSSSLASQVGEADGAAEEDHALPLSRQLGGSGSQAWDSGERSAAHAIEDDTVEGVA
                     LRASHGLPMQSSASPDEEAQANAGSGLDPFLTEMDAEDVDDWREEDEHDADEYDEEEA
                     DNTDAPPQTRSGTRRRGASAVPNYVNAFAHSRVKELLKYEGSSSIISKDAISAVSEAV
                     ALLTRDLVAMAAGEATKRHRKTVTYEDIARVAQLLDRFSFLAEVLPPVAASSSNALGA
                     GNSIVIGSSAHSAAIPGSSSGTRRHGDPSVRSRSAHGCPGRNALQNLGESPPASARSK
                     TAHVGVLGAAAHRSAVHPQPGAGLRQATLRF"
     gap             928861..928959
                     /estimated_length=99
     gap             930283..930381
                     /estimated_length=99
     gene            complement(<932208..>933296)
                     /locus_tag="LDBPK_342150"
                     /db_xref="GeneID:13392783"
     mRNA            complement(<932208..>933296)
                     /locus_tag="LDBPK_342150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864326.1"
                     /db_xref="GeneID:13392783"
     CDS             complement(932208..933296)
                     /locus_tag="LDBPK_342150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864374.1"
                     /db_xref="GeneID:13392783"
                     /db_xref="UniProtKB/TrEMBL:E9BR13"
                     /translation="MNILHKIFTPGSKSKKTLLHCDVEVGDRQPHSSPKVSASVQVKR
                     KSTAASSDDDDDCGPLMRSVSMTVVSDPVPTSFKTNSSFANQSRPTQGPASFKSARLA
                     NSFSNASCHLERHHQHTAALAGSVSRHNQRSLFDKIQGSGSFAAGETTVSGGSFTANG
                     GAVNLWRLPWTQQKVTMCPNCHRPRQRDRTMFVSRASYTLQETTIENGMGDDMSEANE
                     DMSYSDSEGMGAPMSDSVTCRCGVVSEGDAPLDYDDSAEATEEHPQMFVVETQNPSAV
                     QLPGTIAEASDSEGEGREDLRRSYKLSLVSPPTSTSLRRRAPHVQPPLSGASTKSNTA
                     SVPKRVTHWLHEQQTSEAPVVLKPKASR"
     gap             936406..937189
                     /estimated_length=784
     gap             937980..938078
                     /estimated_length=99
     gene            complement(<939061..>939606)
                     /locus_tag="LDBPK_342160"
                     /db_xref="GeneID:13392784"
     mRNA            complement(<939061..>939606)
                     /locus_tag="LDBPK_342160"
                     /product="centrin, putative"
                     /transcript_id="XM_003864327.1"
                     /db_xref="GeneID:13392784"
     CDS             complement(939061..939606)
                     /locus_tag="LDBPK_342160"
                     /codon_start=1
                     /product="centrin, putative"
                     /protein_id="XP_003864375.1"
                     /db_xref="GeneID:13392784"
                     /db_xref="GOA:E9BR14"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BR14"
                     /translation="MNITSRTSGPLRTTAPAASAPSAAARRRFQLTEEQRQEIREAFE
                     LFDSDKNGLIDVHEMKVSMRALGFDAKREEVLQLMQDCAARDQNNQPLMDLPGFTDIM
                     TDKFAQRDPRQEMVKAFQLFDENNTGKISLRSLRRVARELGENMSDEELQAMIDEFDV
                     DQDGEINLEEFLAIMLEEDDY"
     gene            complement(<940732..>941736)
                     /locus_tag="LDBPK_342170"
                     /db_xref="GeneID:13392785"
     mRNA            complement(<940732..>941736)
                     /locus_tag="LDBPK_342170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864328.1"
                     /db_xref="GeneID:13392785"
     CDS             complement(940732..941736)
                     /locus_tag="LDBPK_342170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864376.1"
                     /db_xref="GeneID:13392785"
                     /db_xref="UniProtKB/TrEMBL:E9BR15"
                     /translation="MLRKSGRRLALEGERQFFYPGNSPMQSTGGLPFYGNLYAGRVDS
                     QNYVPPRQGGSGLLEVDKSLWDNPATRQKLQSCPYFALSDQVMFHNMDPVYLDPGLLS
                     PEEHQLLLLFSRAYYEKWAAIHRRPPHALPRLRITYGSSKLLDEILFLLDVHPDVCEV
                     LKKEYAVDDSTLIGMNPNLWSSAYLDPANMDHLSGRVLEFAGVPEPKRKKFFLLLDQM
                     RRIKVHRRDLPNGEERTDVVPFCYGVTLYDFCKFLGITPYSGQLKVYDYVDLQGTARS
                     ETLKDEDSYFDYLVALFYRADVRSATLTDLADASDHTCRYTVTVEPFTTADRRVGRWF
                     "
     gap             942732..942780
                     /estimated_length=49
     gene            complement(<943520..>944677)
                     /locus_tag="LDBPK_342180"
                     /db_xref="GeneID:13392786"
     mRNA            complement(<943520..>944677)
                     /locus_tag="LDBPK_342180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864329.1"
                     /db_xref="GeneID:13392786"
     CDS             complement(943520..944677)
                     /locus_tag="LDBPK_342180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864377.1"
                     /db_xref="GeneID:13392786"
                     /db_xref="GOA:E9BR16"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:E9BR16"
                     /translation="MKCAYLSLLAGVSSLDKWTDTSLQRTRTKNTMERIPFVVRRMVA
                     TEQNCAFVHFFASFADVSAAPLAIETKAFRSAAAGGAADDAEPAYQLVYDVMRSRNGH
                     ILFKKSYAERFTHSLTLAAPALALPAELQSLVQARLQAYIESPGVYLDGVTEKNVKLL
                     SWIPATGASTKQAEAFPIPVIIMLAKSSYPSESMYREGAKLGLLFNAHRINPNAKVAQ
                     MGLRDRAHAYLTENGVYEVLLVHDAADAYLVPEGSRSNYLLQKSDGTWWCSAEEDILV
                     GITLKTTYRVLQACGLGSVQHAKLTLKDILESKLLFILGTSPTIMPVQSVLLYGDSET
                     RRFYEEAVRALGATAGTVQQVSDVKAELLFPVNVELASALRTQYFAEAASS"
     gene            complement(<945396..>947048)
                     /locus_tag="LDBPK_342190"
                     /db_xref="GeneID:13392787"
     mRNA            complement(<945396..>947048)
                     /locus_tag="LDBPK_342190"
                     /product="glycosyltransferase-like protein"
                     /transcript_id="XM_003864330.1"
                     /db_xref="GeneID:13392787"
     CDS             complement(945396..947048)
                     /locus_tag="LDBPK_342190"
                     /codon_start=1
                     /product="glycosyltransferase-like protein"
                     /protein_id="XP_003864378.1"
                     /db_xref="GeneID:13392787"
                     /db_xref="GOA:E9BR17"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR027054"
                     /db_xref="UniProtKB/TrEMBL:E9BR17"
                     /translation="MELMLLGFLYAFGAACVVNYLIMFVRIRTTEMYVQRRKRVVDAY
                     EKLYGPLGNGAVEEREGEDHAPETDASADLLSKEPLRVAFLHPDLGIGGAERLIIDAA
                     VGLQKRQSIRLVELIIVTNHHDRSRAFEETTDGTVRIVVRGSALPASIFGRARVLCAT
                     IRMGFAAFATCWSFPNTDCFVVDQVAAAMPVLHFFAGRTPILFYSHFPDQLCDPNRNP
                     DRTFKSAGSGLAPWHETYRGFFDQVEASSMKFATNIVCNSKFSRQVCIDTFPTLADKI
                     HEVTDIFYPPVEMKVREVTEDTLSQSAALRELKQAVSGAVTFVSINRYERKKNIELAI
                     EAFALLLSTGEFKGAEGKKPLMLIIAGGYDPRLAENVQYADELAALATTKLRIPASQV
                     RYLKNISDDEKAVLLSEMRALVYTPSREHFGIVPVEAMAYSKPVVAIADGGPCESVGS
                     VELEDPSKCGGLLSSPEPAAFAEKMARFARDPVYAAKVGAQGRARVLEKFSMEAFSMQ
                     LVTRLVRLRSEADKKLLAEGIELAKKEAASKAGKSSQKAKSD"
     gene            complement(<949709..>952135)
                     /locus_tag="LDBPK_342200"
                     /db_xref="GeneID:13392788"
     mRNA            complement(<949709..>952135)
                     /locus_tag="LDBPK_342200"
                     /product="DNAj-like protein"
                     /transcript_id="XM_003864331.1"
                     /db_xref="GeneID:13392788"
     CDS             complement(949709..952135)
                     /locus_tag="LDBPK_342200"
                     /codon_start=1
                     /product="DNAj-like protein"
                     /protein_id="XP_003864379.1"
                     /db_xref="GeneID:13392788"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BR18"
                     /translation="MSTALGMEPEVVSSSASSSSELEEPTVDPRDVGTDAGNRSPELS
                     LNTATASASGLAWPNNLNVNKISGVRAGATDKLQGGTSAHRGVNGATARFTDPKDENG
                     FTVFSRRPTGAGAAATGLSQQQTSPTSTLAPNVSNGSGVSSGHALRSSANASGATAND
                     ERPGVMEFAKNLSERHLRCALCAKVVVDVVLIGAHASVACRRCALALPGTHITELPRP
                     LREVLRALKAAAGLPEPNDDFVGDRRILRAKRPFPVSATQPNGTEPTVKEETAAVASP
                     GSPAPAAATSTAAMQAVLAELTDAEMAERHQIGSAEASSRAEITTRRSVAIAARAAPA
                     AAAGKPNGVSSRQYKLEADRKYENAEYVAALELYTKAIKLQPMDHQSNVKFLYGNRSA
                     AHYMAQRYNECIEDCLEVVRLDPGSVKMLSRAARSACTMGNLKRAVEIMESTPKDRLT
                     SDMEAELARYKSGLEAYRHAERCFGTPEGDEQYRMLVAQFSDTVPFRVRSAESLREQR
                     HYMRAVEVLEALSYSTRTPAACRIMSECLYLSGFEYFERARKCIVDAAQLDDACNELL
                     KKIDAVDDGKQKGNSNFNKKNYGPAAEYYTVAIQAAADNDQVLRVLYCNRAAAYKELG
                     RYREGVEDCTKTLQIDKEFYKAYARRARCHEHLGDHFAAVRDFKKAIEYDGTDRELAR
                     ELRAAEQNLAKEAEKERDFYFQLGVSRTATEREIKLKYRELSLRWHPDKCIGLDEVER
                     ERAEHKFKIISEAYATLVDAVKRREYDAKQDRERFTRAGGFNFSSTYSGGSANDYYRG
                     RHRAGGNGFW"
     gene            complement(<954707..>955273)
                     /locus_tag="LDBPK_342210"
                     /db_xref="GeneID:13392789"
     mRNA            complement(<954707..>955273)
                     /locus_tag="LDBPK_342210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864332.1"
                     /db_xref="GeneID:13392789"
     CDS             complement(954707..955273)
                     /locus_tag="LDBPK_342210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864380.1"
                     /db_xref="GeneID:13392789"
                     /db_xref="UniProtKB/TrEMBL:E9BR19"
                     /translation="MSFRIEKQPARNFAFATPGESYLILASSASLRKHLTDSYWCEAM
                     EQVCAGKLEGIAVRYTGENLVMVQFCPTNLSPAGYRYPLFMSIPIEFLVPLAESTFNI
                     PPPSDLHGSFGTATTSSFHSRSSSEGRSTSNGATMPRLCVVCGRFNVPGMIHRLHGWK
                     CKECKGTKSDNRLRQEAQKLRKRMKAHA"
     gene            complement(<957199..>962817)
                     /locus_tag="LDBPK_342220"
                     /db_xref="GeneID:13392790"
     mRNA            complement(<957199..>962817)
                     /locus_tag="LDBPK_342220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864333.1"
                     /db_xref="GeneID:13392790"
     CDS             complement(957199..962817)
                     /locus_tag="LDBPK_342220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864381.1"
                     /db_xref="GeneID:13392790"
                     /db_xref="GOA:E9BR20"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:E9BR20"
                     /translation="MASLCASACDAHESLNDSGETDRQMVLIHVDNTLLAMRTSNRLN
                     YRSSPLKEKEASEYAVAQELLDLQRRLFAGAVPVPGRTSSSSSVHPSPQGKSNPACAC
                     STEALPDLVPLALPDSYSKHGEVSEVAILSAFANVCRSPNTSAVVTGVALTALVDMLD
                     LPCAFVSMYGVYAAIEAASETRAEVHDSASHEVLLSRIFSVYVAALNHPAAVMADGGV
                     HVRALGRMMVLATHPEASQLLKRTVEKSMRLIVMTLFRRLLHLPADEDARGALVAAGV
                     TVLRFISRLISGDIACFDNDGHEVASTVAFGGSEGLAGTSASGGSGDDKTSPLENTIT
                     LIQLEGLALAQDCLLLLRCSLSKPLFAPLLDTVQNQLCRALLIAGVGTMRTIVLAQTL
                     RTVHLVMQGSSVHLIPQIYNFIRVLHLNPLEALANELADASAVQPGSPVGRSGSPVAS
                     RPPASPVSTASSGHGNSGRLSAQQLQRKQERRDILLESLAEFCSDPRFGSFCFIHYDL
                     SWRYASLLPQLYQVLANHVYPVFHGDPEEVATVAWSQRRSGMAGDRKAAAQRRQRAAA
                     AVDYRRDRRQRSMAARRLPRSTQRTALDATTNMVSGIAIRAIASGALPSTAAESDTTI
                     CTGSPSTSLAELQRLIQHAQKEKDKLNYFASLFEDSPIKKGIPFLLEHAIRVPAGAEE
                     ETSLKHCTKLVLAEPAGGRELGEALYRLSIVLNKRVLGDYIGEQGRNQPEDVAAAEDA
                     TRPAALFSVRFFEEQLDGFIHQFEFHNKPLLDSIREMVFLLCLPGESQKIDRVMESFA
                     KHWYQQNVTYREDGTLVKDETLNPFHSDSGAFVLSFAIIMLNTDQHSGKVAQQMKRED
                     FVKMNRGIDDGKDIPAAYLGSIYDDVRQHEVVMAEMMDRGFANDTTWRLEMQPCLNFV
                     HHALSAAAEVEKAEAVKALTTISSHELGAATAAATAGSTVATARMRDPESGVLQIFDL
                     LLFQSLWKRSLLVFDGMLASAVDEVSLSIVATGDTIARAVEEAEQQLPAEMAILQSSL
                     RGVCLLARAAHALSLPVVADQCFMGLLKYVVMSDLTNAEEEVRALYRSVPKLLCMREI
                     FALLVDIYSSLEDSWLPLSRLILDMQLVGLFAEPAQAAARGRPKPRGADDGDAEASDS
                     RAAQRSVSAPTEPLHVLLQDPGIYANVFAPLSAASAAGDIAAEQKAASERGWFSSLFG
                     GSGALQVSTVQLSELRDALGRIGSCIPNMRRLLSILQRVSADPNAAQRCLCSLSAVSS
                     IEEDIAGSSGNGVNSAPAEGEGKKGNGHPSGLDEASAYAASYELAFICAVVGGAATTA
                     VLQPAHFASLTTRVSRLLREVDVYLHDTRASDGVRAYWCTLGNRVVCASLQLMAVHWR
                     GQHGAVAMEQLWACWMRAAPSTFAFVVARPVAAFLYDQVVVLDEAEKGAGPGEKERDA
                     MQPWASGSEVLVLLAPFAVHAAAVSDVVVQRQIGSLLLHVVQQRRYSVSDDTESIVSL
                     CLSFSVWMRHSRAAGSSTAVGDTPESNEALTKAKCGAVATTSLPSGASVAEVLGLCGR
                     NVLLDNAGTAAGGAGAERGEWCSLWVFVLRSLGALALCSSDARDGSEAILCLQRALLD
                     SEAHDLPSSAVMAVYEDILIPLTERLCAPKARLQTGLQWAGARKAALGENSGAAASFS
                     RSVLGSLVNSLVSPVSPERNGQGESMASVVGASALSRRSAPPTLVFTEVKCRLLSLVP
                     KVLLRYTAALTTQPDLLLSLWRRVLGTLYAVHSAYPVIEDAAGHGMGGGSTSHDDAML
                     VQEAVEETVKNMIYVVASTWQCSSSSTVGSVAGTQQQHAAAFWAAIVRFLQPFSFSAP
                     LVDFMVQAGLVRIEAGAEAAIAPDAAAPAG"
     gap             965575..966049
                     /estimated_length=475
     gene            complement(<967760..>970387)
                     /locus_tag="LDBPK_342230"
                     /db_xref="GeneID:13392791"
     mRNA            complement(<967760..>970387)
                     /locus_tag="LDBPK_342230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864334.1"
                     /db_xref="GeneID:13392791"
     CDS             complement(967760..970387)
                     /locus_tag="LDBPK_342230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864382.1"
                     /db_xref="GeneID:13392791"
                     /db_xref="GOA:E9BR21"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR21"
                     /translation="MLQQEAFRIHRKSSDATASVGTGYQDDAVATTTLPCTSTSHCVP
                     PSALPAPNGCSSTAAVGAGEVAAVSSILPPPTSSSADGEQMLSLHTVVQETHAGTKSQ
                     QQILAERARASFRHDRRLQRGQRDPRQTDALSSSTPHYPHPLMGSPAWVALPESVVAH
                     SEETASPSLLLDGADERNCVSARPTAWMCSCSSVMNSTPPQLLPPSAASTTSSATLGG
                     RAGGLAYQFLTAEDDEGDVEYKWRLTGISPSRFQHLVTQMQFRVSEGHGQCLYELGVS
                     DDGTPRGLTRRDFNESVQTINRMAAQLQLEATLLQCCVVRKTAATPAGGSVSSPYDKL
                     KISAAERAERDGEQHEPCHSKENEEELLCGEIMLSRRQAGNSGHDLSVAFCGAVGSGK
                     STLMAVLLTSRLDDGCGGTRQALFNHKHELDTGRTSSLASRVWTVTQTPADTSSELKR
                     PVSAAQLPSPRDSPAAALRGSAPSWSCTSSPAAPLPPSTLPFTGASPRSITLLDAGGD
                     ITKTMLFCLMSRKPDYVCVCVAADTADVSDVSLYAEVCCAMNTPFVVVVTKSDLVEEF
                     ELDGLIMELAIALEVVGCESEQVDSTLMAAAYCRAWLPRHRDAAVEGGVGTTTPISTP
                     NTTAVPPRAERLRVPVFCVSSVQGGEGLELFRYCLSHIQNPPPSPLLSPSSWASKPPF
                     EVLLDYAFAVDGVGHVVHGRVARGPVEVGCSCYIGPGSDGRFYAVLVRGIHVDGEHVN
                     EAQVGDEATFALNRLPDAVTVSHKGKVLVRQPETAVWSFQAAVSVLSQSISAHMEPIM
                     YTRNARQAVCVTSVTPPGSEEESDAAAAAGLRESILVQCRFLFRPEVVSAGDAVVLHW
                     APRGIAVGRITSMNAPAKV"
     gene            complement(<972033..>972467)
                     /locus_tag="LDBPK_342240"
                     /db_xref="GeneID:13392792"
     mRNA            complement(<972033..>972467)
                     /locus_tag="LDBPK_342240"
                     /product="ribosomal protein l35a, putative"
                     /transcript_id="XM_003864335.1"
                     /db_xref="GeneID:13392792"
     CDS             complement(972033..972467)
                     /locus_tag="LDBPK_342240"
                     /codon_start=1
                     /product="ribosomal protein l35a, putative"
                     /protein_id="XP_003864383.1"
                     /db_xref="GeneID:13392792"
                     /db_xref="GOA:E9BR22"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:E9BR22"
                     /translation="MTTSKVHSQRSKKLHQLSAKTSRVNRNRKAPRLYMKGTLAGYTR
                     GLHGQTKQTALVRVENVNTREDATWYVGKRVCYVYHGKKVKRCVRWSKAPARRSTTRA
                     LWGRVTRPHGNAGMMRVKFNGASVPASAIGRRIRVYLYPSQI"
     gene            complement(<973469..>973885)
                     /locus_tag="LDBPK_342250"
                     /db_xref="GeneID:13392793"
     mRNA            complement(<973469..>973885)
                     /locus_tag="LDBPK_342250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864336.1"
                     /db_xref="GeneID:13392793"
     CDS             complement(973469..973885)
                     /locus_tag="LDBPK_342250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864384.1"
                     /db_xref="GeneID:13392793"
                     /db_xref="UniProtKB/TrEMBL:E9BR23"
                     /translation="MGFGTRSCMVFCYLNGVCAVFISYLFKIGIDSMAITSVINKWDR
                     QEKARACRNAGILYLILAVAVTVKDAIDTCRERRLSRGVDQRMAEYGVADAHAGAEET
                     VPLLECSAYVHGDGTRRRSVAGRGGSGSGGYGGAYY"
     gene            complement(<976288..>977421)
                     /locus_tag="LDBPK_342260"
                     /db_xref="GeneID:13392794"
     mRNA            complement(<976288..>977421)
                     /locus_tag="LDBPK_342260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864337.1"
                     /db_xref="GeneID:13392794"
     CDS             complement(976288..977421)
                     /locus_tag="LDBPK_342260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864385.1"
                     /db_xref="GeneID:13392794"
                     /db_xref="UniProtKB/TrEMBL:E9BR24"
                     /translation="MLRESASSSQGGEGGGGGLTGENAFSRSALLPAWVPPEASTLHQ
                     RSASLTPQLNSTTCSPLLGLRRSNASKMAGHGDDGLRGAGASASPQPPLGNPRFGLSP
                     QRASTSLNMPSPPLSSMYYSPQVPPAQCSGLSITPTVASFMSSSSSHSPTAARVLMSA
                     AASQSPSRRPVRLALGAFCMLNAVIAFLFTWMMCTQQIGFALTAAKRRWDLKERSGAT
                     CTAGVYYLIIGLVLLIDRLSSTVAVVAQLGVRLVRAGFPSILRWLMWCVSRIAASRVC
                     VPLLRRLAPHAAIASSENYRVLMRSKSARPLRSSSAAVPAVGAPTALSGHGLLPRFSC
                     SQMGSSFQCSQTNSMRESVADSEVDRRPCSATAASLSIRRRGG"
     gene            complement(<979648..>980865)
                     /locus_tag="LDBPK_342270"
                     /db_xref="GeneID:13392795"
     mRNA            complement(<979648..>980865)
                     /locus_tag="LDBPK_342270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864338.1"
                     /db_xref="GeneID:13392795"
     CDS             complement(979648..980865)
                     /locus_tag="LDBPK_342270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864386.1"
                     /db_xref="GeneID:13392795"
                     /db_xref="UniProtKB/TrEMBL:E9BR25"
                     /translation="MKSPESFDGLSSHCQRARFRVQACFDTAAHELILSAEASENSAL
                     LIADDCSVELRVAPVSSGAAGAAGVSPTTHALTALPWDCSRMRLGVNGISYGTGPLVL
                     RDGDELTLHPNHVTEATTSYTYNVKAVPASADVAGNEMGDGPPLETRPSASEENHRLR
                     VIMSNVEQYAKWNNFYSERFTNLATVSVPPSNGTCTTGQLHKCACGSYVQAEVGTSDA
                     MPRGTHPPNAAQTPLVWDADADVSKALPSAHARTLVTLLPSLPQLLDFGSPATQPPTA
                     PRAPLPATCCCCPFTSASSNPALRLCRKKSAYTSAAAPPSSIGESSDAQQVCETGPSL
                     RVDARQTSWSVYAQARRDDCVAAPQVSNAKKAVDAPNSDAFLGGASLGRPAVALLNRI
                     SSLESALMGLRYE"
     gene            complement(<982349..>985573)
                     /locus_tag="LDBPK_342280"
                     /db_xref="GeneID:13392796"
     mRNA            complement(<982349..>985573)
                     /locus_tag="LDBPK_342280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864339.1"
                     /db_xref="GeneID:13392796"
     CDS             complement(982349..985573)
                     /locus_tag="LDBPK_342280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864387.1"
                     /db_xref="GeneID:13392796"
                     /db_xref="UniProtKB/TrEMBL:E9BR26"
                     /translation="MTQQDGGPGPSSAVSPNGDVSDVTHSTAYVVLNALIDEGQISEE
                     RADYLKRKFKELHSRVLAIYRRDNTLLKHARQLRSRLEVERQRIYTFGDAAKKDDEVI
                     QALKRNLMEHERDLAAALERDSVLQVEVLEYDRRKQHLILEREDAIAAEEARIRPKME
                     SMQAEITEMGTHIKELAADLVRCQAEKDELVKEEAQKKEEIANFATTLAQARKQLQNV
                     QSDPERAKKQLDLVQGSLVGAQRELSSTEEKVLAQAERIQSMELQRNSRAEDHEAAKK
                     RLQTLRAEMDAKRKTLATMNTSLEVEVETRQATQERVAELDQLVLSTKIALQQEQDGV
                     DRIEREREKCMRIFSTLERDMEDSRREEESLREQIGLLHRELEQVTRATAHVEKEIQA
                     HRKDAEVRTKKLLFEQAKSKEFVKKAEQVLAEIREAEETIAVKAKQEDVKRRELAAIA
                     VKRQEFSRASAREETRVYLAQCELQMREVLVKEAQRRHSELEKRLGKAIDLFQRVKQE
                     RAQKATQIQTIAQAMAQVAEKTKLLEKELSVLTRESALKDQEIAKAKFQLHELTHLCA
                     NLRLEKNRQRKQMEKAADSEREVKAQVRRLNTDIAATEDTMADLRRAYAAAIENRNQA
                     GIQLIDRNDEAALLAARIKAQELAIAEGTRMTNDRANEVRMLKTKLGTLLHDIEACQH
                     SIPKVSQMELELTRLREEIETEQWRTQVLEDDITDPKNPHRWNRVPLVLPGNVALPAA
                     SEAQATAAAAAMCTQADSAPAALSASSSPGDAGHADKSGGDARAAPAPALVGGPSEQY
                     VCLQARCQELEARVQKLNAKLREKNLILEEVTELAERVGDQADAGKECTLALAQQVNK
                     YHSSIRHKSRQMMATIAELSLFQASSIQLQQEVQRLESVVEEAEERLEAGEAPYAEAE
                     LHYERERQCQQRYVAARQRQRDAAKESETSLGMQMVATTAVPRPNAYVPQDDDLGLPR
                     PFGPFAPFKSASAPRVAFNPPRAEASLPSGAQGPSPAPRSMEAVRGSSVPLSAPSSPP
                     GTSAGIPFKACGPSTPPPLPTATAAAVTTTDATSFSSPVPKRRQ"
     gene            complement(<986596..>987675)
                     /locus_tag="LDBPK_342290"
                     /db_xref="GeneID:13392797"
     mRNA            complement(<986596..>987675)
                     /locus_tag="LDBPK_342290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864340.1"
                     /db_xref="GeneID:13392797"
     CDS             complement(986596..987675)
                     /locus_tag="LDBPK_342290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864388.1"
                     /db_xref="GeneID:13392797"
                     /db_xref="UniProtKB/TrEMBL:E9BR27"
                     /translation="MPGSLKVQTGRSDARKTVKKTVPSKGNIARSDEPAGAAHSAASA
                     SVATSSATTASTLTNAVALSTSEQERPVEAVKATIPASASREVLRKDPIYRIMHMLPR
                     SDVLEVVRSRFEKPHCERAAAYFDLSYMKNPLRHLRLQLGCDGPTGIYLFFRRIAAHR
                     HTLRVVDFSRNRLSADDAVLLCNTLGLGVAGDAATAPGITKASSPGAAADSTVSTAAG
                     ASAQSSSSLELLDLSYNAKLGNDGAVHVVAAVRRLPSIRAVILKSVGIDDDGAIAVAD
                     VVRRWPAPAVCASSATPHALLRPATASATKFYLNLNENYIGARGTDVLGKGLPHYVSL
                     TLAKQRPDPARSRKRSRDDDGAARR"
     gene            complement(<988568..>990178)
                     /locus_tag="LDBPK_342300"
                     /db_xref="GeneID:13392798"
     mRNA            complement(<988568..>990178)
                     /locus_tag="LDBPK_342300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864341.1"
                     /db_xref="GeneID:13392798"
     CDS             complement(988568..990178)
                     /locus_tag="LDBPK_342300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864389.1"
                     /db_xref="GeneID:13392798"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BR28"
                     /translation="MPGFADSLNGVAVGSSTMLTRGTHSSQDAIHYTDTAAAAEWRAL
                     YGASAEMMNSTAHTFRAGGAGVSYMTPIFHLTADDATILSMEHNNHCRLLGIATSKNQ
                     IFVTWTQLMPVIENMGMLWAPDDDLFGGEQATPVDERLLEWDPATMSILIDELPYTCT
                     ELSWAPWQQGIYLAGLCPGHGIRLYRYSHGNWALDDCIRSTESVSCSISTNFTVACAC
                     RRGRVELWVRGSTACGTAVAPGPSPSLSAGDGTATNGGDGVSHTSWVLCRVLTLPFTE
                     DDGGGSRTHDGDRSGDAGSSSAVAARHRRRDTLGVAWDESGALLAAGDQGGSVYVVAA
                     TQDSTRLGEVVYHRLPSALCSPCKQVAWSPSSGRSFLCLAMVFTTCVRLVLFRRPRFM
                     NAAGLPHATHSVGGGGGGRMGWAHGSVAPIAASPLEELATAQVPCEEVAKLSWNNTGT
                     RFVTAHLDSSVNIWAVDFRYQHPVKGGGANATGGRDEANTLHSVDSARMDGQVETSVF
                     AAAGDKRLGIVVSVRRTSAVHPYHALSK"
     gene            complement(<999379..>1000554)
                     /locus_tag="LDBPK_342310"
                     /db_xref="GeneID:13392799"
     mRNA            complement(<999379..>1000554)
                     /locus_tag="LDBPK_342310"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_003864342.1"
                     /db_xref="GeneID:13392799"
     CDS             complement(999379..1000554)
                     /locus_tag="LDBPK_342310"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_003864390.1"
                     /db_xref="GeneID:13392799"
                     /db_xref="GOA:E9BR29"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BR29"
                     /translation="MSLRPVHRPVATVLAVDMMHDSRAPHGKSRVSGGSSCFPSDYLN
                     NESFNLNSETEHVSTNSSTCDPAESYHLLLPRELRTPAQDFTTPEIPDSSSHSPLCSA
                     FFSSVTEMQHQSVLEVGVASDQGIRSSMEDEHVTVVEPEVCFFGIYDGHGGRQCAEYV
                     RSRLHKITLAHECLKTAPRKAISDAFAQVEREFLGQNTNDMSSAGCVCAAAVVQGSVL
                     TVGNVGDCEVVLARAGQPVLLTVKHNPSCNDAEATRVKKAGGCIFNCRVGHPRLNPRM
                     CSLAVSRAVGDAGFKLEEYTNGKPSGIIAVADTSEVLLAKEDAFLILACDGLWDTMSY
                     AEAVELATAYVASGADANSVADQLVGEALRRGTRDNVTAIFVRLGGPAQAGLGDAEK"
     gene            complement(<1004472..>1005827)
                     /locus_tag="LDBPK_342320"
                     /db_xref="GeneID:13392800"
     mRNA            complement(<1004472..>1005827)
                     /locus_tag="LDBPK_342320"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_003864343.1"
                     /db_xref="GeneID:13392800"
     CDS             complement(1004472..1005827)
                     /locus_tag="LDBPK_342320"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_003864391.1"
                     /db_xref="GeneID:13392800"
                     /db_xref="GOA:E9BR30"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BR30"
                     /translation="MPAEKKSDATATRKPDSPHSPKSPTSAGATTAFTSAKKKSILRP
                     KQKPPTVPVNKSSSTSSSTSVGKHPHFLSPLPASSPTRPRDPAKTGLPPQAPPPSTGV
                     EDASTPQSACDGSHGKGHQANHVVVPSNMSSAAPSRQNSTTLHPLCRHSSLRKTAFVV
                     VDYGATAEQGTRKTMEDQHTMLSEGIPFFGVYDGHGGTQCAEYLRDQLHGLILGHPEV
                     KTNPEKAIVDGIVEADRAFLARSEAETNESGSVCAVALIIDDKLVVGNVGDAEVVLSH
                     NAKPVVLTVRHNIASNPSEEERIRSVGGKVCHNRVGHPNYNPAVVSLAVTRAIGDAGF
                     KLAKYTDGKPSGVIAVPETSVTRLTDEDEFLVIGCDGLWDVMTYAEVVDFCSQRLQEG
                     VPAQCIAEELAQAALTKGSTDNVTAMLVHLTRREGPLSTREFVPEAAVSTSTRNLSEE
                     P"
     gene            complement(<1006930..>1007709)
                     /locus_tag="LDBPK_342330"
                     /db_xref="GeneID:13392801"
     mRNA            complement(<1006930..>1007709)
                     /locus_tag="LDBPK_342330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003864344.1"
                     /db_xref="GeneID:13392801"
     CDS             complement(1006930..1007709)
                     /locus_tag="LDBPK_342330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003864392.1"
                     /db_xref="GeneID:13392801"
                     /db_xref="UniProtKB/TrEMBL:E9BR31"
                     /translation="MCDCGTGVADCACECVCVDVCPSPLAVNAREVKLDGHCNGTVVA
                     VWGTRKVGRSVTKCIPSIEVLGETIEPKPRVRSSSLPFSRREKYLWVVVPSPCGKDVV
                     CRFIVHHHNVPCLCFPHECRVLLFCFCTLAPALCRVVTRLRCVHTYAHHFTPPSYSPL
                     TFCFSFVFPDFTIIAAAGERVRVCVCESRVAAAAFAVGHCSWPTPFSTLCSPSHKLAS
                     PRSVSEKDPRNSANEESEAKDKRTQRSRRTPTKNKNVEAVL"
     gene            complement(<1008532..>1015818)
                     /locus_tag="LDBPK_342340"
                     /db_xref="GeneID:13392802"
     mRNA            complement(<1008532..>1015818)
                     /locus_tag="LDBPK_342340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864345.1"
                     /db_xref="GeneID:13392802"
     CDS             complement(1008532..1015818)
                     /locus_tag="LDBPK_342340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864393.1"
                     /db_xref="GeneID:13392802"
                     /db_xref="GOA:E9BR32"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR015403"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:E9BR32"
                     /translation="MEKGIEEIVDACAHLLAEMKSDTRERTILSAVSKTLKRLAQESR
                     QHQDQLSAQSAPSQGANASLPMPSAAAPSCSASALQSSGAKPSPTGGDRTEAAAVVST
                     TSLEATEATQSVAALLSAPSSSSTSVPTTTTACSPLQRFLCNDEELSKLAYACRMAIM
                     GENGGLARNSVRILTAALELAAVVLTSGVLPSELVAPAPTFAVPESTARGAKVFLSKL
                     LGGKKRPSSPSCAGAPDAVSSEITSVPADTVGLSQNVRDCLVDAVLAAVDTVQSKESS
                     DRLYFVMIVALKAAAAPRLSRKASTNTQPSAFQPLQLSVHDGRLVSVFRALLELCSRS
                     AGVSPILIDEAQKALHAITRALSKYVEQGVSDGDDRSGAGGCSKEQTTTSHSASSSST
                     GTPLMPLPTAVTSISAGKPTGPSFVDPPLERTETDNGETPDKARELTAEKPPSTTSST
                     IAAAAAPLGVPPVCDRAETTTAAALTAASPPRRLRGVTDMLLLLELCGHIARLTPLSC
                     ISSILSGSGGGLEVGVAAASASEYHRDAPVNCAGGGGGGDGAAPAAPRRTSGNATEEG
                     ASTTSFSAASLNEHILVTALSFLLYSIVNGGPQFRKSPDIVQLLRQVVVPAAIRTSIS
                     ADLDIFRLSINVLLSCCLRFGPQMVSETSTVFRHVYFRVLDSSFTSLEHKLLVLEAFG
                     SYIEEPQLLLGLFLNYDCNTHSQSFFEMMIHYLGALAMPPAQQVCNSDLFAELKRVLT
                     VRLEYDVPEPLRRKALVSLLQVSDSNIQWIERFECDQEEDGHAGTPSNGAACRDGATA
                     DTVPHELAGCSPFVHDLSEDGLRHGRTHALLCGVEVMGSSMSGVGSNGGLAAAANVDA
                     FLQARRYKDAFKKFLDLFNQKAAPDAAIEYLENSVLILESAGQAVSATPEPPTTVGAQ
                     GSLNDRAGAAAIPTTATGTTNASTSDGLRNDDAEAPSDSNAVSRRTEQVPGDGDVDAA
                     AASPAPVEAAATPTAAITSDVDDAMLLSARKVAAFLRVKEDYLDKMVLGDYFAKCFRR
                     PSSRVVFEEWIGLHDFTGKTLDEALRLFLGGFKLLGEAQVVDKTMELFAAQYCRQNPG
                     IFGSADTAFILSFSICMLNTDAHSPHIKNKMTKEGFLQNNRGIDEGNDIDPSILGGIY
                     DRISGEEIVLRPSPKCGTQPSVHASAAAAAGGFAGGRRSSKLTTNLLDSIPLLRHLSP
                     IAAAITDKVLLPMDAAGNALFNSARRKREEMYQQELRATLKEVMNALQEASTNDAAHH
                     AMFLTATSIENALPMWEVSVDVVCHIVVLALQQLLEDSEKYVRPQSFSSPSPPGNELE
                     AGAEYEAVTAYLEDTQSAGYFSTILLGLQNTVRVCCAFGNVSHTEKLLEHMFEMTRLT
                     SVVVLKAVPSSRVMIKSTIPFTRLQVLSTFFNLFMQCGSSFNARGWQAAYKAMSLVDA
                     LANGIEGMWQRQARRLLDTTPVSKETSLVLPKPPDSAAKSAASLASTGLDASNNNTRS
                     VSSAAMAPEQQQQQRADLWFGALNDVPASIVDRASRDNRKAILWGLRSVPTCHVDLWL
                     DRLFDATQYPPRVQLEMTSGLVKVCEMELQYTRTFSLTKLFDFVSICASFLSRLQWRD
                     LWAHASEVFTLAGCRSSSEIALSSLDGLRLVALTYLMREELLNYSFQKEVLKPFELIL
                     MSNQNVACRQKVMMILSEVIDFRAEHLASGWNVVFSCLSHAAAIPEVAPSAWSICEGV
                     ILRHISYVKDCFSDLIFCLTTFACSGVEESMPLRAISYLVACGHWLQYGLEAPPLEVR
                     TADAVTRWATRYLTVEQELAASHVLGKPLSRVTLAAEPLTLDALLQKPMTFTSKTKYH
                     LWMSLFEGMVPIVVVHSSVRVRAHALSSIWALLAQYAGLFDAEVRSSLFNGMVRPMLT
                     TLLTHVPGDADLVSPTMSGGYESDRFDYRLLVYLALKGMLLACKDHAHLLELACKVLN
                     ELVESTNITMRMLRNDYVDEVLRVCYDFVWAAPSLATMDALDRLPSVPGAPSSKDAVN
                     YAERLYQWIPTEARHDNPFVVGLVHEIQQAGVVDVVHFKRTAGWVELHQTPAARNTPV
                     QVSLSRLSATSVQLASAIMLQIRSTIFRCLTHGLLGKLQLLLSTCEADRNVCLEVSGA
                     MRHVLLGVSFYFLVTRDARAVRFLKSVMATSHEHGMVGSHDVASHTEPASLTTAAGTD
                     ASAGDGALKSRCSSTAAVAASPAFIATSKNAVLETLLLIPYACVLIEFIAAFDLGEAD
                     DNVVRNDLWAYVSQYLEELKRTRLACIELQQTVQAGVRAELEAAATTTNPSTPATQVF
                     KEYKGCHFTDIFRSARYPIGARTLYLTAQSDPSIRQRVFTEWCYLLRIYALKCTAILG
                     ASSVVLQACPTRDLIDVLRVIPSAFEEAAVSAYFNSCWEEMDLHCSMPPEPCVELCAR
                     ILESRM"
     gap             1020594..1020692
                     /estimated_length=99
     gap             1020829..1023888
                     /estimated_length=3060
     gene            complement(<1023889..>1026000)
                     /locus_tag="LDBPK_342350"
                     /old_locus_tag="LDBPK_342360"
                     /db_xref="GeneID:13392803"
     mRNA            complement(<1023889..>1026000)
                     /locus_tag="LDBPK_342350"
                     /old_locus_tag="LDBPK_342360"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864346.1"
                     /db_xref="GeneID:13392803"
     CDS             complement(<1023889..1026000)
                     /locus_tag="LDBPK_342350"
                     /old_locus_tag="LDBPK_342360"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864394.1"
                     /db_xref="GeneID:13392803"
                     /db_xref="UniProtKB/TrEMBL:E9BR33"
                     /translation="MAHLPLEGSVVCYEFLDAKRKWLWGVGAVTHSDDRVCVISQWMG
                     TPVDKAMTAKLESEAASSKAEAKTHQDRLLAIRERIESQSCGTSKEEKERTSEELSEC
                     LVLIGKHRNRSRSLLADLEIIKGPSTVQVKCQQFTPASSSIAILRSSILRVISHVTTP
                     SLVLSSEEVESIEKAVTHTHSQLNSELHKLRATVEATEIESNELRDQIRNLEEQLKRV
                     KTTFEPVRISDGGESGSAFPEKLREHDILSLRGAWDSSTALVMTEHTIKFPWDDGDTL
                     LHHKPEETKSVFAAEAAFACCVPIQCVTNPKMTTHGKHLSAEFSVSHPETVTTKEIDQ
                     RLASYAFPSMHLLHEEPLGVKTGLDRAIEGLEHALGIPEGKHEGLYFDEFMENMPDTT
                     FSNDKDAYESEIGDLLMLLDKLNNENRSLQYTLDKSAAELKRQVSEAQKDHDALNTEI
                     ARLRNIVSKLKDLAEQQETELVRSRVQTQRAEEARFHYNLAPPANDSQDAEYAVTMQE
                     YKDQKEATDNAQRALVEEKAKAEQMHHLLKMHEQQSAQNAKRLRSLQDAFAAETQQTA
                     ENFCALECELIDVLLQFKASQALTQALHHINSQQQAELFSFRARRNAALEARDADGTL
                     PVPARPVPAGEAAERALEPQQIADEPLYAVTLGEYLGKDAAVEQLAAELEEQRAEAER
                     LAKEVAAFRARRNAALEARDAD"
     mRNA            complement(<1023892..>1026000)
                     /locus_tag="LDBPK_342350"
                     /old_locus_tag="LDBPK_342360"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864347.1"
                     /db_xref="GeneID:13392803"
     CDS             complement(<1023892..1026000)
                     /locus_tag="LDBPK_342350"
                     /old_locus_tag="LDBPK_342360"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864395.1"
                     /db_xref="GeneID:13392803"
                     /db_xref="UniProtKB/TrEMBL:E9BR34"
                     /translation="MAHLPLEGSVVCYEFLDAKRKWLWGVGAVTHSDDRVCVISQWMG
                     TPVDKAMTAKLESEAASSKAEAKTHQDRLLAIRERIESQSCGTSKEEKERTSEELSEC
                     LVLIGKHRNRSRSLLADLEIIKGPSTVQVKCQQFTPASSSIAILRSSILRVISHVTTP
                     SLVLSSEEVESIEKAVTHTHSQLNSELHKLRATVEATEIESNELRDQIRNLEEQLKRV
                     KTTFEPVRISDGGESGSAFPEKLREHDILSLRGAWDSSTALVMTEHTIKFPWDDGDTL
                     LHHKPEETKSVFAAEAAFACCVPIQCVTNPKMTTHGKHLSAEFSVSHPETVTTKEIDQ
                     RLASYAFPSMHLLHEEPLGVKTGLDRAIEGLEHALGIPEGKHEGLYFDEFMENMPDTT
                     FSNDKDAYESEIGDLLMLLDKLNNENRSLQYTLDKSAAELKRQVSEAQKDHDALNTEI
                     ARLRNIVSKLKDLAEQQETELVRSRVQTQRAEEARFHYNLAPPANDSQDAEYAVTMQE
                     YKDQKEATDNAQRALVEEKAKAEQMHHLLKMHEQQSAQNAKRLRSLQDAFAAETQQTA
                     ENFCALECELIDVLLQFKASQALTQALHHINSQQQAELFSFRARRNAALEARDADGTL
                     PVPARPVPAGEAAERALEPQQIADEPLYAVTLGEYLGKDAAVEQLAAELEEQRAEAER
                     LAKEVAAFRARRNAALEARDA"
     gene            <1032274..>1034886
                     /locus_tag="LDBPK_342370"
                     /db_xref="GeneID:13392804"
     mRNA            <1032274..>1034886
                     /locus_tag="LDBPK_342370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864348.1"
                     /db_xref="GeneID:13392804"
     CDS             1032274..1034886
                     /locus_tag="LDBPK_342370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864396.1"
                     /db_xref="GeneID:13392804"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BR35"
                     /translation="MSRIASGDSVKLLKGQLSEKEFRIGELENRVKDLFNEAKELDEK
                     LRIANRNARVLEEENSNYHIRIKNFEKDGGALDIFPLQKEAMKLIQENDELRQSLTEA
                     ERRVREISGRERDSDHDADKRIRELQSECERMRKERLREYKELESTRRLCADLQKRLD
                     DDEETLKSAKELWDQERDRYQQKIDELLDFNKRAERPLVTRTAWHRDGPADEPLEQFL
                     LKEEVAQLERTLKEVQHKNWEKEKTWVRTETELRHHINELQVSGRSESRNDNALFQAM
                     KDQVRALQDEIQALRTDRRGSRSAQGAPMSSMSTSSTVTPAVKSGVVEEWAARYESVS
                     RENDNLRDQVDAAKAKILELQNLVDEKVVACKEMELRLAAAQKQRAIASQAPLVDRPS
                     SIRSTSERSYESRATGAPRSQDDARAMMVMRQRVLDLEAELRTLCSAHEQKETISHAR
                     LKDYKKQIVELLRENANLRDASMDQADTEGGCTIMDFSDGMMRLTKDKRESVEEVMRL
                     LELAWDSEDELNRQLRRAKYQNAAMAAQGASKDDEIQCLQKSVSILESKLRDMEKRAH
                     DNGDLKDAMGELRKQRRGLTDENDKLRKKIGDLEKAKEEVVRQQSAKQNDAKRRIEEL
                     QTEIDDLTHKLANARKAGSRPVSPRLSTRSPQPGTLSPRPSARRRTPEAAALSHLSVR
                     STDEQRRSAVPEGAHLAFTVVELTDVLRNGRPITEAGHVIIKVKSIKEKYKTSVKLLS
                     SVIRFDETFVFYLAQPDQDVITLHVFYKPHGGSREFHIGDACFSMATLYRGLPRQRIA
                     PVVQSPGTKEARRAAQVEVHLQTDDFGKTMVHTQEEVEKEKMRFIELVNKFEKGSPEM
                     LHAVDVYMASNELQ"
     gene            <1038156..>1040009
                     /locus_tag="LDBPK_342380"
                     /db_xref="GeneID:13392806"
     mRNA            <1038156..>1040009
                     /locus_tag="LDBPK_342380"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864349.1"
                     /db_xref="GeneID:13392806"
     CDS             1038156..1040009
                     /locus_tag="LDBPK_342380"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864397.1"
                     /db_xref="GeneID:13392806"
                     /db_xref="UniProtKB/TrEMBL:E9BR36"
                     /translation="MNSITNRVIAYRLPQDGAGEEAYGLCLRKEGNTLRVMLLQKEDN
                     YERPLRSVLRKLSDEDAVVSELENRFKSLQSSLIEENDAARQKKCRLQKRMLQWAIRR
                     LEGVEEKEWALLSQQRCPSAMVSCIGCTVASIAVGKSLVSSTWTDAQRLFRSGKEMVL
                     QLRQVGEQRMDRSLYDSIEETYLSDSTLSYSSVSQESLSLGVLHKWITAFMDYQRACY
                     MEGGDAELQQQMTDCQSSLESARERRSSLAKQVDLIKKGNCYSRTQTVRSVPIEHVLY
                     LMTSEKVTTRQYLLKERVPLESLEEALTNSLAGPQSARGCRDEKTRMTALSFPRVEHP
                     VAEARHTDRTPTGASKHPSPKAESARAGSRVSGRHVRRPRASTDDGGNMDGAESRCAA
                     VPSSTDSLREQRDKIHAAREVKRASRRSSGSLLSSGKAAVARAMETTTTTTGAVAASF
                     SSTTHADRETGASFPSCEPSTPSASADAQHVLADVKNHFKNVQETLLACLEEYEQLED
                     KYSNTVEQSKQLLHTLEERDDEIARLREDLSRATKKQLLASRLISLLQRNQRGASSGG
                     RCNEDQNCSDEARLQPKTSSACDAGTFARHVEYLLDDTLDFVRGAAAAPVM"
     gene            <1044714..>1047002
                     /locus_tag="LDBPK_342390"
                     /db_xref="GeneID:13392807"
     mRNA            <1044714..>1047002
                     /locus_tag="LDBPK_342390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864350.1"
                     /db_xref="GeneID:13392807"
     CDS             1044714..1047002
                     /locus_tag="LDBPK_342390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864398.1"
                     /db_xref="GeneID:13392807"
                     /db_xref="UniProtKB/TrEMBL:E9BR37"
                     /translation="MGSISPARPSIEPSLRVREPSAANTRYEKTSVPSGYCSPGLAVE
                     EATILEPAGCIFATTVAEEFVRADAMTVSMATTPLASVQCTPRLPRGKENAAKSTESI
                     LGHCKPARSPRPSQVTELRLTTNEVGVLTTPHVGHGLQTRAASAACGTRRSFTDKTDG
                     SLTKMALSTVLRPRGNSLCEPDSLDLLSAVGQSDVSMDDFAPTAASFQLTCEGTKWCA
                     VVAAHIEAVHRLATIDITSSCGVAKGELSKLTMIATEKAGLQICFQLATWGDAQREIT
                     FRRRLEMCELQRLTRLYQTFVTTPMSPPPADGENKQWPPRSLEDDSHLPEGVVASNTN
                     NHRRVSEDRRQLVSEFETTLEDMQSMLLQKEQELQHLASQLEEERRCSGQNVAVLQSQ
                     LITMRLDHACMDKELESISTALIDTQESCNVLRQLITESEEQHRFHTQQAQQEYTALQ
                     KEQAHLINHYEAQITSLNEQLREAHKKLDALHNADITDTPCALVRADTQNLNTPFTAH
                     PEQNNKHNVLSLYTHGIVDAVRSEYEAQTAELVDSAELVEARDALGAAEQRCAALAAA
                     HAEAVAALEAKSAASESELAAARVALCCAAEGCFEKASPLLRVCDSRECFVAGVQYGV
                     EVLRDGFESRANEVVGCTRRIVSARAAVEAARRRCAEVSSKLTQAKACGDDEKEFCSG
                     ELVAAHAELRAVMERYLEAEAAVDEEEAEEHPYEALFSALSRELKDAREKLKTMQQLN
                     RMLREKFRSDLQASERSSSYSS"
     gene            <1048484..>1050157
                     /locus_tag="LDBPK_342400"
                     /db_xref="GeneID:13392808"
     mRNA            <1048484..>1050157
                     /locus_tag="LDBPK_342400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864351.1"
                     /db_xref="GeneID:13392808"
     CDS             1048484..1050157
                     /locus_tag="LDBPK_342400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864399.1"
                     /db_xref="GeneID:13392808"
                     /db_xref="UniProtKB/TrEMBL:E9BR38"
                     /translation="MSVLELPWVSVLGGHSGAFEDAPQKFVAKVPATATVAPLVSTFS
                     SRFTKKFDGDDWKDLVASVPSLLYQTFVYEASIALAVPQEAITDVQFRLGSLYVTFHV
                     THDEDISQEEMAHRIEEYPFREMWRLYNQRDGAPDGLDAALQRLKDVEMELKDKNHEL
                     EKERGDKEQKVNELKKQLQALQEELAGPVAEREQSLLQQLGKEQGARKKAETQLKVVD
                     DERKKLLEAVKQEKLRAEKSAQRHNDLIAAIIQENKKEKEAKEREHNEQMEVKDYIIE
                     NLKSQLRTHTNGSASPRNSIVDVDQTDEFNRLMERMEDMAAVLQRTQESENQARAQIQ
                     RLSDLLKESEEARQAESVSYDNNVAALTQQIHSYRDTKIAEDHERRAKEDRQRGRGPV
                     SEALKENATIVRQYTTSLENLIVSLQDRLHAISEEYNNYLTEAEAGVSHERQILVEQD
                     EDSKKTRQTFRSSSIALQKIYWGSREPEAQQIIQNLDAAASNAEKSSAAVRVVIAMLD
                     SKARAFGDHRNWMEQQHRMMRELLTSLRDLNQRAFDRQRALMDEKVLKA"
     gene            <1053504..>1054121
                     /locus_tag="LDBPK_342410"
                     /db_xref="GeneID:13392809"
     mRNA            <1053504..>1054121
                     /locus_tag="LDBPK_342410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864352.1"
                     /db_xref="GeneID:13392809"
     CDS             1053504..1054121
                     /locus_tag="LDBPK_342410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864400.1"
                     /db_xref="GeneID:13392809"
                     /db_xref="GOA:E9BR39"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="UniProtKB/TrEMBL:E9BR39"
                     /translation="MPPRPSRDEYRRVREGRENRDRPEGAENEVRVTATHGQHSYISY
                     VIAVLNGEDGKTRNDTVKISGMGGAIYNAVNIAEIVKRRISGLHQVTELGSELVRDEY
                     EPIDRTRNPENVVVERKVSTILITLSRNCLDKSNPGYQEPIPDSEVTEQERRDPNMSR
                     RGGRGGSRGGRGGSRGGRGGSRGGRGGSRGGRGVAAIDRRDDREN"
     gene            <1059656..>1061062
                     /locus_tag="LDBPK_342420"
                     /db_xref="GeneID:13392810"
     mRNA            <1059656..>1061062
                     /locus_tag="LDBPK_342420"
                     /product="adaptor complex subunit medium chain 3,
                     putative"
                     /transcript_id="XM_003864353.1"
                     /db_xref="GeneID:13392810"
     CDS             1059656..1061062
                     /locus_tag="LDBPK_342420"
                     /codon_start=1
                     /product="adaptor complex subunit medium chain 3,
                     putative"
                     /protein_id="XP_003864401.1"
                     /db_xref="GeneID:13392810"
                     /db_xref="GOA:E9BR40"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:E9BR40"
                     /translation="MLSCIFLLNEHGEVMVELQFSERIPRSTLEGFWSTYMAPSKGGR
                     EAPAAIVAYGGTVFSHIHRNNVFLVGTHPSDDTALVVIEQLCLVARVLTTYLSEVTEN
                     TIRENFSTVYQLLQEMFDYGYPLTTEFCALEELVPRPTLENRVRTMLDTPLVNKVMPV
                     GSRTSIGVGSRQASSFFGGVPWRDPETRHSTNEILFDVVESLDYVLDSEGRCVRAAVQ
                     GSIEVNCRLSGMPDVVLRLRDVDAVVDDVAFHRCVRLDRYEHDRTLCFIPPDGKFTLM
                     KYTCKSSQLMPLPPFYVTPQVTFNATGGRFHCMTGIRGGGAGFSSVAEKDKDVQRLSV
                     RLLLPPNTSSLTVTNCSSGTTVFDRSKATLTWSVGNLTHYATPSLGGEFLLEPEGSDS
                     SGEQGRDNAAPSRSARATTHAAGVGNATMAAVSFQLPNRIMSSLRVDSVQVLNEIGKP
                     YKGLKYLTQSGSYFIRGA"
     gene            <1062062..>1062331
                     /locus_tag="LDBPK_342430"
                     /db_xref="GeneID:13392811"
     mRNA            <1062062..>1062331
                     /locus_tag="LDBPK_342430"
                     /product="acyl-CoA binding protein, putative"
                     /transcript_id="XM_003864354.1"
                     /db_xref="GeneID:13392811"
     CDS             1062062..1062331
                     /locus_tag="LDBPK_342430"
                     /codon_start=1
                     /product="acyl-CoA binding protein, putative"
                     /protein_id="XP_003864402.1"
                     /db_xref="GeneID:13392811"
                     /db_xref="GOA:E9BR41"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:E9BR41"
                     /translation="MSAEEFERYTKLVSDLRSNLSIPQKIEMYGLWCVATRGKCTLKQ
                     PSRANVVKYGKWAAWKKYEPLGQQKARELFVEKAKAIVAKYPSRL"
     gap             1064182..1066332
                     /estimated_length=2151
     gene            <1067529..>1068980
                     /locus_tag="LDBPK_342440"
                     /db_xref="GeneID:13392812"
     mRNA            <1067529..>1068980
                     /locus_tag="LDBPK_342440"
                     /product="ATP-dependent DNA helicase, putative"
                     /transcript_id="XM_003864355.1"
                     /db_xref="GeneID:13392812"
     CDS             1067529..1068980
                     /locus_tag="LDBPK_342440"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase, putative"
                     /protein_id="XP_003864403.1"
                     /db_xref="GeneID:13392812"
                     /db_xref="GOA:E9BR42"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR42"
                     /translation="MTEGPIRTAEARDLTRVERVGAHSHIRGLGLDDTLEARVSSQGM
                     VGQMEARRAAGVVVQMVKKGKIAGRCVLLAGGPGSGKTAIAMAMAQALGPETPFTMIA
                     GSEIFSLEMSKTEALTQAFRRSIGVHIKEETEMIEGEVVEVTIERPSTNPAEAHQRTG
                     QLVLKTSDMESTFDLGQKMIESLQKEKVQVGDVITIDKATGRISKLGRSFVHSKDFDA
                     MSANTRFVQTPEGELSKRKEVVHTVTLHEVDVINSRQQGFLALFAGDTGEIKPEVREQ
                     IDQRVAEWREEGKGEIVPGVLFIDEVHMLDIECFSWLNRALESPLAPVVIVASNRGIS
                     RIRGTQYKAPHGIPIDLLDRMMIITTNPYSQEELGKIINIRCEEEDVELTEDAFVLLT
                     TLGQKTSLRYVLQLITTANMVAQKRKSSTVSVDDIKKVYLLFIDLRRSVELLQEHEKD
                     FLFGEEDAHVENSTRVRVRDGEEDCGNEEETVR"
     gene            <1069951..>1072014
                     /locus_tag="LDBPK_342450"
                     /db_xref="GeneID:13392813"
     mRNA            <1069951..>1072014
                     /locus_tag="LDBPK_342450"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_003864356.1"
                     /db_xref="GeneID:13392813"
     CDS             1069951..1072014
                     /locus_tag="LDBPK_342450"
                     /codon_start=1
                     /product="RNA helicase, putative"
                     /protein_id="XP_003864404.1"
                     /db_xref="GeneID:13392813"
                     /db_xref="GOA:E9BR43"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR43"
                     /translation="MAWRRRVAAVGASWPRASPASLRFASAAPPSPLTSARQHQLHNV
                     CDAIYRSGTAREALRQAIHEPSHESALRLLEEFEKDPGVWRDEAWTTAFLTASSHLSS
                     QMDLLLARFTHWHTVRKAPTKVAMHKPWDWYPHARLMRRRFIFHYGPTNSGKTHAALE
                     ALMRARSGVYCAPLKALASQVWHRVKERVPCDLLIGDERVFGGAAEHVSCTVEMTPVD
                     LPVDVGVVDEIQMMTDRDRGWAWTRALLGLPAREIHLCGEARALPLIQNLLYATHERK
                     NLSTVEHKRLVPLTVSPSLRSRLRPETVENGDCFVCFSKKQVLDLRDNLNRLSGVTSS
                     AIYGAMPFQVREAEAARFNRGVTEYINASASCSANAKNNAAGCSTTSSPGTRPRESSP
                     ETATPTKHVLVSTDAIAYGLNMNIERMVFTTLRKFDGKAMAELPAATVQQIAGRSGRF
                     GLTRQHAVGRCTVLHERDMAAFRAAMSAQLEPLAKAGLLPTADILQLFAELESAKSRK
                     AGKPTVDLSGGSFFELMSTFAASCVESHNFFPCDIHRSLLRVAELLEPVCNLSLTDRI
                     VFCYLPLSDTSAASLQLIVAYATDHAAGKPVPLRFDVWCTELMQRAEREETCGVGASS
                     PGQRQQQQLSVRDLATELERCFRQAEMYCWLSWRFSKTFVERERGLELKASITAALTR
                     LNGSA"
     gene            <1073318..>1077793
                     /locus_tag="LDBPK_342460"
                     /db_xref="GeneID:13392814"
     mRNA            <1073318..>1077793
                     /locus_tag="LDBPK_342460"
                     /product="phospholipid-transporting ATPase-like protein"
                     /transcript_id="XM_003864357.1"
                     /db_xref="GeneID:13392814"
     CDS             1073318..1077793
                     /locus_tag="LDBPK_342460"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase-like protein"
                     /protein_id="XP_003864405.1"
                     /db_xref="GeneID:13392814"
                     /db_xref="GOA:E9BR44"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9BR44"
                     /translation="MRKWTQQRLAKPEKDRSCEQRTIQLNDPHGRTNFCDNRIYSSRY
                     NIFTFLPLNLWEQLHRPINIYFVMVVALQFIPSVAPVSPLTTIFPITVAFLVNTVKEG
                     IDDLRRHRQDVEVNERMYQRVRPGTLELEDVMSADIRVGDVLILHPFEVVPSDVVILL
                     TSQDSGSAYITTESLDGETGSKQRFAILHQLFKYSQAAASPVPSRPHCCGLTFGTTTA
                     PDSDAAGVHASAAKTMGKLTDAPVWDLRRCCDTAEDHQLHCLQCAFRSRLVLYSEGPN
                     AQLHSYHGAATVRAPRSSSQTWRESRPSTSSACGAAGDAVKAGSAAPESLPGCRYGSF
                     PAPAVLPISADMARADEADMGEAFPRHLPMPVMVPPPLRQRATRTPDSMVVDSFPSIV
                     DERSGLLEPGGPSQASAPPRQSSLEGQTGAYDYFDGPEQTLSVNIDNVVYSSSRIGNT
                     HFIIALVIFTGRETKMSMTRNVLPTKWATIDNRFNYLTMLIFLVQFILVSTCAFVSCL
                     RLKAHAPLWYLGASVDPIKVSEYFPILPLRYLMMLSPMVPLSFKVMVEISKAYVSYAI
                     RWDEDMRTEVESVSVNNSALAEELGQVEYVLSDKTGTLTANTMTFRALATVNDTVFSA
                     TTEDFIESDLHRPLAKVGKAIKATTARGQHEDYYLMLSMVFCNTIEPTLSPQFSANGS
                     VAYGARSTRSSGVNTNGNTSFSRRWMSSSPDEVALVEGAEQCGFSLRRRSRTHGTVGL
                     WGEAGTSLEVEVVRTLPFSSDRGMMSVLVCCPAVAVKGAEAEASDTADGGNTFPPMNY
                     VLLIKGADEKVLPRCTDAYSRSHLEDITNRLAGFSREGLRTLVYGYRIVAEEEVKEAL
                     CRFTAVEASFASAVAREAELQRIYALLERDFTYCGITAVKDELQEGVPQTLAQLRHAN
                     IRVWMLTGDKTETAKQTAVACGLLTSTDRVITLTPPNEDLLAPTDHLAYVSEKLSEIK
                     GILAQEGPAVEMTMLTRWQRVRGWCRRFFWERSGLEDFVHEFTQPATCECIRPVDHPL
                     LTQPLSTIQARYGPVSPSVTDMVPRVCGAARREPGLHFASAFGACSDFDMCGLKRGYC
                     VTLSGKTLRLLEREDAMSNGHSAVVRLFQLCLLQARAVVCSRTAPSLKSYVVDMVRRS
                     GHITLAIGDGGNDVPMLQAAHVGVGVKGREGSQAKLASDFAIGQFRFLSKLILVHGHT
                     AYQRTAMIVQQSFWKTVLIAWVQVLFNVSTDFSGVSYWDSLSLTLYNAIPTVPVTFLC
                     VMDMPLSHWLLCTTTRLYTMSQRGRYFNATTFYGYVARALLHGTMIYYLSVALQRGTG
                     AIMTNGWVLDRSGDFYAPYIAVVTVHTYTVWTESHAITIAHWFCFLFSIWTCFLSFWL
                     YARAPASPNETFSMLLRSPSFYLSYLGLLTAVCVSLAIYAIPKMLWFPDALQLERLLL
                     AHVRQTRAWHRGLPVRALRAFFQEDNPSQFWKSISLYHALRYSPPPRQTFTVAAD"
     gene            <1078899..>1082999
                     /locus_tag="LDBPK_342470"
                     /db_xref="GeneID:13392815"
     mRNA            <1078899..>1082999
                     /locus_tag="LDBPK_342470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864358.1"
                     /db_xref="GeneID:13392815"
     CDS             1078899..1082999
                     /locus_tag="LDBPK_342470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864406.1"
                     /db_xref="GeneID:13392815"
                     /db_xref="UniProtKB/TrEMBL:E9BR45"
                     /translation="MCLRGCGTETKDQLASLPGEMLHITHFSGEASQAPARCTVGTLY
                     DTLVHTQGCSLTAPPSLEVFFVRLASFAPLFLRLTPTSHPGGAARQDSAEMLVEYCAG
                     MTASLYSTLHPFTRRLLREVRVSWQPWLSSPKIARVIAAAGGGGAAADGDGGNERSVR
                     EHVSPSSVSDSTDSSLEALGCLPSDSGRSGTRAGKHQYACTSQDAVAAENAWQPLLEH
                     APPFFVATARVQASLRRAYSDDKALRLLDAWSSQSHLHATAPLDAVADAECRSPLRLR
                     CKDSRCRGPYVEASPCGTAIRAPSPEQCLQAGCPARLIYKPQHAPAALHEKYTLLHCV
                     DDCGPWLMHMALALVCAVVPSTPQPLSVVRQIFSGHQQQQCSLRQQEEHSGKAIEAAE
                     GLDIAPAAAHAACASFFPCVEVLLDHPQLAFAVQVTDRSTGYVCARFPVPSEAGARAA
                     APSNRLQKLQVQLHPSFSHAQRGRADAALSVLEKMQRMAMLAEVPRPQHKCDAPFDVS
                     HVCAVRFHDARDGVLTESLEALLQLLAKESATTLAAGSASDAEQAFFVGVSEVTGLGD
                     EAPIRRDSSTAVHEARCAPESPRLVLLLSAVRNDSSGVDVVAVEGRALCSQLWRMGAD
                     DATTSAADEEQVATAKDRLLPVLARVLHSPTLVKVLPSSAFAEDSLCDAHLLRQRGPS
                     AVRWLIDSLRSEALTSVCSLEHIAHYVGYPVDGAMPLTLTSETDSLLASTILAHYGSA
                     IDTTTTQQRSGSGGETRGSALEQSTCARAICGAATISLAASLLLQNHAQEHPLHVPGK
                     ERGKHNDGSATESTLGMTLSCALQHWARKPALARQHGLAVRLERFQRWLAHATAGKVD
                     DLIAHSRVSSDAAARHLPMAFAAKQQCLGGHEVTLRDLVSHFGPEPLPNPCWMRGGQT
                     AHARKVKNGCCDAGVGTVKDTGGQIVKAKRSGSEENPSLPFSAEVSASEGHVDVDALV
                     HDALVQEAAAVLQAVARHASPTNIADSDAATSTPLHNDTGLPLTPKEASTGAACSPPP
                     PPPCSPRSDACATSGAGASVEEDSLQSYLSTLFDEPDARPTTTTSLQTPSPAAQSSAL
                     TSSAPRPERVTKGADPVVAPNVVPSLRSSTAASGATDLSTDHLPAAPAFHLAACSFEG
                     SGRDDPPTAEAPVSSTRALPVGFLYGPASFITTSKSSTASGLANAKSGAGELSHPVNF
                     PVFPGLHGSREAPRQGWPPPPNQSASIMESEKSAPSSRQSPSAVLATYHPPSRDANFA
                     PVARFDRFAPWKRSAPSAPNPQNSPPSPRPQSPLSSSYAIPSTCQNESAQPPRPASLS
                     SATPTGSSLETLFSFDPKDAERLRLRSLLVDTLRGTTKRPPPSPRR"
     gene            <1083762..>1085588
                     /locus_tag="LDBPK_342480"
                     /db_xref="GeneID:13392816"
     mRNA            <1083762..>1085588
                     /locus_tag="LDBPK_342480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864359.1"
                     /db_xref="GeneID:13392816"
     CDS             1083762..1085588
                     /locus_tag="LDBPK_342480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864407.1"
                     /db_xref="GeneID:13392816"
                     /db_xref="GOA:E9BR46"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BR46"
                     /translation="MLLFSAGQGRMRLTLPFMSGRRAAATLSLLQLLLVLVLALAAFQ
                     ATAAEAVRGARRTFASDADDRMIVEESDENLDASGWVSLIVVDSILLLFAALFAGLTL
                     ALLGLDTLSLEIIADSGSEPDKTYAQKILPIRHLGNQLLCTLILGNVMVNTLIAQITD
                     SHIHGWVATVVSTALTTLGGEVIPQALMSAHALQVGSKSAPLVKFFVFIFWPVCKPLS
                     MILDKFIGKDPGQIYERNELKKLMFMHAARSAESGIGAGEVDLMVGAMELHEKTVMEV
                     MTPVSDMLMLEANERLNEETIQLISDRGHSRIPVYQTTKNNVIGVLFAKDLLMANPQE
                     NTKVLLLVKFYNRRCHVVPSETKLISMLKYFQTGKSHIALVQEVQQRPYGDPYYEVKG
                     LVTMEDIIEELIHSEIFDEYDIDPHQIQHTALGNASNLAKRQIGLTSKCSRRVHLNYN
                     ELRAAALFLCESLPELSMEDVSALMQGMMECTTVYRVRAPKDSRGMADDDKQNVWLYR
                     EGVPSSVFTLVVSGRVEVFAGKDSIALEMGSWSLLATDALSSDLFVPTFSCRVVQDST
                     LMQITREAYVEMLRICNNPASDTSRTASSAANAERKASMESI"
     gap             1086790..1086822
                     /estimated_length=33
     gene            <1087697..>1090417
                     /locus_tag="LDBPK_342490"
                     /db_xref="GeneID:13392817"
     mRNA            <1087697..>1090417
                     /locus_tag="LDBPK_342490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864360.1"
                     /db_xref="GeneID:13392817"
     CDS             1087697..1090417
                     /locus_tag="LDBPK_342490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864408.1"
                     /db_xref="GeneID:13392817"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:E9BR47"
                     /translation="MSGGGSEAETAELILYRLEEIDELLATVSGDEDDSQAATLAQYL
                     RGGQDLESALSLQEERLRGFRDTFIQAHVSQAEKIAQLYHEFGACERHIVDFEEEIVA
                     FQRKLEGSANDIVHMQQQADALARKVSNRRQVSNKINEVYTTLQKCDSFCDVISNKSV
                     DASYLANLRELNRRLEFLSGNKALQFSAVGNEIRPKLTAAAYKAGDKLQRFLTKKILA
                     LAEDPSRTADEQQSLEESAQFAFRFLQLYNPPVAIDVMKLYIRYMSQSYVRQFRLLFA
                     QLSEVSAVHADPLEPLVSAEEARDITSNRDIGAPSGNQVNPALVNFPGRTLARRQRSV
                     SQHMRGFTSFMSNGAAVSRTESLRLLRAATFEDSVKALNALRVRHGKLYVDDAVAEQL
                     DECNSWTWQFVRCFQTLVNTCESECRFIGNFFCVAGDVEGGEDFTSAEPMARAVLGSA
                     VHSVETSIIDDLSIVMERTEVLAALRVLETVKQHLCTSLDPIPLLLLSGVLEISKSAL
                     RNSLRTAFENDGLALAFLPTLKLSPFYRAAAENSSWAGILGNKPYCATLGPHPAVYRV
                     CGVLGQLEYLNTAAVRASAFTGGTGVAFDPSVATFVKNCLAHMMEFVDQLKRRHTSPL
                     AQQVFACTNVYTVMATWRELMSVSGDGEPSSPTASRLTSSDARNCSASGGRWHFASDM
                     SELPKVSHAEVSAAGRGAVASGTSHHTQYLESQLQNAIQGWVNADQKNGESPWNYLLA
                     FVDEAAKALGEGFFGSASQPPFTTCGQNSTSAAPPPPLSALPAELSECAALRVATQLH
                     SRWQSQAKAVAEVVRKAVQQSLGRTVSNGSGDGTTTGCTAAAAAVRQRQCDELSTLVM
                     RAIFSTLTESNRKLAVFVAHYHSGNRELQSKLVSNTTMLHALSRVLDSSS"
     gene            <1092010..>1093884
                     /locus_tag="LDBPK_342500"
                     /db_xref="GeneID:13392818"
     mRNA            <1092010..>1093884
                     /locus_tag="LDBPK_342500"
                     /product="NADPH-cytochrome p450 reductase-like protein"
                     /transcript_id="XM_003864361.1"
                     /db_xref="GeneID:13392818"
     CDS             1092010..1093884
                     /locus_tag="LDBPK_342500"
                     /codon_start=1
                     /product="NADPH-cytochrome p450 reductase-like protein"
                     /protein_id="XP_003864409.1"
                     /db_xref="GeneID:13392818"
                     /db_xref="GOA:E9BR48"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:E9BR48"
                     /translation="MTDLTILYGTQTGNAERLALRIARLALCRGFECVSCLPADDLPI
                     AEWPHTGGPVVLICSNANQGDAPNTFRRSWASLLQPTAAGSMEGLQYAVFGLGDSLYL
                     KFNHMAKMVHNRLRQLGGTPIVMRGLGDESDATGVEEALQPWLAELWKALEKPDKCGA
                     AAHTPAYPQEDLPFFPLFSIAPASACDEATAGALSSSANAAIAPLPYFADSVFSCEVV
                     ANRRLTSAACEQVVHHLELRAGPDTTDAAAYDVGDALGIYCPNREELVEGLLRGLQRD
                     GAEMVVVTPDASHGLVRQPARPFFGRPLSLRSLLRHYFDLDAVVSQEFLWMLAHEVTG
                     EDEGAVDVRGRLYELADPSNVNDYLQYAHREKRNLCEVLHDFKDLHPSLELVLSFAMP
                     MLPRYFSIASAPAMDGAGRFDLCVGLLDWHTPLKRHRTGLCSSYLVGASPGTRLTCFV
                     WQGSLALPATPTPLLCIATGTGVAPIRSVLRQVAGLSTQGWDDVPVVLVFGCRREAED
                     YLYREEWATLKEMGALPTLRVIPAFSRDTDKKVYVQHKLGQHARLTSSFLQPEGAGVP
                     PGVVYVCGNAKQMPKDVQHTLEQIVEATVAEVQDEAGAAAHIRALGRVGRYQIDSWSA
                     "
     gene            <1094853..>1096496
                     /locus_tag="LDBPK_342510"
                     /db_xref="GeneID:13392819"
     mRNA            <1094853..>1096496
                     /locus_tag="LDBPK_342510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864362.1"
                     /db_xref="GeneID:13392819"
     CDS             1094853..1096496
                     /locus_tag="LDBPK_342510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864410.1"
                     /db_xref="GeneID:13392819"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BR49"
                     /translation="MADHSASSAASQGAASASQHQRILLQKQLTEVRMENTILRQQLY
                     QVSTLLDIAVSKLGTMGVSLETPIDIRALRTEALQRAHAETAQAQYNAIGASPESGKS
                     PAQHHSKKFQMRQQLREHTRAVQCCAFSDSEDLLIATGGMDCRLIVQNYLSGAKLWDA
                     TAHEEAVSDVAWMNHNCLLSASYDNTVKLWDVNGGTTNKDVLYQYTTHGFVLSAIPLG
                     PSLFACADSRHKTAIVDVRVGGKGMVQEHDYRINSLSYDEAAQQLLMGQSNGVVSIWD
                     MRRPDQVLSTANSSIGGILPGSSSPPPPPLPPQQHQHQRCGSINDMNGAVEGDAAPMT
                     TLEDGAAGGSNIPGSNSGLMASGSANSVGGPPRFTRATEIENEPSRSPISFIAHFHSD
                     DDTCRLLCVSGDNMVRLYRGNFSAFTGGGRKDGIGLYVLRNVLAGVPTRGNVMRCGFW
                     KGERDKTEMSVFFDDGEMDGVSRPPRRLTECDLLVTGGPDNTAQVCDVTDDGGAVVLE
                     RLEGHRDRVTGATVRRSRKPIIATMSADSTVRIWMPVKS"
     gene            <1097694..>1099409
                     /locus_tag="LDBPK_342520"
                     /db_xref="GeneID:13392820"
     mRNA            <1097694..>1099409
                     /locus_tag="LDBPK_342520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864363.1"
                     /db_xref="GeneID:13392820"
     CDS             1097694..1099409
                     /locus_tag="LDBPK_342520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864411.1"
                     /db_xref="GeneID:13392820"
                     /db_xref="UniProtKB/TrEMBL:E9BR50"
                     /translation="MTCAPQVHHSAPNILAFHESHHDLIKGTLAPDLHGNLPRHLSSV
                     ILQTNRAPFRLPATGAPRSSPYRTPQWTELSECIREVSPPPFPDEDVRRLAGSRAEPL
                     SHSPSTMSLPGYAVVRRLADLSQASDVDPAAITAALREAERVLEVPMDAGTNREYARC
                     SGAMIAERSTDEERLPLSRGRATSSVASSASARLREEDAQSRCPRHHHEHPRHQRHHC
                     DGSRALSPEHVTAASGLGAASCFHSSSPWGWPAPAPVLSGSPAPPRPAPTATNSPANN
                     HAGPHASSSTAGVLDPTLRWYDVYYAWMFYYQQLYAAQALQEQQRQRAKRGKREKRES
                     HRTPHGRHAVSRAASSGPEASMGNQEDGTHYAHVLRQPRAVARVERGGGPEGAVRSMS
                     EASVSMSAQPIRHHCPISPPKPSTHTRASQTPRVPGEKNAKGDDRAARLRAELRRLEE
                     EYATLSSSLADVEGDEAQPPTCADGRIRHFAAASAAGATIARPQPACPPAPAEARAQR
                     GKWLDSRDDVGPTSHRGSAAPAETWQALSERQRNETFHSMARVRASRGPSPQPLSRQR
                     PQWRH"
     gene            <1100147..>1100914
                     /locus_tag="LDBPK_342530"
                     /db_xref="GeneID:13392821"
     mRNA            <1100147..>1100914
                     /locus_tag="LDBPK_342530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864364.1"
                     /db_xref="GeneID:13392821"
     CDS             1100147..1100914
                     /locus_tag="LDBPK_342530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864412.1"
                     /db_xref="GeneID:13392821"
                     /db_xref="GOA:E9BR51"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BR51"
                     /translation="MSNWADAAQDEEQYQAAYGSDDNDSYSEYQEPKPSWDTAKTEIT
                     FEVDADGNRFEVMRKVRSYHVDRPVTMADIRAKLAHFGKGKGDQSTLVSAEPPLALEM
                     GSVDQFERESRAEVKRMIHEASGIDVAVKDEHLRIVREMEEKAKKDPRVVRSGAGSTW
                     GAIASKSTDNREQSTTGIRIRNLSDDITQENLSRIFEGRGWITKNVRIPRGDNNQTRG
                     FAFVIFEEAWMADAAIKEGKFHFKNVVLDVSRAETRT"
     gene            <1102674..>1104029
                     /locus_tag="LDBPK_342540"
                     /db_xref="GeneID:13392822"
     mRNA            <1102674..>1104029
                     /locus_tag="LDBPK_342540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864365.1"
                     /db_xref="GeneID:13392822"
     CDS             1102674..1104029
                     /locus_tag="LDBPK_342540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864413.1"
                     /db_xref="GeneID:13392822"
                     /db_xref="UniProtKB/TrEMBL:E9BR52"
                     /translation="MSSRRGRQWQSPSGGDDNGLRRDSSARYSSSAHTKSLRYGNGGG
                     FRSNDSRRTVDTSDRYCDMYTLQWGCASSSDGARTARIGEVQVGSTSRDCRRRDASRG
                     SGVSGPGARGRSARGGNRQYDAPSSWSTSSYTYSYSGSDANNGDSSSEERARDQNRVY
                     AGSRARKRQETKSSRPTPLGSARSPIRVTPTGPPPLDAPPPGAIRWVDDGRRGREVYR
                     GENESKAGSLSRQHTDADEQDAAMMKPAASLRPLLSARTPSLQPTGMLRRVIAAVAYY
                     RGVPPPPSVPPEVILAFDEYVSRGSVMLKFASRGPPHQRFFAIRFLDVMAGSIRLGCG
                     RAYDQRPSILHAVLSWYRSASSRRMIRFLPLHDLIEVKADGADHRYVRRRTVQPGLLR
                     GPRSGLVTTYVRADFIVQFRFCSRLSRAEETLALMAENRTQYLAWLVVGSFISQIGEI
                     Y"
     gene            <1105467..>1107488
                     /locus_tag="LDBPK_342550"
                     /db_xref="GeneID:13392823"
     mRNA            <1105467..>1107488
                     /locus_tag="LDBPK_342550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864366.1"
                     /db_xref="GeneID:13392823"
     CDS             1105467..1107488
                     /locus_tag="LDBPK_342550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864414.1"
                     /db_xref="GeneID:13392823"
                     /db_xref="GOA:E9BR53"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BR53"
                     /translation="MQTTAANMVEVVRHYTANLRTFFTIPPLSESMAGVIILFVFMNS
                     MATSIWMSNAWPPFVYLLFNNSNLAVGVVAGVNGFFELSCAIVSGHIADKVWGPSHTL
                     IFAVRLGMVKLCIVALAIWMKHHWLLIVAQMFEGCYMGLNLTCVESVFAQCLRTGERD
                     RLYSLKFSVESVGPIVGLISSLFLYLIVGTEWNVQVLQIVMTCGVALHLMSMIIFSKL
                     FVALPSHLDEKRKAAAATDIVLIDDIHCEGGGVPSAPVRTYNVEERRVTDAAGHEGEV
                     DEELSPSNLVQSDKTDTTDCAPSSITYPTNNSCSPSLVSHYGPSVCATRSTDAALLQN
                     KQGTTAVGMEPYQQAASAGEGATSVAVGPDSAGNPTSLIHTRQGGPSSLVDIHNIPAG
                     THIEYVDHEYEEASACRRRVMDCFPLRIYPMAIVACDVVLLLGSGMITRYLPLFLMKN
                     YNVSLATICVLNLFNSFLITLMAIINGFIGKRYGRIRAAMPPKVIGTFLLLYMALAQK
                     TRYGSKFWMSLAYVFRNALMNCTVGLSRALIMDLVPEHRHSRWNALESVQSAGWSGSA
                     ILGGLMADKFGYGAAFVFTFFFHFFSTSALVPFTVRNDARLPQPVLVYDGPPPQTSVH
                     EQRTRGLSSPTRMPSPPPLTTTTKVAVAELATENVRRIASCTSVNREAE"
     gene            <1108688..>1110904
                     /locus_tag="LDBPK_342560"
                     /db_xref="GeneID:13392824"
     mRNA            <1108688..>1110904
                     /locus_tag="LDBPK_342560"
                     /product="gpi transamidase component, putative"
                     /transcript_id="XM_003864367.1"
                     /db_xref="GeneID:13392824"
     CDS             1108688..1110904
                     /locus_tag="LDBPK_342560"
                     /codon_start=1
                     /product="gpi transamidase component, putative"
                     /protein_id="XP_003864415.1"
                     /db_xref="GeneID:13392824"
                     /db_xref="UniProtKB/TrEMBL:E9BR54"
                     /translation="MHLLERRPSASGVLLAFAVVVLTWVAAAVTAPSHPYAANTSRRY
                     SMMVEELTGSLDERGTTPTLVSVAMEMSLTLPAKPGAAAVWEGDAEANEIDDAAVQHL
                     TFDDDFDPIWYYVLRRRGFERLEWCGCGGKWRPEWSIPKAHQRRGGDAAALSAEHESN
                     SVLFGRLRRLLAHHAVCTYSSVSFCGASHERGAASQFQWAAQFVSTLTSSPLSWTEAT
                     PRHSRPNGIVIQRDSSHASGGEDAYWCSYHLVYHDTLCTQHVSPLLNGGRSGRGVQEG
                     LPRGIFKAAFPSFVKYFGAPFQHFTVKATQERLPGNSAAAQPPTVRLKVEVRMSMVVG
                     EASDLEALSEVWSRELPAYARDGRLQVHIGPGGLSQHLRSALPTAAIVSSPNEGQAKA
                     TPQRQASASASPLSRIGCSPEVQYEVRTHGKDHGYLTVNLQPALVLLDAHAGVDAEKR
                     EGSDGADEESALQHSFLLREGDVVRTLLLFPLHLVRPSLYNMESLLGTTRIVHAHADV
                     VSNTLAVLLETTVTPVHVAAYEAAYAHARHCHEMAGGGGTGGRACRAHDGVLLGRFQL
                     FFGWSALGDMPPDDNSNRLVPQPVVVIRRAGTSADLGAAETSSQSDFCHAQRRHVASV
                     GSIPQLDHEDSLAAVFQLLSRSHGWRDDKKGSLSAALANLKEDDACIYWVRSTVSSGT
                     TIPGPDGAMIFNVLSLGLFFLAVAAGMLTRLTRRLTCKREDLVNLLPQEGATTVVK"
     gene            <1113634..>1114188
                     /locus_tag="LDBPK_342570"
                     /db_xref="GeneID:13392825"
     mRNA            <1113634..>1114188
                     /locus_tag="LDBPK_342570"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864368.1"
                     /db_xref="GeneID:13392825"
     CDS             1113634..1114188
                     /locus_tag="LDBPK_342570"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864416.1"
                     /db_xref="GeneID:13392825"
                     /db_xref="UniProtKB/TrEMBL:E9BR55"
                     /translation="MMPLSAASVAYCSSSLDSHVFAKPFTPASTPRRNDPYSPCLLKS
                     CCTPEDSFYACYSEVDETPAVVAVNPANTPIRSHVVGQKAALPTETQALLKLLSKATA
                     STSPFMSPMATPLKTADSMEQSPASLIAGGGLTTAPSLSSTPERAASPSSRQPPATSA
                     RVIRKVVSCGVDRTSGRPVPRPKD"
     gap             1124958..1125267
                     /estimated_length=310
     gene            <1128060..>1129343
                     /locus_tag="LDBPK_342580"
                     /db_xref="GeneID:13392826"
     mRNA            <1128060..>1129343
                     /locus_tag="LDBPK_342580"
                     /product="methyltransferase-like protein"
                     /transcript_id="XM_003864369.1"
                     /db_xref="GeneID:13392826"
     CDS             1128060..1129343
                     /locus_tag="LDBPK_342580"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003864417.1"
                     /db_xref="GeneID:13392826"
                     /db_xref="GOA:E9BR56"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BR56"
                     /translation="MPAPRPELENPPEVFYNASEARRYTVSTRVRKIQRDMTLRALEL
                     LNLPKDDAAAATGVNCSALLLDIGSGSGLSGDVLTEQGHVWMGVDISRDMLRIAKEDE
                     LHYYDVGAAQKSAEAEEAYQTSSSNARFDTSHVKWGLITSEDDQEEVSESEGGKGVDG
                     DDDDVASGDLASSAAAGNGAGGAASGPRMVEVLQNDIGVGLPFRPGTFDGCISISVLQ
                     WLCHSTKKGEVPQRRLMALFQSLYNALRRGAKAIFQFYPSNPEQVHIITRAAMKCGFD
                     GGVVVDFPHSARAKKYYLVLQAGQVQGGFVPPAALTGEVEGDGDDDGSDGDSEYDGEE
                     YYGSGEDGDDDDDDDGLHNPNSRKRVRVGGRDAHHGKRARASSEHGQKRRRKDNRPVT
                     GTREWVLLKKEERRRRGYQTTADSKYTMRRRKPRF"
     gene            <1130343..>1131248
                     /locus_tag="LDBPK_342590"
                     /db_xref="GeneID:13392827"
     mRNA            <1130343..>1131248
                     /locus_tag="LDBPK_342590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864370.1"
                     /db_xref="GeneID:13392827"
     CDS             1130343..1131248
                     /locus_tag="LDBPK_342590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864418.1"
                     /db_xref="GeneID:13392827"
                     /db_xref="UniProtKB/TrEMBL:E9BR57"
                     /translation="MNPDDGSEAGSIAEPLPQEQITMLLNVQDFQEKVAQDPANLCCV
                     IVTSTLCRHCGIRRIPYPKVAHPHSKTSSNEDGESEDEDADTDSDDGYGDEEDSQADG
                     GAGHSARAGHFYRDIEEHLVHNRDTATQRRHTRFFHVCACMEEETCVDFLIAADPAYS
                     LLNKQPTAHEMALLHKKAHHQLKELLNLLEVRSTPSMRLYLAGQPLRYSAMLSSCNDA
                     AAPKDVTAETDVLQVSGANWIKWFQVLQNAVVVRNEVMRSYDTEEREKARAARAEARR
                     QARRERRKQAAADEEEGDEEGAEDG"
     gap             1132462..1132560
                     /estimated_length=99
     gap             1133846..1133944
                     /estimated_length=99
     gene            <1135093..>1136124
                     /locus_tag="LDBPK_342600"
                     /db_xref="GeneID:13392828"
     mRNA            <1135093..>1136124
                     /locus_tag="LDBPK_342600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864371.1"
                     /db_xref="GeneID:13392828"
     CDS             1135093..1136124
                     /locus_tag="LDBPK_342600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864419.1"
                     /db_xref="GeneID:13392828"
                     /db_xref="UniProtKB/TrEMBL:E9BR58"
                     /translation="MVKQSAAQVPLRVPSTRVRNESHSINADGKQTCCPSLKVIGAAA
                     RKPSAALADAPLRRKRVPAVPTTPKRAGGWNAPWQPRRGSSGITPDEDSRKAREHLRH
                     SPPGKRRGNSIGHRSHSAGASRHAQRPASDMVTVGLPRMHSSPQAVTSVHENGLTSDD
                     LLLLCGVKPGSSKALWYTTMRAQLEARALATAAEQSDRGDSATSNRPRTGVGSSSSSS
                     HSLTRRADASSEPLVLPTALLLLTEPSDLNAHTMGAPESAAQQKGKIPRTRSGEDDAE
                     KVEEDDGASSLGTRSTSLCSEKVANASVTQGAPNAVPLVPLKKLRLSPKQLTQMRVSV
                     LSLQALADL"
     gap             1137262..1137360
                     /estimated_length=99
     gap             1139986..1140037
                     /estimated_length=52
     gene            <1140764..>1142647
                     /locus_tag="LDBPK_342610"
                     /db_xref="GeneID:13392829"
     mRNA            <1140764..>1142647
                     /locus_tag="LDBPK_342610"
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /transcript_id="XM_003864372.1"
                     /db_xref="GeneID:13392829"
     CDS             1140764..1142647
                     /locus_tag="LDBPK_342610"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /protein_id="XP_003864420.1"
                     /db_xref="GeneID:13392829"
                     /db_xref="GOA:E9BR59"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BR59"
                     /translation="MSGLDSSDVLYYLYDPNLVPPARDKYIRVISELLAGYHDSSYVD
                     KIDIMDILRGGAREAVELCEDAKSVLSKEPTVLGLCVSDVDDFVFVGDIHGQFNDLLH
                     SVLSVQLSRSAPVLRKGTKVATQPTQRMDGEEDSGERSSTLPIVATPTLSPPLAPSLS
                     STAIPRHHDDSDGFGRDAGKIIRFLFLGDYVDRGPRGLEVIVLLLALKIEYPQHVFLL
                     RGNHEEAQTNRLYGFFDECRAKFFMVHHAREHMSYLEPGCDGACSSLIQRSPTNVAKE
                     AIGVECHNSPPHCLHLDGERATDLRGTSGSSRGNNSSAEVQSLLADTDADAWMSFNAT
                     FCWLPLAAVVCCCAGSFFCTHGGLSPPLRRITQLHRLKRETYGTGLCETITPPLSGSC
                     SVTSSPERSPRGVYGSPASKREPNQIIDGLLWSDPSDHEAGCQVNVRGCGYSFGVDVT
                     RRFLDANCGYAVSQTPSLRTEVNKDDEEKRSCPGSAPPRNAQHGGSQRMHFIMRAHQC
                     VNAGFQWTQEGLVVTLFSAPNYCGMNGNKGAIAMLRGAAQASGESIRLEFKVYDSFKC
                     ASFTGGSKLTLGKPEHKNSGSSLSATGGAQPRCPAFPLRDRNVVNNPILEAYFGSIAK
                     SGN"
     gene            <1144877..>1145416
                     /locus_tag="LDBPK_342620"
                     /db_xref="GeneID:13392830"
     mRNA            <1144877..>1145416
                     /locus_tag="LDBPK_342620"
                     /product="40S ribosomal protein S19 protein, putative"
                     /transcript_id="XM_003864373.1"
                     /db_xref="GeneID:13392830"
     CDS             1144877..1145416
                     /locus_tag="LDBPK_342620"
                     /codon_start=1
                     /product="40S ribosomal protein S19 protein, putative"
                     /protein_id="XP_003864421.1"
                     /db_xref="GeneID:13392830"
                     /db_xref="GOA:E9BR60"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="UniProtKB/TrEMBL:E9BR60"
                     /translation="MYSPARMSFIRRVTNPSCIMAALKNKIHRIGKRKGASLKDVSAW
                     RWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCAAVLRAIYLRPGV
                     GYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPGAQSGQRLTRKGH
                     KFADSLAFQVQIRKFGASK"
     gene            <1146524..>1148332
                     /locus_tag="LDBPK_342630"
                     /db_xref="GeneID:13392831"
     mRNA            <1146524..>1148332
                     /locus_tag="LDBPK_342630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864374.1"
                     /db_xref="GeneID:13392831"
     CDS             1146524..1148332
                     /locus_tag="LDBPK_342630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864422.1"
                     /db_xref="GeneID:13392831"
                     /db_xref="UniProtKB/TrEMBL:E9BR61"
                     /translation="MAVDFDLTLFIKETQLQHGLRAEDYARYHHYTTNRLATLRRQLS
                     LSNDKKKFLRKEVTPQNTTDVRHLMLLALYAERCWAEAEAMQVQLQAKKESRGTDANK
                     PKGGVPPQDQYRKRLNKSVKWASKLHEVAKEVASDRAKKECSAYLKDTAGRCHASHGK
                     FKEAKEAFLEARETYATLRSISSESQWVVIACKISELDDRVTYCMQRLGEDPTTYRPA
                     PIFVTASADGAVADSAVPMGGASQLSWNGRTLSVYSIKVKDALREAQAVEVESTEAKL
                     QETRGVVPVGQSNRVLDLMDRRINYYNDALTHARQDLRAVPEGAGKTEHQLIVHCILF
                     HVAQETLRRTLFLADLYRRRFEATERTLKSTAASSSSPSFPRGHKQQQKHRKKKAEVA
                     PTQYASPLEVVRLYQAAAGSVEEMELLPGVAGREDVEALHAVCSAGQLFFTGESWRLS
                     EAWSTAMKYYCDALALLRRVKGPYVASMHELIEQRLMQGAAEVVLAASFMGADGNTRR
                     STPLMTYLVDAGEETTQVAQGVVRFPPDYHAAPCKPVFVDVASTFLNYPVDSGDEADS
                     DDRSGAKTATVPATMKNTSAAAGQPKKKGWMFGWRS"
     gap             1150166..1150264
                     /estimated_length=99
     gene            <1152987..>1154666
                     /locus_tag="LDBPK_342640"
                     /db_xref="GeneID:13392832"
     mRNA            <1152987..>1154666
                     /locus_tag="LDBPK_342640"
                     /product="tuzin, putative"
                     /transcript_id="XM_003864375.1"
                     /db_xref="GeneID:13392832"
     CDS             1152987..1154666
                     /locus_tag="LDBPK_342640"
                     /codon_start=1
                     /product="tuzin, putative"
                     /protein_id="XP_003864423.1"
                     /db_xref="GeneID:13392832"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR62"
                     /translation="MAVNAFFAKSASAALAPIAKGSIKSKIAGTVYAVHLQHLFLSPI
                     IEVGSRVYLERDKGEEYAGTVVGGTVVRVNGNGTYGVLLDNNSFDMAVPADMVVFSEG
                     RGKLASDAEHREVVEWLRRAGVARRAHQESIACALFHRGWRAHRLYLLQASDVHCVTH
                     IPKAVRMRVLDEAESQRDHHRQMRQLLKERVMERDFRYKLTKYSGVVSASMALLGIAF
                     AFGWNVKNSRTQKREHQLKVAVKALMQTLNQHHNTLQGTTPVAQHFVRREKEESAVRQ
                     ALRRLDVAHPRIIVFTGFRGCGKSTLCRNAVLQERVPAVYVDIRGTEDTLRSVVKALG
                     VNRVEVCGDLLEFVADSCRTAKATNGETPLLVLKLREGSNFQRVYNDAVALGCDRRLC
                     HVAIEVPIESLSMATAGLPRLDFCMIAMFSREQAFAYTQHTMDAVGLNHFIDIIGTNS
                     NDLDELFAAVHQRRISAVTYTNEKLLKAMRQLQTTCAGRPRLRSALQQLSAIPYGDGQ
                     HAGGDAAALQSAALGEIVFYDPVQDAWLFRNKLFHSASRCCWPQARGEMRR"
     gene            <1155486..>1155740
                     /locus_tag="LDBPK_342650"
                     /db_xref="GeneID:13392833"
     mRNA            <1155486..>1155740
                     /locus_tag="LDBPK_342650"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864376.1"
                     /db_xref="GeneID:13392833"
     CDS             1155486..1155740
                     /locus_tag="LDBPK_342650"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864424.1"
                     /db_xref="GeneID:13392833"
                     /db_xref="UniProtKB/TrEMBL:E9BR63"
                     /translation="MHMRVLVRACTLSRGSPWLSPIPHSPPSALLSSSVAPSRLPCGS
                     LCCAPPLHLSQHFGARFRRWGASSPFSSTRSSSSSRSFPC"
     gap             1155997..1159970
                     /estimated_length=3974
     gene            <1160118..>1160435
                     /locus_tag="LDBPK_342660"
                     /db_xref="GeneID:13392834"
     mRNA            <1160118..>1160435
                     /locus_tag="LDBPK_342660"
                     /product="amastin-like surface protein, putative"
                     /transcript_id="XM_003864377.1"
                     /db_xref="GeneID:13392834"
     CDS             1160118..1160435
                     /locus_tag="LDBPK_342660"
                     /codon_start=1
                     /product="amastin-like surface protein, putative"
                     /protein_id="XP_003864425.1"
                     /db_xref="GeneID:13392834"
                     /db_xref="UniProtKB/TrEMBL:E9BR64"
                     /translation="MHAYICICVYLCVRVRCQEALLGSLPFAALRPPPSSPALSRHLD
                     SPVVRSAVHLRFTFLSISARGFEDGVQVHLSRLRDPPAHRVPFRADRYAAGDVSWHHE
                     GPV"
     gap             1161170..1162846
                     /estimated_length=1677
     gap             1163314..1163412
                     /estimated_length=99
     gap             1165592..1165690
                     /estimated_length=99
     gene            <1168247..>1170778
                     /locus_tag="LDBPK_342670"
                     /db_xref="GeneID:13392835"
     mRNA            <1168247..>1170778
                     /locus_tag="LDBPK_342670"
                     /product="zinc carboxypeptidase, putative"
                     /transcript_id="XM_003864378.1"
                     /db_xref="GeneID:13392835"
     CDS             1168247..1170778
                     /locus_tag="LDBPK_342670"
                     /codon_start=1
                     /product="zinc carboxypeptidase, putative"
                     /protein_id="XP_003864426.1"
                     /db_xref="GeneID:13392835"
                     /db_xref="GOA:E9BR65"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:E9BR65"
                     /translation="MNGLDRDASLRGADDAARGAAGSQIRAASLTAPGPEVDDAHWVF
                     QRPPNNQRTFYFQEDNLEFSSQFDSGNLIQVERVGVFHYRMYTAMDCGNAPWQTNNRQ
                     WFHFSVRGGSKGAVVTICFVGMAHSNMFTYDWMPVMAVVPTRPQYTRIAGKANVEALE
                     KMPETPGYPLLVHKPVSKDDADSDGGGDEGDNDADAGAAGANNNGGAGGIAFSISPTG
                     RSSGTSKKKKTKKKSIAMNLTFNFKIETEIAVTYTPPQGRPDSPAIYIASNHPYTYYT
                     LQRNLAMWQETARRSNTLREMSLQAPDHQARRSSSEQRSGPDSYAVDGLATVQPGSSG
                     RSKKWAGSSNTGNVAAPYSAEFSEIYFHREVLCKSLEGRDVTLLTISDCSRMAIERAP
                     LLSKEDGLPHSSALGFTQRPYSFFGKQYVVLTARVHPGECPGSHLMHGCIDFLMNCTD
                     CRAAALRHNFVFCVVPMLNPDGVVRGHSRVDSNGVDLNRMYRDPSRKRHPAPYAVLAL
                     LRSLGSRVALFIDMHAHANKRGTFFYGNSMDWANQIENLLYAKLVSLNTPYLDFRSCN
                     FSEANMFAVSKSGKRKDSSSRVVAFTEAGIVHGYTIETSHVMADALNPVALLTNHQTD
                     QLDTALPSPPPVMHSPATFRDTARAMLLGLLDLKGINPKSRLPLTQFHSTRGLALWLQ
                     RQLQIESAETLFAQAFKLHGKEAQASTSESGNTLLATIMKSMAAEEYPEKITIREARL
                     LPRTTFSGVRSFVPLDTAIVLLSQTVPTGPPRSLLYGSGNCGAASGAAAAGGTGSKGG
                     GSAQRRGTSPSFSGNNCTTAIPPAVIATRRRSKPMLLSSDTTVET"
     gene            <1173181..>1175124
                     /locus_tag="LDBPK_342680"
                     /db_xref="GeneID:13392836"
     mRNA            <1173181..>1175124
                     /locus_tag="LDBPK_342680"
                     /product="regulatory subunit of protein kinase a-like
                     protein"
                     /transcript_id="XM_003864379.1"
                     /db_xref="GeneID:13392836"
     CDS             1173181..1175124
                     /locus_tag="LDBPK_342680"
                     /codon_start=1
                     /product="regulatory subunit of protein kinase a-like
                     protein"
                     /protein_id="XP_003864427.1"
                     /db_xref="GeneID:13392836"
                     /db_xref="GOA:E9BR66"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BR66"
                     /translation="MSSFDKYVVQLVRRMGDSVSKGMRETILLNIKDSIDDYQRLRDP
                     AEAQAREKAAAAKKRRAAARKAKEEERRRRMERQANLPPLPPPRSNNATQPATTDSKS
                     TRKTHKEKSAARSNNINFSASSAERAGAMTAASAAAKAPARSKMHSVALKGIDLLFVK
                     EVAAQLRDLRRKPGAISSLAGSTQECIASNAVGAATPMGAPSAPTTAEAVETAARNKK
                     SRSAIPKKRMSPPPLDHTAMKQSDRENSSIGGADETLPLPRSDTISYQETFKTFRFGR
                     QDADNESDSKAENDSQDGEQRQREAEEDEFIDDCEDARRRTIQMQRPSRGAISDSSLD
                     IDEARIASFPTTPKSQEKMKTISRVLVRHFLFSTLDDSDIAKFASIMDVEKFEAGTQI
                     LEKGHTNDTFFIVLDGEAETTVVNEDGAEVVVPLVRGSTFGDLGLMYEISNGAAVVAR
                     SSVQCASLERRTYKMITSRAMEDKRRRYVDFLSSLPVFAGVSSHQLDDVAERLKEDSY
                     VQGQRVIAAGVPNHWLHIIMEGSVCVMAPDGESGDMKEVALLHPGDFAGQIEFLYHHV
                     AVADVVAVSAVVKTAKLSRRSFEFFPMEARERLIRAVEEEETYATYQKRMHSGTRPPL
                     DTTPPFDAPPSHLRYSLRQHESA"
     gene            <1178549..>1178860
                     /locus_tag="LDBPK_342690"
                     /db_xref="GeneID:13392837"
     mRNA            <1178549..>1178860
                     /locus_tag="LDBPK_342690"
                     /product="ubiquitin related modifier (urm1)-like protein"
                     /transcript_id="XM_003864380.1"
                     /db_xref="GeneID:13392837"
     CDS             1178549..1178860
                     /locus_tag="LDBPK_342690"
                     /codon_start=1
                     /product="ubiquitin related modifier (urm1)-like protein"
                     /protein_id="XP_003864428.1"
                     /db_xref="GeneID:13392837"
                     /db_xref="GOA:E9BR67"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR015221"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="UniProtKB/TrEMBL:E9BR67"
                     /translation="MQMTHRKIKVVLSGGCELLFDKEVNITLADVVPVGATVAQLIDL
                     LRRGYVKERPELFVDATGANVRPGILVLVNGCDAEVLGGVEHVLEDGDEVEFVSTLHG
                     G"
     gene            <1179463..>1181499
                     /locus_tag="LDBPK_342700"
                     /db_xref="GeneID:13392838"
     mRNA            <1179463..>1181499
                     /locus_tag="LDBPK_342700"
                     /product="selenocysteine-specific elongation factor,
                     putative"
                     /transcript_id="XM_003864381.1"
                     /db_xref="GeneID:13392838"
     CDS             1179463..1181499
                     /locus_tag="LDBPK_342700"
                     /codon_start=1
                     /product="selenocysteine-specific elongation factor,
                     putative"
                     /protein_id="XP_003864429.1"
                     /db_xref="GeneID:13392838"
                     /db_xref="GOA:E9BR68"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BR68"
                     /translation="MLNVNIGLLGHVDSGKTALAKALSSTASTAAFDKSPQSQSRGIT
                     LDLGFSACEVSVEDGNADATRVLREADLTKVQCTLVDCPGHASLIRTVVGGAQIIDAM
                     VLVIDATKGMQVQTAECLILGEVLAKPLVVVLNKMDAIQGASPAAKEAALAALKRKLQ
                     QVFRRTRWPTVAIVEVAAAPREVAGGIGHPLNTEAVLPQVLRAVDLAALKSAKESEAE
                     RPAQFYMLVDHCFAVRGQGTVFTGTVVAGVVRVGDTVLVPELQTTRKVKGLQVFHKPV
                     EMAQSGDRVGLCVAQFDPTWMERGVLCSAASSGRALVSSSQLIARVHRVRYHPLPCDT
                     HTKFHITIGHATVMGTMRYFARPPRANESLDVPGTGASFDPSIESTYVEELDDGVVAS
                     YTSTDTTASVPGRPLPVAPAEQDYYAVLLLERPVLAAPGVSMIAMRLDVERENFCRIA
                     LAGTVCHVFMEDGAAARTTTAVPGRSDHSASHGQVPAWRRLPVVRYRYRALRVDRVLD
                     SRSCIADGVVSLQTPGAGGSGSRPAGASAGARRDKGCVNAEARQRAELFAEVQKFLRL
                     VVVFEPEDADAAMTTPQPSNPGAVKGIIDSSFGKTGKVKLVFDGPVFADPAANAATAP
                     IGSFVSAARKKRNKSTRGPGSEDAGCSGGVFLRPGRILLVLKKYPFALHSGLEQ"
     gene            <1182941..>1184176
                     /locus_tag="LDBPK_342710"
                     /db_xref="GeneID:13392839"
     mRNA            <1182941..>1184176
                     /locus_tag="LDBPK_342710"
                     /product="serine acetyltransferase"
                     /transcript_id="XM_003864382.1"
                     /db_xref="GeneID:13392839"
     CDS             1182941..1184176
                     /locus_tag="LDBPK_342710"
                     /codon_start=1
                     /product="serine acetyltransferase"
                     /protein_id="XP_003864430.1"
                     /db_xref="GeneID:13392839"
                     /db_xref="GOA:E9BR69"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="PDB:3TBH"
                     /db_xref="UniProtKB/TrEMBL:E9BR69"
                     /translation="MKRLDRIREALEQLNPQRADSALPTFHPRISLHKLKELVECLFY
                     VFFPECTNPPSEVTPTFAEADALMEWVIGHIADILMTQIYVAFVLHGDAHAVEDTKPF
                     KPLNTSQRTQLEWNGQRCATLSLLAMESTCTKGGCGVAAAAEKDVSKAAAEKLRCTGN
                     RARLPSTEVSSKSSTPKANAMCETADINSGANQAFLTNCKRRADAIVTKFVVERLAHV
                     RWLLHTDVEAIFEGDVAASSPSEVVLCYPGLRCMVHQRVAHQLHLLGVPQNLTRMLTE
                     LAHSETGIDIHPNTAIGHHFFIDHGTGVVIGATAIIGNGVSIYQGVTLGARSFPTDEK
                     TGERIRDLPRHPIIEDGVTLYANAVVLGRVTIGERSTIGGNCWVVRDVPPFSSIVQRS
                     HHVLQPHERMFLERDGSGI"
     gene            <1185914..>1186270
                     /locus_tag="LDBPK_342720"
                     /db_xref="GeneID:13392840"
     mRNA            <1185914..>1186270
                     /locus_tag="LDBPK_342720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864383.1"
                     /db_xref="GeneID:13392840"
     CDS             1185914..1186270
                     /locus_tag="LDBPK_342720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864431.1"
                     /db_xref="GeneID:13392840"
                     /db_xref="UniProtKB/TrEMBL:E9BR70"
                     /translation="MFRVSFTLLGHGQYKTRLKKRMVGFIPKVIPRKIRNNMVALRSE
                     ANTGHMEGYIKTEAERLDATGRKLQKTMWDPVLQRYTLMKETKVRGPFLTKSNIARKV
                     DFAIGALHGAKSGDKK"
     gene            <1187062..>1187355
                     /locus_tag="LDBPK_342730"
                     /db_xref="GeneID:13392841"
     mRNA            <1187062..>1187355
                     /locus_tag="LDBPK_342730"
                     /product="ribosomal protein L3, putative"
                     /transcript_id="XM_003864384.1"
                     /db_xref="GeneID:13392841"
     CDS             1187062..>1187355
                     /locus_tag="LDBPK_342730"
                     /codon_start=1
                     /product="ribosomal protein L3, putative"
                     /protein_id="XP_003864432.1"
                     /db_xref="GeneID:13392841"
                     /db_xref="GOA:E9BR71"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:E9BR71"
                     /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARAFPKDDATQKPHLT
                     SFMVFKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVIVGIVGYRQTPVG"
     gap             1187356..1188080
                     /estimated_length=725
     gene            <1190307..>1191605
                     /locus_tag="LDBPK_342740"
                     /db_xref="GeneID:13392842"
     mRNA            <1190307..>1191605
                     /locus_tag="LDBPK_342740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864385.1"
                     /db_xref="GeneID:13392842"
     CDS             1190307..1191605
                     /locus_tag="LDBPK_342740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864433.1"
                     /db_xref="GeneID:13392842"
                     /db_xref="GOA:E9BR72"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:E9BR72"
                     /translation="MSSMHSPAHDSCTSLSTGDDSHHYQRQQREDDEERWDITVSFSC
                     GGWFQMYFFGAAYALVDSGVLQRWYCEGKRVRFTGVSAGALAATCLASGQYDILSVKQ
                     FASAAAEDYRSSVFHCFRVGKYLTAAIDNFGTNLRAVDTDPRMRQVLMSGSLEVGVTV
                     LPKLKSRLISSFSSYAAIRETLLASCCLMPLVGMPFKMESTGEWCADGGISNFTPRIE
                     EENTISVSGMYFQDASVRPRVFVPSWWALHPPNAQKYNNLFWMGYNDMIDYLVSVGHL
                     SVADGNRLLKQEVDFRIHDSYLEVAFTFFMELMMLMYIRPVVIIFVYVELAISMIWWA
                     AKGILTWDGASFRNLYDGFRNTISLRTLGRLIFGSKISSNEERLSRQSRVFRVFQPVV
                     LGGSKKTGRKCWGSSSAVLLERVPTLSPNARRAAPTSLSK"
     gap             1192583..1192681
                     /estimated_length=99
     gap             1193974..1194072
                     /estimated_length=99
     gap             1197924..1198057
                     /estimated_length=134
     gene            <1199033..>1199302
                     /locus_tag="LDBPK_342750"
                     /db_xref="GeneID:13392843"
     mRNA            <1199033..>1199302
                     /locus_tag="LDBPK_342750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864386.1"
                     /db_xref="GeneID:13392843"
     CDS             1199033..1199302
                     /locus_tag="LDBPK_342750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864434.1"
                     /db_xref="GeneID:13392843"
                     /db_xref="UniProtKB/TrEMBL:E9BR73"
                     /translation="MLRLTRRSLMQRSRMTLEANFKSHSAAANPATGASVTGKVKAEL
                     KKMIKIQLVLIPICVVFMVWMYPTPTEEDERRMRLEYERNAGWKT"
     gene            <1200113..>1200685
                     /locus_tag="LDBPK_342760"
                     /db_xref="GeneID:13392844"
     mRNA            <1200113..>1200685
                     /locus_tag="LDBPK_342760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864387.1"
                     /db_xref="GeneID:13392844"
     CDS             1200113..1200685
                     /locus_tag="LDBPK_342760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864435.1"
                     /db_xref="GeneID:13392844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BR74"
                     /translation="MLHRSFASLFLKGIFKVNKPPVTGYEIAELPNEKVLHDFMQFYR
                     TKGVVVVLHSGASYAAAAAASSGGSRSTLTSASANSSGKAHSAATAKSASTPKPKTEL
                     LQDPLTRSFISSINAMNLGNPEEVKLALVPGPQAPCFVEEHNVITYPTSLLFLNGQCI
                     YRVVGARTRELSIKSLFMLRNGGRNIFSRD"
     gene            <1204590..>1205474
                     /locus_tag="LDBPK_342770"
                     /db_xref="GeneID:13392845"
     mRNA            <1204590..>1205474
                     /locus_tag="LDBPK_342770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864388.1"
                     /db_xref="GeneID:13392845"
     CDS             1204590..1205474
                     /locus_tag="LDBPK_342770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864436.1"
                     /db_xref="GeneID:13392845"
                     /db_xref="UniProtKB/TrEMBL:E9BR75"
                     /translation="MSSTKDQGRRPVIASYRCDEHVFPELPATHPLSVRRREVQRFLK
                     GDGTLGRRAWNPATKDELHPFPQPALNNTTTCYNGVDVVATHFPETVKGTAFLKMQET
                     VLPAVWTHNRDRACASTKRHTYRCEALERQEVPLSFLATVIRDDNNPEKRRRQEGWCA
                     STTLEGFRGNRHAAPAAEGVFDAKAHRELNKMLTARLSGGYVKPYNRVKHLNSSLEKQ
                     KELQQKAAADSLINLYASQPGPAAFKMSNADEWWDIDPVAVTGDMRKRIDEMKANPYS
                     TIFRSTTFATTPPRSSRV"
     gene            <1206197..>1207465
                     /locus_tag="LDBPK_342780"
                     /db_xref="GeneID:13392846"
     mRNA            <1206197..>1207465
                     /locus_tag="LDBPK_342780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864389.1"
                     /db_xref="GeneID:13392846"
     CDS             1206197..1207465
                     /locus_tag="LDBPK_342780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864437.1"
                     /db_xref="GeneID:13392846"
                     /db_xref="GOA:E9BR76"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9BR76"
                     /translation="MNRDPQNALLLEQTAQKVKRLLLQRSPSAVNGIRSFSRSLGIAD
                     DLGSTQVTAEELQRALQENHVSLEEHEIQNIFTVLDRNGKGTIDPTDFIAVMCNNLSP
                     LRRVWLQRVWRMFIKDPDDGSVQVCELQRQFIAEGHPAVVRHETTAAEVRKDFESAFN
                     ESTNPDGKISAQEFAEYYAGVSASCRNDESFVALLRGVWPLPGVSRDFSISLAKGEAQ
                     YQGSYHTEQSLAEKTAVASREAARSALMSMIRCDHAPAVLSSGAAARALCLSLAQADE
                     AGSGFVSEAVFVGALRTHRLYVPNTSVLECLDTNGDGSVDIKYYEELLLPSLSAARLM
                     LLARLWSSCFENKDGAYRVPVQDLHRKYHASSPADKDAFLTAWDVRTAVGGKVELEEL
                     VQWYVPQSAAVQRDKDFEELLHRQWGKYDE"
     gene            <1208284..>1208976
                     /locus_tag="LDBPK_342790"
                     /db_xref="GeneID:13392847"
     mRNA            <1208284..>1208976
                     /locus_tag="LDBPK_342790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864390.1"
                     /db_xref="GeneID:13392847"
     CDS             1208284..1208976
                     /locus_tag="LDBPK_342790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864438.1"
                     /db_xref="GeneID:13392847"
                     /db_xref="UniProtKB/TrEMBL:E9BR77"
                     /translation="MLNIIMEGLTQPLQISSNGAYSLGLLLALSTGPLPLASEHIIGA
                     YLALQLMWWLLLCIRAARAAGSQSARRELKERAKEAYLKWMDGLRFSVAELICHHLLH
                     FEFGAQVCMFYCGTGALRTVARPLLYVILRLSAGSEWATRLTGYNPAYLLESVGCGNR
                     TEFASGPAWKQHGHASGAGVEATSAQVRVSSLAPTKHSDSAKNNNNRCTVLDEGPHFN
                     RTSRGCMLKYTE"
     gene            <1209767..>1210315
                     /locus_tag="LDBPK_342800"
                     /db_xref="GeneID:13392848"
     mRNA            <1209767..>1210315
                     /locus_tag="LDBPK_342800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864391.1"
                     /db_xref="GeneID:13392848"
     CDS             1209767..1210315
                     /locus_tag="LDBPK_342800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864439.1"
                     /db_xref="GeneID:13392848"
                     /db_xref="UniProtKB/TrEMBL:E9BR78"
                     /translation="MHSEVERLSLVDQQFPEGADVEEDDRVRHSECVSMNVVSLHDML
                     RQLGCAGESSGFTSFSASCLPPEMVDALLHYLVRLQEDVRQLDARAQLLDEQRARDTQ
                     KAELLNERTERLKDAVANMSAKSSAEMKEFRDYLQQNASANKQRQRELVDLTRKREKL
                     ELEVKRTRMEMDRLRKIAKRVR"
     gene            <1211386..>1212417
                     /locus_tag="LDBPK_342810"
                     /db_xref="GeneID:13392849"
     mRNA            <1211386..>1212417
                     /locus_tag="LDBPK_342810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864392.1"
                     /db_xref="GeneID:13392849"
     CDS             1211386..1212417
                     /locus_tag="LDBPK_342810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864440.1"
                     /db_xref="GeneID:13392849"
                     /db_xref="GOA:E9BR79"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR006602"
                     /db_xref="UniProtKB/TrEMBL:E9BR79"
                     /translation="MATSTLDPRMAFHAQQQDPGAPQPRQLILRYFYESGTVELMEVP
                     SGRLYLKRTAVGIPASAFTVGSTVMLFGKATTITAFADEVTRQLCAQCSESTAVLIAE
                     EAFPFLGRYLAMLTEECCFTITDVEMVWVQAETVSAFDLPEQLANTRMVVVLCTRKKA
                     VEKGFAFVERATGTCTAKDAEQAALWGQLGQLAKAKPLAVLNEANSSVVVLKPHLVSA
                     GRGGSAFQQLLDLGLEPTALTTVTMTSAAAREFMEPYRGVLPDLEGTASSFVGTNWVL
                     QLASLDETVDVVDTVRNICGPYDTVVAKKLYPKSIRACYGDSETENAVHCCDLPGDGP
                     IYTKFFFQG"
     gene            <1214208..>1215464
                     /locus_tag="LDBPK_342820"
                     /db_xref="GeneID:13392850"
     mRNA            <1214208..>1215464
                     /locus_tag="LDBPK_342820"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864393.1"
                     /db_xref="GeneID:13392850"
     CDS             1214208..1215464
                     /locus_tag="LDBPK_342820"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864441.1"
                     /db_xref="GeneID:13392850"
                     /db_xref="UniProtKB/TrEMBL:E9BR80"
                     /translation="MATSQHVPVEFSLLRYSTGDALHFVFQNGVRRQGNEGGASPLPG
                     LSKVVELQEKQAVRDKLHTCGTTDDPLNLENLTHIGTHEEWCAHSQTACALAKNAVAQ
                     CLQRRWEVRVRRYGEAVMRLSEASPTLWDREGQARATAADTPYATTALSTPSRTSSAQ
                     DHTPSAVKADNSAEAEARLNTDDEASDVAEEEEEEELETYLLQHPAFGADMAAAWLQR
                     RYLRCCHVINVRPSAAVCHRFSRGVQATLISTLGSFAAQKAVPPLSPVAETPTPFRCS
                     PGRRTWMSFPGTMVLLRELRTVPYEVNADFSGCAEIGHQQRHFIALLGVLEGCRNTVV
                     SLNLAKTCLNDDEVRVLCLFCRAYLRRLQVLDLSGNKSITDKVAVWIKQLAASSPLLF
                     RLAVRGTSLSRSTMRSVAGILCRKAL"
     gene            <1217424..>1219310
                     /locus_tag="LDBPK_342830"
                     /db_xref="GeneID:13392851"
     mRNA            <1217424..>1219310
                     /locus_tag="LDBPK_342830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864394.1"
                     /db_xref="GeneID:13392851"
     CDS             1217424..1219310
                     /locus_tag="LDBPK_342830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864442.1"
                     /db_xref="GeneID:13392851"
                     /db_xref="UniProtKB/TrEMBL:E9BR81"
                     /translation="MRSGTGTPYTLTQGTPGVSMYQNVSRSVSPSVRSRQAPRVDLET
                     IEELQDAWSRRYETLRDPPPPPLLNSPRSLRACELANVSPQSTLQKLSLKQHLFCVLG
                     NPHALSSLPDSATTEYQVLMQSALRSFREAAVGLGTSQEKLAAFIAFTNQEKLRVPQL
                     ASLRELRRQLVAKEAIAERGRHHQQPDYEVSKRSSNASAACQDAGDQDAHLSNLRRVN
                     VLRSSKTEKSLQRSRASSLSHQRGDSTTGARKTRFQSPRFSPLESVSFVQAEAASDEY
                     DEDIRGRGARGFAPTPTPSGKLPYKPRDVYLLNSSYFANRSIRSDGSNPCGAPLPTSS
                     PGTPPRSWGGAITETAFAKLPAPSQQPLLTVDSSLGSVIDVDSEFSLVREAEDTTDSR
                     SAPKQDLSIASMNSSQFELLNIAELAASSSEAALAQPSAATVLAGIRGKVADGSLSKH
                     TVTLFHDSKEKQSRGAAAATAAEEVAVASSTASIAERKPAPSSQPLKQRGLCGYTNHG
                     NFASLLIPNVLARPVSLPAEGKVAPFSLCVAAAAISPSDKEKAAASEQQEGITSTTAI
                     AIESTDSAEPAAAPAPSRLPLPPLITQAEESDGFVYYCANPSHSVIDSYTGRRKLLAV
                     TVKL"
     gene            <1220411..>1221160
                     /locus_tag="LDBPK_342840"
                     /db_xref="GeneID:13392852"
     mRNA            <1220411..>1221160
                     /locus_tag="LDBPK_342840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864395.1"
                     /db_xref="GeneID:13392852"
     CDS             1220411..1221160
                     /locus_tag="LDBPK_342840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864443.1"
                     /db_xref="GeneID:13392852"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:E9BR82"
                     /translation="MSINPTIGDKDILQRRTSANPKYDSVQAVVESGMTAQLAEYMRN
                     IKIKTKRQPGELFQRLRVDVIAAFLSRQEPKSVLEDGGFARPMDEYGGPENAVDKAAI
                     SYLLIDCREVEHYEACHIKTALHYPKIKVHHSTNPFLPEMYAYKNKENRYIVLYDMEE
                     EAVVNLANTMFQKGIDNVAIIAGGLREFAQDYADFLTARPPVPIVPRDWRMKRRAEEA
                     TQARSEARTSMSHKPKGLSSSLARSSRKGTF"
     gene            <1224031..>1226856
                     /locus_tag="LDBPK_342850"
                     /db_xref="GeneID:13392853"
     mRNA            <1224031..>1226856
                     /locus_tag="LDBPK_342850"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003864396.1"
                     /db_xref="GeneID:13392853"
     CDS             1224031..1226856
                     /locus_tag="LDBPK_342850"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003864444.1"
                     /db_xref="GeneID:13392853"
                     /db_xref="GOA:E9BR83"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BR83"
                     /translation="MQVDIGNNTVLQNFSSIVSSAEIRQLNDRLQQAYAGAAPAQATA
                     AGHQEGGEPGTVLSQRRVYHNAVEGAAGAPSSHPNVSRLRRRSSLNLSRSSAGSRHSY
                     HHYQGRQHGSTPRSRSGHSQSPEQPALWPQQATLGVSHIAAVTRITTPANSSTAVNNA
                     SVPSRANISGIPRILNSHVVQPPHLQQLLAPPQQTPAAFGGIGPSPAPMATVTSTPHR
                     QQGWPDAAQDKGGAASPAGAVDGAPVCAGDNRSKGMFGKEGDGNCRRDEGSGPHGGGD
                     ARSRNCNDKPAAAASPKLAHTKIQVGMRLRRWIIINRIGAGSFGETFTAMEVDGPAEE
                     EDSLTVASENMKLLENLPPVEERNEVCIKVEQENKNVLRLEALALKKVQPCPQVVRYL
                     GSGCTNGMNYLVMEKLGSNLAELRRRSQHGTFNIYTTLKAGVSCLTAIRGVHDLGLVH
                     RDIKPSNFVTGLPGTPDHTTCYLIDFGLARRFRRSNGEIRPPRENAGFRGTSRYASVA
                     SHHHQELGRVDDLWSLLFMLVEFATGTLPWRKYKEKDDIGRCKEESISPHLVRNLPRE
                     FQPFLAHLQTLRYEDEPDYDLLLTLMHRALERRGYPPNKPVEWEIDSSLADSCIDADG
                     APVVNAGAGAVQGSAAHLRDVGPAPDAAGNGHSIDGNASGRPLQPPPRRAAPLPGAVE
                     MGSRELLHMPLHPDAAQPNSAASRVGSGNGAAGNGATASGYPADALHPHNSGTLRVSE
                     VDIGGSGACQDSMHGNPPVGVDVSVQNRGPRPQGDSVDIPLTTACLAAEGSESPRAQA
                     SSGEYDHNEYSLRENGSGAYSPPMAPVSYFNAAVASGADPPGSSPAAGSLANSALEPN
                     NATHWRETAAERNGLKRRSGQQQRENECDIPDITKRGAGRWHQHMVGPTADLDASVAA
                     DEQGEAHYGKDGKASSKKKLQCECVVM"
     gene            <1229759..>1230811
                     /locus_tag="LDBPK_342860"
                     /db_xref="GeneID:13392854"
     mRNA            <1229759..>1230811
                     /locus_tag="LDBPK_342860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864397.1"
                     /db_xref="GeneID:13392854"
     CDS             1229759..1230811
                     /locus_tag="LDBPK_342860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864445.1"
                     /db_xref="GeneID:13392854"
                     /db_xref="InterPro:IPR029239"
                     /db_xref="UniProtKB/TrEMBL:E9BR84"
                     /translation="MSELDSLIDELFPEKHNNESNCASAPGPSRRRSEWDEESDDGQD
                     IRMFTGSKMHALQQRNPTSVSSSRADPSTSATTVAPTRCLAGHSFDEDGDADGDVGHA
                     VASHNVPGELVDKDLSARSLTRMSKPVLFPVPFPSLSGSEGSYACASRCYLTNLGTPL
                     IRDAGHPTLQQLRAIAANEQASLDTSRIQAMLRKGAFHAAIAKLGNGCLDHHGDFTVD
                     GGCPNILCRQCNYMVVRLQGAEWDDDGVNLYLTLRNYYPDWCRLASATPVGVEDGAEA
                     SRGVLRSSSAAAAYCCQCSWVTVRSAKMVIETRLTDITMAKPAREGEHPFATKLPLPL
                     GEKRRPPLWVCHGHTQ"
     gene            <1231835..>1233634
                     /locus_tag="LDBPK_342870"
                     /db_xref="GeneID:13392855"
     mRNA            <1231835..>1233634
                     /locus_tag="LDBPK_342870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864398.1"
                     /db_xref="GeneID:13392855"
     CDS             1231835..1233634
                     /locus_tag="LDBPK_342870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864446.1"
                     /db_xref="GeneID:13392855"
                     /db_xref="UniProtKB/TrEMBL:E9BR85"
                     /translation="MPAKKKSTKANSSKKEVLPEPATIKNGTGTVFIGGWSSYDTIES
                     VSQASRSVIAANTDADGVVAAPLPRTNVLVLPTEKADDDADSGAAQAPFVVEVADQFF
                     VEGVSRHQCAQAQALVKTWEPAPAQPTEATAPSEQIAAPAPKEEAVNPYADAASDRRY
                     TQEVLVGASYAARDVVIRGPCSIEGVAPIIVVPPQLPEKPDLDAVTLDPPADNAAAAA
                     GVSTKKKKTAKNKKKSKPKLTPEQVEELERKKAELEAQYMRQTEEAVQRAKQESDYLM
                     TFAHPDRWANVVFRHMTFAGPVQVHRAHVSFQNCRFVGITNTAMLDRPLLLVSQYCRV
                     QCTKCSFEAPQRCGIYALPSAQVGVRKCLFTGVKQDILWAAALPGVSPQNAGAAASLE
                     VDGGDDDSAGHGRPVSPTDAADDHSADHKAAGVLSFPVALGGELQEAARAALHDRSAA
                     VGILSDCAKLMVHGCDFLCLGVGVYVKGSYTVYVSHHKAAPKTPQQLAPEACDTSLDS
                     NSFHHFANAALLLDRSSRLVSIRRSYVEGSAHYGLDCQGGASSVLVRQNYFAADATVR
                     IREGAKVAMLHNDFQSIPLNDNSYGNPCLQSVY"
     gene            <1234888..>1235424
                     /locus_tag="LDBPK_342880"
                     /db_xref="GeneID:13392856"
     mRNA            <1234888..>1235424
                     /locus_tag="LDBPK_342880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864399.1"
                     /db_xref="GeneID:13392856"
     CDS             1234888..1235424
                     /locus_tag="LDBPK_342880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864447.1"
                     /db_xref="GeneID:13392856"
                     /db_xref="GOA:E9BR86"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BR86"
                     /translation="MSSDGKQQLLVVAAVTAAAATMSMFYLWRNKDFAKNLGMLGHKI
                     GAAVRKRTSSSAGEAPGSGIRPVSGIVKKGYTREQLSQYDGVKNERIFMSVKMKVYEV
                     APHFYGPGQHYHVFAGTEASRALAKADLTGKYLNQYWVNCSEEELEVLEEYVEKFNSK
                     YPIVGWYVPDDQFYKVTE"
     gene            <1239315..>1240391
                     /locus_tag="LDBPK_342890"
                     /db_xref="GeneID:13392857"
     mRNA            <1239315..>1240391
                     /locus_tag="LDBPK_342890"
                     /product="mitochondrial carrier protein-like protein"
                     /transcript_id="XM_003864400.1"
                     /db_xref="GeneID:13392857"
     CDS             1239315..1240391
                     /locus_tag="LDBPK_342890"
                     /codon_start=1
                     /product="mitochondrial carrier protein-like protein"
                     /protein_id="XP_003864448.1"
                     /db_xref="GeneID:13392857"
                     /db_xref="GOA:E9BR87"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BR87"
                     /translation="MIKADGGWKAFWRGNTINCFKAGPEFAIVFSIRRYLSSLYEDCV
                     EREKARKKILLARWKAMDERSASICCRTQETREFMKVGTEEPRARTGATGLQSIVDGT
                     RSSYRAGHPTLVSPVSPAASVTPMLTSDEVRQRERAISVEASILTPPFHRLGCISTVP
                     QLAVNCTIGALAGLGAQGILYPLEVVKTRVVVSRSHEYKGGVLEIVRVAYHKGGVMEF
                     YRGFVPNMVGIVVYRGLEMGLYSSAQQSIMMYRMQVKKMKRHEASLNSAEVGVVGMFS
                     STVAQTVSYPLNVIRTRLQTQGTNGRAKKYSGMVDCMVKMIRNKGVTSLFSGLTANYL
                     KAVPASACTFVVFEWAQRLLVDDD"
     gene            <1243234..>1245144
                     /locus_tag="LDBPK_342900"
                     /db_xref="GeneID:13392858"
     mRNA            <1243234..>1245144
                     /locus_tag="LDBPK_342900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864401.1"
                     /db_xref="GeneID:13392858"
     CDS             1243234..1245144
                     /locus_tag="LDBPK_342900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864449.1"
                     /db_xref="GeneID:13392858"
                     /db_xref="UniProtKB/TrEMBL:E9BR88"
                     /translation="MLPATDSIRMGVIQADAGAPTAAQQTDWSFSAQLDEAGRHVNRV
                     ASFDDHGTSAVSLNDASASAFVQRARGVGVAAPSAPDPQQPEEVQELPIEEVVNSTVI
                     HLDKPIEHMPLISPPELKLVGRCVTFKGDTTINGETRSFFYEGLIGTINKETVMLIHV
                     HRYTEEDFQLHKLERRHAFRADENLKSSQQGVAVAPSNCAVEGISSGGHGGTAREEIE
                     ANYSNDNLNCVRNPVVAESIQKPKDDDDNFDFDFDHHSISVTEHQEMPALLNALGETH
                     AEEATRVRNRMQQQKGTMGPIPYVTFSRSHIHRVEFGVDPQSSFYSIFRDPTKEYFDM
                     QCLRMFVRRYIIHTSQGNNPRCVPLRAFITSRCNCPDLDNDLLERTTREELAHLIKID
                     RDVKRVKKKKEQNRRNALRAYRAPQGLFRLTGILFLTHLPQQTLSIAVMEMIVTLVLL
                     IYMLTTILTAEPNIVGIYFAKVYPYIFCTVIVSVLATACTSLHAIRMSLPIRDGIFVA
                     SMRAFFTLSATACSTMAMIIIGGHASYERLLSFVESDVMAPRLCGFYSAQRCSGITIP
                     CTSIYADKRLCNCFHMQYDSYPCQSIMIAYVQRGLIPMVCLAFILFATFFFDGYLHLR
                     LFHIAHLLEGRL"
     gap             1247074..1247172
                     /estimated_length=99
     gap             1248864..1250354
                     /estimated_length=1491
     gene            <1250744..>1252048
                     /locus_tag="LDBPK_342910"
                     /db_xref="GeneID:13392859"
     mRNA            <1250744..>1252048
                     /locus_tag="LDBPK_342910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864402.1"
                     /db_xref="GeneID:13392859"
     CDS             1250744..1252048
                     /locus_tag="LDBPK_342910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864450.1"
                     /db_xref="GeneID:13392859"
                     /db_xref="UniProtKB/TrEMBL:E9BR89"
                     /translation="METPAVYCVSDAAASLTMADDWIRGLSRQRHKAMCEAGAVFPVA
                     RTGERTEDDEAQTASSYRDSIGRVPTNRLHLHMMHRRRLYKQYAMDLSVRADTHSFYQ
                     LMMWCHDHHVFLHPTVEMTRHRSAFREHVFRVKEDVDAFTPLLAIPEDLIIGFKDANT
                     ESSDPSASTDDRNNLYDAKREAEFHKLNTGENSDADICQFFFASLGMIVSDLITAKSS
                     PLTDPRHLFAKLLSKVPTLQNAPYFDEEVVFDSNETCLADVLLQMIRNYISGGPLVNK
                     VPLHELRWAVSVSLSHSTPLSIGAVRSIGIVPVVHLFPHGGTATNAYVVARTSREKSA
                     EKMATFFREKFGYDFQGQANGKWIYVVPERPLKAGEAINLQAMAPVCEKDSEAEQMWR
                     LSCGTVPESYMLSAQASARQEAATRFIVEQGEALWKASKRSL"
     gene            <1252906..>1253670
                     /locus_tag="LDBPK_342920"
                     /db_xref="GeneID:13392860"
     mRNA            <1252906..>1253670
                     /locus_tag="LDBPK_342920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864403.1"
                     /db_xref="GeneID:13392860"
     CDS             1252906..1253670
                     /locus_tag="LDBPK_342920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864451.1"
                     /db_xref="GeneID:13392860"
                     /db_xref="GOA:E9BR90"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9BR90"
                     /translation="MSHSRHSERRESRRERRKESRHSVKKHHHHRSSGGSSRHRHNVI
                     NEKTPVPRDFHCHICGKTHWTVYCDRLQQHPENYPLMDAERGCRQCGQQGHSASQCRI
                     KKYLCRDCGGMHDTRDCVFSHVGEDWYEFYDPKTRHVYYANSDESQIQWNPPTHQLDT
                     IYWYCSRCQVMISAKFRECLLCHSIRPESKQQETLTTDSGSDSSRSSSTFSNSSSSDT
                     SCISPSSSSSGSTSSSDSSSDDDERSAAGRVRDKAP"
     gene            <1254802..>1256079
                     /locus_tag="LDBPK_342930"
                     /db_xref="GeneID:13392861"
     mRNA            <1254802..>1256079
                     /locus_tag="LDBPK_342930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864404.1"
                     /db_xref="GeneID:13392861"
     CDS             1254802..1256079
                     /locus_tag="LDBPK_342930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864452.1"
                     /db_xref="GeneID:13392861"
                     /db_xref="UniProtKB/TrEMBL:E9BR91"
                     /translation="MEFVSASSPVQRRPVGVPPYRVPPLSGLYRMRYHPPTQDSTSSD
                     RLRAESGVEGSGDAVSGTRTACRATTGPPAQAGANSAAARHAAVHQQLLRASSLLDDG
                     IDLFALYSLCEVESVPCKLCTLHTQATLNTCSYRLRQSYELQKRGTDPSLHYLTRVTE
                     TRDEAAARSATESSPLIRILQQGWYVFFFPMSECGRLKDNLLVYVGEALIAGDVAECD
                     LANDGCLRPLKTTTAVALPGAVNGPLGGTTTAGASKSTSANPQYWKSLFYYVVSPVPV
                     HWGTRQSADVHLTILWRSIPAAYPEHRQRKKSVTLLYSYYCSPRAPDTFTCRAHFPSH
                     TRLRLVRSPNCDTKVQLRSDVTEHMAKVHVETMDGKPLETHRHTRDYVFVLQFLLGDD
                     TGILEESGVFAAAVVAIVFLLLLWLLLTKDLIL"
     gap             1256724..1256888
                     /estimated_length=165
     gene            <1257181..>1258947
                     /locus_tag="LDBPK_342940"
                     /db_xref="GeneID:13392862"
     mRNA            <1257181..>1258947
                     /locus_tag="LDBPK_342940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864405.1"
                     /db_xref="GeneID:13392862"
     CDS             1257181..1258947
                     /locus_tag="LDBPK_342940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864453.1"
                     /db_xref="GeneID:13392862"
                     /db_xref="UniProtKB/TrEMBL:E9BR92"
                     /translation="MSADYSRMCAAENASESHPPAYSRDALERELREGFRKQQQQVNK
                     IRQVEHMALAKGLGESAATSLKDGFYIPHKVLPPLKPEEKRLFERIDIRKWCRHAERK
                     LEDSVVAPPPTLGEDSAEHRPMQVQEHQKSTEAGAEDALSTSLSSTASSLAALEGNSS
                     EDVRQFLHQLRSTSRATSSLRDARAEVDDNIQAVEEALLRQSSPLSFEDLLDTAARLL
                     AAMERGELTEDVLVPRGADVSTEKDEGNPGSPADSADAPSSASGSTTRVLHGAVEVET
                     YTRRHLLPRAYQVVAIAHTAEWILQYTMAYLRTTVTVNQDEAFTRLALLARCVRLLGN
                     IENFSSILLSLETKCEEYAGFAALKDTAEKHLGTLLDDVEASLDSILSVPFPSRRSRL
                     LLLEGGIQKKLQRALLFLNEIDYSWTPHVHFHWAWKVQLLSTSFHRIHGRISRKHMQC
                     SMGFVDSSLYERVADTRITGRYMGASPVQPKVLRAQQVEYEKITEGLTFQQIGMSIKG
                     VASLLVGEQLCMGARYILCQSTKQFDQVWGFHMDEISTAPTQEELSATAAKIATHAKE
                     QLTARPTIERKEHSSSTFLTQM"
     gene            <1260085..>1261791
                     /locus_tag="LDBPK_342950"
                     /db_xref="GeneID:13392863"
     mRNA            <1260085..>1261791
                     /locus_tag="LDBPK_342950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864406.1"
                     /db_xref="GeneID:13392863"
     CDS             1260085..1261791
                     /locus_tag="LDBPK_342950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864454.1"
                     /db_xref="GeneID:13392863"
                     /db_xref="GOA:E9BR93"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BR93"
                     /translation="MESSAAAAAPTTCVYVLSDVDGYKYKLVMQGDLQLLTVRKVKRY
                     LQRAAGIDPAQQLLTFNSVALDDTMSGKDAGFFDGAILRLQQVSSSSAALAQCISVDG
                     ASPFHRAHGGPGCSSSFTALPRGEQDTGTRTSPRGDGSFFAETSPRLSASAATGVVGA
                     PQLISSPRALPPPLRCLSPNKLTGGAECEAYDAASCRRRGVVAGVAYSSPPELAGTTS
                     VTVSTPQVIPGRASSAPNADGDGFHVYYRELEEKVAALSLDNVRLREQLQVVARQAAE
                     ACTDGRHEEEVKRLKAAVAMAQEGVKDAERAAADRWRVKEEELVKELDLLREERRRFH
                     EESTAQEAKLQELVHSMEGEIRGLKYELHDKDEALQAARLSLAEAQSEKRSRTDVARR
                     GVDICPRGEANHPFAPAASRRARIPLHQRQHGGSSSIDELAETALEYLTQAFESATPL
                     VLEPENDTCVVPVANDLKVLVTLDRETERLYLYVTLLNHLPSSPVQRMQLYEMLLEGA
                     LLGKDMAGGSVGVSLESNLVLMSVSANLRHSGASALAATAAPFVNAAQAWTKSIDVLL
                     NS"
     gene            <1263520..>1264728
                     /locus_tag="LDBPK_342960"
                     /db_xref="GeneID:13392864"
     mRNA            <1263520..>1264728
                     /locus_tag="LDBPK_342960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864407.1"
                     /db_xref="GeneID:13392864"
     CDS             1263520..1264728
                     /locus_tag="LDBPK_342960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864455.1"
                     /db_xref="GeneID:13392864"
                     /db_xref="UniProtKB/TrEMBL:E9BR94"
                     /translation="MTAVPTALWFAGPYEWSAVPKFLKSKMLQEAEQLTLYMHDRDAY
                     RLKKAAADTASISESNRLRYGGFDRKGTKGTAIRVSPWVESERRTHAEEVLVTSSPHC
                     SEFGYRASAAAEEREMDAATPTTRSQQQQPQQQLTLLTASSPSNILAEWGQTRNAPAE
                     TASSPSLSAARERGSVVAAVSHPRFPSQPQQKDGCGSDAAPRPTAPPPLRASLQHRRN
                     CGSTVYSLSTLSETMDDKLNEALLNLEDGGNEVGEALVERREKEAFLIVTEEDLSGTR
                     ISSAEELMASASQRTGLDDGAEDHGNVLGNTPASKRWSLKRGRGEAARGRRISRSGNR
                     RAFREGGDGRRLSRGGWAKSTCGAELLQSMCDDAENAPPPQHLTRADIRRRHSNQPPQ
                     EDSQVVFFDH"
     gene            <1267384..>1268916
                     /locus_tag="LDBPK_342970"
                     /db_xref="GeneID:13392865"
     mRNA            <1267384..>1268916
                     /locus_tag="LDBPK_342970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864408.1"
                     /db_xref="GeneID:13392865"
     CDS             1267384..1268916
                     /locus_tag="LDBPK_342970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864456.1"
                     /db_xref="GeneID:13392865"
                     /db_xref="GOA:E9BR95"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BR95"
                     /translation="MFRVFSGSCMSLEDMDTVLRSNLVEHPHLLGPGADFFTESGEPV
                     RPQPGAHTFQKVFSGSALDLNAGNAEVSDEDVTATSPLGQGSRVIPPSSILNQISTEN
                     EKEKARAAKMKIHVLVVGESGYLASHVVAKLLDAGYSVRMTVPDAARQQKQIDLYGAS
                     RDVAQRLTILQADVTNSNSLRDAIRGCRYIIHCGCSSASPQAKDLVALYTKAIRALFD
                     GIRLSGKSTVKRVVLTGAASSIVHITECDPPSGLFDESNWNSVATPEDDPLPFAKLVF
                     EREAWRLRQMMGVELVVLLPSISIGPSLTDETSEAMVTIEGLANSSKYFPFCPNLSWN
                     FVDVRDVADAHVRALEVAEVRDQRIIISNECVSLPELCRMMKQLCPQLTPPTHTAWTF
                     VTLGIATVVLWNSVNLRFLWRSLGVRKRLDNRRAKEQLGVSFTPMQQTLRDCLDQMSR
                     SAKANADAEAAAAAQRTSTNGKRKAAAAPSSLRLVSPAVVLSLFTLAAAGAAVARYVK
                     RK"
     gene            <1274487..>1277690
                     /locus_tag="LDBPK_342980"
                     /db_xref="GeneID:13392866"
     mRNA            <1274487..>1277690
                     /locus_tag="LDBPK_342980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864409.1"
                     /db_xref="GeneID:13392866"
     CDS             1274487..1277690
                     /locus_tag="LDBPK_342980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864457.1"
                     /db_xref="GeneID:13392866"
                     /db_xref="UniProtKB/TrEMBL:E9BR96"
                     /translation="MWGGLKKRTHYGDVFRRWSACQGLDVLRTALYKEPRPWYIAYTL
                     HQANHLLQDHHCARLLAWSTSIVELRPILASKQEAYRYTQEMFSIFVRHHKVGQQSLY
                     EYMRLCAVGKDLSSAFDWFKYWQEAQLGAHDTLSSLSWLLRVAALSPNDERVEDMALT
                     VLELYTERFALPSADTTAKNAAATTAAASPSLTTTLRHFQPTTPVEEAELRRFFCLFQ
                     QLAPRVEANAQVRSFLETLPVSATEALADCAVTGWPTDSAHRIFPQLEQHISSGLTKV
                     CLGKSSNAPGDEPRRIGGDSLPRLRDSLLHPSFLAKLEDSAARHNAAAVVALVEDYEE
                     HVRHERERTGSGRVPAVRKRTSEGEVWRLYADPTSMAFRRRLVEEGGVTPELYHYLIA
                     ALAATQPSAALRTLTRMEEAQLRPLDVTRATVLVAVQDCAEDRLRLFQQQLEEMRLRA
                     RLDEDYDIVKVVEAYWKYDYVDFFHYRNALEKKEFYEFLLHRLGPQALQQLLLDAKAH
                     GPTATPEDLVLLDEDLCTASYRYFRAQVGRSAVERALDDISTHMPKLDMGLVGTLPHF
                     GDYCMDGDDSIAHSTAALQGLVQPYETIYVLDTSFVETSEAFLAVGAASPSLVLVPYL
                     CLLQLAESVANADRFVTFDPALQQMTRAEPFLASQRLRGLFAMISAPAASRQAGAGRR
                     TRVLHFTECICANQVDQKMLDALGLSPSSSDNDQLLLVLAMLSSLKAPKTRLVLCTDD
                     AQLVEQLECLRGSSLFGSAVDVIRTAPPEKLDLEKDLINDNPVLKGADEWDSAEAFEP
                     RLRIAADLRALSEDKEDSAVGEPQTVADSTVTGRDAVSSSHGEAAAGVEVGASSNVPM
                     KVPVTVSGGIDSPWLELLKEDEEEDAVEVARAAPASTREVASTSATAPPPLPGMSPVE
                     QERRARLMDLYETPFDVVPVGVRMEEASTVGSVFTEFDSLEPELREARAADRAAARSS
                     LSLEDSKASKRGGVKTRRRRRSVLEEEMLANRGASNKDRFQMARQLSNWSGGRVPFNL
                     RYRVVEANVRDPRNSHLRSAYKAALAKKRFSFKQKHG"
     gene            <1278252..>1278887
                     /locus_tag="LDBPK_342990"
                     /db_xref="GeneID:13392867"
     mRNA            <1278252..>1278887
                     /locus_tag="LDBPK_342990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864410.1"
                     /db_xref="GeneID:13392867"
     CDS             1278252..1278887
                     /locus_tag="LDBPK_342990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864458.1"
                     /db_xref="GeneID:13392867"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:E9BR97"
                     /translation="MAEQLGASLPTGSAAAAEGSATAAAAATANWSYVPLPSSTTFDY
                     FTERYYHQFSIRDCKKVKGNDCRILQHSNGLCVLCLDPNHELVRRCAPADAGVTVAKV
                     AFFKGRTAISPENIQVVGKKKKNALVCQNDTKLCSIVLSDGTEYTVPACVNGFVLELN
                     ATLLEQPWMVAVAPTAEGYLAIINPTSKADFSGYEKIWTATGGDAVGEDED"
     gene            <1279939..>1283412
                     /locus_tag="LDBPK_343000"
                     /db_xref="GeneID:13392868"
     mRNA            <1279939..>1283412
                     /locus_tag="LDBPK_343000"
                     /product="aminophospholipid translocase, putative"
                     /transcript_id="XM_003864411.1"
                     /db_xref="GeneID:13392868"
     CDS             1279939..1283412
                     /locus_tag="LDBPK_343000"
                     /codon_start=1
                     /product="aminophospholipid translocase, putative"
                     /protein_id="XP_003864459.1"
                     /db_xref="GeneID:13392868"
                     /db_xref="GOA:E9BR98"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9BR98"
                     /translation="MRQIRYRALHNGADEDARSRNSSTPNISTSSAHGPQLPQRHCCR
                     PRDFVFDDSLSTGAAVSVLAIPQQKKHSVRRWLREMLHLPIAPSLDNRQIPFGYFPGE
                     WSPVGYPSNAVSNRRYTLSTFLPLALLRQFQNFFNLFYLFLAFSQVIPVLKVGFIFTY
                     FSPLVMVVCLSLMKDALDEWKRFRRDRIANVEVFEKLTGGGDVVTVRSSHIRVGDLLI
                     LHQDQRVPADCVVLHTSEKSGTTFIRTDQLDGETDWKLRYPLNSTKGLGYAELGALRF
                     NVHCGAPHKDIYSFAGTLELANGQSESITMENAVWSSCVVATGTLVVAVLYTGRETRS
                     ALNSTSPRNKLGLIERELNLIAVLCFALLLILSFLLVAQQQFRGDFAVMFVRFFILLS
                     SMIPISMRVNVDVGRLWYSYDMSHDPNIPGAVARNANLPEELGRLRYLFSDKTGTLTK
                     NKMKFRVMQVGPDTVLTDRFTDQLAGALQEYFGTGNWGAGARLMLGNVSARVSVRNSK
                     QWSRDVQRVGDLIRAIVLCHNVSPVVMEEPLALGTDDETTAPGRGAAAAVPATTDMRS
                     QPTDYQASSPDEVALVKFCRSLGIVLTYRDLTTIAFTVGGGAQLHTCTIVKTFPFSSE
                     RKCMGIILRERTGSCSGGSSQETVKFYMKGADVKMASVVRQSEWLDECCQELAQMGLR
                     TLVFASRTLSEEMLGAFLQQYEAAISILGEGRAAAIEAAMKLLETDMTLTGVTGVEDE
                     LQDDVVVCLETLGMCGIKVWMLTGDKVETAITIGRSTRLIPRHCRIEYLCGMAPADIG
                     HRLHELQEEFCWGVTCGSIVPPWTLVLDGNALAYCLSHASFFADVARTAYSVIVARCS
                     PTQKAAVVTVMRDSCRDARVAAIGDGGNDVSMIQAANVGIGIEGLEGKQASMAADFSI
                     TKFSHCLRLIMWHGRNSYQRTCRLSQFIMHRGIVYSVVQTVFSVLFAGTTMSVFNGYL
                     LMGYSTVFTMAPAFALVLDEDFNESDVHEYPFLYKDLLKARSMNTRTFLQWVWASFFQ
                     GGVMMLMALQLFKSDMFQIVTIAYTSLLITELAIVGATAHLRILWRERRARFFLFLCS
                     EVVSLLMFFLAVVVLPDTFDRDFFFSWSCWWRVAVICLASIAPLMIFQMVGKYILFNP
                     RIAVSCMGCRT"
     gap             1284000..1284098
                     /estimated_length=99
     gene            <1284779..>1285219
                     /locus_tag="LDBPK_343010"
                     /db_xref="GeneID:13392869"
     mRNA            <1284779..>1285219
                     /locus_tag="LDBPK_343010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864412.1"
                     /db_xref="GeneID:13392869"
     CDS             1284779..1285219
                     /locus_tag="LDBPK_343010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864460.1"
                     /db_xref="GeneID:13392869"
                     /db_xref="UniProtKB/TrEMBL:E9BR99"
                     /translation="MFYPLYPSPPAFSLMLTLTFSSLHDLPLMCVPVRLCLRASMFFF
                     FIWACSSLSLLLPHFRPPERPRSMSWDGWQVEESQSKRRSLLWRNHRCTKRGVDLRVS
                     VQHALRWPRSRGASVFCGRISGSGAGPRVCRPHTACSSSSVLCG"
     gene            <1293643..>1295556
                     /locus_tag="LDBPK_343020"
                     /db_xref="GeneID:13392870"
     mRNA            <1293643..>1295556
                     /locus_tag="LDBPK_343020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864413.1"
                     /db_xref="GeneID:13392870"
     CDS             1293643..1295556
                     /locus_tag="LDBPK_343020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864461.1"
                     /db_xref="GeneID:13392870"
                     /db_xref="UniProtKB/TrEMBL:E9BRA0"
                     /translation="MDDLHSPLSGTFAASPHYLGGVSDSLAHLPPLYQLLSLGGVFCV
                     IHLRNNAVVTWLVVQLHSSIGTEAMWPEEYRATLRAMTFTERLCFTLYGAALAAVAVV
                     LFRVFCQDAWKIGLNAAQMFPDKKLPTIAMVVLMCVAEGIRLQQVIVQELCTPGSLAR
                     LAMHGFDGIEESEFDQRVSESNTHFVIQVELLRAYLAQACVHRVPVILLAGAYRLFRD
                     VPNKAHVALRWYMATMAGFTIAQEMLGMYIRYVWTDWSLWAMVIWPLVFLGVVNYVYG
                     LSKRAGTVVTMSSTNCVTEALRGLVTCGALWLIASLIVLAFVVSVHEELVLIWLFMSL
                     MILWTPAIIDACATDYMAFLAIGAGCMVYAMGGVSSVWASARFGALHFLWWFFPSLLY
                     NATLHLFASRYIAMTVAASWFLWSLAPPSELLKNAESAAELGLEDGHGVVHLFTARVL
                     WLRAVADFRTLPKGSWIYGLTQGDGERAFDLILHAAAAACAVCIAISFAVERRFTAEA
                     RLAWRQRDIVSATPAVLLRKMIRTVVVVGCVAASAGMWWVVRHYVLPMWTQLLPDMIS
                     KLLATVAAVTVLGNLMDMHDSMYISCMRILGLPDPLITIDGPAVASDDLVSSATSKMP
                     TEDKGVHPSRTFE"
     gene            <1296777..>1298528
                     /locus_tag="LDBPK_343030"
                     /db_xref="GeneID:13392871"
     mRNA            <1296777..>1298528
                     /locus_tag="LDBPK_343030"
                     /product="putative pyruvate/indole-pyruvate carboxylase,
                     putative"
                     /transcript_id="XM_003864414.1"
                     /db_xref="GeneID:13392871"
     CDS             1296777..1298528
                     /locus_tag="LDBPK_343030"
                     /codon_start=1
                     /product="putative pyruvate/indole-pyruvate carboxylase,
                     putative"
                     /protein_id="XP_003864462.1"
                     /db_xref="GeneID:13392871"
                     /db_xref="GOA:E9BRA1"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:E9BRA1"
                     /translation="MPFNGYTVGCHLLDRLVEAGCDHLFGVPGDFNLRFLDDVMAHPR
                     MKWVGTANELNAAYAADGYARQRGLGAVATTYGVGELSALNGIAGSFAESVPVIHIAG
                     ATSTKSQGNRELLHHSLGDGSHMHFLNISAEVCCIAVMLTPENCLTEIDRVITEVLYQ
                     KKPGYIALPMNVAEMIVPPPPAKLMRRLPEVSLESVSAFKHTVASRLHSACSPAVLTG
                     HLIHRHQCGPQVNHFLENVHIPYAPAVLGKGAVNEHLENYVGTYIAGDEPCPAKSVIE
                     SADVCISIGVQFVDTVTSIFRHKIDPLKMIDIQPFFAKVGDQVFYQVPMEMAVKAVEE
                     VAMECHANWSTEYPEPEGLRYPESPDTFDLSHVWQEISNGLQPNDVLLVDIGTSSFTS
                     ALLRLPQGCDMLCQQMWASIGYTLPAAIGAQIADESRSVVCILGDGAAQMTVQELGSA
                     ARYKLKPKYILINNDGYTIERYIRGWDSSYNDISVWNWTGLARNFCKGVEPRTCVVNS
                     VGGVEAVLREKQDNMVFVEVLVGKYEGPLRSSVPLPRKPASKEREALDFQRRESKSEG
                     SGVDAETMMMASKTLLT"
     gap             1300173..1300271
                     /estimated_length=99
     gap             1302346..1302444
                     /estimated_length=99
     gene            <1303699..>1306137
                     /locus_tag="LDBPK_343040"
                     /db_xref="GeneID:13392872"
     mRNA            <1303699..>1306137
                     /locus_tag="LDBPK_343040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864415.1"
                     /db_xref="GeneID:13392872"
     CDS             1303699..1306137
                     /locus_tag="LDBPK_343040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864463.1"
                     /db_xref="GeneID:13392872"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="UniProtKB/TrEMBL:E9BRA2"
                     /translation="MQPSTREAGAAASSVGRNGTMREYFKSREVYRGSQGIILVDAFR
                     FVYHGAPLTDWACRSQRPSPPSANGAAPSGTPYSATSPVSNQGLGLASTSRAARAHTF
                     YFLSHFHSDHYAGITNRWHSGTIYCSRPTATLTQSQLGVPASWLFPMDLGQTYIFSLS
                     TGVCLARVPETPHHPHVQSLLSPPAASSKGQAQEKTVDGMFVVRLIPANHCPGAVMFL
                     FVSPVFGTVLHTGDFRFNGSRETWEQFVRSSNGRQTYVPPLPCLIKRGEEQHASTAAP
                     PAPAYEQFIADDEALRDVAQRQLLDVLLLDNTFCAPAYKFPSQWEVTQRVIEVLRSLF
                     HRAACRAGVAVHSAGHPQHRQVRCAVLIGCYTIGKERVALALRDAFPLVRSSEQSRAR
                     DSLKGSQHHANAAEPASWRIHVSPSRYALLSSIGFFEECFEPLKASRSSENAVTARDA
                     GKDASTRPPTETAHVEDVPVLLPVLLGECNAQGAQRKRVASGLACKPEETRASAAPAV
                     RPSLAVGLDMADGAGNQSAAEGRTEEVEHLLSVFLVPMASVGYQAVAALAHADSPAVV
                     DIEDGLALNLDRYDQVLIVEPTGWCKRCVAREVSEKHTLLRVPYSEHCAFHELLEFVE
                     FVNPACVVPTVSEEGFKQYEALFVAKAPRLRSRVSNVQPITRFFSVLPVHHAEAPTGE
                     RRDDTAATVASSAARTVLDGSSVSLAGAIPVEDPSVDDAQTASTASAVVRKRARAQRH
                     AVTVAAPTSTATAVAATPSITCTLERLFQKVKRDAAHRSPERQPLEEVVAGDDDDCQV
                     VGVVQAVVEISDDD"
     gene            <1308959..>1309516
                     /locus_tag="LDBPK_343050"
                     /db_xref="GeneID:13392873"
     mRNA            <1308959..>1309516
                     /locus_tag="LDBPK_343050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864416.1"
                     /db_xref="GeneID:13392873"
     CDS             1308959..1309516
                     /locus_tag="LDBPK_343050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864464.1"
                     /db_xref="GeneID:13392873"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:E9BRA3"
                     /translation="MNGIACAASVRVTSAGPSVSGPLDHSTLAALRTPARHKASTIRI
                     ANRKKVEMFVGKRYHLPTRLRVAAPDIAAEWDHEKNPMHLYPDIVSIGYMHPVYWKCR
                     GCATSYQMSVEKRVVRGGRCPVCEDRELSRSMAFNTAAMDVGSAHAREAGIECGSAMQ
                     PLLPGEENRSLRPKRTTMLNLRTKY"
     gene            <1310717..>1312480
                     /locus_tag="LDBPK_343060"
                     /db_xref="GeneID:13387344"
     mRNA            <1310717..>1312480
                     /locus_tag="LDBPK_343060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864417.1"
                     /db_xref="GeneID:13387344"
     CDS             1310717..1312480
                     /locus_tag="LDBPK_343060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864465.1"
                     /db_xref="GeneID:13387344"
                     /db_xref="GOA:E9BRA4"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BRA4"
                     /translation="MLRYEVIKQRGTQVITLHTSSESIPATFVCGEVRLLRKKAFKGS
                     FFTPVVSTNYVLLVFPSSCAPGGGQATALSSSLDASSSGGGGVDASVSTLTLEAQSCI
                     SAFLGQMEHIPFSVADAAACSFSGCAIVVLACHSMQDVLSVLQVCTEVAGQGNDVRTS
                     SMYIKGFPCLEGAPTTVDAQVLTSYYYIPTCPMCGDRLECTISGYGSQTPLCTCAQSG
                     SASQCTCFLCSSCHLCRRFADSLEYAQQQQRQQQPTASAAIKCEACAKAGDPWICLIC
                     GYVGCSRYQAMHAKDHCVAQQHFFSMNLLTQQIWDYDGDCFVHRVVILLDSSTGTSTW
                     MQFPGRDEPMLDDVVAGESAAMAAAVGDSPEAWKAEKKSISAKYDKKLTSSHAQYAMV
                     IKSELDAKRALYESQLAREAGSGDDNEEGLEETELGRGAASTRAEELERCEYIDLAAA
                     FEPLESVMMDLGEKRRKTTALLYAVKNLKHELDTRGEETTRLEKQLESCKTALRSVIQ
                     QNVATDLRLSSSIRELKETLQDIALNAETQRRLAAQLGEQGVSRVVLVGGSGSAGKAR
                     NGAAAAGRRSNEKAPPSDAAK"
     gene            <1313948..>1315384
                     /locus_tag="LDBPK_343070"
                     /db_xref="GeneID:13387345"
     mRNA            <1313948..>1315384
                     /locus_tag="LDBPK_343070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864418.1"
                     /db_xref="GeneID:13387345"
     CDS             1313948..1315384
                     /locus_tag="LDBPK_343070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864466.1"
                     /db_xref="GeneID:13387345"
                     /db_xref="UniProtKB/TrEMBL:E9BRA5"
                     /translation="MTAHNALLRGSRDDDVDISVRRGAHADTLTVDGAAARLLSAIAS
                     YTKFAAATDVEAESSGDAAQEAAALSLMAHMQRLSLLCNAARTPETSCTSAGQGNIHK
                     CVDDWAKWLLGLESQPIVLASKVALCLPPLQACWRGGSAVDGAGSAHIDRIEEAIGSF
                     FARAARRCVTEWTTHGTPLRTLLPPLALLATYARFRWAWSRFTELGHVGGDEHLGGAE
                     GGIAVIGSADAMHRQESRYIDFLSIAGEVESCHADKLTREVLLHSLKTIDWRAGNAVP
                     AVKEVAPLVWCVFLRCRSYALHSHSQNHSSFSDFFAHEASARLVAQVLRCTVDGVRLC
                     IERQAADMHVARATQLCTCDIPCLVLLTRLWFSWIALATDAATVLLPRLERSLRKLVS
                     SAVKLRGGAETKPPSSTVAAALAENSGEVSRTEQETLFVEVAWKVAPLSMSEIASATA
                     AVPWADAFARAREVQAVLEKRTLVAPVP"
     gene            <1316127..>1316768
                     /locus_tag="LDBPK_343080"
                     /db_xref="GeneID:13387346"
     mRNA            <1316127..>1316768
                     /locus_tag="LDBPK_343080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864419.1"
                     /db_xref="GeneID:13387346"
     CDS             1316127..1316768
                     /locus_tag="LDBPK_343080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864467.1"
                     /db_xref="GeneID:13387346"
                     /db_xref="GOA:E9BRA6"
                     /db_xref="InterPro:IPR002036"
                     /db_xref="InterPro:IPR020549"
                     /db_xref="InterPro:IPR023091"
                     /db_xref="UniProtKB/TrEMBL:E9BRA6"
                     /translation="MKTFRHLTITGATPTLHRGARHVMHLLLTLERAPYDTRLSLEFV
                     SLAHMRQLNCKYKGSDRPTDVLTFTPAGEADSFVNDLLFGDFLERGDGDTGTGATLTT
                     SPTCAGAVGAEPNALTQSIIRAELIDLGSIFVSLDYMRLRCRRFPSTTLPLAPYLHAA
                     LVHATLHALGYDHKNPALLQQMVRREQQLGRQLAMIARQHPRCLPPLSMWDSI"
     gene            <1317234..>1318805
                     /locus_tag="LDBPK_343090"
                     /db_xref="GeneID:13387347"
     mRNA            <1317234..>1318805
                     /locus_tag="LDBPK_343090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864420.1"
                     /db_xref="GeneID:13387347"
     CDS             1317234..1318805
                     /locus_tag="LDBPK_343090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864468.1"
                     /db_xref="GeneID:13387347"
                     /db_xref="UniProtKB/TrEMBL:E9BRA7"
                     /translation="MEAFRSVRLTCRTTLAPSIAREENEHVLRIFNAPAQYAEREAES
                     RLHRFHGRAGFLKRQHEPAIGFNPLRFLERMSTEAMTDMDAEKMAYSMHTHATSFDQL
                     LSFLIAKLQETVQGVSWNRPQAHQEWDADLRFYGPWWLVVRSERHLRQPHGSTRSILT
                     HNTSASSTVQARRTASAVPPRDLLFTLHEGKPENQYTPLLVEQSIAAESQLIADIALR
                     LGGHTFQLNLFHLSGVFLGPDRMHVLVFDGFRRLCAGTATATTTASAIQSEFVDGEDS
                     LLSTLSLSSCHIASAGLLILLAGIVYLSKHHNCHVHSLDLSYNDLTSSSLWCLTQTLP
                     FTNIRRLSLRGNVLTSRDPSALCELLSDGCNREIEELDLSYTALSAAQTSALIDYLPR
                     LLKLRVLLLEEVAVPSAKWPAFALAVAKTHLLRVQLFAGAPSSVMAGYAKTIEEMCLR
                     NRQRAMECCGDEVLRKGMTAYFGVKNASFFQEFFQVSLLRGGLAFGETTTALPGGYGI
                     FTDNDPSLQVGDASE"
     gene            <1320090..>1320551
                     /locus_tag="LDBPK_343100"
                     /db_xref="GeneID:13387348"
     mRNA            <1320090..>1320551
                     /locus_tag="LDBPK_343100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864421.1"
                     /db_xref="GeneID:13387348"
     CDS             1320090..1320551
                     /locus_tag="LDBPK_343100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864469.1"
                     /db_xref="GeneID:13387348"
                     /db_xref="UniProtKB/TrEMBL:E9BRA8"
                     /translation="MLRRAALRLATTAHSGAGVAAAAGGAGGSGQHMNSQQRVLEINS
                     PMSLLRMCYRSIDIKVKSRHARSFLKKRLMEQWAEKCKETNPDKQRFYMDLAGSFLQA
                     LHTERNPKPGKAVNFQLSRQVAYEQKLADREKSAAARRVRRMSKEAKAQDH"
     gene            <1321846..>1323486
                     /locus_tag="LDBPK_343110"
                     /db_xref="GeneID:13387349"
     mRNA            <1321846..>1323486
                     /locus_tag="LDBPK_343110"
                     /product="cytochrome p450-like protein"
                     /transcript_id="XM_003864422.1"
                     /db_xref="GeneID:13387349"
     CDS             1321846..1323486
                     /locus_tag="LDBPK_343110"
                     /codon_start=1
                     /product="cytochrome p450-like protein"
                     /protein_id="XP_003864470.1"
                     /db_xref="GeneID:13387349"
                     /db_xref="GOA:E9BRA9"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:E9BRA9"
                     /translation="MAPTVSPVQAAAAIATVGFLAYATTRMLQALYSAPPNMPEPAIP
                     PNSEDGLVWSVVKRVLYRHFYVVRKGDPLKTLQRWCAEFDYKPFVMKIFFRPHVVLSS
                     PVDIEHVLLRADTKFYKDTGYDIVRIVVGRVGLLAVGNKAQHAIHRRILMPIFRSQNI
                     RGVANEIIRMHALRMMGGLFDLIQCGGEQDAVVNLSDHVFRMALSAIGEAAFRASRGE
                     SLRVRGHFDVMMKMSRVNYFCPYLKSSAQRNARNTLKEMCVELLDKNMQINQIGTRWC
                     VMDALIDELYVHFSMDDVLDHVVTFLFAGHDTVSHTLEFLFALLGTNTEVQERLYEAL
                     EDLMPSICTCPTVQELMECDYLVAIVKEVLRMYPAAPIIYRDAAEDVYLPGSAVVIPK
                     GMTVVITLSALQRNTHVYGDDVDVFRPERWLGEEGEALRKRCGRCGYIPFSCGKRSCI
                     GQELGYLELLVVTALLGRHLKMELVGEFPEARYNITIAVSHSVSMRITARDGIPVGEV
                     YERIANVLDLNDEDAESARNVTREAEGETSCKEAAVRG"
     gene            <1327839..>1330022
                     /locus_tag="LDBPK_343120"
                     /db_xref="GeneID:13387350"
     mRNA            <1327839..>1330022
                     /locus_tag="LDBPK_343120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864423.1"
                     /db_xref="GeneID:13387350"
     CDS             1327839..1330022
                     /locus_tag="LDBPK_343120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864471.1"
                     /db_xref="GeneID:13387350"
                     /db_xref="UniProtKB/TrEMBL:E9BRB0"
                     /translation="MQAPDMMLVHTVPIFENDLRCTLPRDPTRSQMVGKRTADLPCTS
                     PATDSAETGALTAAAWTGKDFLLPPSTGTVQPETPSLVEVEQVAWVGLRFLAVKTRQR
                     QVLLVRSGLTESASSPSSEGDDDAQFAALEGPHGRHRDSSAVCASFARVTDFCTASTA
                     GRRASIRAECSPVSVMIVAGLKRVTGVVCCGGAGLAADPARKAASSQPSQVNWQPLVK
                     EHTWNIGPFNRVAATARDDAQVCICATSLRGSVEVYAWTVHSTGGDAVPVCVHQVLMA
                     PGHFFYGIAVAAAVVPPHETAKQAAQDVSFWVMGGESAVAEDGRTALSCDAEAKYSAL
                     PALRGLDGRVIQVNSQSAERAWKDPSSDASHASLAAGSAAPRTLNSLWAAPSNGSAQA
                     SDRIAQHTAVSGGADPALWGTALSALEAVSSLRIEAPCFLPQERRGALKDDGAYMHTR
                     PGCALTKRYALLVHASAKRASGTGDGSLAMPASSPQCVDDEETVAWSSAFMSLDSPDG
                     AAALDWLAEAPTETGTPPPFCLASVAPALATDGERRASSATVVQHMHALILFTPRRIL
                     QFDVCYRRESTGDSMTRLGFEVHGTYEVHRPQRIVGLVPLPSPKAPAPLLFFYGSASS
                     IRANGVGSGEDTRSLYGQQRRRSTWAVVVEVQASLLHWLTTWSSQATAKAMLLSSSDV
                     QAHLCESELFDKVQAMVQAECARIHRHLDDRMDRLEAILQRLFRS"
     gene            <1330503..>1332125
                     /locus_tag="LDBPK_343130"
                     /db_xref="GeneID:13387351"
     mRNA            <1330503..>1332125
                     /locus_tag="LDBPK_343130"
                     /product="ATPase-like protein"
                     /transcript_id="XM_003864424.1"
                     /db_xref="GeneID:13387351"
     CDS             1330503..1332125
                     /locus_tag="LDBPK_343130"
                     /codon_start=1
                     /product="ATPase-like protein"
                     /protein_id="XP_003864472.1"
                     /db_xref="GeneID:13387351"
                     /db_xref="GOA:E9BRB1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BRB1"
                     /translation="MRASHTRDVMEAKKVEETRALACHARDLLRYQLVAAAHRPLCID
                     EQRELRIALQQLLPCLSIIRSYEQEYTYLSTYELAISAVGQVLGSLAAAETTVNAEDR
                     QLVKAKHDAEHHRKEDNPKASATLSTPAAPLEAAAAFVPASCARQAAATASSVTWKNT
                     YGCDDAILALRQATTLPLQHPSLFTGPRQPWRRLLLYGPPGTGKTRLAAATAAEYGAM
                     LLSVSAADLLSKWVGESEKQVRQAFMQAAASAPRCVLFFDEVDALCSARGGHGESELA
                     RRLKTELLLHLQMDLPAVTVLAATNLPWELDAAFLRRFDRFIHVSLPSDAVKRRLLGS
                     ELRGVAHTITDDALDRIVAQTDRFSVVDVRRLLSHAVMAPVTEWLRLTQATVDDRSSD
                     SRESAEAGSDGIDVLCTAASTAPAPLLHRPSPPRTHTELKHRSVYCLADTEVLGAGVR
                     SVTSGTESTPSPCSSPRPSSPVGPERCPSKHSSSLPHCRHMHCRLPGNHANDVPFVEY
                     RHFESALQVITATTSAEEIARYATWRCRSAGV"
     gene            <1332733..>1333368
                     /locus_tag="LDBPK_343140"
                     /db_xref="GeneID:13387352"
     mRNA            <1332733..>1333368
                     /locus_tag="LDBPK_343140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864425.1"
                     /db_xref="GeneID:13387352"
     CDS             1332733..1333368
                     /locus_tag="LDBPK_343140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864473.1"
                     /db_xref="GeneID:13387352"
                     /db_xref="GOA:E9BRB2"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:E9BRB2"
                     /translation="MRLFAHVPQPGLFIHYGKIVRAGHIMTIRVMLQAMDQGHLLVNN
                     VDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVDVLLQTKIFTHFSPEKMINQPQS
                     LEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKGVGAALYDRFCHFVRVARGVDESR
                     VDANGAPLNEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI"
     gene            <1334183..>1334635
                     /locus_tag="LDBPK_343150"
                     /db_xref="GeneID:13387353"
     mRNA            <1334183..>1334635
                     /locus_tag="LDBPK_343150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864426.1"
                     /db_xref="GeneID:13387353"
     CDS             1334183..1334635
                     /locus_tag="LDBPK_343150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864474.1"
                     /db_xref="GeneID:13387353"
                     /db_xref="UniProtKB/TrEMBL:E9BRB3"
                     /translation="MALSSSGSAALGNRIARATAAAPQWTVQQRCFRQLMKSLRGAYF
                     HDRSKLFWARHRVLVEFYKYSRVEEEKDVLLLVGIGNEIATFVAEYMKVDVGAIMEHN
                     EKIQSLPVAKAKKYREEYLLHEKQHESWCKQKIRLMMDRRPPPPYPFS"
     gene            <1335777..>1336682
                     /locus_tag="LDBPK_343160"
                     /db_xref="GeneID:13387354"
     mRNA            <1335777..>1336682
                     /locus_tag="LDBPK_343160"
                     /product="aldose 1-epimerase-like protein"
                     /transcript_id="XM_003864427.1"
                     /db_xref="GeneID:13387354"
     CDS             1335777..1336682
                     /locus_tag="LDBPK_343160"
                     /codon_start=1
                     /product="aldose 1-epimerase-like protein"
                     /protein_id="XP_003864475.1"
                     /db_xref="GeneID:13387354"
                     /db_xref="GOA:E9BRB4"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:E9BRB4"
                     /translation="MVAFTPDSRGRNCVTIHSEDGSSVTVYEQGAHVSSWKTKDGKEH
                     LYLSPTAIFADRTALRGGVPLIFPQFGAYGPLQPSHGFARIRSWSIEDAQSGRASFSL
                     RVPLCELLPEDSSLTDSPQSAVNLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHT
                     YFAVSDVSKTVVSGVNRSPFVDNCKARGNPNTQPSPPEQLWIIRGEHDRVYPDQACAI
                     VLQDLGTKTTLQISSPNLSDVCLWNPGESKCAAMKDMPPDGYKHFVCVEHGKMLKKVV
                     VPPCSSWTGTQEIAIIAESPRESNI"
     gene            <1343247..>1345436
                     /locus_tag="LDBPK_343170"
                     /db_xref="GeneID:13387355"
     mRNA            <1343247..>1345436
                     /locus_tag="LDBPK_343170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864428.1"
                     /db_xref="GeneID:13387355"
     CDS             1343247..1345436
                     /locus_tag="LDBPK_343170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864476.1"
                     /db_xref="GeneID:13387355"
                     /db_xref="UniProtKB/TrEMBL:E9BRB5"
                     /translation="MYFCCNDTFLTSFALDTLLSKLVAEVCEKRPVSSRQVLELMREA
                     LETQKMQQWYYSETVRSFNDAVNSLSRRGFPLQMACPLYFRIPQEDGGVHELFRYGSE
                     IAVTPNNYDHFELMLKRYQAVVNGELSQEGYYDAVRHLLPISAHCNLLNSSYTPIINF
                     LQECLLNPRSQWAIQSSSVWDQLGVTYAVPFAGRLFAVDPTKPVTALVPFEDANRYVE
                     MASERCRTLSSLLTTGASLNVVRRAAAAAASPPSASPGRAAVISAPPTITVASSAATS
                     EEARPWEAFEAIGLRPEVFGDMSPAEIEFWKYILRLRQSPSQIHDISFHLEFGPHHMD
                     LKENGRFIPVTRLNLNQFIQAVVAKQDEVHRYINEVALGTPTHSNTSRGAGGGGEGSA
                     GPPPPPVAASNTAATQLTPPPQQDIKIPAQPPPRTVGSEAASAVGHTQSEAHRGNEAH
                     LTLRDVDSTVVRSIMELRSQYQLGRLTKTELNARQLRFCLPCHDGVYNLIPNGRHIQV
                     ATGNIGIFLQYVEEERKRVEALSGGKAEDSAARACSHSAEATTGGIRSLSVMQRDRER
                     VYGTVEEADADVGYWTDKNLLDIWTYECTTECLLKSSMSPEEIVRQTQLQWDTNFLSS
                     KDCPYANASEDGCVILPKDVKTYLRLLRRRLQSIRLAILDAGKYPQEPSEWDVAEWDV
                     VTPSTPPVELEIPASVHALTSTPENLNMFSPTHNTGGLLAPSQSLNL"
     gene            <1348609..>1349571
                     /locus_tag="LDBPK_343180"
                     /db_xref="GeneID:13387356"
     mRNA            <1348609..>1349571
                     /locus_tag="LDBPK_343180"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864429.1"
                     /db_xref="GeneID:13387356"
     CDS             1348609..1349571
                     /locus_tag="LDBPK_343180"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864477.1"
                     /db_xref="GeneID:13387356"
                     /db_xref="GOA:E9BRB6"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:E9BRB6"
                     /translation="MNEAAPFCVAPQTWQGGLARYPASQSHVWNNNIILQPEDIDVEV
                     FNAMCQVENQYNKNEISVEDFEMLQLTFCLFTVNQSCYDLIPNGREIRVTQANAFEFF
                     QRVHAAYDNLKQRPALNQPTQSSPRPRLRTSGARLRLTGQDTDSLEWIRWTAQNDPAA
                     LAFHPDEPLRWAVVPRGRDFMIRVQPEGENTFVDPNHLTLFLDMLAVLLTEIERAISV
                     FGYYPPNCVSAAPVECADEYSICTSHSTRATRLPFPSQRVNSRGRSALHKFAMSVTAA
                     AAATEQNRRTVCRASSADLENQRALFSPTHDTGGLLAPFQEWNV"
     gene            <1351522..>1351836
                     /locus_tag="LDBPK_343190"
                     /db_xref="GeneID:13387357"
     mRNA            <1351522..>1351836
                     /locus_tag="LDBPK_343190"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864430.1"
                     /db_xref="GeneID:13387357"
     CDS             1351522..1351836
                     /locus_tag="LDBPK_343190"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864478.1"
                     /db_xref="GeneID:13387357"
                     /db_xref="UniProtKB/TrEMBL:E9BRB7"
                     /translation="MHRRSGGGALHIPEAHTHTRVERRATSEQHQPWREGQVGRWKRR
                     RVKQRSGSGERYGADAYSRKRSMHPFYCSFSLPFVCGRSAKGGRHEAANKKYPQRPLT
                     TA"
     gene            <1354190..>1355737
                     /locus_tag="LDBPK_343200"
                     /db_xref="GeneID:13387358"
     mRNA            <1354190..>1355737
                     /locus_tag="LDBPK_343200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864431.1"
                     /db_xref="GeneID:13387358"
     CDS             1354190..1355737
                     /locus_tag="LDBPK_343200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864479.1"
                     /db_xref="GeneID:13387358"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:E9BRB8"
                     /translation="MTILLSWMGPMTVAASVAYAYAANHPSAAQLESGSAYPFPLTTL
                     RYCGLLFLVYASGTMPRNPFFPSFVFRSNIFPLLYKMYCSYTIGYRVLRPFMHKPVAY
                     PHSDYRIGIRCIDAGSPLRLKPVTTGTAPFLTRFYARAGGVVDAALWTGSVVRGVAVV
                     PIPIFGDNYAYLIVSMQTHKVAAVDPADPETVLRIMESLRAQLRVPLQLTEVLTTHKH
                     WDHAGGNELLATLSKKEVPVPPHEEVGVDCAPNMPLLHPKLRFIGSEEDAPLCCDVLV
                     SDASPVFEIMGGAAKVQAMAAPGHTKGSLVFVVGSAEEGVLTATPARVAVFTGDSLFC
                     GGCGAPFETVSVAQIMKARATFLEDPRMRTQPGTGQEVAEEDVLLYVGHEYTERLLAE
                     VVTLMTRVTTRSRTPSDPRGKEYLRAVADALDGVKMLRTESDGLTDAARMGCEADRQK
                     PQVLLPSCTVPSSLAVEKVVNPLLTVDDEVLTALKEAEKHGPMDSNEVERAIYCSDRR
                     RLPASAT"
     gene            <1357003..>1359273
                     /locus_tag="LDBPK_343210"
                     /db_xref="GeneID:13387359"
     mRNA            <1357003..>1359273
                     /locus_tag="LDBPK_343210"
                     /product="cleavage and polyadenylation specificity factor,
                     putative"
                     /transcript_id="XM_003864432.1"
                     /db_xref="GeneID:13387359"
     CDS             1357003..1359273
                     /locus_tag="LDBPK_343210"
                     /codon_start=1
                     /product="cleavage and polyadenylation specificity factor,
                     putative"
                     /protein_id="XP_003864480.1"
                     /db_xref="GeneID:13387359"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="UniProtKB/TrEMBL:E9BRB9"
                     /translation="MAAPFLPEAESTAAPAALRSNAPDEVEVLPIGSGGEVGRSCVVV
                     RYKGRGVMLDCGNHPAKSGLDSLPFFDSIKCDEIDVVLITHFHLDHCGALPYFCNQTS
                     FKGRIFMTSATKAFYKMVMNDFLRIGAGASDLVTSEWLQSTIDRIETVEYHEEVTVNG
                     ISFQPFNAGHVLGAAMFMVDIAGMRALYTGDFSRVPDRHLLGAEVPPYSPDILIAEST
                     NGIRELESREEREHLFTSSVHDVVRRGGRCLVPVFALGRAQELLLILEEFWDAHKELQ
                     NIPIYYASSLAQRCMKLYQTFVSAMNDRVKQQHANHHNPFVFKYIHSLMDTKSFEDNG
                     PCVVLASPGMLQSGISLELFERWCGDRRNGIIMAGYCVDGTIAKDVLAKPKEVAKPDG
                     KVLPLRMSTIEAVSFSAHSDGRQTRDFIQSLTKVKHTILVHGNPGAMGQLKSKLLQDF
                     RDRNMSVYTTMNQESIRIPFVQERTAKVMGKLANMSLREGEFVSGVMLVSGQYQYSIV
                     HPDDVPVFTDLSVNRIQQAMVLPLPRHRSPLEVLQVLQRYFAQSKLFEEVVPRPSSHE
                     EAAEAHQAAAERGEARDPDSTLLFVSKDVTVDVQKSSQAQTTLTITWYSSHYNDLLAD
                     VTCIALAKLAEEPHEAEAEDVLVPADVSGQDRIFRVKCFHYMISQFYPSVKTNLSSGS
                     CSVSLADGQVANIVDCIEVYLERSAGKKDVDYDAPEVQKLKQILKRIYLTLFPIPADN
                     GWCDCGMIHGEEPVAE"
     gene            <1362570..>1364477
                     /locus_tag="LDBPK_343220"
                     /db_xref="GeneID:13387360"
     mRNA            <1362570..>1364477
                     /locus_tag="LDBPK_343220"
                     /product="DNA topoisomerase IB, large subunit"
                     /transcript_id="XM_003864433.1"
                     /db_xref="GeneID:13387360"
     CDS             1362570..1364477
                     /locus_tag="LDBPK_343220"
                     /codon_start=1
                     /product="DNA topoisomerase IB, large subunit"
                     /protein_id="XP_003864481.1"
                     /db_xref="GeneID:13387360"
                     /db_xref="GOA:E9BRC0"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="UniProtKB/TrEMBL:E9BRC0"
                     /translation="MKVENSKMGVKREQSHSNEDEEINEEDLNWWEQENLRIAMKGER
                     RWETLAHNGVLFPPEYEPHGIPIFYDGREFKMTPEEEEVATMFAVMKEHDYYRMEVFR
                     RNFFESWREILDKRQHPIRRLELCDFEPIYQWHLVQREKKLSRTKEEKKAIKEKQDAE
                     AEPYRYCVWDGRREQVANFRVEPPGLFRGRGKHPLMGKLKVRVQPEDITINIGETAEV
                     PVPPAGHKWAAVQHDHTVTWLAMWRDSVAGNMKYVMLAPSSSVKGQSDMVKFEKARKL
                     KDKVDDIRASYMEDFKSNDLHVAQRAVAMYFIDRLALRVGNEKGEDEADTVGCCSLRV
                     EHIQLMPDNIVRFDFLGKDSIRYQNDVAVLPEVYALLQRFTRRKSPGTDIFDQLNPTQ
                     LNDHLKSFMDGLSAKVFRTYNASITLDRWFKEKPVDPKWSTADKLAYFNKANTEVAIL
                     CNHQKSVSKNFKLQMMQLTTKSEYTRKTIELLEKAEVTAKKKSVEEAAKEFLEEQDRM
                     QREWLESYGTEEQKKEFEEIVAKRAAPRVRSEKKKSTSGAKKAESASGKKRAAKKKKS
                     AKKGGKVLSKKAASKSSKKAPKKLKEEDEDDVPLVSVAAKTKKTAGVKRQRANKVVSD
                     DDDVPLAALRV"
     gene            <1366131..>1369760
                     /locus_tag="LDBPK_343230"
                     /db_xref="GeneID:13387361"
     mRNA            <1366131..>1369760
                     /locus_tag="LDBPK_343230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864434.1"
                     /db_xref="GeneID:13387361"
     CDS             1366131..1369760
                     /locus_tag="LDBPK_343230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864482.1"
                     /db_xref="GeneID:13387361"
                     /db_xref="UniProtKB/TrEMBL:E9BRC1"
                     /translation="MSSVTLSSAVRANPRLVSSSLDKMTCNAQGITVVDIYPSVLSAL
                     TAKGAPVSVAESVRVFVQAARCSRRAQRLSTEDNGDRVQHRPAASPGPAVTTGVRSSN
                     SPVEKEKSAANEDSYLNCFNVGIAMSLHTVLLSRNRISSLLGIVQFRHCVCLSLLGNR
                     IRTIEDCEPLAMLPDLQYLSLEYNPVTRLPHYRAHLLRICSWPQELSPSTCRLRKLDS
                     AAVTTAELKHAALCLLRESALLPELLYRMQLLAFLVDIENRQRLHRELRLRGHVLHDL
                     GEQASVELLLERGVAHALSRVGVAGAAHMARQLVRDHRRLCATSPSPSENSSAHLARA
                     QAPHAHTHTGVTEEKGVCEAVDEKSGRAADVRTTRVTNFASDTIDPSEIASVSTVSSC
                     SLLSSTSSSGASVLQSLSHLLASKELDWSRRSLRRADATEAAATCKAWSKDAFRQTIV
                     SLDIRLCTLLLRISSVSGQTLTSHDVDRLCGVWLHAVSHCTPAEAAEVNATGPRRLVV
                     EFGAVATERKSTKRRGALEGQVAMKQREASLSTVVTGRTPMGTVAPVETSIKDALEKE
                     SRSLSSTSPSPPQLEHRDAHDVTRDCTQISMTSLSSDAALLPRDAVPLPTTRSRADPT
                     QPSMPNRETTGSTDARAALHAIAQDSASLKASARAETIYAFEALARGRCKRRAFQQWC
                     SALRQRWQTRIATAYIREKVSDGAAANIRSPSWGGLLAQVTYVERKRGFFTVWRRRAQ
                     LHRDCRTQRLRRVWNLLREKAAASSILRVRCEQASALVAQHMRDAAFRTWKSKAEKRA
                     SERCTAARRRIFAEEPHSTDAFLALASLTPVMAHLAARTPSPRITVLRRTLADALTPR
                     RKTCTTAVEAPSVTSVPDEVLSDTPAAAAASPAIMSVWRHVAALERRACSPHASASVS
                     DKEVQHGRYVCSSSDEEAGLSAVGASPTPGVSVSSDTATPFVGVTSPEWVQQPQPLCG
                     AARAGALLSGPSGELSPPPAMRMLFSPEPRGQNAGLSGCSHTVDAATVQPRALQPSPA
                     QLPLARAHARSSAVVLVPPVKSTSYRFYGSSKPSRLPSTAAARRAIVQSSSTTEVEAA
                     PGDVDSPYPAADVEALVERARQLEIDRDHLIETLRSLHLSQQKHCTQERPQPLHAAST
                     ADSVLLPSSAPPAPSFTVAEQLEGRCASLEKEVHRLEKFVVALQDERHQLLDNMKRSM
                     FRYRA"
     gene            <1370382..>1371809
                     /locus_tag="LDBPK_343240"
                     /db_xref="GeneID:13387362"
     mRNA            <1370382..>1371809
                     /locus_tag="LDBPK_343240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864435.1"
                     /db_xref="GeneID:13387362"
     CDS             1370382..1371809
                     /locus_tag="LDBPK_343240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864483.1"
                     /db_xref="GeneID:13387362"
                     /db_xref="GOA:E9BRC2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:E9BRC2"
                     /translation="MFGGGEEYFQDPPEIDRDTLGRYATFCARLRAIEKPGKRTITEA
                     ATLAREVGDTLLDYELVVGALFRHIKTWTGQKQLACWYILDKLCKEDRDKYGYTAGKY
                     ILEVGRDHIPYEDADLAGKYESLVEHWENVFPRHVVDALWIAKKERLWAVDHPTEVKQ
                     QQQAEEEEWAREEEVMQDEDGLNDFGQPCIDYLQGHCSWGDSCRLYHPPGEEGSLPAE
                     CRMGDWKCSACGVINRHFRRRCSNCVREKPQYKKGRVPSAEDKLLCTPDPAVTAAFHQ
                     QFGYNPYMPAEAVAHFKLRLEGVSAEEYRKERAAAYRVRILGKAPTNPVEERCKATKH
                     FPDIDMEPDEEYEVGTDGLVAKRQRTESLVPANASPNSAIALLAQLVMERGILDPTVP
                     QIFGELSRYIRQAAGDPAMELNETQAEVLLSACKLGFTAWNANKGAVPSVATFFKAVR
                     HNESKLGLSSEQAEQLESMASMFLA"
     gene            <1373005..>1374081
                     /locus_tag="LDBPK_343250"
                     /db_xref="GeneID:13387363"
     mRNA            <1373005..>1374081
                     /locus_tag="LDBPK_343250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864436.1"
                     /db_xref="GeneID:13387363"
     CDS             1373005..1374081
                     /locus_tag="LDBPK_343250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864484.1"
                     /db_xref="GeneID:13387363"
                     /db_xref="GOA:E9BRC3"
                     /db_xref="InterPro:IPR003198"
                     /db_xref="UniProtKB/TrEMBL:E9BRC3"
                     /translation="MTSVILVNPIAFGPNPKTKDNALIQSMHVGNAKADMDRSQVCAL
                     VTELESFFKVSCGVRTVVVHQSREPKLCRVTLEERGESVCVADSLSVHNVVDGNGVIQ
                     RHLVVFYPMNPFRQGELARKQLVNHITKAAEENAAIELIDLRPFEEEGKYLEGSGSLI
                     FSPGGRYVYTAVSQRSHPDVLEALCRPENLNIPPENRFLLRCKNAIPHTNLLGWCGTG
                     ICAWAISSLVFDVEEEEVAFYDHLSAVYSCVLELSEAEVEKFAASALEVPVQPQSGSA
                     GNAHYVLVISETALAGLTSKNRELLIDWYGEENVHTFYGEVLERRCGTSLPSCIAASY
                     TLGSRPPLPSQPSTIELLRLGANS"
     gene            <1376391..>1377104
                     /locus_tag="LDBPK_343260"
                     /db_xref="GeneID:13387364"
     mRNA            <1376391..>1377104
                     /locus_tag="LDBPK_343260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864437.1"
                     /db_xref="GeneID:13387364"
     CDS             1376391..1377104
                     /locus_tag="LDBPK_343260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864485.1"
                     /db_xref="GeneID:13387364"
                     /db_xref="UniProtKB/TrEMBL:E9BRC4"
                     /translation="MPTQEEPPQQTRLLLRRTLSTRFPLILGEMRLPSMAPSPSIPYD
                     VLLRRYVDLRDAARDLISADPRQSLNVHDTYLRLCQAHGYPLDNHYLGYLARYATVQA
                     AITSGSARDVVDKVRHLDFLPTYVGKLAWMPIFVTLSDCVLLHSLSLSGQQLDSDLVL
                     LLAHSLPPLVQLACLDVSGNPIGCTGVQALIRLVKSSPSLTQCNIHGSASIAPLTRRL
                     EAALARNQERTSPTAVASQ"
     gene            <1377875..>1379152
                     /locus_tag="LDBPK_343270"
                     /db_xref="GeneID:13387365"
     mRNA            <1377875..>1379152
                     /locus_tag="LDBPK_343270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864438.1"
                     /db_xref="GeneID:13387365"
     CDS             1377875..1379152
                     /locus_tag="LDBPK_343270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864486.1"
                     /db_xref="GeneID:13387365"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BRC5"
                     /translation="MLARLAWPTSRLAIAATGSSVPLCRGRLAGVAAALGAPSFVSAA
                     LVSQRWASSDGIGNNASTGDSSTGTAAIADLSEKELVELNKEAAEAFEKGEFSSAIEA
                     WEKVAQSKQHTPNSPTLMSCLNNLACAYGEMGDSIRKLKLLERSRDLVQAVYGTDHPQ
                     YGMVLYNMACAKEEMGLYADMKQLLEQSLALHEKRFNPRHAKVGRVLLLLAAAHGHLG
                     EHEAQLRTAERAYEIVKRHCGPEHVQTTIAMMTLGRAYGAAGQVERQLQLAQAAYSIQ
                     ERRLGPMSPQLAMTLLEVAEAHRVNGDFYNQKALLEQAVELQQRAFGQQHTQLIDTYI
                     ALGDACGQLENPKSQAQYYLEALKIARQRFQGRHIAIGKAAVSAARAYLSHGNKAKAQ
                     ALLDEALSIVKRNVSPEHPLSKQLAKVAKEVAR"
     gene            <1380062..>1381441
                     /locus_tag="LDBPK_343280"
                     /db_xref="GeneID:13387366"
     mRNA            <1380062..>1381441
                     /locus_tag="LDBPK_343280"
                     /product="ruvb-like 1 DNA helicase, putative"
                     /transcript_id="XM_003864439.1"
                     /db_xref="GeneID:13387366"
     CDS             1380062..1381441
                     /locus_tag="LDBPK_343280"
                     /codon_start=1
                     /product="ruvb-like 1 DNA helicase, putative"
                     /protein_id="XP_003864487.1"
                     /db_xref="GeneID:13387366"
                     /db_xref="GOA:E9BRC6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BRC6"
                     /translation="MSGIKIEEVISTTKKERVAAHSHVKGLGLNPDGTTKHIADGFVG
                     QEKAREAAGIAVELIRSKKMAGRALLFAGPPGTGKTALALGIAKELGPKVPFCPMVGS
                     EVYSAEVKKTEVLMENFRRAIGLRIKENKEVYEGEVTELRAEETDNPLGGYGKSISHV
                     IITLKSQKGSKLLKLDAAIYESLEKEKVSVGDVIYIEASSGAVKRVGRSDAYIGDHDL
                     EADEYVPIPKGDVHKKKEVIQDVTLHDLDMANAKPSQGQDALSIVSSMMRHKKTEVTE
                     KLRQEINKVVNKYIDQGVAELVPGVLFIDEVHMLDIECFTYLNKALESTLAPVVIFAT
                     NRGSCRIRGTEIRAPHGMPTDLLDRLLIIRTMNYDVSEITSIVEIRAHVEGVKISEAA
                     LTKLGIIGESTSLRFVAQLLTPALIIAETNGREMIEEEDVDLVAELFKDGKASARLLQ
                     DHAEEYVYQ"
     gene            <1382533..>1383519
                     /locus_tag="LDBPK_343290"
                     /db_xref="GeneID:13387367"
     mRNA            <1382533..>1383519
                     /locus_tag="LDBPK_343290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864440.1"
                     /db_xref="GeneID:13387367"
     CDS             1382533..1383519
                     /locus_tag="LDBPK_343290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864488.1"
                     /db_xref="GeneID:13387367"
                     /db_xref="UniProtKB/TrEMBL:E9BRC7"
                     /translation="MLEFVVTTRPSRRIVCRNEATYIYFWPYLFCREVPGALQLCRWA
                     ARRGAAVHGAVRLQPSETPNAAHRCYLKVTRPVAAGRTLISLPAALSLSVSSPESRKG
                     TFIGRYSALENFAQLLARELHNPRSPHRAYLEFLHDLHNSGTEEVSDALLAGLHYERA
                     AVLVDQLDAMYAGNSLQARGAANAPFLDKEQLTSASQRVEWVRLQQLQRRLEQGVPHF
                     AAKSTAWALSMALSRAMEDDAEGLSLYPLIDFCAHSFEPSAYVCVGEERVAAVRPVRW
                     ADSSGEPLVHVVTRRLLRAGEKVTLRWHWRPVKTTEDAEFWQMRFGYVPLSE"
     gene            <1384477..>1387341
                     /locus_tag="LDBPK_343300"
                     /db_xref="GeneID:13387368"
     mRNA            <1384477..>1387341
                     /locus_tag="LDBPK_343300"
                     /product="peroxisome biosynthesis protein-like protein"
                     /transcript_id="XM_003864441.1"
                     /db_xref="GeneID:13387368"
     CDS             1384477..1387341
                     /locus_tag="LDBPK_343300"
                     /codon_start=1
                     /product="peroxisome biosynthesis protein-like protein"
                     /protein_id="XP_003864489.1"
                     /db_xref="GeneID:13387368"
                     /db_xref="GOA:E9BRC8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:E9BRC8"
                     /translation="MQQSSFEVAVDRSSQHSFVTVSQHYLDTVLRPLYTGRLPLAVPL
                     RITGRSGHDIYVGCLTNRPHTRSKFVLVFPLALCYDHGLKEGELVECVPLPNTPRATK
                     VLVAPLTVDDSEVVEQNALRVENLLLRQVQVVFPSMIISVSIFPGVPAKVMVTAIECG
                     DAEEKLRSGCATMHEGTHFVIATRVRQEQTDRGADGAAAPPLWAFVRGRPARAAADSG
                     AERNDTAAVRVRRVTADKYHWKNGMALGVLDCATLATLNREEVTPGFLRAHLKQMTVV
                     VVDNADGEAAGAADEEGVCVVDSLAQATNLLLTPHGLDLSAPTAGKAGDATRNDSAGV
                     VRPVLSSPALLPLSAVALDAVTQVHGRVAEELQQHLVAALHQSSVPRFANLHQNNVLL
                     CGGKGFGKSTVVRAVLDTLSDVHTVTLECGKVKSFSADIARALMECVLCKPAVLVLEN
                     FDSIAPAQQEGHAEAMTAMTRATLEATLTRFCYQFSVRPQGAVVVLATCSSRDAVHET
                     LRSAYCFRRVLTLEALNRASRTVLTEQLFPYAPREDVAAAAALMDNYTPFDVKQLAAR
                     MRAKLAAEPALSLRECAAACVTFFTPLAHTGINFLKGDKVSWESIGGLEEAKKTLYNT
                     LVLPIKHPQLFARLPLKTRSGILLYGPSGCGKTFIVESIVNAENLHCIVINGPEVFGK
                     YIGQSEQKIRDVFERAQAAAPCVVFFDEFDSVAPQRGADDSGVTDRVVNQLLCYLDGV
                     EGRKDVFVVAASSRPDLIDAALLRPGRLDKAVVCPVPSEDDRVAILRSLLSKASAHFS
                     DEELRQVARRTVNWTPADLSAMVSSASTLMSMRFVERLTKQAAGVSGSIAGCGTAPDD
                     EDGFVIAGLGHGVTREKVGDTLKPLCLATHGGAEAAVSDTAALAAELMSIDDLWASVA
                     TTRPSLSEKDIQKHERIHALFSKGKSAPPPKPPGSRLVTR"
     gene            complement(1387613..1387619)
                     /locus_tag="LDBPK_34tRNA6"
                     /db_xref="GeneID:13387369"
     tRNA            complement(1387613..1387619)
                     /locus_tag="LDBPK_34tRNA6"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:13387369"
     gene            <1388856..>1394693
                     /locus_tag="LDBPK_343310"
                     /db_xref="GeneID:13387470"
     mRNA            <1388856..>1394693
                     /locus_tag="LDBPK_343310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864442.1"
                     /db_xref="GeneID:13387470"
     CDS             1388856..1394693
                     /locus_tag="LDBPK_343310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864490.1"
                     /db_xref="GeneID:13387470"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BRC9"
                     /translation="MLAMSHEAQLLGLLWCEATQPSCNAATLTHNIGVAFRYLETPWE
                     DKAKQIIGALITLNAGPMHTTIWAALFQQLRETDKPTIKVYVLKQFANVCWTVPTNQA
                     ANAFRAFALEVRPLLEDVNVVVNATFQRSFAVTIKCFSSFAEKALSNELFSALYRSLK
                     EWKRPDSIRAASTVIAAMANDNPSCPSPEQLLRQARYDLDCFSFAVLLDTLVSFEVVP
                     GRILDERRIAAFRDELSEILDSILAAPQANEKVVPPCVSAYRRLKQVCDSWEPVAAEA
                     FALFIVDALAQAKVSKLLVCPFLHFLHETSCVWSRSSRTVWQLTGSSDPFVRADAYAA
                     LSTTVYVIDAPEQRLVLSDLLERLRFSIADNCSGTTVAILKFIKKLLLHARFPPSAEG
                     LYLSKLLHLCRRHGKGLYHDLPAQLELLNVFLCASIAPEALVVFALELFSVSPDRAVA
                     KKAFSVLRHFSTEVFLDSCVQNSGEYSDDANYFEAAIQMRRDEPFEDELLPFLRLHRT
                     KGLSACIYARLCTLAENETKSSMTCIVVCDAVKEISRTSAAAIFDDIFFKHTTLCLLS
                     QLLVLQDPMPSDAYVSLVQACASCLQGNDLHIREDAHLLSMLVQHSWSAIVTCTTALF
                     STFLPAPVLPSCRFFRTDSLSQACRHLILMCRDIALSNDVAFYDSMLHEMLTSNVSLF
                     ISCVSFLRHAPIFIAELVESMSCWLECCTALSTCVPKSVLRLLTVVLEAAEEELPVVR
                     QRAGATRHSLLSVARMCNGMVKQAIEMDLLLCCPEICNFLLFFISKDADDEVFLFREL
                     IANNWTLIVDLFSFCERIAICLHNDNDAGALAAVLNLLLALCDSVYFPQVTSVISRGS
                     FEKLLQVLRKTADFSQKRQCMCFVSHILAAFDENNSLEEKVSGCFSACSTDVDFFGRI
                     DRLVQLWNASDTQTQARFKTALTSSSSIERLVCAAAVDVQYIPKAVEAALGASADREV
                     LDVLLLIVTEAEPETLSPLLFAINDEVFGENDDLVKRIICSYRWGWYGGQQTMQMLSS
                     GAWRNLSTPLSQYLKLLFGFRQLERTERDVRCERYLGTLDSHESSFSFWQLLSGEASV
                     EILQHEMEKGFSLLRLTDVLQLRGTSALRTIRSLFDQGISIVTAFGPSNIRRLAILFS
                     TGVDCELSSWDSLSLLRLLQVLVSTARDSPVESELSEWLQLSCWLLFDRVCLSSNTKE
                     TTEAASGQRPAQTFAAAELATVFVQLSNLFLCSTAQTLDDVAISVIRYAMRNATLFTL
                     GDVSERLFWMVVSHCIYEVWAAITAETVVSVRDPEIIAFLCRAHVKVGLPRSVQRELH
                     ALFTPQLLSYGNTDSELEEDSLRCILWLVGKFASGDVHSSVRGRTSSLQYAPKLTGNA
                     DIGPPPSGRRALKCLPAAESNFSRNDARSLAAAVRHVTAQLAERVLANTTGATPSNVL
                     DALGALCNLARPAPAESGPAAPLLSNAVSLEQVYRIARDFTEAFPILSADASLDPPGH
                     CLDHLLGQLPRERRAHSIPDALCLNSIAWLLSKLLQSWGRENAPDSALPAQLPCVLAS
                     YLPYLLRCDLPSYLCLLQSLRYLSVCGATPEVEAVYDVALPRLMEDLVDVRWGAGVAG
                     CWYEMLVDCLSHVPGAVPDGGRQLSRRIWEGLWRGAGSVELSCNQRFTERVQRSLQHV
                     IHGLALKSAQWELCRLVVLDSGLQSRRVALTPVAASAFSIESNAEAFFSLARELQERT
                     WRSQLLQTQSAFVHHGALALDADSSRSLLFEFEKAVAPVRESPDERGEFAIGEEAPCI
                     IAECVRDSLFSATDAVLAALNHFDFADIIQRRAVLHELAKMMARSDATTPSWAEVYFD
                     VLYERAAWHDEGLWVACALAAAAVGQTELCWSKTVLASLIPASSISWKRELMRRIGQR
                     AKISGAQREARRFFADASERLSALQGPPLPWKRELLAAALSVFSS"
     gene            <1395384..>1396058
                     /locus_tag="LDBPK_343320"
                     /db_xref="GeneID:13387370"
     mRNA            <1395384..>1396058
                     /locus_tag="LDBPK_343320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864443.1"
                     /db_xref="GeneID:13387370"
     CDS             1395384..1396058
                     /locus_tag="LDBPK_343320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864491.1"
                     /db_xref="GeneID:13387370"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="UniProtKB/TrEMBL:E9BRD0"
                     /translation="MSVTPKHSPSAETAADVQNRSAAPLPEADATSLGLIWTRAGIVA
                     LVAVFSWITISYCSHVYFDRDSAFHNALECSERVLKQHEKSNWLLNGTLLGSTRLGRL
                     VLWDADLDIGVLVPSPSSFDAASAALDEECFGHRSIVKRGALNSDLRIWRKCTSRICA
                     EFYETMLVSGTAKTGEGQSKESDLFPLKSCTVSGVHAKCPNNAPFYLAQAYGQDWLTI
                     PLIKLF"
     gene            <1397015..>1398241
                     /locus_tag="LDBPK_343330"
                     /db_xref="GeneID:13387371"
     mRNA            <1397015..>1398241
                     /locus_tag="LDBPK_343330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864444.1"
                     /db_xref="GeneID:13387371"
     CDS             1397015..1398241
                     /locus_tag="LDBPK_343330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864492.1"
                     /db_xref="GeneID:13387371"
                     /db_xref="GOA:E9BRD1"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:E9BRD1"
                     /translation="MSGNDLLPLWIGTPQRGVTQDDASDPYTSKVGGQAVYFRLGAST
                     AEQQSAGALSKYFQCPQCKSTAHVSLLCQVYAPLEVYDRVLYILTCAACTRRSRAAAS
                     FHESVPVPALTTSTSKKSGLAAAAARSHTSFCYALRSQNFSREYFAELQEQLRAEVQR
                     ATENEEKAEDDAPLFGGGDDDWGDDADDWGTEEGPVKEARPSPAAPLDDASDTNDALE
                     KTPKELPAFPLASRGMTVPLKGALYTSGVPLDLYEEPPPKQKKELSIEEQLAAAKSMY
                     GSSAALDTSGFEEDDEAPEDTCVREYMEHMERTPSQCVRWCPGGTPLRTSTIPIGVNG
                     SSLPPPCPVCGAARQFEMQLTAPVVYYLTKDIGEAKNTALHFSNVLVYTCSSNCYNTN
                     SNLPYLPEYVVVEDEL"
     gene            <1398810..>1399835
                     /locus_tag="LDBPK_343340"
                     /db_xref="GeneID:13387372"
     mRNA            <1398810..>1399835
                     /locus_tag="LDBPK_343340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864445.1"
                     /db_xref="GeneID:13387372"
     CDS             1398810..1399835
                     /locus_tag="LDBPK_343340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864493.1"
                     /db_xref="GeneID:13387372"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9BRD2"
                     /translation="MSFEDVILRNDVAGVRAFFNAVAKNAVNAVNGSGYVPLYFACMK
                     PSVSPEVIKELVQLGAAVDGRGTDGETPLYISVYNHRLDVAKYLIARKADVNAVNGPH
                     RETALHVAARCGFADILSFLLSAGADLNMRNARQETPLYVAAQAGRHDTVYLLLEADA
                     NAALANEDDKTPLHIASEKEYKHVVVLFKAARADLKHAKSLADTEWRLRPEPMMSSDQ
                     MLDKAAADQQFAAAVRRRSLAGAPAPDTKPMEVVEIKVPEPQVRRQNPLTGESYGPCR
                     SLEEVGYDSPPPIPKELQNRPPARLSRIGGTSMVVGTGTEEGGREPIRIDSIGGDGVE
                     YYAPPNK"
     gene            <1401507..>1404329
                     /locus_tag="LDBPK_343350"
                     /db_xref="GeneID:13387373"
     mRNA            <1401507..>1404329
                     /locus_tag="LDBPK_343350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864446.1"
                     /db_xref="GeneID:13387373"
     CDS             1401507..1404329
                     /locus_tag="LDBPK_343350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864494.1"
                     /db_xref="GeneID:13387373"
                     /db_xref="UniProtKB/TrEMBL:E9BRD3"
                     /translation="MPAVTLAQQCRFRHVLRCACLIVLLGLSLGSSPTLVTAQDEPAR
                     DGIAPLPEGAQQAEFELAMPVPVAEYVDPVGPSERPREAVVEVSVEVPLDDGAVAEHD
                     VSDAPHADAEEQRVIEEARMAEASLEAAETRRDVQAEREEDRRLEENERTAAEAQSPS
                     EEAAAQKAVETQRSVEAAMEEEPFPSTVRVSAEENGAQPSGSGAFHSEDLAQEAAVHH
                     DEQLPPPADSVMEVEPSSSTGAATLDTHLPTKEKGNKHMAEGTKRAEAQIAAEAQQAD
                     TAPHLEEMPKAAEASAAEEAKQLGETRVVQELQKKEQVRIAEEAARQAEEAARQAEAA
                     LQAEEAQKDEKERLAEERRKGEEARLAREAQRADAQRAEEEARRAETRRKAEEKRQVD
                     AAEAQRRLNTERKPVLAKIDEERVRFRTAASDLITQQEVEKSSAARRDRAVATELQKS
                     MEKKLEALQQDLVTLGRVSVTLRGRVSALLHSSTLTQVQEDAQALDEVVVKAGETLDS
                     IREAADSLADAARAAVGNQKDAPATTAEKITLLAKQKMALETARDAAIQHFLERLQAI
                     DSQLVEAAEQTETEETAVAGPAEAAEGLATPPLSPVAPAGVEAPQEVVSLPSEAPRPV
                     GTSTHAPTPSAPRAEPRVNSPKHAEESHSRYRGELSETPANRGGEEGYSESSYEAYHR
                     EGGAPYKVKRHMEIAGTVVVITIAATVQTLRWCRSGCRCGEEEDEETSEDVTPELQAR
                     ETSLASPQKSPPQSGGPLQQRPQASPPSTLRPRGANAGPDRNGMELPSRWESGNIPPP
                     SQRGTPSASSEQMRLPAEEGDILSPTPVLRHHPDAFPLGAPVPGRPGVTRRPPHGTPP
                     LDTARAPPPPGTTSPFTPSRNEALGISLTPTQRQLPLPGGQFGGPSSPPLSGHPSMAG
                     TPLQMHRRRSNGDDFELRNPFLSRWS"
     gene            <1405113..>1407725
                     /locus_tag="LDBPK_343360"
                     /db_xref="GeneID:13387374"
     mRNA            <1405113..>1407725
                     /locus_tag="LDBPK_343360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864447.1"
                     /db_xref="GeneID:13387374"
     CDS             1405113..1407725
                     /locus_tag="LDBPK_343360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864495.1"
                     /db_xref="GeneID:13387374"
                     /db_xref="UniProtKB/TrEMBL:E9BRD4"
                     /translation="MPSEDESSWRLLFGIALSHGELLRAGRLSHDGWMVFLSSAQLIG
                     PATGVFPVLLDQLWQRQSLSEGARQAGVNEHDPGPASVSSRAFSLSVGSSRMSLISRD
                     FQRSGNITTAPSSSMPRPSSAAHEGESIGFSGFVDMMKVICVRIFQTQRFTRLREGHG
                     NFDEGEGESALRALRESAEDHVLLTESVKYTAATFLRPFISRCVIHASSQMRLHPARN
                     GWALHVNRLVAHVVGALLHTAILPLFRKYAVAGRLSEAGYRAFIRDAFPVLDAVKETC
                     AVAIFYHGGFPDIRPLVKGLQPLAASVSPELATVVSEPTLGFTDFIEAMLMLTVVVYS
                     DEVRYPAQRPITAKVWSFFEEHVCGRALRGAAMCSDPYVTGRYATVPPGLVAVYPAVA
                     PRLQCPCLFVEVINFQGDNVTGGAVQPPAAQASNKGPPSSLFLTEVTVAETELSLCSP
                     WDCGANSDVALQAAATFFATEWSLLERNRCVPLFGRSRASVSHAIMICGAAVEAAPTR
                     CPEILQVPLPDSLQQPTLYQCAVEAAAATAVDGVFEEGAVCILFTPFRSLTVELAVSD
                     DDAATRDKDGEPATQTGSWGCADVIATDTPLVQVVPPRLLAPLHTLFVSQTPARSGDD
                     PAASAPPRISLSAVCELCRQLQWCATSYKQQHDLPSLCAQAWTKYGDFQRILHSTVSR
                     HGNTSSVGGALSSFTEQAALLSFTDLIGCLATVLFLEQGGRLSDVPDVPRRLEFALSS
                     FPSTFTSATGTASRVPDAGLRSPDIYSIPYNAFRDVPYLTALERKSKQSKEAQGRRTA
                     LIASLREHHALQIPTPVTLPPLPEDRPCAMRLVSQYGAANPTTVFHAVMRDGAEAIKA
                     HFLQQELAIPEMPE"
     gene            <1408562..>1410397
                     /locus_tag="LDBPK_343370"
                     /db_xref="GeneID:13387375"
     mRNA            <1408562..>1410397
                     /locus_tag="LDBPK_343370"
                     /product="phosphatidylinositol 4-kinase, putative"
                     /transcript_id="XM_003864448.1"
                     /db_xref="GeneID:13387375"
     CDS             1408562..1410397
                     /locus_tag="LDBPK_343370"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase, putative"
                     /protein_id="XP_003864496.1"
                     /db_xref="GeneID:13387375"
                     /db_xref="GOA:E9BRD5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:E9BRD5"
                     /translation="MGGIPKRRAEAQRRSMLKNLQLISFTDQSAEEQEMCVRQLYDTD
                     ISTLEECLLQVTHVCITHPNPNAQELLHNFMLWLAGRSLNIALRLAWTVDAVSAFYSS
                     TGFAGRLKHIHDKLESYAINQGQPAVPSDSTSGGDGSRTSSDPEEGLGDVDASVVQRK
                     EVRLKLYNDERTFVTTLTNLSNTLRFFPDRNYRKDELRRGLRVLNQRLESMRLVHPLC
                     TSSESVQWIVNISVEDCTVFSSRERAPCLIRYEVIVDDTATMQDPTVTRLRQPDGRFR
                     VRADSDEIFVPAPPPGSEPRAAPLVEASGSGAVEDASPEALQCLHAVFGESKKARMAR
                     VRKSSPWGAHPNWSMNAMIVKAGDDLRQEELALQLIHTFRCIWQEAGLTVRVKPYAAL
                     PTHRDCGLLEVIEDSASMDSIKKATRVSSIYNYYLKAYDGEDSVLYRKAQQNFVESMA
                     GYSIISYILQIKDRHNGNLMIRRDGSLVHIDFGFLFVTSPGGLNFESAPFKLSQELID
                     VMGGASSDAFNYFRILVYEALAAARERCEDILALVSILTPNNAMPCFGADPGAVVRQL
                     RGRFRDDLLSEADYAVYAKELIVNSADNWRTRRYDQFQSLQNGIL"
     gene            <1411908..>1413074
                     /locus_tag="LDBPK_343380"
                     /db_xref="GeneID:13387376"
     mRNA            <1411908..>1413074
                     /locus_tag="LDBPK_343380"
                     /product="adenosine kinase-like protein"
                     /transcript_id="XM_003864449.1"
                     /db_xref="GeneID:13387376"
     CDS             1411908..1413074
                     /locus_tag="LDBPK_343380"
                     /codon_start=1
                     /product="adenosine kinase-like protein"
                     /protein_id="XP_003864497.1"
                     /db_xref="GeneID:13387376"
                     /db_xref="GOA:E9BRD6"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9BRD6"
                     /translation="MGLETLSNGTSPAPISVVCFGHPLLDMMATVENDFLREHNVEPG
                     SVTLAAPEQLVLFSKLLDEFKDQVDYVPGGAAMNTARVLAWMLPDAHIAYVGALGKDR
                     FAEILKSALTKAGVEQLFEECEDKPTGTCAGLVVQKDRTLLANLGAAVTLSLTHIQTD
                     AVQSAIEKASLYYAEGFFLNTASSPNNLLYVAHHAHLHGKLFCFNLNAPYISIAFESR
                     LHVLLPHVDILFGSDEDLLTYASVRWPHDFDLSTLGTVMHANSRRHEAFVRCLARISM
                     LPRANSARPRLVVGTCGPHDTYVACGDHVRSYPVPPMAQEEMVDVNGAGDAFVAGFLA
                     QYIVNRDESTSVVVGHASAQNCIRHNGAVVSGAPPALTRRISGTTEPVMTANSA"
     gene            <1417106..>1417627
                     /locus_tag="LDBPK_343390"
                     /db_xref="GeneID:13387377"
     mRNA            <1417106..>1417627
                     /locus_tag="LDBPK_343390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864450.1"
                     /db_xref="GeneID:13387377"
     CDS             1417106..1417627
                     /locus_tag="LDBPK_343390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864498.1"
                     /db_xref="GeneID:13387377"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:E9BRD7"
                     /translation="MCAAKHTIRELRNVAESPYRAQVLSWYRRCLRAAFTAPWSSDED
                     ALYVLEETRRLFHQNQGIRDLERIERKLREVEMRYEMALHYNIPYPRPFNKMQGSMQE
                     SGVPYAAYLDSAYDHMVNPHIGVIAEGSANLGIMGGLEKSSQYFEDSTGEADVDGRAN
                     PYDTEAEPPSTVR"
     gene            <1418947..>1420659
                     /locus_tag="LDBPK_343400"
                     /db_xref="GeneID:13387378"
     mRNA            <1418947..>1420659
                     /locus_tag="LDBPK_343400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864451.1"
                     /db_xref="GeneID:13387378"
     CDS             1418947..1420659
                     /locus_tag="LDBPK_343400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864499.1"
                     /db_xref="GeneID:13387378"
                     /db_xref="GOA:E9BRD8"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:E9BRD8"
                     /translation="MDSALHAFRMHGASFYHWTSYVVYVIYSCLFFACEVIAGVLEIP
                     TDAPQYDALTHQANCATTYEEWLPIASTLDDMDGFQKWRTDEASTYFSFEGVMRTIEE
                     LLELRSVGSAEALLDNLQKHVHRSLYGISHRRLYLYKTGTKTVIHSYNSLVCFLLGRV
                     GEAARADRRMAVRTREVLSEMSRVYGSTALLLQGGVLASSAHFGVAKALYDAGLLPPV
                     VYGSGSGALVATLVCCSTDLASLFHSSSGSNSIAEANALLGTPTADSRWKRFHRLLHT
                     GEVCDPVALADFLQRSIGDVTFAEAFARTGRVLNIPFVSASPVMPRRNADVDVQLLNY
                     LTSPDVLVRSAVLCAICPAAAVHPASSSSYGPAGGAAPPTRTLLARTRLTSAIVAYEP
                     PVVHQSYACSWGDHVGYGVLDPVQRMRGLFCIRFCVVSDASVRGYLWQLLHQSAYRDG
                     LRHRTRMWDWARYTFALCVLGLAHVFLRLLAWMGYDAIAAPSPTSMWTFFEDDVGENM
                     RMHPISSVWSYLRLCYSPTTANMQVLVLEGERQVWPRLEQLRMSISVEQVLAAMLKRL
                     PTYR"
     gene            <1421747..>1423282
                     /locus_tag="LDBPK_343410"
                     /db_xref="GeneID:13387379"
     mRNA            <1421747..>1423282
                     /locus_tag="LDBPK_343410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864452.1"
                     /db_xref="GeneID:13387379"
     CDS             1421747..1423282
                     /locus_tag="LDBPK_343410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864500.1"
                     /db_xref="GeneID:13387379"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BRD9"
                     /translation="MRLPKALAVAALCFALCVCTASVGGHQVALISDIHYDPLYGTSR
                     ALKCTSDSSPMYGMQGCDSSLQLMARTLADVSAQNPSLVLYTGDWQRHKFANSSLAPA
                     AIFKDMSERFHNVTVDGSLGAVAFSGAMGNNDVVPDYYYSLEDTVSEEELAHRVAAMR
                     GAALLSDAEASVMRNCGYYTHMMDSVHVIVLHTLLWAHELQPPLPSNLSDPCNQFSFL
                     RSELAKVRAANKRAIIMGHIPPGLNTYNVLKRGFGSAAGDMFWKEQYEATYNSIIREY
                     KDLLVVQLFGHTHMFKLLTMPRNDVLGIVVPSISPIFGNHPSYLMANFSETWELEDAQ
                     SRYTIGEGVFHSGLSAKEVLSLNAGLHSVSDVRAAITLLATNDTMWDRFLTVFCGGEK
                     RSQVFPHRKCDKQCRYIIVCSMLENNHTYIQRCVANYSLLPGPSQDTRTTVFMTAGIV
                     LFSLFVMGASVAMLLMIRSGQTTLSWSNMKSAIWWKSLVSKQGSQTTPVLENELGDRR
                     TVV"
     gene            <1425869..>1426357
                     /locus_tag="LDBPK_343420"
                     /db_xref="GeneID:13387380"
     mRNA            <1425869..>1426357
                     /locus_tag="LDBPK_343420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864453.1"
                     /db_xref="GeneID:13387380"
     CDS             1425869..1426357
                     /locus_tag="LDBPK_343420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864501.1"
                     /db_xref="GeneID:13387380"
                     /db_xref="UniProtKB/TrEMBL:E9BRE0"
                     /translation="MSSLRKLVPATAIAVAAMALPAAATTTTAAPVPVNLRLNIITAV
                     LILGVSIVLALVYTLWRLLPRIRSGELSFSKLEFDWRAELLNQTPKKEKARRAAEKAR
                     REEEMASGCDRDNNEGRVQYAPTQPRVEVGEGDAAAARSQRNGQRHGEADESVAVTVP
                     RE"
     gene            <1429989..>1430516
                     /locus_tag="LDBPK_343430"
                     /db_xref="GeneID:13387381"
     mRNA            <1429989..>1430516
                     /locus_tag="LDBPK_343430"
                     /product="hypothetical protein, pseudogene"
                     /transcript_id="XM_003864454.1"
                     /db_xref="GeneID:13387381"
     CDS             1429989..1430516
                     /locus_tag="LDBPK_343430"
                     /codon_start=1
                     /product="hypothetical protein, pseudogene"
                     /protein_id="XP_003864502.1"
                     /db_xref="GeneID:13387381"
                     /db_xref="UniProtKB/TrEMBL:E9BRE1"
                     /translation="MPSPSVAFCLRQLHRCPCTLPLLPLPLFPSTCRDFLALPLPTTI
                     SSLIYASRQNHSSRYLFSHAYLITMSSLRKLVPATAIAVAAMALPAAATTTMTRSPMY
                     ADDGVNMIPVMMVVGVSIVLALVYTLWRLLPRIRSGELSSSKLGSKWRAELLNQTPKK
                     EKARFEDDCSSADMV"
     gene            <1434534..>1435013
                     /locus_tag="LDBPK_343440"
                     /db_xref="GeneID:13387382"
     mRNA            <1434534..>1435013
                     /locus_tag="LDBPK_343440"
                     /product="60S ribosomal protein L21, putative"
                     /transcript_id="XM_003864455.1"
                     /db_xref="GeneID:13387382"
     CDS             1434534..1435013
                     /locus_tag="LDBPK_343440"
                     /codon_start=1
                     /product="60S ribosomal protein L21, putative"
                     /protein_id="XP_003864503.1"
                     /db_xref="GeneID:13387382"
                     /db_xref="GOA:E9BRE2"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="UniProtKB/TrEMBL:E9BRE2"
                     /translation="MVHSYGYKSGTRHLFAKKFRKHGAPSVSTILTNIKVGDYVDVVA
                     DSAVREGMPHKYYHGRTGIVWNVTPRGVGVIINKPVRTRTLRKRICVRFEHVRKSRCQ
                     EAFKAKEHQFQAYLAAKKAGKALPPLKKSSRMGGIVRPKNVEVLARRVADYEAMVPY"
     gene            <1436374..>1438287
                     /locus_tag="LDBPK_343450"
                     /db_xref="GeneID:13387383"
     mRNA            <1436374..>1438287
                     /locus_tag="LDBPK_343450"
                     /product="transmembrane/endomembrane-like protein"
                     /transcript_id="XM_003864456.1"
                     /db_xref="GeneID:13387383"
     CDS             1436374..1438287
                     /locus_tag="LDBPK_343450"
                     /codon_start=1
                     /product="transmembrane/endomembrane-like protein"
                     /protein_id="XP_003864504.1"
                     /db_xref="GeneID:13387383"
                     /db_xref="GOA:E9BRE3"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:E9BRE3"
                     /translation="MRLGKQVPGSARHMRAGRAPILVAALVLLCATVFASAGITGYST
                     GTIISPQANAYRSRRTLSPMDYYKLPVCQPSDEVMKARREHPLIGDILTGNRLVPTMF
                     EFRVGEDVKCATLCDASFTVKAVRRANYMINNDYYVRMFLDNKPLVSASPHEGSNAYL
                     LGYPLGAQNDVEKTQVKTNIIHNHLDFTIRIKNRAISQFTGEEVVGFKVVARSLAEVG
                     TCTATAFQHSSRPYILPSYRDGKDLKVPFTYSVTWERSNEEYPIEHRIGEDTQRRGHK
                     IAALYGVLLTMLTGVVVAFVMLRTVRKDLAVYLDEELDEREIREESGWKLVRGDVFRP
                     PQQAAALATAVGAGCQIAATMLSSVFLCAIHVVDSTHRGTFLSTVIALFLIGHVVSGF
                     VTTRLLKLFGMATWKSAMCCMAAFPAALGGGVMLLNLIHWAKHSTAAIPFLTVVGIIL
                     SWLLISLPFGCYGIYWGFKMDTLAVTARVSSIPRLIPEDADSMTLYYVLAGSLVPFIA
                     CCVEIPFALNAFWREEPMYLYGFLTFFSIALVVLCAEVGIVVTYFTLRGEDYRWWWRS
                     YSALATSGIHLFAYSILFLKRSLQIRALSSIILFLGYMLGASIMFGMALGSIGFIGSF
                     WLVQKMYASIKAE"
     gene            <1442168..>1444000
                     /locus_tag="LDBPK_343460"
                     /db_xref="GeneID:13387384"
     mRNA            <1442168..>1444000
                     /locus_tag="LDBPK_343460"
                     /product="vacuolar ATP synthase catalytic subunit A,
                     putative"
                     /transcript_id="XM_003864457.1"
                     /db_xref="GeneID:13387384"
     CDS             1442168..1444000
                     /locus_tag="LDBPK_343460"
                     /codon_start=1
                     /product="vacuolar ATP synthase catalytic subunit A,
                     putative"
                     /protein_id="XP_003864505.1"
                     /db_xref="GeneID:13387384"
                     /db_xref="GOA:E9BRE4"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005725"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022878"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BRE4"
                     /translation="MARDQHGFESEQQMGSVKAVSGPVVIAENMSGSAMYELVQVGSF
                     RLVGEIIRLEGDTATIQVYEETDGLTVGDPVYCTGKPLSLELGPGIMSEIFDGIQRPL
                     DTIYQMVQNVFIPKGVQVRALNAQRQWDFTPSVKVGDIVTGGDVLGFVAENSLMNNHS
                     IMVPPNMQGRVVSVQPGGNYTLDDEVVEIECNGKRKSLRLMQRWPVRTPRPVALKESG
                     NHPLLTGQRVLDALFPSVQGGTCSIPGAFGCGKTVISQALSKYSNSDCVIYVGCGERG
                     NEMAEVLMEFPTLTTVIDGREESIMKRTCLVANTSNMPVAAREASIYTGITLAEYYRD
                     MGKHIAMMADSTSRWAEALREISGRLAEMPADGGYPAYLSARLASFYERAGLVTCIGG
                     PKRQGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLEKRLAQRKHFPSVNWLISYS
                     KYLNALEPFFNTFDSDYMRLRAVVSEILQREEELQEIVQLVGKDSLSESDKIILEVAK
                     VIREEFLQQNAFTPYDKFCPLYKTCWMLRNIVTFYEEAQRVVAESAGDHKITWNYIRE
                     KIPTIYTGLTEMKFRDPIEGEEANTDYFKKQNEEIISSFNSLLQ"
     gene            <1445976..>1446584
                     /locus_tag="LDBPK_343470"
                     /db_xref="GeneID:13387385"
     mRNA            <1445976..>1446584
                     /locus_tag="LDBPK_343470"
                     /product="50S ribosomal protein L13-like protein"
                     /transcript_id="XM_003864458.1"
                     /db_xref="GeneID:13387385"
     CDS             1445976..1446584
                     /locus_tag="LDBPK_343470"
                     /codon_start=1
                     /product="50S ribosomal protein L13-like protein"
                     /protein_id="XP_003864506.1"
                     /db_xref="GeneID:13387385"
                     /db_xref="GOA:E9BRE5"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:E9BRE5"
                     /translation="MLRATFILGAPFKSVLRRHKYHPEGLPLYNDLSKQWLCREGERW
                     WLLDARGQQLPHVAKIAAHYMTGQHRPDFTPGMMTGDHVVITNIKDAVMTGDNWIRVP
                     ITWQTAYPGGKYRVRLSEMYERDPCMVMWWYLKDEVNRHFVRKLKTRTAPLEKAWLYE
                     DSVHPHAEKNPRPLVWTDTATMGWRYKDPTFQRRWSPNQFMS"
     gene            <1447581..>1451705
                     /locus_tag="LDBPK_343480"
                     /db_xref="GeneID:13387386"
     mRNA            <1447581..>1451705
                     /locus_tag="LDBPK_343480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864459.1"
                     /db_xref="GeneID:13387386"
     CDS             1447581..1451705
                     /locus_tag="LDBPK_343480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864507.1"
                     /db_xref="GeneID:13387386"
                     /db_xref="UniProtKB/TrEMBL:E9BRE6"
                     /translation="MRGTRLWRLRVSLAVRNGARATQAESLGRRWADLDAARPANLTG
                     PATELLRETIAHLQESAPALKSSSASLPAAASSSLSTSPPLLSTRESAQHIWRSLRRQ
                     RVPWQDALALLPWQLQAMTPAQRQFLSSQAARTPARVASLALAAWDMHEDAALVQQYR
                     SLKRSAYMVDYARLVSAALRERPSLPNGLLPVPYGVVEHGYALGLCSPQDAKIALALS
                     KHMTLLGREALTREAEECLVLRHAALEGLAGHWQAALGIVQHSRAVRLSAREGMKRYV
                     RSLLTRQGGVPLTTDAPLARSCDSSVSKHSDAQAGPRNEKAAPAEFAAEAPVRREDTS
                     ANWVDALCAFLSKEPHTQTYPGARHVLESLPPEVMGNRTYLLLASTVLHCCARRMFAG
                     TLTRRVASYVANANWAMALALTCAAQYYDVAAPLIPLATKASSGGTTGVLDVPPELRA
                     YVAAVRHSQQEERPAAAETSSLTVTEAAALTYPEALAHALTATSPATWRTLLLSCPHA
                     GPPTRLRYFLLAACGEARDATLFERTSVSRCAEDRIECCTFQSCAVSRLICAAAEPRN
                     QQYFFKVIPASARAHHFERSPLINAPTRELGPGLGTGQRIPAAAAATTEAAQALSNSA
                     AGAPAESALMAVSVTAARARLQTWRRQTVTTPEECTQLLADVSLYLRATHRVEGAVIS
                     AHQQPRLTEDVFLKAVAALAASGVLQLAPPERFHWPLAVLKTARLLRVQVDASLMAAT
                     ARTIPSMFVDRTGLALPSILGAHTLLGDWKAGLQLCTRLLRKQQDGEIEVDADTPRVG
                     KPQTHRFTAPPPTLLEAMAQVGYASPAAVAVRHWQTLEASSASTLASLHSERSCALPL
                     LLLELQQFHDERQLCEEVRHLCAGRRRGSPQQKLNALSRRRMLLGAAFCLLDNEAALR
                     RVLRAAGKERARSADVDTHGLQRLLRVVQPTDAAQVLAAEAREGRCAHEHWLCEVMSR
                     SDVAADAAGELARLRPFSATLSALWFFKQAAAAQDAAGCLKGLVRLAERASECPYPDG
                     LLLSLLRLLRLFLSHGGLLSASVVTREMAEGKGPAKLPRSTVLALACKLFNRMQEMQR
                     LSLPLKAARRVLRRASDAHLPDAHAVAGDTDAVCPGKSPAAPCAVWALLGVLHSTASS
                     VLQVPVPASFTSSLLSRVVETNRAADWWTALLFFQSIRHPTMQERALLVRALRHCGGA
                     ATPILLSNRRFLRDCPEQVVIWADEASGQSKWSQSLTLLEHAQEVERRTTASAAEADQ
                     DASDSMEPARAPASPLSPAVVAIIRGWNADERLRCGELLRRQGFIATGSSKNGTPLDD
                     ARVTKMANPRAQRQAEAILQLLKEKPSAAVPFINAPPRLDAHHPGVRAARRNDE"
     gene            <1452411..>1453787
                     /locus_tag="LDBPK_343490"
                     /db_xref="GeneID:13387387"
     mRNA            <1452411..>1453787
                     /locus_tag="LDBPK_343490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864460.1"
                     /db_xref="GeneID:13387387"
     CDS             1452411..1453787
                     /locus_tag="LDBPK_343490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864508.1"
                     /db_xref="GeneID:13387387"
                     /db_xref="GOA:E9BRE7"
                     /db_xref="InterPro:IPR009286"
                     /db_xref="UniProtKB/TrEMBL:E9BRE7"
                     /translation="MDASFIVFLGAGKCNVVVDLPMCFVPSSLSAASHPTGAAAQRAA
                     LRIRDTAVKECSECYRALEAYAGGRRVVPLPADLYAAIASVVPAKYHALMHNASEATL
                     VPNFTSDPAQLLQMDMAASDAAGRVADYTVEVKPKSAWQPPQVVGIVADGVAHWIEEV
                     KHRHCRYAQMLRYKEVRDVAEGAPGSVASAAPHDSVRSAKMGSGPYCPNYLFRPALSS
                     REGLQRLMHNPQNNLKVVSYHASRKGTHTGDPKTLTVEELNGIADAIDASRVLAPLAH
                     LQLYGCAPASADASPEEAQSRSVPVLDAHLLYHWSVAQNKENVQWIVVDTDPETLCSC
                     MSITDGDACKRPSRASPRYVAPTLDYAKCLDRFYVSTTAKDVSLMIAVSCRKSQPVAP
                     ASECAVLTNILPEVGGGCFVRRGADVYRIGVVDLDSKTHKSLAHYYMHDKVIVNAFVA
                     RGSNMGNE"
     gene            <1455165..>1455716
                     /locus_tag="LDBPK_343500"
                     /db_xref="GeneID:13387388"
     mRNA            <1455165..>1455716
                     /locus_tag="LDBPK_343500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864461.1"
                     /db_xref="GeneID:13387388"
     CDS             1455165..1455716
                     /locus_tag="LDBPK_343500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864509.1"
                     /db_xref="GeneID:13387388"
                     /db_xref="UniProtKB/TrEMBL:E9BRE8"
                     /translation="MAHGAEECIMAAPGCVYLTPEQEEQLVDRLYTQSLLHKEATMAE
                     LDARYYPVAASQAISQEMLQKSVQRQVDVEMERRQQRRKEMDAMAVAEATGHANGSRV
                     AASKKTMTLEQTDVSVRRLYDDTLARKKARKAESERLYAFHPEDLKSAKLSKAALQES
                     VNRMSKPKKTEFTMAEVNKIYGL"
     gene            <1456559..>1457467
                     /locus_tag="LDBPK_343510"
                     /db_xref="GeneID:13387389"
     mRNA            <1456559..>1457467
                     /locus_tag="LDBPK_343510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864462.1"
                     /db_xref="GeneID:13387389"
     CDS             1456559..1457467
                     /locus_tag="LDBPK_343510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864510.1"
                     /db_xref="GeneID:13387389"
                     /db_xref="InterPro:IPR007511"
                     /db_xref="UniProtKB/TrEMBL:E9BRE9"
                     /translation="MSEEKRTTSAAPEAKYNAYAEAADPARYRVADALLFTCAEHGKA
                     CVLCVTAGKNGRNGRTAAVGATIFWLTCPNLNAIIARFEGHRCVRAVSAAMEQQPCLC
                     DWHVQSHDVYASRARELLSPAQWCFFEAHFLSDDQPSLHKYGNAAVSHAAGMKCLHAL
                     VAQTLAGVANPVGSVVVNYILLQHQLVREAAEMGNTEQHGVEERRLSMKATLDSTRLF
                     SDFTTAFVRAASERACEGWHGLRNVSFEVPLPEGNMWGKTAVQYMWRADSQLAALCPD
                     LCARALTVLVALEGQLRHRHKKHRIN"
     gene            <1458236..>1459282
                     /locus_tag="LDBPK_343520"
                     /db_xref="GeneID:13387390"
     mRNA            <1458236..>1459282
                     /locus_tag="LDBPK_343520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864463.1"
                     /db_xref="GeneID:13387390"
     CDS             1458236..1459282
                     /locus_tag="LDBPK_343520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864511.1"
                     /db_xref="GeneID:13387390"
                     /db_xref="UniProtKB/TrEMBL:E9BRF0"
                     /translation="MHLAGTSCVRQRGAYFSTPELSSSSHNERSSSAWPTGSPPQRHT
                     HASTPVATYMHAPSRDVAFGGRAHVATHRSRDTLTAELQRIRAEANTIVVERWFWRWG
                     LYAVRRAALRRIQHRARLVLWSRVGARCFAWWRLVAQRRLCREVLYREAAARERATLI
                     EGLCRVAWDKWRQWARVRARQCARAAHLGLVNRQRHALLRFRAWTCHPRRCHQLRSVE
                     QIRFSAERSLARFTLIRWRLHALESYLAFPLQVRAAQQVATAAFRAWQRRALIGASMR
                     LIRHEALLHVAERCFDRWRRWLRRRLQAALLREANEARLVLRIFSQWAWHHELHALDY
                     EQYVAERHLPRLFS"
     gene            <1459978..>1461444
                     /locus_tag="LDBPK_343530"
                     /db_xref="GeneID:13387391"
     mRNA            <1459978..>1461444
                     /locus_tag="LDBPK_343530"
                     /product="serine palmitoyltransferase-like protein"
                     /transcript_id="XM_003864464.1"
                     /db_xref="GeneID:13387391"
     CDS             1459978..1461444
                     /locus_tag="LDBPK_343530"
                     /codon_start=1
                     /product="serine palmitoyltransferase-like protein"
                     /protein_id="XP_003864512.1"
                     /db_xref="GeneID:13387391"
                     /db_xref="GOA:E9BRF1"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:E9BRF1"
                     /translation="MSSLSETLSEQLMSHPFHRALELFFAAALAYFLLQRFHRRGKGK
                     PPNPMSRLSPEEQERRIAAFQSIPFRAECSVTSNVPVPEYHGLTEVVGREGSHITILR
                     PGSSEAEECLDLATYDFHSFSTLPEVVEVARAAVNAYGVGSCGPRSFYGTIKPHLVVE
                     QDLAKFLKTDEAVVYSFAYATVATLISCFSGRGDYLVYDDGVSSSVMEGCILSRSDIR
                     PYKHCSMTSLEERLQEVVAKDGYSKPHRRFVVTEGLFSYTGEICPLPQILELCHKYKF
                     RLLLEDSYGFGVLGESGRGTPEQFNIPTMDVDVYIGSLSTSMGAVGGFCAGASNMIDH
                     QRLTSTAYVFSASLPPYITASVSQSLAVLARDDTFVAKLRRHTKRIRRHLREAGFNAE
                     KIKLVDSIDDASPVILLAAEREYVEREGLEKVENRLQRVINALQKKKVAVVRNVFTTD
                     EPVNNVSGLRIVAKSLATEAEVTAALEAIETAVKAEFS"
     gene            <1464425..>1465747
                     /locus_tag="LDBPK_343540"
                     /db_xref="GeneID:13387392"
     mRNA            <1464425..>1465747
                     /locus_tag="LDBPK_343540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003864465.1"
                     /db_xref="GeneID:13387392"
     CDS             1464425..1465747
                     /locus_tag="LDBPK_343540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003864513.1"
                     /db_xref="GeneID:13387392"
                     /db_xref="UniProtKB/TrEMBL:E9BRF2"
                     /translation="MALPPVLHLGPHKLKLFPICRSAEAAPGRHRCNDSLLTGFCFVG
                     ELQTDAVGLSVANVAADRDSNRRKVTILWYYSPLFHFEHKRIRVEEGVIEAALTKEVT
                     ARQHADANSPSLKFGGAEAVKHEDSCSTRSSVASSAALSVTHATGLPALYLRVGNSTT
                     FREYRLVIEGQHSTALGDSTELRTPSGAGVAGDGHNDVSVHAAHKPPTLRPLAPRRPT
                     LRPIDTRPDGNGLRSTARLAHKRNAALSGWRASASAPTQCHAAPVEEELKALQQPSPF
                     STAARTAITTAPAPHPHNEGANVACEAVLPMRMPLSCGDYSQASPRVPNEGNLPQWAS
                     PVDHCETREVCAHKDFPHGSFPLSAAGGSSVSSAFLSSSLCLCMPSQSPTGALSTARS
                     AETDTNDLHSSARVSGSSGRFLYDVHRHSREITCLVSAVCTPLPQSTS"
     gene            <1468756..>1470309
                     /locus_tag="LDBPK_343550"
                     /db_xref="GeneID:13387393"
     mRNA            <1468756..>1470309
                     /locus_tag="LDBPK_343550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864466.1"
                     /db_xref="GeneID:13387393"
     CDS             1468756..1470309
                     /locus_tag="LDBPK_343550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864514.1"
                     /db_xref="GeneID:13387393"
                     /db_xref="UniProtKB/TrEMBL:E9BRF3"
                     /translation="MLRPFQGRATASTSAATRESTASRVATPQARHQQMRKGELIYKE
                     FVSTEARDGKPYCGTAQSVSMTQSMTAANTVSSARAATSTPRSVSGGAAASTSAVSTG
                     FSYLVLDGCSFGEETQELRPGSYSADEVDPLLQAAMQLGSPLYDPVKRQFVCWQLHVL
                     EKRPRAAYGDVEGVSCDFCGHTDWLDGLAERATTSPSASGTVVNDEGKKDATAPSAAA
                     SFTAHARFFYNCSACQVDICQACLEEVRSDERLHVPCFQCQRCGGYETRQNAPLHRCA
                     ELTLISDDDERRTGVQALLTSPSRNADASQALPAAPATTSPKCRGVPAGRPVRLGLCR
                     RYQQAAKGVAARDTEIAAHAGKIANSAPHRKRKRSSPERVPVAKQRPEKTTNDTAEVF
                     LVGDVTDKSCRKVKPASASALPKPAPAKQEGDDGDGDASRALMEAAILPFAGYEVHLT
                     PRTAEEVGEVDRIAREQHLVCSPLPSLAKTCVFNFATRLAAETCVDRATAASLDAILK
                     RRVKPVCRT"
     gene            <1471671..>1472474
                     /locus_tag="LDBPK_343560"
                     /db_xref="GeneID:13387394"
     mRNA            <1471671..>1472474
                     /locus_tag="LDBPK_343560"
                     /product="actin-like protein, putative"
                     /transcript_id="XM_003864467.1"
                     /db_xref="GeneID:13387394"
     CDS             1471671..1472474
                     /locus_tag="LDBPK_343560"
                     /codon_start=1
                     /product="actin-like protein, putative"
                     /protein_id="XP_003864515.1"
                     /db_xref="GeneID:13387394"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:E9BRF4"
                     /translation="MRPSVGWTFASGAASSIVLDVGHSRTTVTAVLDGYALRHSVDTI
                     PVGGDAVTAQYSELLSKHRPVVEAAAPALSHSTVREIYWRDWVADVKHCLARVLPYQG
                     DTGGVASAAGKGSASTAVKEATVRAVTDLQAPDGTRVHLDERTAALPFEVFFSATGDE
                     KRNVATLMAMCKRRMDPEWQLHTVPHLLAGAGSLVPGFRDRVVGELKAQDSSYFRYER
                     DGVLNVAQTADGAWVGASMAASSSSFEPLWVTRGEWAEEGASVLYRKLF"
     gene            <1473659..>1474516
                     /locus_tag="LDBPK_343570"
                     /db_xref="GeneID:13387395"
     mRNA            <1473659..>1474516
                     /locus_tag="LDBPK_343570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864468.1"
                     /db_xref="GeneID:13387395"
     CDS             1473659..1474516
                     /locus_tag="LDBPK_343570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864516.1"
                     /db_xref="GeneID:13387395"
                     /db_xref="UniProtKB/TrEMBL:E9BRF5"
                     /translation="MERRSEWLASLRSTLPQFSKRSAAPLERGQAAAILGSAPRRTLE
                     EAVSSHNTTSSLLLPSQWREQATQRLITTLHGIVPPLQVQQTDYFLCSLIHPSYVQVS
                     TMRCESDALRRRVQQELRRTVCMPLELTMTGSKSLRLLRELTHYVEQGAAAAAASARA
                     RATLPAAPVAEKSEERYPSCGPASWSSYPLDASWPELNGADSTAFVQAFRRAGLESLV
                     LYDKSFFAPSPTSTDINGTGSAEVSLAAFTALCGSIELVSGWSSLLQFVDRVAGEQRG
                     LERTTDDHE"
     gene            <1475320..>1477101
                     /locus_tag="LDBPK_343580"
                     /db_xref="GeneID:13387396"
     mRNA            <1475320..>1477101
                     /locus_tag="LDBPK_343580"
                     /product="phosphomannomutase-like protein"
                     /transcript_id="XM_003864469.1"
                     /db_xref="GeneID:13387396"
     CDS             1475320..1477101
                     /locus_tag="LDBPK_343580"
                     /codon_start=1
                     /product="phosphomannomutase-like protein"
                     /protein_id="XP_003864517.1"
                     /db_xref="GeneID:13387396"
                     /db_xref="GOA:E9BRF6"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:E9BRF6"
                     /translation="MLSLDAKVEQWLAWDRDPATRQVIESLAAEKDTAELRRRLETRM
                     KFSTAGLRSTMGAGSAHMNRLTVLQTAQGLAAYVKQQFAPAELSRGVVIGYDGRHHSR
                     EFGEITATVMHQQGIKTYLYRHCIPTPFVPYGVRFFKALAGVMVTASHNPKEYNGLKV
                     YWSNGAQIVAPLDASIAASIEANLTPLESSWAPFTATDHVDPYDVVFEDYFATLRSSY
                     APASDASAVRFTFTAMHGVGTRFTTHGLRHVLGLPASHLSVVAEQAEPNPDFPTVRFP
                     NPEEGQSALALSFATAETYGASVVLANDPDADRLAVAERLPNEEGWHILTGNEIGALL
                     GWWAMERARRQGIALERCLLMSTVVSSCILKTMAAREGAQYSETLTGFKFMGNKALER
                     KASEGLQTLFAYEEAIGFMWGERVMDKDGVTAAVVVADLACYLRKERRRSLVEHLQSL
                     YQQYGYHFTHSSYMMIDDPSRTKVLLQSIRTAASGDYPSQVAGRPVTRVVDLAAQVDT
                     AAPSRRPSLGKTPMITFHVGGGMSITIRGSGTEPKIKWYAELVTKDAAGQQVLNAFVA
                     KAVHQLTQPHKFGLVMRPEDAETFSKL"
     gene            <1478927..>1482841
                     /locus_tag="LDBPK_343590"
                     /db_xref="GeneID:13387397"
     mRNA            <1478927..>1482841
                     /locus_tag="LDBPK_343590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864470.1"
                     /db_xref="GeneID:13387397"
     CDS             1478927..1482841
                     /locus_tag="LDBPK_343590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864518.1"
                     /db_xref="GeneID:13387397"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BRF7"
                     /translation="MSSVSAAPQLSPKVIPGCSNTHSNSGLPTILSDLGTFAYQSACY
                     GPQQLLACSSAVTNAGEVIFVYDMNSMLLTQSLSGHKAAVTALLWRRPPASYLQTGLF
                     LWSGDASGALMYWDVVEGVALTSIQTPCHAAVQSLTLLTDEHLLVVTQEGTGYVFNSH
                     LVDNAPLPPGRLLLEAKQSTLLGNISRPSLVACSRLNDQHCCAVVLGDRLRILTAIPL
                     DSGAAAPVAKDLIYDSCDGAPTVIDVFFSDAQEEVLYFATRNTVGCYDWKLRLMLNES
                     LLWLPDEVEFRRIFRSCSSGAAARTAESRSQESTASSSGDAAAAQVPLMYSFGSDQRL
                     VAWHVTRHDRFTAVSTDVRGVRINAKLCVNVVQSELDSSLFAVLFEDGSIVHWQYSPL
                     ARRWRLLDCWLAPVVRPVTFCPVGAHHCCVALESGHLALMDITHSMAVRRFNLVYSGG
                     TKIVLLCGYKWSDLVWIVSDRIQQYRHHHQVSLIDTRTGEVVRVLRKPSSAPEQTRMK
                     EITMDPTTTYVLLTFWNGTFEVWTAADSRLVHIHSGLGVANVSWAPPLMRRCLSGVQG
                     TPQLLAVLFSEGTLSLWSAYKDRVVVSRDAIPLFHPSAVEGSVRSAVVADTLVMWDGH
                     GNGVVLRAQGTRLAVRRLRDAPPNSGAVMCLGGPSPPSRATEFMSFSSPLAWPSSGSL
                     SYHEDGDNAASSISTGDAGLPSTPTAGFSAARAVAVLFESGVFAVWDIATGERRALSS
                     VGMAADVRALSLYWTGGSLCVLGADGCLYVLDTYLTEMNSSVRYRALRRPMKNVAFLL
                     PAHRTYVQVALELGSPQSGLGDQAQRASHSLSDAPSAVMEAVPSSVRPCRGPFGQLLT
                     EDIRTLQDELELYRTTMVPRDVLLRLSRCGSTAAGAAPVSPLTWLRRAAVVADFLGQS
                     TKQRFMRLAADVLRHWQPSAVARRGARGTPSPASSPADAALATALTDCPPASPDSEPI
                     GEDSFSVPQTYACADAYSEALAPSHVVRRNRILLNEQRSAALLVNARNHRARDDSITR
                     LALARDWLRLEHRQNVIEVLLDAPPQSTTYNELATLSMAVAASTAVQSSSADSATSAL
                     FAASAKRAAAMLLAQGDVEAAVEKLTLAGEYRSACVTLQSKGRWRDAVLLVKAVPQVQ
                     RPLLAEVLQRWSALSVKRGYRLLSAALLLAVGEANPYETQPPPLAALSLLIESAHFTD
                     VAGVLALVLAQYHEAILGWPETAAAAWMFISPAHSSDTSPVQPVSAGAMMDTVLHALG
                     DYSGLLHTVGNLAAEEVVLRQAAMLKVSMRQAAKDDSDECGD"
     gene            <1483775..>1484842
                     /locus_tag="LDBPK_343600"
                     /db_xref="GeneID:13387398"
     mRNA            <1483775..>1484842
                     /locus_tag="LDBPK_343600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864471.1"
                     /db_xref="GeneID:13387398"
     CDS             1483775..1484842
                     /locus_tag="LDBPK_343600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864519.1"
                     /db_xref="GeneID:13387398"
                     /db_xref="UniProtKB/TrEMBL:E9BRF8"
                     /translation="MRARRSCKFAEYLSTYAILEHIGIHPTTLIEKRDAAVGVGVYVR
                     DACDAGTALLAVPSKRFCTTSVLSRVGLKTSFCSPWRADSEVPSSASAGPACDVQGGI
                     LSFLTGSTQWPELAWRLALEQHRSVSPLWGWLQSLPSVEELADRRDAAERQCRVHHTT
                     LLPYYLKGRQRIREETLAAYSQLRADNILPGFDRFAWAVDVVLSRGLLLPTAWPAAGG
                     VLTNSTTDGEQEEEDSDPLPHLSLECGVVPFLDLVNAPDDVGRAVNADIEIATSLETL
                     PRFLTDELAADATARGRGGDDLAEVKRLLETHYYLCLTLRKPLRASEEVILDWQVPVL
                     TTEVLTAAEDAIVSRFLKYMF"
     gene            <1485597..>1486190
                     /locus_tag="LDBPK_343610"
                     /db_xref="GeneID:13387399"
     mRNA            <1485597..>1486190
                     /locus_tag="LDBPK_343610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864472.1"
                     /db_xref="GeneID:13387399"
     CDS             1485597..1486190
                     /locus_tag="LDBPK_343610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864520.1"
                     /db_xref="GeneID:13387399"
                     /db_xref="UniProtKB/TrEMBL:E9BRF9"
                     /translation="MSFAYQRLKMRATTVAVDHMRSFCDGCHLVLSAVTHPFKRFVGR
                     VKAEAPWVNTLVACTLVTALPLIFYPYVKKYVLNDERAAAEAERVRLCLQKGIDPYPY
                     MHHKEFVYGNSAPVLANETQIPQRIGWEFKALENYYKRKEELRHEVGGNIDDTVQKLM
                     TLKKEQRSAYDRMRGKPGTEPRDLIFRGRNDVDRLTS"
     gene            <1487146..>1487718
                     /locus_tag="LDBPK_343620"
                     /db_xref="GeneID:13387400"
     mRNA            <1487146..>1487718
                     /locus_tag="LDBPK_343620"
                     /product="ribosomal protein L14, putative"
                     /transcript_id="XM_003864473.1"
                     /db_xref="GeneID:13387400"
     CDS             1487146..1487718
                     /locus_tag="LDBPK_343620"
                     /codon_start=1
                     /product="ribosomal protein L14, putative"
                     /protein_id="XP_003864521.1"
                     /db_xref="GeneID:13387400"
                     /db_xref="GOA:E9BRG0"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:E9BRG0"
                     /translation="MLRFFRARLAPTTTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYR
                     SRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRLIAKATAERFAHCRVFPAVAHRVS
                     VQRFKGRGRGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQRV
                     PLGTRVMYCAGRHVNHKYHLKAVVLANFFV"
     gene            <1488588..>1489457
                     /locus_tag="LDBPK_343630"
                     /db_xref="GeneID:13387401"
     mRNA            <1488588..>1489457
                     /locus_tag="LDBPK_343630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864474.1"
                     /db_xref="GeneID:13387401"
     CDS             1488588..1489457
                     /locus_tag="LDBPK_343630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864522.1"
                     /db_xref="GeneID:13387401"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:E9BRG1"
                     /translation="MPAIVKQLPSSDDENDQASLPPAKQYAQLGEDSSPAGASRAELS
                     NAEAGAEAEGLAEPQKPDAGGSERVVDVEECARLKAAGNELFKDGDISEALTLYRKAL
                     WCASLKPLPPHHTATGKSSASPTPLDGSAPAASSHTATEGDETEAEQQPEDTTDYTLT
                     AQVYCNAGLCLMKLDVKEEAAHMLSEAIRHDGSYLKAYIRRAECYYMMQKWSSAYGDY
                     ESYEKLGGVLDAQGRTRKAASKAKVDEEMQKMLGELKSLGNKILGNFGLSTDNFKFDK
                     DPNTGGYSMRFER"
     gene            <1490223..>1490924
                     /locus_tag="LDBPK_343640"
                     /db_xref="GeneID:13387402"
     mRNA            <1490223..>1490924
                     /locus_tag="LDBPK_343640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864475.1"
                     /db_xref="GeneID:13387402"
     CDS             1490223..1490924
                     /locus_tag="LDBPK_343640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864523.1"
                     /db_xref="GeneID:13387402"
                     /db_xref="UniProtKB/TrEMBL:E9BRG2"
                     /translation="MTVRPQVAQRQETVKQLEGLPHDVLRGMLRDVQAQLQEERRAFS
                     QERKEFEHVQLRLAKLKRDLESAQRQREQQRRHASKDAEAAARTSRLLRAARRRGQEY
                     EEAIARALDDIHQLRRGSRDRAASPTSMPVISVGMDALSINSSRPRHADVPPEVSVPP
                     TPARESSRAAAAARAANEEQRRSVLLHELAHRVARVERENRMLRSSIDILSRGDASSV
                     KLYYELESLRPSRVG"
     gene            <1491787..>1492566
                     /locus_tag="LDBPK_343650"
                     /db_xref="GeneID:13387403"
     mRNA            <1491787..>1492566
                     /locus_tag="LDBPK_343650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864476.1"
                     /db_xref="GeneID:13387403"
     CDS             1491787..1492566
                     /locus_tag="LDBPK_343650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864524.1"
                     /db_xref="GeneID:13387403"
                     /db_xref="UniProtKB/TrEMBL:E9BRG3"
                     /translation="MSQLSASPREEPVGIPELFVQYLKAKDFREQLAIVHAHPALFTD
                     DVVAALKDARAQINETFVEVKEAFRIIDAVSGSLQYTGTSVQLQQSEVKEVLNEEAIL
                     KNFAASLAGLLRAGETAGPAAPSTISSLSTACRVSSSLGAGQSQSPGAWFTQPSLVFS
                     VLAFLPAEEIFMAAENVCRAWQTWLFLPDMSRFFWVGCVQREFPEQLQVALQTAGDDL
                     YESDWRSLAMLCVTEAEQAAEAEEAEEVGTEGLLRGVVPFL"
     gene            <1493541..>1494233
                     /locus_tag="LDBPK_343660"
                     /db_xref="GeneID:13387404"
     mRNA            <1493541..>1494233
                     /locus_tag="LDBPK_343660"
                     /product="aquaporin 9, putative"
                     /transcript_id="XM_003864477.1"
                     /db_xref="GeneID:13387404"
     CDS             1493541..1494233
                     /locus_tag="LDBPK_343660"
                     /codon_start=1
                     /product="aquaporin 9, putative"
                     /protein_id="XP_003864525.1"
                     /db_xref="GeneID:13387404"
                     /db_xref="GOA:E9BRG4"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:E9BRG4"
                     /translation="MLSEFLSQLVAEFVGTFLLVLTITLASVGVGTLAPIPIGFMLAA
                     MCFTFGYISGAHFNPAISFAVFINRKMTLRRTVMYIVVQLAGSFCASLYASAIIGLQI
                     PAPVANGDLANTWQVLLCELVYTFALTSVVLHVCFSRQRSNDFYGFAIGMTLMAAGFS
                     VGGFTGGAFNPAVATGTQLVLCVYKNCDPLFYFWVYWIAPICGAFVASVIFQLLDTHE
                     SVPVVLGKEAVY"
     gene            <1495662..>1496003
                     /locus_tag="LDBPK_343670"
                     /db_xref="GeneID:13387405"
     mRNA            <1495662..>1496003
                     /locus_tag="LDBPK_343670"
                     /product="small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_003864478.1"
                     /db_xref="GeneID:13387405"
     CDS             1495662..1496003
                     /locus_tag="LDBPK_343670"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_003864526.1"
                     /db_xref="GeneID:13387405"
                     /db_xref="GOA:E9BRG5"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:E9BRG5"
                     /translation="MAESIPIKVLFDALHLKVSIEVATGEVYHGTVEELQNNMNVLLK
                     DATKTARGGKETKMDSVFVRGSNIVFFQLPDALQTSPALLRAGEVVSKAKDTRGDGKG
                     FGASRKRARNS"
     gene            <1496572..>1498914
                     /locus_tag="LDBPK_343680"
                     /db_xref="GeneID:13387406"
     mRNA            <1496572..>1498914
                     /locus_tag="LDBPK_343680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864479.1"
                     /db_xref="GeneID:13387406"
     CDS             1496572..1498914
                     /locus_tag="LDBPK_343680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864527.1"
                     /db_xref="GeneID:13387406"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BRG6"
                     /translation="MLFCVHCIPYCSLYPVSLCHKPTYTLFSHLCVLLIACVCRMVFP
                     KGKGGPRVLRLLGATALSLPFASSYAVCARGLIRLFVPSLLLVSLFMHRATHGSSRTS
                     CVRSAALADVPAAATLANARHISETYPRLVSPSVTLPELRPPAPILRSGNSNAGAKLP
                     ESSRVVEETRCAIRKTPREVEFPAAEDRPCLPFPLEPIKSTSPPFTTSKLASSDDPAT
                     LVLKKGVPEPQKEFHLCHTGTVESLLSRQQYVDVYFVASSLLTIRNGAARVEAGGEKC
                     RLHLLSHRCLCSYALLRFKECCEDGTATLALYRHLQGDNSFSSRGMPDEVLHSRVVQA
                     LLGALVMRELYSDAAVLMASVPTVLSAGGDTPSKEFGGIPSLPLFATRQDTLSSLASF
                     RQCVAARRWVEAAQIIDSSTTAQSWVQATPLCAMLAFVRLEMDDPKAARGLLLPYLAS
                     LPEPPPWEVLSTAPVEHAQLWDNFISHYVFSTTLLAKASFMSGSAYLNISAALLQRAL
                     RLSPSYAPARLFAEFVLSFEAQRQHVDAAMSASDYPKALSVTAEMLRMPEVTRLVHAE
                     LYLVRTQAQWMRGQPLEVVHEASRCVQCDPQCALAFRLRADAFAMMSREAEAAADLAV
                     SKHLNVRVGALFDELRVQRSRYNAAQVEAEVKRNSAPVFKSFPSASAPLRSSPRENFC
                     SNTRRSGARERKFTDAELPPSLRTHYDVLGVSSNASAAEIRRRYRRLTLQLHPDRLVG
                     AAESDRRAALEAFQLLGNAYSVLSDTQLRATYDAGLPSLH"
     gene            <1500713..>1514650
                     /locus_tag="LDBPK_343690"
                     /db_xref="GeneID:13387407"
     mRNA            <1500713..>1514650
                     /locus_tag="LDBPK_343690"
                     /product="dynein heavy chain, putative"
                     /transcript_id="XM_003864480.1"
                     /db_xref="GeneID:13387407"
     CDS             1500713..1514650
                     /locus_tag="LDBPK_343690"
                     /codon_start=1
                     /product="dynein heavy chain, putative"
                     /protein_id="XP_003864528.1"
                     /db_xref="GeneID:13387407"
                     /db_xref="GOA:E9BRG7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BRG7"
                     /translation="MTTNAETDPRLLWVFGQICRNLNGVTDDSLKDLFRDRDNVDTVL
                     STFGTVDSMLESSFVIVAREKEPIDGHSKDPLQHAADAPPPQHHTGDGGGRGQRLRIS
                     SGAVYNANIACSTLYAPDHSRCLFFVRVDHREITAEDAADWATNPKNPIHFAFELSGT
                     QVPSLNSFYVLLMEVFAPMLQDMGQAAGKRKALMALALNGGASATSITQGGAAETGSG
                     ADAADGVTATGSNRQLYADIHSWINRLGTQLEGFINQVGAERKLLIPQDLYALEYSDA
                     QLQAVLSNKDVLRQVDATVSQWQAEISYAMSVEPQKEGPLGEIEYWRERYSTISALYE
                     QLNSSQAKFILRIAKEAGCTSATMIDLTLQQFFRMHSESKDNVKFLGTLDRHFRTLHS
                     VDPKLGSLQPIIDTLFSMMTALRMVWIISRFYSTEERMVGLLEKIARLIAQKVSEHID
                     FRTVLTLPSEVAKVKVTEGQQCLIKWKAAYKSVQEEINSSEREQHWSFDERRLFDVTD
                     YMSDRCTDLLEVIETVEYYTTVLSAQLKTVLTDATDIERILKDVEKLKRPFGTLTFDP
                     FERRATHNWQVVFSGFLTAVTSLDHEVSLFINRIFDDDLRSAESAFELLVSFKRIRTR
                     PDRGGNSLDISALLLEKTDRILAQYFTEVENVRRIFQDQKEAPPLSKNQPPVAGAIHW
                     SMSLFHRLKKPIVRFQHEGMLKSSVGQQVKAKYVEASRQMKNYSTARFLKWREEVRVP
                     APASLKWNILRADPDGTYRVNFNWSIFDIIRETKYLDRLGFEVPKALLHISLQDEAYH
                     GYVDALNAMLVSFNYELGALAGPERAILAAEVHELKQALEPGLLDINWTSLSIPDFVS
                     NCEKAITKFRNVSREVRKSADSLQTQVVNKIASTRLIPEYREFLQAGGELPELQTLVD
                     IIERRRVEQLERCMRAYRTAKPLLTKVEGQLLGTHTGRCASLVPYYSHWEQRIWRALT
                     TMVLKSLASFAKLVGYTTSSRASARPPPLFKVTVLLTSEPTYTPQQQEITTAFHKIQA
                     GIIETTKHFQRWMRGTCLEFTQGEIIPRPAEEEYMTLFTYYQDIYNLPQVYKLQALVN
                     RTIQTHLGALATNIKMLQRYRFVFLADKKISVEQQAKSQLQWIDYDAKFQLYFNMIRD
                     FDEESHVHDFGFMRCDETPFYTELVGHVYQWVAMEGAQLSDTVRVRIMQRHNTIRKIN
                     EDLMRPCDNIADLKFVLEVMHNARTSSLEMEQAVREIEYVYSSLQHYGVPLDAGMVKL
                     AMSLQDMWSCTLARVHQTGIALEPRKVQFRELTVQEVSKFLDEGRKVLQEFRCTGPGR
                     DDIDLAAGNESKKQWRQRLSELQMKRDQLVKAENLFDLPLTTHTCLQQLNEELTKVET
                     VYDLYEHWMSDLRRWNRSSWKDLLLSDLEATTEERAKQARVLGKQYGTINPFPAVHQL
                     ILNFQNSLPLLAKLKSPALKARHWTELMRVTDKSFNYEQINLSELIAMELFRYIEEVD
                     HVVLAAAREQGIEQEIRAIKQYWAEKVFTPVPYAPRKGTARCDVLTDTSEIQEAVDDN
                     MLKVQSIANVKWAQPFAEEVKTWERRLSVISDVITLWVTVQQKWQYLESIFKGNDDIA
                     QQLPREASKFNDLDKKFVRIMQDTSASPNVSHCCNVTGRLEELRYLEEKLEECQKDLS
                     NYLESKRCLFPRFYFISDDELLSILATSSARAVQDHMLKMFDNCAQLVFKSERDETIC
                     GVESQEGERLDFGTPVKTDGRPVEEWLQAVLDESKQSLHDILKAGVFHYPKMQRLEWV
                     KQYHGMVALTGAKVFWTYEVEYAFAQVHKGKRSAVKELSASLSRQLIDLVAEMDKDMN
                     KQYRKKINTLIIVDVHGRDIVDRFVRDSVTDAREFDWESQLRFYWEKAVDTCTIAQCT
                     GRFRYGFEYMGLNGRLVITPLTDRCFMTLTQALTFCLGGAPGGPAGTGKTESVKDLAK
                     AMAIQCVVFNCGEGIDYKAMGTIFSGLSQTGSWGCFDEFNRIELPVLSVVSEQLRSIQ
                     AALRAGDKEFLFGDSVIRLVPTIGTFITMNPGYAGRVELPDNLKALFRPVVMVVPDME
                     LIAENMLFSEGFTTARELARKMVTLYSLAKGQLSKQHHYDWGLRALKAVLVMAGQLKR
                     GSSDLSEESVLMRALRDMNAPKFIAQDEPLFKGLMGDLFPGLDPTRVPQENLAKASTS
                     VLKERGFQINLKQIDKVVQLYETMQTRHTSMVVGPTGGGKSTVIDTLCKAQTELGLTT
                     KSYVINPKAQPTSALYGMMDPMTRNWTDGIFSNIFRSINKPAEGTERERRYVIFDGDV
                     DAKWVEDMNSVMDDNKLLTLPNGERIRLHPQCSLLFEVGDLQYASPATVSRVGMVFLD
                     PINLGWKPFMHAWKMRRPRDEQETLAELVDQFVQPLANFVLDGADEEGTISPPPKLVM
                     PTNALNMVKQLTTMLCTVLPKDASLEPRALQSVFIFACVWSFGAFISSGPDRLRFDSF
                     LKRISGWNLQDVGDNFLTRFVGSGSLPEARTLFDYYFDLQDSRWKPWKVLVKPFQRKP
                     GQPFSSLLVSTVDTERNMWLLNRIVLNRSPVLFVGESGTAKTVTIQSYLQHLKWSSVL
                     SSESGSEVSGGDVQLEAMLLEMNFSSRTTSLDAQRTLEDNIEKRTNTVLGPPARKRLI
                     VFVDDINMPKVDLYGTQQPIAFLKLLIESFHWYDRKDLIFKNVRDTQFVAAMAPPGGG
                     RNALDPRFVSLFTVFNILFPEEEAIQTIYQQILADAYKTLPVDAEFAKTITSMTLKLH
                     VDLVAKLPATPAKFHYIFNLRDLSRIYEGLCRATPDKFPSTGALLRLWRNEVMRVFVD
                     RMGEEEDKAFVCGLIEKHVSEHFPRETATVMADPLLLGDFGDFEPASELEPLHIYEDF
                     GPSYARARQLVEAIMDEINTPVKKINLVMFDMALEHLLRITRVLSLPRGHCLLVGVGG
                     SGKQSLTKLAASICKMGVFEIVLSRNYGKDAFREDLKKLYHYVGVERQKMIFLFMDGH
                     VKEEGFLEDINNLLASGMVPALFTEEEKEPLYASVAEDVEGAGLAPSKDNKWTSFIAR
                     CRDNLHVVLSMSPSGDALRTRCRNFPSLINNTTIDWFQKWPAQALEAVGRKVLSEETL
                     PDELRTPIVEHMVHVHLTADRLSSKYQNELKRHNYVTPKNYLSFLANYAKLLVTRRED
                     IDDIVKKFTIGLEKLQHAEAEVNVLKEELAEKEVTLREKQEINAQMTHEITEQQQKNQ
                     VRKDESLKMEEELNIQNAEIEKESAEAQVVLEQAMPALEEAMEAVRHIDPKSITELRS
                     FAKPSVNVVAVVRMVCIVKGVPATWESGKIMMGQADFIRSLVDIDTLTPTLNQAKMNE
                     INKVLKEFPVNSNDLKKVSMAASGLMIWVEAMKQYWNVAKEVFPKQELVRQLQKAKEV
                     AERQLQACRDEIDRLTESLHRLEQQLEAGMAEARRLQEEKSVMERRLNAAHKLIDGFS
                     SERVRWTEEKKLLSASRSRLVGDCLAGAAFLSYLGAFTYPYRQEALDSFWLPDLRTRG
                     IPLTDGFDVRQLLTNDVAVSQWASDGLPSDALSVQNGILTSASTDYTGKGKRAGKIRF
                     PLCIDPQMQAVRWIKRQHQVNTRFETATFSDPDFLKKLEFAIQYGNPFLFENVDEFID
                     PIIDSVLDPQFRYESGQRLIRIGDKDIPWDDNFKLYLCTKLPNPNYAAEVFGKTLVIN
                     YGVTEDGLEAQLLNYVVASERSDLQRQSEELVQTMAESRAQLKELENTLIRELTLATG
                     NILDNDDLIATLENTKSSATEVELKLHLAQETARTTEKSRQQYRPAAKRGAVLYFVIS
                     QLSAINPMYEYSLSAFLYDVFGYSITKSDASFEIQDRLRNIIQTLTYNLYTYVCMGIF
                     AKDKVMLSFQMAVRLLGQEGRMVQSELEFFLRGCVLASKSFPANPVRWLTERQWNDVC
                     KLSTTVDVFEHLTKDVADNAEEWQAWTALDRPEELDCNPLPCGYSNKISAFQLLCLLR
                     CFRSDRVYSAVTNFISTCDLLGEQFVMPPILRYKEVLEKSSSMSPIVCIVSPGANPTD
                     EIVKLAAKEVGLDKMRSISLGQGQGEEAMRLVEVGATRGHWVLLQNCHLLTAWMKDME
                     KMLEKVDCSQVHEQFRLWLTTEPIEQFPMGILQRSLKVVNEPPNGLKMNMKNTLSKVT
                     EDQLDVCPHWAFRPLVFTLAFFHAVVQERRKYGKIGWNVIYDFNETDFTASMRLLDTY
                     LTKAYLNKDPLPWDTLRYLVGEAMYGGRVTDSMDRRIVQTYLAEYFGDYLFDTFQPFH
                     FFVESGVADYCLPSGSTDPEKRVTLSQMVAQVDTFPNANAPDVFGLHPNAETGYLRHS
                     TETLWSSLIELMPRVSTVTVGGETREAKLTKFTEEILAQIPEPFDMKAVLLKETTRAT
                     ANGHDAVQPTQVVLLQEMERWNRLVNVMRTSLKELKKALSGIIGMSSELDELESALDN
                     GQLPQSWRRYAPATRKNLGRWIAHFQRRYEQYLSWNMNGEPKCVWLSGLMVPDSYLSA
                     LVQVTCRKYRWPLDRSTIMTTVTAFARPEDVTAAPEDGAYVSGLYLEGARWDPQRRAL
                     APQLKKQLITELPVMQIVPTESSRVKTVGTFKTPVYVNGDRRNAAGVGLVFMADLPSD
                     VHPSLWVLESVALLLDSDD"
     gene            <1516150..>1517064
                     /locus_tag="LDBPK_343700"
                     /db_xref="GeneID:13387408"
     mRNA            <1516150..>1517064
                     /locus_tag="LDBPK_343700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864481.1"
                     /db_xref="GeneID:13387408"
     CDS             1516150..1517064
                     /locus_tag="LDBPK_343700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864529.1"
                     /db_xref="GeneID:13387408"
                     /db_xref="UniProtKB/TrEMBL:E9BRG8"
                     /translation="MGHHADPNKYVAYRDATVLQRRIATFVLVFSVMIIALVMTFSSV
                     QHREAPCQDRAHEVEFDFMIRPDSTHEAIVTALQTILEKRRCWLDFAPQNDDAPTMVQ
                     LNVLDTTTGLIAGRGFRVVRRSDGSNYHYELRAVFDKLCGTYPPISMEVMANVDYERV
                     TYNIKAASLMNSTVKYLQHSSLLTKEKNRVTTVTQLQSVFPGFHQLGPSTARLSTIQS
                     AKYTVEGVSQVYFNGSPLDIRVRVQHWLSDKGTPDFWRVVLSTQNIMAERDLVSLQSS
                     IREGLTKLNLLCNATSSSCANELDLYLR"
     gene            <1520164..>1521669
                     /locus_tag="LDBPK_343710"
                     /db_xref="GeneID:13387409"
     mRNA            <1520164..>1521669
                     /locus_tag="LDBPK_343710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864482.1"
                     /db_xref="GeneID:13387409"
     CDS             1520164..1521669
                     /locus_tag="LDBPK_343710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864530.1"
                     /db_xref="GeneID:13387409"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="UniProtKB/TrEMBL:E9BRG9"
                     /translation="MSLPMRSFAMSFSRRPHCHSTALQHYLAVPQTPLDLPALSKLPA
                     QPVENGVVHQIVREMAIRTSRCYQSFSDPIIQKTMRKPNVDRLWWVKSYVLREFNYCV
                     ALHRGLEQCPRQGIFDSSAEICFERHEYGSSPSLFPRLRNTDNDSLIYEPVQTYSSSD
                     SVSSCAPRDAEDDTISAGAPSSTSTSAPSTFRPLGLLSNPAMTRDEIEAAFSTWDRGK
                     ATMPLTLALKVLRPCQSLLDVMVNEAAIRSDELNGWFIRFCRRRVAWRVLHEHLLYLT
                     HPADTQQVISSDTDVVEVLQRAGIAVVEIFSSLVDNGSVLSLEIHLEEDKRILTRVPC
                     GTLVSSSTSPLSCPADLPETRPTPAPSRGIYSVEGHLTYIFREVLKNACAATLKLRPD
                     IDVLVRYASDDTWVVVEFVDQAGGIHPQHFKNIWKFGWTTSEHYESHLGGFGVGLPTS
                     KVYMGMWGGSIDVYSTLGVETTVRVRFPKAPVEVLVPESTTAAAGVSAAPK"
     gene            <1522526..>1522819
                     /locus_tag="LDBPK_343720"
                     /db_xref="GeneID:13387410"
     mRNA            <1522526..>1522819
                     /locus_tag="LDBPK_343720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864483.1"
                     /db_xref="GeneID:13387410"
     CDS             1522526..1522819
                     /locus_tag="LDBPK_343720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864531.1"
                     /db_xref="GeneID:13387410"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:E9BRH0"
                     /translation="MEKEHKSICWRPKNALIECVVMTKCFQEKESVEDCIGANDCFLE
                     RRNWTLCKMNAVNPRYRLRGNPYDLATEDQKKIEARNERIRQRELEEEGIFTK"
     gene            <1524126..>1525721
                     /locus_tag="LDBPK_343730"
                     /db_xref="GeneID:13387411"
     mRNA            <1524126..>1525721
                     /locus_tag="LDBPK_343730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864484.1"
                     /db_xref="GeneID:13387411"
     CDS             1524126..1525721
                     /locus_tag="LDBPK_343730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864532.1"
                     /db_xref="GeneID:13387411"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BRH1"
                     /translation="MSFSRPQRSPHRTLRHSRNAARLTDLHQARHSRNCFPRRPLRAS
                     HAAQCLLPSNPDAAANDAAISTSYSVTAYTTTAYINCEGVSGSDSEYSEYDLVNEQMQ
                     DFLLDSEDTSDGDADVEDILGFGAVFMGGLIPARPRDAHQARAWRRTTKPNRRRMAKK
                     SESCSSLSNAARPTASSSTTMLSDLDTNVREAVVTGGAAQRRGTRKQRRAMASGERRW
                     LVPPLSAVSVKATDDRNDGRRQLPWFTVVFDLDETLVGARYGPIHLRPHVGELLRSLH
                     RLPVEIIVWTAGTAHYVNPILHAIGQACGRRQWFHHIISRHKRWYRGANTCVKDLRQL
                     GRPLDRLLMVENNPISALPQPSLCVLLEDYLQPNAADESLLVLKELLERLSLQYEREA
                     RTSFAASTCEQSAEEDCRAQRHTRSPKNTLRDTTTSRTTALPSSALPSLELLVRDDAA
                     LQLVEFRMEDILKEDGVSMLQRAEMRELVGGADTLRCLCLCYTPPLLPSSTAVAPRGT
                     AASVSCVPMAMRSYGSVNPLRPL"
     gene            <1526698..>1528344
                     /locus_tag="LDBPK_343740"
                     /db_xref="GeneID:13387412"
     mRNA            <1526698..>1528344
                     /locus_tag="LDBPK_343740"
                     /product="expression site-associated protein 5 (ESAG5),
                     putative"
                     /transcript_id="XM_003864485.1"
                     /db_xref="GeneID:13387412"
     CDS             1526698..1528344
                     /locus_tag="LDBPK_343740"
                     /codon_start=1
                     /product="expression site-associated protein 5 (ESAG5),
                     putative"
                     /protein_id="XP_003864533.1"
                     /db_xref="GeneID:13387412"
                     /db_xref="GOA:E9BRH2"
                     /db_xref="InterPro:IPR017943"
                     /db_xref="UniProtKB/TrEMBL:E9BRH2"
                     /translation="MSAAFAAMKSYGKRGGRAAWAHKRSLCVLWLLFLSASWLCFRGT
                     QSTHGGCLTDIRATADKGAIGCRSANVSVAVTSTFMNTFIKAAVIPMIQNDSNTLIVP
                     QQEVNHVWVDKMVLQHFKLGSLTVSTGVPDAQSMMIRGTGLGLKVNKSRFIFHYMGVR
                     CSGTFWASLKETAVDAVIRLTLLPEERWNVTFPRLALDWGQVDVHHELDSETCSLAQK
                     VVELFTGELDVFVVSKVKRMLDEEMPRKAADRLNDAFARFGIRAITPPVMTANAMAVT
                     LDLNPLDFGCASTPTASTVPELVSRDIAARTTATSVNNVLYNAVQAQRLQVEKHLSAM
                     WNTSLLADLFPELYRACPGCRLYTLAQATKAPIIDVLRDGEVSVDVHDLILGVYVQPN
                     SSEHSSALSSLITEKQLRPRAGFSAAYRSFERKKRISSQYHRKAFPVLAIGCSAASGV
                     RNISASTGHSISYELLPVRDVAVKVMVSNIGDVSTKDLEKLITKVWNDFAAPLANSAS
                     PLKLPFFFQEAVLKVGPDIIEGGVNVSLKEEFLQAVLSTL"
     gene            <1532552..>1540438
                     /locus_tag="LDBPK_343750"
                     /db_xref="GeneID:13387413"
     mRNA            <1532552..>1540438
                     /locus_tag="LDBPK_343750"
                     /product="phosphatidylinositol 3-kinase-like protein"
                     /transcript_id="XM_003864486.1"
                     /db_xref="GeneID:13387413"
     CDS             1532552..1540438
                     /locus_tag="LDBPK_343750"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase-like protein"
                     /protein_id="XP_003864534.1"
                     /db_xref="GeneID:13387413"
                     /db_xref="GOA:E9BRH3"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:E9BRH3"
                     /translation="MAETLAPNDVGGISVTKLFSSDSTAALGQQLSSIFSNLNSTPND
                     RQQRAEECLSALTDTLFLHENELGANESLHERIISLIDGTFCTSVDKGCSSFRVVFDV
                     KWKDQHEKRNRCFVLLLSRAFKCTTPEDCLKVIQCLGEVLEDNIRTTTDLLADNVEPL
                     LRDLFAADVHRRTVACEVLAKIVSTTTFIIKRNPTLLELLTSSCAPLVTLKDAMETRN
                     LWHRTALIRLTSALVENCYEVTPAVAKDVADLVFRYMRAAEDESQLVGVLSALIHVAV
                     TPAFVSAPWDLPQLVRFLCETDWSVYAVATRVAAVAAINKVAFFFCQEENACYEALRT
                     RSLEFISLDDAVEVVTEGLELIKEMEVLERELHLGTAVVNALCACIQRLPHVPIIYEL
                     LELIRERYGDLEVKPIYSLLEGYLDTKQELLNFGKVNALLRFAGSRIRLDDPRLAQLR
                     INVGANQPIPVILHSLPLLTTLQRTEQLHEVLEILSHDDRGVRRVAVSTALELCEIMM
                     ERNKFRNATPKGGVQRMQWLDEEVSNAVERVLDVAVADRDPEIRLWALQHLTVPFFPY
                     LCLCDNLDAIFMARNDNDKATRDQALTLLCQLLPYHPTVVQPQLQRAQEYMLHDVATM
                     DASVSFAVCKAGLLKMCVDHDALLIEKSTVEAIVLRRLEAQPFISRSLSIALLQLIRS
                     ILERTASQHHSDFHSFLRPLLLIVNGGDSCTRRREALETLTAFISHITKTDISGLSEV
                     YRAVARIIRRETEEEESVTIAAMKVLSSIGAVTPVKMRHVFRMVESDEMEEEEEVVTP
                     ALAHCKPRLRISTDMPERYPSTVLYYLVRSLQLALDPKQQVDTLVAVRTMLHDVEGKV
                     KLNLLTQLLPQLQTWLRDPERAFLYETVLGLMNDLAILLCQFKESVAPSVGHELLRSV
                     QAFCLLPQASQKPFSAYVVQLLDSLAKGIPAQEMRDNRWAIEFIHQRLSQNKNDLDLV
                     HRVVKSLESFIAVMHEKELQMILPHVLQCIEPAKASPGGKLSKSKDINDACFDFLNFV
                     MAKQLTLVKHCCAQIVHTIMWYIELADSNEEMDVGLNTLATLVDTVKMPAKRFIMPIE
                     RVAVRNGFPPQYFVNLVQSAAGGAKIRMTTSNGTGLNPDRPITLVSHLPRLSQAEFEH
                     EMRSTPRSENVLIDVLDVRHHQGQTMIDFRFHPGTDTAACCNLFSRKATDNKSAMRRN
                     LGILRVEQTEESPRPVGADVIKALANLPVAKTKKREQSWVLWLHNATVTLLRNSPYAV
                     LRDTCAVADRNTELAKDLFPFAVAAVCGHLETPLRAQLMDIFDRALAAAPADVKQGLF
                     CFAEFMESERDDDRVKLVKVMRESVFSVDRESTSQKFGINYDQDPERGVIVTKLAPNG
                     LGARAGVPIGAQLLAINDIPVRAVSDIRGLIEGLTHIELLLSYEVEEKTKSKPKPLMN
                     LEVLASVAFSGEMHIKAIYFNEVLFESLSSKICKITDRKDSQMRRVMTIAEDLIQYYR
                     HLNMTMTANGLLKTLTRKFSDEIFAPEQFGFEEIASLEQLNWWSEALRRYEARMASFG
                     ARYLEVASLVGVLRCEQALGHSSRVQELAEQYWEQLPADAQREVAPFRAKAAFCLGAW
                     DTFDALALDKRMQSCFGVVERCAALFRAECHDELLRYTDKVRESMLESFADSLNENYN
                     RAYEGMTRLQHLRHFEELVSFTTACEERQALLKRVWHRRLVQMSSRPDDLMTVLSINS
                     LVLEPEDDLHSYVYVIRCLCKSQWFSHAEHLLQRLLRENASLEVLCECDPELIHTYIK
                     YVYLAKDKHGAYVELKNILSAVEVDPEDPRAEMWGQCWLLLGEWTMYLFPDCGEEAIK
                     ELMCATELGPNSAAAFHSLGILHCDLARDPSTQGEVQNNHLICCINSLFKSIQLCNDV
                     PGSLVMQDVLRILSVWFANSSIREINEAVHHGVQVVADHVWLNVVPQLIARIGIEARY
                     ARAILTDLLIRVGSQYSHALIYPLTVAEKSPDAVRRHMAERVIMGMRNIPENDRIVKE
                     ASLVSNEMVRIAILWTEKWHAAIQQAAYKPNNTAAIFSMLQPLYAELDRASTPNELSF
                     RCNFGQTLRRAKVALEEAKTEEAWGFLRQVYAQLRRGVLERRLYMSDVSPTLDGIQDS
                     IVAVPGTFEHDKPLITILKFHSRVYVMPSKQKPRRIGLDASDGKKYRFLLKGHEDMRQ
                     DERVMQFIRLIDTIFQSDNAASAIGLSIPQYAVIPLTDNVGVVGWVENTETIYKMLET
                     YRQAHEVSIYEEVNLIMKKGGLDTIEDYHRLPKQQRKALLNYAMENTPKNELRHIFWD
                     HNDTCEQWLSYRQTYGQTLAAMSMVGYVLGLGDRHLNNLMLQGNGTVVHIDFGDCFEV
                     AMHRALYAEAVPFRLTRLLVCALGITGVDGLYRMTCELAMKNLHRHSENLLSILEAFI
                     YDPIINWRLNTVNDVTEKSGSKSAQQESSNGGTAALAGETAAAACLGVDDAAQAEAKP
                     VAMQLSKSVSKPVPHSALPGESQMFENGEETRNQQGDLALARVQAKLTGQDFGVVNSS
                     FSMMRSSRRLEAGGSQPQGSSWGSNSLAGFTDSPKDSFAAPLLTTYLSLRVLNGGAES
                     LDVPHQVDRLIQEATSLDNLSDAFLTGWAPFW"
     gene            <1544834..>1545646
                     /locus_tag="LDBPK_343760"
                     /db_xref="GeneID:13387414"
     mRNA            <1544834..>1545646
                     /locus_tag="LDBPK_343760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864487.1"
                     /db_xref="GeneID:13387414"
     CDS             1544834..1545646
                     /locus_tag="LDBPK_343760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864535.1"
                     /db_xref="GeneID:13387414"
                     /db_xref="UniProtKB/TrEMBL:E9BRH4"
                     /translation="MSAAQVRRSDGAWEVPSPDTSRDSQPLRLAYGAGGVATRCTSTH
                     AKNEIQPHLDAIHRELVELKHRRERLEAQRKELLEGRREHAEGQRTGCVSGSVSTHAG
                     VARSHSTSGLTFAHPCSEMDSLTACSGLHAAHERHSKSVYQDSFVLANMKPIPSEKER
                     RRLLKATPHLAVKNALRTAAQHDSTLLMGSFLLEDNPHTCTFARERRFRPLLGQKGKY
                     FLSADVAVDQCMNRSHANATKSLSALGSASQTPGPGAYTPRYSKLSRPPRSS"
     misc_feature    1548536..1548550
                     /note="Short protein (LDBPK_343770, CBZ37854.1) was
                     converted to a misc_feature."
     gene            <1551624..>1551908
                     /locus_tag="LDBPK_343780"
                     /db_xref="GeneID:13387416"
     mRNA            <1551624..>1551908
                     /locus_tag="LDBPK_343780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864489.1"
                     /db_xref="GeneID:13387416"
     CDS             1551624..1551908
                     /locus_tag="LDBPK_343780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864537.1"
                     /db_xref="GeneID:13387416"
                     /db_xref="UniProtKB/TrEMBL:E9BRH6"
                     /translation="MLNIPDYRQQPLVRMVYAWPAFLGVLLFTLLTLVGMMRCVFRGL
                     DGGSPRYIGPNTTTSVRQDIFYVVAAPLVFQGLCVSIYTTWVSWKFFRHN"
     gap             1552603..1552701
                     /estimated_length=99
     gene            <1555374..>1559483
                     /locus_tag="LDBPK_343790"
                     /db_xref="GeneID:13387417"
     mRNA            <1555374..>1559483
                     /locus_tag="LDBPK_343790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864490.1"
                     /db_xref="GeneID:13387417"
     CDS             1555374..1559483
                     /locus_tag="LDBPK_343790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864538.1"
                     /db_xref="GeneID:13387417"
                     /db_xref="GOA:E9BRH7"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:E9BRH7"
                     /translation="MTSLRDESARLADEEAYTSLLEICTELIIAEGTDDPPLKQPLGM
                     LHELLHRQHLGGDATVLSIRAVRILLEKFISAMSSKLRVKLVECARSAFERVSRLIHG
                     SPTSDADSGFVHTKRWELQEELLQCMSAAAQSDSAVQAALPPLQEQLTFCKSVMDVSL
                     DMCLQALRMCCVLLRSAQLSAQPHLVSMIRDLFQSRLTALESMEMNQDWLRLLRHLTE
                     VAVTLKAYAARTPETAEANAITGKRMNRKRKRTMASNPSRAARISAAGVDGERGDGTD
                     EALVLLRLCQKVCATPRLDRAFRSTVFSCVNAVLSDAARIAGVSADTCVSVAMDLARE
                     LTRNVRTTLTIANPFVNREVVSGTSSAAASIPLARGDEEADDDEEQGEDLLSSTEGAK
                     WHLPEPEWPLLVLIANIFAAKTVPTPEHMWWSVGDDEYARRFSKEDRLRLTNAFFAAE
                     DVLDLKKRGSRVHLSTMREFLWPFDLGCRVLFQPVPCTYAVAEAVPVAPSLQCPPSRA
                     GELTFALRKCDVSAFLEHLGAVLHNGGDVAAFGQSVLLQVLLVVGPHARDVTRAALLS
                     FLADAATPLIEQVSEVLVRHDRAWASTLLDAGVTETILRRSTSVTPERSPVVQMLRRE
                     AASLPSTPPLLPRCGLPTVGPAELRRVLQHGGRSDVEALLEVLTFTEACVWDTVACRE
                     AVRALAGAAALGKDSTAQANGAASAGWARQLEHLLTSLVMKRLQDMALQLQQRRTLQQ
                     IVEESEVVEVIVCDNGRSSQFTCPRQHPLHHHHSCNWKCDECSASGLQDAWSCRECDY
                     DLCATCARTRCNRVNGALTATTQDLLTAWRASADTSTEASAPLTRAVLFSEERGLVSV
                     ATPLACLHRQSVHLGEIYTACPCGLVSPGPARPLEAAAATDTFLLGTLLSLFGRTCGQ
                     DVGVQRRLLKAYESAGPFVFLGGARAVPAELRCLTTHLAPHLPLSVKNLITRYVAIDC
                     RRFAFQTLHDQAATVMSANTGVAPESPKPHKTQVPRSDKPALLRVLHDSFCGLLSPLV
                     KVDFTFEGEEGFGSGPSQEVYTELSAYFRAESKFWFVTEDDGGADPVTLPFPTTKALF
                     LKEFFALGAACARAFIDEYRMDMDLLPQAWPLLMLPSLGLPVGQKAGARSSPCASTLA
                     ALTNLLEVLDPSLHRSFAQLRRISEAELAAVGLEMDDGTLLRTHADLEQHLQLTVVTR
                     FEVALENLRHFQWGLLSVMEVEALWCLSDEERSMLICGSDAKADGPLFTEEELRAQTT
                     MGSGYSSGSVHVEMLLSIVGGDFTRAQQRDFLEFLTGSPRLPFNGLAGLGRLITVAMK
                     DMESKDEQTLPSCNTCFLYLKLPPYTTREIMRERLLLAVTEGRRNYSLS"
     gene            <1560458..>1562953
                     /locus_tag="LDBPK_343800"
                     /db_xref="GeneID:13387418"
     mRNA            <1560458..>1562953
                     /locus_tag="LDBPK_343800"
                     /product="adaptor gamma-1 chain, putative"
                     /transcript_id="XM_003864491.1"
                     /db_xref="GeneID:13387418"
     CDS             1560458..1562953
                     /locus_tag="LDBPK_343800"
                     /codon_start=1
                     /product="adaptor gamma-1 chain, putative"
                     /protein_id="XP_003864539.1"
                     /db_xref="GeneID:13387418"
                     /db_xref="GOA:E9BRH8"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:E9BRH8"
                     /translation="MSSMDSMRLQATIRLIRQCKTSEEERSNVKIISAQLRKGFADAK
                     PYIRVRYMLMLLYIRMLGYPTEFAHMEVLKLLSQTDFSGIRVGYLALQLLFSESDEVL
                     TLVENRMIAHLSVAGSRRGISYEQLCLIGISLNAAANIASEDMCRDLLDSILHLFKNS
                     PQQLRSKAALAALRVVRKAPDQAGYILEHCADLFDGNTESLMCVLTLVIECLQTDSGA
                     KMIGAFRKHAMSAMRALKALVLSSRITEEDVGGITDPFLQVKLLHFMRIIGAGSDVTS
                     EALNDVLAQVITNTDATRNVGCAVLYECVRTINAIESDEGLRTLAVNTISRFLSSVKD
                     NNLRFVGLQTLLMYSSKDFDAVVQHQAIVLECLRDADLSIRRRALDLTVTLITVNNVR
                     LLVPDLIAYMSLCSEEMKGDVARHICSVIETHYPSDIWRVDYSIRFLKVAKQFAPLDF
                     ACNLLAVLSSQTKDVQTRAVEALWEEASYPFDARHQSRKAFLMVALWCIGEYVELLLG
                     AVKGLTGADVATCLSSLITNTSFTLIKQYGLTALMKVATKCPDAKPQAMATFASNMTS
                     MDCELQQRACEYTTLLVDFPQEAVFSFSQMPPINPEADAVKPVEVVSLTQEQLHQETT
                     NTLDDLFNFDGATKPSSPSTDTPTLIGGSSSQVNSLFSPDSAFPTVSQRAPSSTNAFD
                     GIFGDSGDGCAPAVSGSTMMADASVKSESASPTGAGGVIGVPVCSCADFDVLLSGRME
                     GSIIFADLAVQSKLSDAVEQLSFSVAVLRMCTVEVAPLPSTIAPYGVAAQRLKVDNTQ
                     NTANPHMLALRVRISYTVRGEPREQMFQVSQAL"
     gene            <1564133..>1564579
                     /locus_tag="LDBPK_343810"
                     /db_xref="GeneID:13387419"
     mRNA            <1564133..>1564579
                     /locus_tag="LDBPK_343810"
                     /product="nucleolar protein family a member-like protein"
                     /transcript_id="XM_003864492.1"
                     /db_xref="GeneID:13387419"
     CDS             1564133..1564579
                     /locus_tag="LDBPK_343810"
                     /codon_start=1
                     /product="nucleolar protein family a member-like protein"
                     /protein_id="XP_003864540.1"
                     /db_xref="GeneID:13387419"
                     /db_xref="GOA:E9BRH9"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9BRH9"
                     /translation="MPQDEQAKAAEEYDYDRELYRCPISWPITSDKPKMTKKVYSLIK
                     KTVTANKKRGIVKGIKDVTKAIRKGQKGILVLGADASPYDVVSHFPVMAEEAKIPYVW
                     VPSRQDLGTATQCKRATSVVLLKVNEELKSSYDKIVLAIEDLNSEE"
     gene            <1565936..>1567372
                     /locus_tag="LDBPK_343820"
                     /db_xref="GeneID:13387420"
     mRNA            <1565936..>1567372
                     /locus_tag="LDBPK_343820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864493.1"
                     /db_xref="GeneID:13387420"
     CDS             1565936..1567372
                     /locus_tag="LDBPK_343820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864541.1"
                     /db_xref="GeneID:13387420"
                     /db_xref="UniProtKB/TrEMBL:E9BRI0"
                     /translation="MDFSLTMSAAPHRLWYIDGDVVKVRVSLTCVPGAASGTQMEMAP
                     LQRVPRHNYFSVDSTEAESRETDVRVRPLEVELLGLVELDTSVVKPINWPAAVSEEEI
                     AVSPRPGRSRSAVIYTLYRTGKKTLQEDMHLKRYECAALEFVFRLPEGCPPTFKGRGT
                     DYRHDITISATWYPVRSSASAKAAKPHICKVKVPLVVFNSVAAVAQLPLLSLFPLPPN
                     SALVAEDFHFQASPLAAVPTPWLAAPLMDVMHPQQAQLRTSLTVRHDAKATMQSSLAA
                     QRQPLSLMIPCGGVNVLQVHLHSSCVPLGEYLQGSLTVLQTRQRSCDSAAGPGAQRKQ
                     DTEAPVPVSVTATLELLECVTPECALATSDASVTDAKEHGMENFVCTHRRVIDHAEFC
                     VLDTPCVPFEFSLPVGLVPASTITDITSFLWQLRVVVMVVPRKTLARTAAPGVGQLGP
                     LLAPVAGVFPLLVMPPSVPFKVRQGAAC"
     gene            <1567825..>1569345
                     /locus_tag="LDBPK_343830"
                     /db_xref="GeneID:13387421"
     mRNA            <1567825..>1569345
                     /locus_tag="LDBPK_343830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864494.1"
                     /db_xref="GeneID:13387421"
     CDS             1567825..1569345
                     /locus_tag="LDBPK_343830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864542.1"
                     /db_xref="GeneID:13387421"
                     /db_xref="InterPro:IPR012462"
                     /db_xref="UniProtKB/TrEMBL:E9BRI1"
                     /translation="MEDVVTGVAGTASYPLHVLQRNKKTVGIVGADALAALPMAGSSC
                     THHLVTSATELKPFLTDSPAAEVLFKWCARVSCSLSRTLKRHCLVVKNVSRGVAISAL
                     LEGVRSDDSTVETVWADVERSAELWKTPFTGDSTETLHVYMMSVPEVPDTISNTLHDM
                     PGVSAAVPECSLVTTRVLLGDSASEIVASIRQLFHQFLGTEAESLTATEVCWPASMLF
                     PVNVHTRDDARRRAEHAALRLPYQGLLHHEDAIQAWSTWDDLRRQHEAKDASVFRTGA
                     AWERHLATSPHRDLAPASAPSIPGAETLLVSGAYDYYHYRVDGFRDDGWGCAYRSLQT
                     VLSWFQHAGLLRAAIPSIRRIQEILYQVDPDKASKRAFVGSRDWIGSFEIMLVLQQYF
                     PGLECTIKRLERGQDLDTDSSVQLLLIEHFRSPLAAPVMIGGSSYAHTILGLHMNVHT
                     MEAQYLILDPHYSAYPTQIKTAVRKGYVGWKEASKFFEAGCWYNLCIPRVDLFDPR"
     gene            <1569939..>1570253
                     /locus_tag="LDBPK_343840"
                     /db_xref="GeneID:13387422"
     mRNA            <1569939..>1570253
                     /locus_tag="LDBPK_343840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864495.1"
                     /db_xref="GeneID:13387422"
     CDS             1569939..1570253
                     /locus_tag="LDBPK_343840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864543.1"
                     /db_xref="GeneID:13387422"
                     /db_xref="UniProtKB/TrEMBL:E9BRI2"
                     /translation="MMLRRVAAKTTMAAAAPLLSSTRAYNMFVFKDPVRRPQLSPEER
                     AKVKINYAEWPEEFRDYDPEDPYKNSPEIIEGLSSWNLFLWGVECAFIYQFYEVVFPK
                     SI"
     gene            <1571498..>1572487
                     /locus_tag="LDBPK_343850"
                     /db_xref="GeneID:13387423"
     mRNA            <1571498..>1572487
                     /locus_tag="LDBPK_343850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864496.1"
                     /db_xref="GeneID:13387423"
     CDS             1571498..1572487
                     /locus_tag="LDBPK_343850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864544.1"
                     /db_xref="GeneID:13387423"
                     /db_xref="UniProtKB/TrEMBL:E9BRI3"
                     /translation="MRGSRRLPSLRLVECTAVQSSSVSRPLAPPPSALITASRRFCIG
                     ATRMFYALPHRPHAVSPSSASHPSAKTGDEACSEKGALESPPPSAEARAASATVAAAA
                     PAESMPSNTAGKSTAETTSASAASAAAQPQSLPIQDSLTRRLFASWQQGVVASIGAVM
                     GIGFLLFFLYTPVKEDTVHHTAVVASEALADARLKGQAVQLSKDVVLEVLRNPKSLDA
                     TVDVVVELLAREETKIAVSSLLQSLFEDHYTQEVTKKFVLRVVQDPWIQDQLQMITEE
                     QVRKLLNNAAIKTELSKFLLKSAVDSLEKPQLHYEVAKAMRHSVASLVNFWWT"
     gene            <1573331..>1574323
                     /locus_tag="LDBPK_343860"
                     /db_xref="GeneID:13387424"
     mRNA            <1573331..>1574323
                     /locus_tag="LDBPK_343860"
                     /product="geranylgeranyltransferase, putative"
                     /transcript_id="XM_003864497.1"
                     /db_xref="GeneID:13387424"
     CDS             1573331..1574323
                     /locus_tag="LDBPK_343860"
                     /codon_start=1
                     /product="geranylgeranyltransferase, putative"
                     /protein_id="XP_003864545.1"
                     /db_xref="GeneID:13387424"
                     /db_xref="GOA:E9BRI4"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:E9BRI4"
                     /translation="MAESAAPSGPIVADLHHKFVHELDDNTQWKAQHLKMNGVYWGLS
                     SLVLLHRMDYKPDDVVGFVLSCYNSDGGFGGNADMDSHLLHTMSAVQLLCMFDAVARI
                     DVERTVRWIASMQLPDGSFQGDEWGEVDTRFSYIALSCLRLLGRCECVDVEAAVQYVL
                     RCQNWDGGFGVSPGAESHAGQIFCCVGALCIANALDRIDRDRVAAWLAMRQLPSGGLN
                     GRPEKKADVCYSWWVVSSLSALGRTSWIDKEALFQYILSCQDTQDGGFSDKPGNQPDV
                     YHTFFGLCGLSLLGYEGYKLNPINPVYALSYDILDRLNIAPEHGSQVGRRVPRS"
     gene            <1575195..>1576214
                     /locus_tag="LDBPK_343870"
                     /db_xref="GeneID:13387425"
     mRNA            <1575195..>1576214
                     /locus_tag="LDBPK_343870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864498.1"
                     /db_xref="GeneID:13387425"
     CDS             1575195..1576214
                     /locus_tag="LDBPK_343870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864546.1"
                     /db_xref="GeneID:13387425"
                     /db_xref="UniProtKB/TrEMBL:E9BRI5"
                     /translation="MESSVVDSFAAATVSLTAPQRRDLMRHWLRSLAAAVKYLPRKET
                     SLSASEGVDADRFSPRSSRRARHGAHDGETWSGASPYFSLPTSDLLCLCLRECAMADP
                     TTGPDVLRELLLCAVKLELGEVDVLKHIVHVLTSTNMCRHRTSSEQVELLNMVSLAVK
                     RCKLPLPPLDRVLCVLVGATLSARENLVVLSCIHRLQHIHAADTVAAVSRRAATQTGE
                     YNIKDVVYGLEVAALLPGCNEIFAAGVLLRAGELAPHMSPKELGAVCKYVALLNPSRR
                     QNTLSYSCGRELRALLPLLVERTERLLGHFRFHEARHVLRCFREHKVRHSLIFSRLTP
                     MAEDG"
     gene            <1577056..>1579086
                     /locus_tag="LDBPK_343880"
                     /db_xref="GeneID:13387426"
     mRNA            <1577056..>1579086
                     /locus_tag="LDBPK_343880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864499.1"
                     /db_xref="GeneID:13387426"
     CDS             1577056..1579086
                     /locus_tag="LDBPK_343880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864547.1"
                     /db_xref="GeneID:13387426"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="UniProtKB/TrEMBL:E9BRI6"
                     /translation="MDSIVSLPAASDCADPLLARLQDSYTRQKRQIAAQKRKQVDAEL
                     QAAAAHCSDLPVTLELLSDGTASLFDELERLLEARREQWNTPSRELALLQHIRLQTNR
                     ELRECMSFIEEGYTSGFEKLLRESRLDGRKSALPETAVSLSPATSTLNNVQQAKAASV
                     GPSVTPVDAPSHLSVREALSESISLMAESLAVLLQCEVVRVYLYDTNAHLKCVAQFPY
                     RAQRADPMHSSYLALMAVREVHHIVCQERLVINGWLSKSQSANDGSGRAAAAHNVGSS
                     TAASGLEDIRTCLLLPIFSPEGAGKPYGLVHAVNKQYPTALGAATDDSTEVAHVGFTA
                     DDETLASSVARVLGTILHRYPVELFFASGTGEKLRRSAFPGDAEVLSLTAHLPPILQD
                     EVQDAAEVAQLALSHLTPILAHRVPMDAIYEARTAAGEGRRRKLAVIGPREGAVSSVE
                     FNLRCMKELWESSRDDNVTLHKQCRTLQEQVHAMRLLLRNVLDGLAVARAMQLSTDVA
                     QFLHNLEMYGRTERTERMAEYVSEKMLAIPDNTVGGPGAADARAKAPSLEADTNATQY
                     HMRGSDLQTLQNHHARLNTVTPASLHFDGPSGVRSYTSDPAQKREQVRFIDELCRLAR
                     DEKPSLPLARGGGGRRQVLPSTLPTVTRAKAARGSKPAVKQDLYPFGRPFKL"
     gene            <1580708..>1583428
                     /locus_tag="LDBPK_343890"
                     /db_xref="GeneID:13387427"
     mRNA            <1580708..>1583428
                     /locus_tag="LDBPK_343890"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003864500.1"
                     /db_xref="GeneID:13387427"
     CDS             1580708..1583428
                     /locus_tag="LDBPK_343890"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003864548.1"
                     /db_xref="GeneID:13387427"
                     /db_xref="GOA:E9BRI7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9BRI7"
                     /translation="MRSGYVGIYNQGSTCYLNSVIQALYHLPAFRTQIYNLPNVQKDS
                     VALALRDVFAQLEVRNRNTTTTELTKAFGWSAQEAAVQHDVHELMQQLFDSLETTLKE
                     TPKKNMIRDMFGGLMIYRSRAIDGAEYLSDRLEDFYDVELVVQNKANIEESLREFSSG
                     ERIEGVCVEVMPGADATPHTIERSQHFLDCPKVLLVHPNRVAFDMETYELVTLRNVWS
                     FDFNLSLASYVVDDASLKLDKESQEKWKKLSHRTHLGANYSLRSILTHAGDATIGHYY
                     VYVNFDGEWVRFNDEVVEPATEEDVRKSAFGGQSIQSRYRLFDNERASLLIYVNDDVK
                     EELLNETPPPSAIVEVGRHIEEERARKEETHKVSYYLCDKFVVDVLDGVHGASDKLQR
                     HMSVRLSPGQDEMTAIITTAAKELRVAPEQIRIFCRDRHGLSPWCAVESMCNSYDSYY
                     YPPIFIDIAPPLAEEDAASATIAAAAAEPFLAFLRNVESPHDRDVPVTIVRSIPELQA
                     RVPRDAVVYESRGGPQYLNAITATNQLVCGANLLYTHQRSSNDAVRGYLQQRQLVCTK
                     VYLYDDYTAELTELFEINIVESTPYTTLQAGLYKMMTESKRGLPIPPSHNHLAFFKGN
                     DRCNYAFAMPMAASLTIQWNTYNHTLRDVWGSVQHEHKIVMTILPMPLEKIDLTVLVT
                     FNGGYNNLPHVYVPVEGGSVTFRELLELMVQQLGSRLRAGAAAGYEQQLTGQARLLRL
                     LRVRRGELVEVVEDLDTPIDLEAREDIVLDKLCPALPGYELVNVLFCRRRSGEYYFGL
                     PTNICINSSLEEQGDVLLRRIVKKLGYPDQEEAMKKWILCVMNVKSRKTRTASKKEVL
                     ADLVKEVGGAPFVFVVDRPQCLLLDGIEEEEHRPESIVIKSASKTDLSAA"
     gene            <1584921..>1586990
                     /locus_tag="LDBPK_343900"
                     /db_xref="GeneID:13387428"
     mRNA            <1584921..>1586990
                     /locus_tag="LDBPK_343900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864501.1"
                     /db_xref="GeneID:13387428"
     CDS             1584921..1586990
                     /locus_tag="LDBPK_343900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864549.1"
                     /db_xref="GeneID:13387428"
                     /db_xref="UniProtKB/TrEMBL:E9BRI8"
                     /translation="MPPKAKAAEPKPKSKKALALQAAIDQSTKEAQKTYKQHEQLRTK
                     ADQVEKSQREYLLLDETVARERIKEEKKRYRAAVADLRTEEQLAFATYIKHDHWEHIS
                     EASRLPNVHSEADINDFLSSWKSRQAANDRYEPDTVVIASRAPNSTEDGKLLFIRGEQ
                     RLPPQKRRALIRGELLQCYDAYELAEKIKDDRDTYNSIASTAAFQKPMPWASVLQQVY
                     LQLRATFDFVSTQTLRFYDQVIDSADGETVTRTVSAANPVIKFGLWVKTKDVTRSFTS
                     LAFPEIEVRLDPKQNSLPKLPKMLGLSKENIAVRAVQLAFDPYSCYVSRRSQYYALDC
                     TIKIDLLTFAERPRPNGEWLLRMETPESHRLHVEEYPPRTAEARVEDPALRISFEVPK
                     SIVIRQPSLFIGRWNEETHEWEPCSGATLGASFGPTVRVAENPRRATFIASELAQFAV
                     LHETVFDVVYESWSLKPFDGSRILVTLEGRHRGDATDREFRFLLEDAKCRLLSPEDDE
                     LAPLRTSCWSPAVLLRKLKQSGFNFLVRDEEACFLENVIPKTRQLEEKAYADMAQFSQ
                     YFTIASSRHNKNGEDADMALFRVSKRWLRPGEEDESFDIPTTSDLWHSIRYRTDDCAL
                     ACFTELDETTNMSILDGAETHYNLYSLLTPVEGEESLRGQLLNTNYLLRRCVLEFLQL
                     VRPLTWG"
     gene            <1588350..>1589150
                     /locus_tag="LDBPK_343910"
                     /db_xref="GeneID:13387429"
     mRNA            <1588350..>1589150
                     /locus_tag="LDBPK_343910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864502.1"
                     /db_xref="GeneID:13387429"
     CDS             1588350..1589150
                     /locus_tag="LDBPK_343910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864550.1"
                     /db_xref="GeneID:13387429"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BRI9"
                     /translation="MLRRSGVRLVYERFEGHVSGDKGHMTLQQACTIFGYQLDEEWTK
                     KDIKKRFQKLALRFHPDKGGTDEQFLALKEAQHLLLTHRHDRGADWAAKGAKGEGGHG
                     GINFRRMNYDNLTNTIHRQTADNPECRSFGLQDFAVFLVFITAVGMYYVYKTYTTHMQ
                     VLRSRWSYSEDAIRADYKGKAPSEGLWHPWIADVETRDRMDDIAILQGSVKRAFIDEK
                     RKDAPPVYTPWQSGGPFARHMAPTRAPEMPEDAHASASTPSTTRWLRA"
     gene            <1590546..>1592015
                     /locus_tag="LDBPK_343920"
                     /db_xref="GeneID:13387430"
     mRNA            <1590546..>1592015
                     /locus_tag="LDBPK_343920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864503.1"
                     /db_xref="GeneID:13387430"
     CDS             1590546..1592015
                     /locus_tag="LDBPK_343920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864551.1"
                     /db_xref="GeneID:13387430"
                     /db_xref="GOA:E9BRJ0"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ0"
                     /translation="MSSTANRTEDAASSALDGDDATAALLSSPAVTTATAEVAQLRQE
                     LHQCQEKFASWKAKAKTGVEQMRAQIVDLTCKLDESNKQRALLEASLGRGTALPALYV
                     AQSQEFMYAHAIAAACLLVDTVLLSHSGGGPGQYKDTAATSPARSPTLQSTTTESLQK
                     TVKDQSDRLKEAHHALKRLSNELQQRTAALHQQDENLADLRRRLAELEACNTSLKQQL
                     MSVPNAQEWKHAQEELDQQLARTRLEYESRESQLVLQHSTEVQALKAVHEREVQDMQR
                     EQRDAVSQAVQDALANRSPTLVRGGAHPGKTDDDDDAYLDLLNDYKAMEMQCAAATQE
                     RDTMAAEQQMLLRELQELLQSARGPLPASAANGTSTTAVTAADGTQATAGWDSFADTA
                     NLKEAVRRIHEQRLTFAKLQEELMHSRREVMQLRRCKAGPPEDGLSAQQLQYVRSVVV
                     QLLCSLSDIRVARHLLPVLSMLLKFTDDDLQAITKAMLQ"
     gene            <1593521..>1594447
                     /locus_tag="LDBPK_343930"
                     /db_xref="GeneID:13387431"
     mRNA            <1593521..>1594447
                     /locus_tag="LDBPK_343930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864504.1"
                     /db_xref="GeneID:13387431"
     CDS             1593521..1594447
                     /locus_tag="LDBPK_343930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864552.1"
                     /db_xref="GeneID:13387431"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ1"
                     /translation="MTSWKDRIAAMLFFRDPEEALTAEKMRNAEAMAKTTEVRLQHNQ
                     DEREVKEKMLQLENGIKAQRERYARQAAPMLKEFDDIAISQHYYQEVGNSVAAQETFV
                     DQMAQRETHQFGYISKKLISVSLNFEALRQQMRSGKPFARELKATLDDAESEDLNAMS
                     EPLRAFADRGVPESTLVRAAAFDLARSIEETGKAPVQQPVLGWLDLLKFRTAFSPSTV
                     DQNEVRARRTAAQFTRYIEQRQYARALALAEEVDTWTRNEHDAAVEYFNNSYRSFRQA
                     TLPVITAEIFLAYAAASLNASRVACVEHMLKE"
     gene            <1595053..>1602852
                     /locus_tag="LDBPK_343940"
                     /db_xref="GeneID:13387432"
     mRNA            <1595053..>1602852
                     /locus_tag="LDBPK_343940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864505.1"
                     /db_xref="GeneID:13387432"
     CDS             1595053..1602852
                     /locus_tag="LDBPK_343940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864553.1"
                     /db_xref="GeneID:13387432"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ2"
                     /translation="MAGNTSHVKQLLSTARMYRRSDMLHDIVCEVRDAEMTTSRFSAE
                     LRVLCAEVAVELKQWSAAAELLKGLGAAQETRLLAVRRAFCEVLVSLHHVDENTSLTE
                     DEKVQEYVAGAASALQALAEAVEVWPDSLDAVLTGIRTLWLIASPLLSAGHEADVCDA
                     VAFLATLHQQLHIGGGYTLVQWLVRAALCLRAAERPNDALTRFSAALEAAALMGNQRL
                     FVQVLRLAAGVILVKEKANVSSKTRSDLLPSYRNRPVHFAVLLTHLVLGGCLEMEACK
                     EDLQSAYHTLSDVADVAQQPPETGASAPRGRKKQAAVKLPPAIRLVDTFAVTESDVID
                     EVKSDLLLCISLHGTLSPEQVEELEQKRSSSNHRVRSFAAFALVVRESHRHGLRGLGK
                     CADASSISAAHRAELRTLAGELVDVLKNTNTIHDESERQHTLRTGASLLWNLVLPFLQ
                     TSTMGDAQAALAAVADVSQAFMPALRKLFLQVTTQQCHTAFEEDNRSVLHQLLPMLQR
                     ECQRGEVDGAAPACLFRLQWLQHQMAIREEPESSLTSQEDRCLFAIEQCRGIANPLKR
                     VSVIKTAFRHLPSIVEENDAHTTVAEASELQMAAPAGGALCTRRSTVQLYRELLELCM
                     QDLSASLYAVAMAVAEALRGLPCPLPGAGAADIEEVRAAASLHAATILARQLEEAEPH
                     GAQKDVRSASVADHRTAAIEESENRLAALLIEAAQRGAEVESRRSGSGGWIAANACVA
                     FLKWKKLSYERGEYRAHLAELLDLQKLYTALYEHDQVQDVELLSDLTTSSVLGLVAEY
                     LETSNPPAGAGTSPLATQMGRDGFAAHVRRLRMCANCEPSNVQLRRAHAMCLEALQII
                     PGVKQKWFLAMLSPALARLVGDKPRFSPHPQEQLFILLGILAGPSAVSEKVALLINDA
                     RPLLRKDPCVRLCAWVAAVATQLGQEEVALECCEVADRLYASNRLGWGSLLEMPSPFS
                     PGGGALAAPGKTTDSGSHKKASMEPALAQLDGQTTFSKPDAEDWEAYAELLYIKAQVG
                     VQHLHGLVSVARNRAVQLLLTNCVNAAIAAVQGPAASKVEHITNAYTLYYTFLRTTRI
                     SLETATFVLPSLRMLLSKALLAQLPKRSWSDSFTEVVYQLSCVLVHVSLSSEQDDDAR
                     QLVAVLRHLRELLPPRYQKSLKDRELTEVCYRNPSIDDFLQRSKNMEAELQARGWMIV
                     ALASKDITGEAEAFALALAASQGGSLATAQCLFENAYAATLRRGDSTPLAQVTRHLQE
                     ALRTLEGLPAAAPLLQSLEETDRWHATLADASLTATFLRSQPQRHCPHNGDVAGEVAE
                     AARGERQAAPLKASVKAHSTKITGVTFHHAFLGLRIVSLLFRTTPSHDVVEVGAASVK
                     AAKYAPAPASRRDCAKVMLDYVSCLWHLSAKWLCEGAADEETVALKLPIDTSLYYNYA
                     EPSAAAQRLRRCVPDEEFKLNTEGLWQCLLDLGDYLARTGDEPHSFMVYSWVRFSVAL
                     AFGGARGDSRCGLVQRLCNWKMCAAAASSGLSDDPYVAALNQLADTRSLVEEAVKRDV
                     EGKCVSPSSEAAMVVSECEVRIHLGQTEQAATLAEDVLCRGLECASWNTAATRARALR
                     VRARHEAICLRYGDALRTLQQAFQLIGAATPSSAPTVISVPLWTELCSDRLAVLMDSQ
                     ATAEAVQWAGTVRQQLHQWRAAASPSAMQVDTTHTACLRADVEDALELWISRLVTTLT
                     PQVPVGDALSHPTACSPPEHRRADTEELLRELLLVAEGPTTLHSCLYTTHAKWHVRDR
                     VTPQWLAQHSAKVDDVRTRLLVLLAEMRVLDELSLRLQTARASCKVGVGSPGQGEVDA
                     ATATSMSFWQGALVYWTAIDRLEASELASYLLVAFRHLSMEDLQLPTSSAPAHCEREV
                     LRFIRGAASSSCAATVERAPHAEEQAVMVGARWQRDGARETDELRQALQHYSVTDARA
                     QYIMDVSAVPALLEKAAAHCRQWPHTRLAAAIVVAVAQVEVLQRVENQLEQCDDLVGE
                     ELQAQTHALLTAAWSRARLIPARIEKPGSRMRKGVPAGKQRKLSEPTSSAPVRPLTEE
                     EAALLQRISRGIQVAVHHGHLDAAADLSDALSHLAVLLERPHIAAAAAERTQANQLVG
                     LLWRSCVHEMADGAEGRLWRQMLAVQPLFTNCTSYMQLAGQIVTATPMRRGLRSCSLL
                     CVQAEEEVAAVASTAPGKGGHATEVSPYAVDSAVLSVAMGNYRTGFCIVTLRHPDGAV
                     EGRRRHVPQQTWATLAATLQRIETQKQEQLGSADDVGIDAAEERVTAEDLSSMLEELN
                     AVALGLFGEFQASLQQYCEKTPLYLCLAPELQPFPWEQTCVLSCCSVVLRELGAAAVV
                     SRTGELQRSGKRSLQHPTKPAGPSFTKGSSAGPLVCLVDLFGDHRESVPAICGTDQSK
                     SKVPPQCLLTCSSAGVPPDATYLTWMLRNTAPGALIVNMCGSLTDALPWSYLASLTFT
                     QLHSVVLADGAFNTSSQWREEQFRLLASATRIGKAGSPPSHPRWMTQTLFLLRGAKFV
                     AANALPCSPCVTDALARRCLSSASSGKALVEQLRGKSRDTKMPFVTLYGVLLGSGPSK
                     AKA"
     gene            <1603779..>1604603
                     /locus_tag="LDBPK_343950"
                     /db_xref="GeneID:13387433"
     mRNA            <1603779..>1604603
                     /locus_tag="LDBPK_343950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864506.1"
                     /db_xref="GeneID:13387433"
     CDS             1603779..1604603
                     /locus_tag="LDBPK_343950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864554.1"
                     /db_xref="GeneID:13387433"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ3"
                     /translation="MDTRPPAKFIAVHDYLGSCASLQQLLNESIADLPLSRLTPTEPL
                     EVYCADLRGHNFSEAAPMTSDSAYLLACAADIIKMQEDILRSEAGLLGLGFGSLVASC
                     AALHAPDAFSSLTLFVREIAQLQRCLPSSYPVGELLRRAPANATALAELNSYLRDRIP
                     DPAERAALLAAVEVRRGLARFRFSNDLLQYTEPFVLNSPAGSTFTKPTVVYLCGKDGA
                     ISPEEEARVRERFPAVKFVKLDTQGETLTSPEVRLVPLFLQSCGMLGEINEANMER"
     gene            <1605588..>1608035
                     /locus_tag="LDBPK_343960"
                     /db_xref="GeneID:13387434"
     mRNA            <1605588..>1608035
                     /locus_tag="LDBPK_343960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864507.1"
                     /db_xref="GeneID:13387434"
     CDS             1605588..1608035
                     /locus_tag="LDBPK_343960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864555.1"
                     /db_xref="GeneID:13387434"
                     /db_xref="GOA:E9BRJ4"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ4"
                     /translation="MLRAIPLVCVAAVLLTCLPVAAIHEDEQGLRDWIMHLVGNVQDS
                     AAQVATNPQLLYVASEDGAVAAIAVGAYGGLNLTWRQISSATPLCVAAGPQAVLTVNN
                     AGVATLMSPTTGSIEVTYALQTVTTTLQAAACSVVSGKAVVVTYDGATLKRFEFSTAS
                     EEQSIPVAAYASASGEVSKMYVAGSVLLVNHGSDSADVLRLDNLAKERSVAGMATSIA
                     ADGHFTTRDAATVRSFPTNGAASEVACSDCGIAVVRNAHTGEPTGVVRVETQVDMLRI
                     TYPNSVVTIPNICSSITAYPLLAFEKDDGDVIVLIKTGAHNLLLVSAAEGLVWRRFEA
                     LANVAAAAIVEPMEALDHFHFNKNILLVSRFGTLYSIPIAGMGAQVDYIKDFSQELAA
                     AMKAPSMAKVQVRELAVRDDGRTAVVHAESGATSGHILIDLAERMVTSVTTCENAVLS
                     TPELEVAADLSVRGSLSHGVFYTYASHAESGTIEGYSVSAAAGARPTWVVQMPSAIVA
                     HAAGSEPRRTDVVNNLRVYPNISGREMVEEVRRTYPMRNVIAVAHYEPSEEELPSLVI
                     TAIDVVTGSILATTRHANVEGDVKMVIVEHAIVYYYLDAKKMRYCFGVWELFEDENSP
                     VVSKTAGATIPQIIASFFVNTKREFSSRATRPPIVVVSTLGSFGGPLADMGVTTSYNA
                     IARKSLVLAYATGRVVVVELRHLLAGNQMPLPGAKDRQMSHLLLPSFLFASHKYRVAF
                     PRKITTEPTLLESSCHVVVSGLDLFYVRSSSGKPFDLLNSDFNKPLLITLVCGFAALS
                     VMARYFVNRKALNSAWQ"
     gene            <1609269..>1610666
                     /locus_tag="LDBPK_343970"
                     /db_xref="GeneID:13387435"
     mRNA            <1609269..>1610666
                     /locus_tag="LDBPK_343970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864508.1"
                     /db_xref="GeneID:13387435"
     CDS             1609269..1610666
                     /locus_tag="LDBPK_343970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864556.1"
                     /db_xref="GeneID:13387435"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ5"
                     /translation="MASRGAAACAIRSRAPEVHRVSSDNVALQEEAKSVRERRLALEE
                     VMRQERARRLQAAASRTTATANTSHSSGCAAPPREQQKGEAVDSNRAPQTLEEYRREL
                     DKDCRNKELLRLHYYTSGHLNPADVHFYTVKSRVKEYQRRAPSPPPSARARRLLLPTR
                     KAHLETEMTQPSTRALETISVLEGTSEQWTKSALLRMQANQHVLRRIEERERKEVEHI
                     GRPIVRGTTAPAGRLSALPQPYNAPVTTSAMASRPVHVAEAAVSACDAPRCLAVDRSY
                     TATAPTWRWSPLRQRSPRKTYLTTSPLRLRGRAASPAAAQSDSLFKTSLIDGSSAPLH
                     MSRTVSFPPTSAGHNGRATCSWRPLEYSGTAHLEGRRSWPAYKPIAEQLPSAPSESPG
                     TWAELTQSRSHPRQGLTAPSPPPRDYSARETGEGAPSVPTVGPPITKPKPTLLNGFRM
                     PDTVLKREDLFQGFI"
     gene            <1611660..>1613636
                     /locus_tag="LDBPK_343980"
                     /db_xref="GeneID:13387436"
     mRNA            <1611660..>1613636
                     /locus_tag="LDBPK_343980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864509.1"
                     /db_xref="GeneID:13387436"
     CDS             1611660..1613636
                     /locus_tag="LDBPK_343980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864557.1"
                     /db_xref="GeneID:13387436"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ6"
                     /translation="MEALSRGFCAAALVQSLAPKEVEAWHRQWPQPTLQVVDIQRYPR
                     VPTASRGTSRFYMAVSDSESVAWLVVPPCTALEDSVAAFEIEVGCCVTLLSHALVTAA
                     NGLNVVVPLEVKYSNNTLRLLGQPSCAEALFPLSAHSLLPRHNADDHTPCAAAASQRP
                     LHAIALRDFMDAPQRALGNWCVTARVVWKGREYPLSSHASRLGGSSDPRRSVCAGSPR
                     FVFRCLLADEHGDAVMAAFYGGEALVERVRLHGCYRLAQGMVKWGTGESGAPSELQFV
                     EKSIEEELTSGATQQMFPFHASALVGEVAQQLRDVVAVSETAQVGGYVSVVGIVVAVQ
                     GNTQVTTKRGRVWRSVVTLASIAEHSAAAGRCSGPFVEVTLWGEVAEAVEPALGERWV
                     FHPCAVHLFQQRKTLSSLASTMAVKLVPHTCGAKHAPRATASPGWEPDGGGADAVPSA
                     VTAGMSVGSPKVLKKDMQLVLDLQEASPTLPVLARVQEVVRPFCDWMCTECCRTQQSV
                     VTAGSIAAGKPTACAHCSAAQLCPTLRLRVWLSDGLCTGLAAFHGCAAESLLEASPAE
                     VALDVERRSAFVDEMLDRLVGLPVLVWLLPCGGADSFDAAQFIVTNCKRIHYVSGAHT
                     LLSAIDTFASLDEGVSSGAADVLAQTLPATGDTA"
     gene            <1614765..>1627490
                     /locus_tag="LDBPK_343990"
                     /db_xref="GeneID:13387437"
     mRNA            <1614765..>1627490
                     /locus_tag="LDBPK_343990"
                     /product="dynein heavy chain, putative"
                     /transcript_id="XM_003864510.1"
                     /db_xref="GeneID:13387437"
     CDS             1614765..1627490
                     /locus_tag="LDBPK_343990"
                     /codon_start=1
                     /product="dynein heavy chain, putative"
                     /protein_id="XP_003864558.1"
                     /db_xref="GeneID:13387437"
                     /db_xref="GOA:E9BRJ7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026815"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ7"
                     /translation="MSLSQATKDCVTAVRKAVKKRICGDVVSEERIGAVLQLQLPATA
                     ASEAEVAQILLSAMVKAACGAQRGSTKLPNGEVIVDGTAPLALHSFAEVVRVSTFRFQ
                     DLPAGNPALRLVAEATYTRHLQRSSELSVQCIHNFPPCLLGEALSRFDVSVGGYVVLS
                     LSVDKDRGIQLRLFTTAIDAVMACMCSTSFTAEVLPRKWASRDTLQPPQLLEMLEEVQ
                     MAISEYWNDSAQDDHARSVAVFLMRSVGTDICEYFGTKAAAAGGLFRGEKKVLEEAHV
                     CCEEWLNTCARLTTIDWGAVWRDRYEDAALVCVRDRLRTTLALRGIIEEIRELLGASD
                     FRALKTDALWDVFDDVDVMDPSSGAQSEWGGALAAYYRRLEPIEQRCAGVLRDLFATR
                     AGLAPQAILHEFSGYCHLMKRPIISRELVTERDGLLAKLNDRLDAIRLEYTRRAESTE
                     DELVLEEEDRRCQAGRFFPGVVNNIIWLRQLRGRVEENIAMCTSILVDLPTASAFVAS
                     ANQLLDELHDYEQECYRNWVADVEDKSDALTLDADAPLMEIDAKGRVDVNYAERLVQL
                     LKEVRVLGAIGFHIPRTIARLAQQGAQFLPMGVALKQVANTYNSMAADIIPCTRAMLL
                     EPAVSFEKIITASGEKKLTWRSKKEAARFIERLQSAAQSLTEFNRRLHKTHHEIEGMV
                     VELLDISLLRSRDRWLSKARQIREKIETSGFQNTESWRHFWDMQLYKAMEAQYQLGLE
                     SLNEAVEEIKADIVYHAESGQAALRPPLEVLRLQYYQRISDFITFPRRFQGCGKEGVF
                     HEMPSRNAHGIYVVLQSAGQLFKRVMHELKRFSPYLVIGRCGLDGNPSLEEIVGKSLT
                     EVQHWEQSVRLLKQKSKDINSEDLFIRCGCITLCTAAIKGAVEVHLVRLTDALKVTLK
                     QSAEKHLNSINDYLAKAAKCLDSKMTKLGEIGQANLLYGELMEQRPAMEVEFYHFYNK
                     NVLLQNMTGTPGLDFTKTKDRWTNFMKRLDSHEKEVDEQLNRIQENVSSSVREWERDS
                     VRFTTRWHELKPKELTAHKPLAFVMKKKEELQALKERGEECKKQCEYFHLDEPDLQPI
                     EDAEADIEDYLKMWSMLGDFQLQVQELCKEPWISFCAKVYRFEDFVKLWQGQLKEIPA
                     NSVTVHIRTILDNWSRCVPLLKYVRGEGFTSAHWTELFQLLKLRSLTQDTVKFGQILD
                     RYEDILKNEGPIKKLHSRAQGEAQIREALDDVRAWGTGARFALTPHQDRAGVVLITDW
                     KDTMSALSDNRALLLSMKESPYFGLFSNDATKWEERLSTLDEYLRHMNQIQRKWVYLE
                     PIFRRGALPHEKQRFDRIDSAYLTVMKAVENDTRLMALAEHTEFKATLHDVSEQLERC
                     QKALNEYLESKRDGFPRFYFISDDDLLEILAQSKNPSVIQSHLKKLFMGIHSVQFDAQ
                     RENILQIQSLEGEVVTLLKPVRVTEEVEAWLSQLDAGVKAALKAHVAQCVAKADIGTY
                     ASQVLCTAEMITFTRKVETAIRDPIGSAAALQKLKSQLQTRLRELTAYAGGNSDALVG
                     IKLKALIMDLIHNIEVVQLLIANGVDKESHWLWKKQLRFYLDNTQQCVLRMVDAEFRY
                     SYEYQGNAPKLVHTPLTDCCYLTLTQGMRLGYGGNPYGPAGTGKTESVKALGNAMGRQ
                     VLVFNCDEGIDFKSMGRIFTGLVKCGAWGCFDEFNRLKVDQLSAVSQMIQVIQEALKN
                     GDKECQLLGKSINVDPNAGIFVTLNPAGKGYGGRSKLPDNLKQLFRSISMSAPDNELI
                     TETILYSEGFENATQLATKVVETFTLCSQLLSHQQHYDWGLRAMKAVLRLGGTLVHDF
                     LMERVAGKVQLSAEQILQKESEILIKSLRVNTLSKLTFDDAVIFNTLLSDIFPGIPVL
                     EIDYQKLRPAIEESIKELRLQVVEAQIQKILQLYEALQQRMGVVLVGPSGSGKSTLMK
                     VLRRALQRLGTKVPLYVVNPKALPREQLLGHMDPDTREWFDGVLTDAARKVVKEEASA
                     RSWIVCDGDIDPAWVESLNSVLDDNKLLTMPNGVRVQFGDNVNFLFETHSLEFASPAT
                     VSRMGIIYLSEEDVDPKMTVASWLAEQPEELQQQLRQWIDAYFYKAIDLLLSSGDLVV
                     GTTRTGLVMSGLVQMRNCTTKKQFVLALLYGLGSYLPDETRRTYAKDILLLAEERAPD
                     AKNPLDFRYDEDRQDYVSLEFVPAADLAIDDLYRHPMVSTVECQRALDVMRAWTKPTS
                     PGVYRPFILVGPEGCGKTMLLNNLFMSTTSTRVASINCSAQTEAIHVIQKLRQACSIF
                     NSNQGKVLRPKEAERLILLLKDLNLPKPDRYGSVQLHSFLQQLILYNGFYDAELEWVT
                     VERVQIVGSISPLGSMGRHPVAPRFLAITSVLSISYPSKEALQQVYSEFIKVMLESGR
                     LKLNMPNKGAADLARGVTTIYETVAARCTVDVASHYVFNPRDITLWVLNLLNYDTPNI
                     ADVLAYEARRIFVDRLVTVEERMRLAKVIRDNVTLLVGHRDAPSEKESIYYVSWLDAT
                     RVGKKRLSGTTLEEVKTSAEAFALNYSRENAGLNVQLIPEVCAWIARVDRVLSQERGN
                     LMLVARAGVCAPQIVRLVAYNNRTEVVTLGITREYGVKQFTAELKSVMTKAGVEGQSV
                     VLLLEDFNFFHPYFLETVNSLLSSGEVAGLFTQEEQDALLNPLKDEAAGEGMSTYNFF
                     VDRIARYLHIVVVMDPTNRNYELQCRANPALFTRCNVYWMGTWDSSSLKVIPRIMIAD
                     VYKALDQREDKKEFSLTTELVHLHRSFGEKFAPQHFKVLCETFDHVFQEKSRQVADGL
                     ARLKSGVRKLDEAQENVDKIATDVTEKKQLLEVKQQEADDALKEIQKRMEEAGNQKRS
                     IHKMQKELDKEQSAIQERKVVIEGRLSGIQLVLDAALSAVSSIRSDHLTELRSMAKPP
                     AAVQCVMQGVVLLIEAGKGAEAATWPAIRKVLAGDIKGQILNYDIDNVGAAARTQVEK
                     FIASNVEYFKRETIARASKAAAPMAEWLKAVVEYSKVLETVAPMRDELKEYEANLQKG
                     QEEMTKYEGKLKKVEKKVEELKGKFGEKTVEAERLKDKLEQAEQLLENAQELLSKLGD
                     EHTRWTAQMKAIKQDSYFLPKRCLLAAGVITYLGEDPEDTRRATLSEWKERVKLHDFN
                     FFTFLRDESVQLHYKAEGLPGDELSMDNAVMIHEQVNTPLIKDPSGQAVGWLQANLKK
                     QKAVVDVCSISEDRLVSALELALRFGKRFIVSDVDRVEPFLYPILRKEFHNEGTKRVI
                     QIGDRRTVDYADGFQLYLVTRSTDLHVPPDIISYLTPISFTITQSGLEGQFLGITIQH
                     EQPQLEKEKLDMLEKEEGLKMQLAELEERLLTNLANSEGSLLEDTTLIESLNQIKSQA
                     SYITTALEQSKVVQEDLDRKRNVYRPFATTASSVFFLTKSLEELSHMYQFSFQLFLDL
                     FLRALKRHKDLRTDPETKIAALQETFIQITVSAIAQSLFKEHRVVYGIHLCRNIHHGA
                     CTAAEWDFFMDKAIAAEEKRKEVRVPTFVLPDSVQTFRTFAALFPDLVSKARFQEADV
                     WLQWMRAATPESEYPDFLKSLTHFQRLLLMKTLRSDRLIAAMNAVACTLLKVDSLGEN
                     GTLVSAVEQSDANRPVLVITSAGADPSQELQSIARETMGRTRFHQLAMGSGQTDEAMR
                     LLRESAVKGDWLFLKNLHLVIPWVSQLQKELMVLKPDASFRLFLTSEAHDEFPSMLLG
                     QSLKITFEPPPGIKQNLLRTYSGWDAAFVNEKDEKQRQLLFAAAALQAIVQERRSYVP
                     QGWTKDYEVTAADLKASVDIVLHQSACGDIDWYSIRGILNDAIYGGKMETPFDKRIMA
                     TYVDKMFRVNCMAGTKQQEPLFHHTRIPSGDYAEFMKVIKKLPDSDIPVLFSLPPNAD
                     RAVQLSRVRALTGDLQRISESYSEAALDREAWAARLTPVLDTWAALTARHADILVPLP
                     SAPPSPSAHSTPAAARKPLERFLEAEHLTALRLVTQVNVAVSDLRKVIDGGALLTENR
                     RTEAAAMILGDVPASWEGHFPSAARISTWMQALVSKAVTIGEWQKMMANGTFTSATLD
                     LSKFMRAKTFLNALRQETAHAIRQPLVSLVLVATTSTPPADAPLVTALEGLMLQGAVL
                     DDADLLESIATADEPAFFPIKKAFAAWMASPPMLKASVRVPVYANTTKEDYVCDFVLP
                     CADEVAAQNFVLSGVSIVLEQ"
     gene            <1628664..>1629113
                     /locus_tag="LDBPK_344000"
                     /db_xref="GeneID:13387438"
     mRNA            <1628664..>1629113
                     /locus_tag="LDBPK_344000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864511.1"
                     /db_xref="GeneID:13387438"
     CDS             1628664..1629113
                     /locus_tag="LDBPK_344000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864559.1"
                     /db_xref="GeneID:13387438"
                     /db_xref="GOA:E9BRJ8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ8"
                     /translation="MYGDKGPPKGYSVPRFDTNASKRCQTCSSTEHWTFECPLKKSAT
                     SSAKKGAAATVKLSPSQMLRYGIKRKSANFVPEPTEREVFDAELRELRNMLTAEVRQE
                     LKAKKFAAHKSGNDCKMHEAPLPSAAPKKESPSDPVKIKKERTEEKE"
     gene            <1629899..>1631641
                     /locus_tag="LDBPK_344010"
                     /db_xref="GeneID:13387439"
     mRNA            <1629899..>1631641
                     /locus_tag="LDBPK_344010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864512.1"
                     /db_xref="GeneID:13387439"
     CDS             1629899..1631641
                     /locus_tag="LDBPK_344010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864560.1"
                     /db_xref="GeneID:13387439"
                     /db_xref="InterPro:IPR009581"
                     /db_xref="UniProtKB/TrEMBL:E9BRJ9"
                     /translation="MFWRDVRRHGRPLSLGLLILHILTVTHWWMVTMYLPRSNSSSLP
                     LIPDHNDAALPSVSQESWWAKLRKQTPPPFSHRPPPPLHNEEPTLPPERVAVISTSAP
                     SVPPRPSVTSTAPPTEAEERAEGVPPSPPKRISGLGISTTSVSPTLSPDDTIAAFYAQ
                     LAVFEANLQVKDVKGNPDQPTKDFVDIDADDEIGVPLPYDPYYIEDPARWTACDPRNA
                     SFSVERDRLCQEYLRNHNNMRSIKAMSSKLLQGRTIKMQITYAHNDLKTIVKLSQRKF
                     IYEAVSEYWAYSFDRALEFNRVPTSVFVPIPLDYLRVAVAYSPLFSQWFNRFVVLYNY
                     TNRNFVQCAYYTRQVSECSMATLQLWMKDVHPALDTFLAIPYEIDHSFIRKYYIPGHE
                     LFAGTKRARLRAVGELLDRSVFDFLIGNTDRGTNNHNNFAYGGCSAETECQLEKSENR
                     IKGLAKYAYIDHGSSLYSHKEPLENPFFGNADRVSICRFRRSTFEHLAKYASTERAHY
                     PLIEHVERSVPAAAYEVSHESVIRKVQVRLDKIVHIINRCRVKYTDNEVFSMPEYDSV
                     RIPEEDATLGDEWK"
     gene            <1632844..>1633773
                     /locus_tag="LDBPK_344020"
                     /db_xref="GeneID:13387440"
     mRNA            <1632844..>1633773
                     /locus_tag="LDBPK_344020"
                     /product="protein serine/threonine phosphatase, putativee"
                     /transcript_id="XM_003864513.1"
                     /db_xref="GeneID:13387440"
     CDS             1632844..1633773
                     /locus_tag="LDBPK_344020"
                     /codon_start=1
                     /product="protein serine/threonine phosphatase, putativee"
                     /protein_id="XP_003864561.1"
                     /db_xref="GeneID:13387440"
                     /db_xref="GOA:E9BRK0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BRK0"
                     /translation="MNLDAWEEKVRLVQPLEMKEMQLLLRTAVNLLIEESNVQGVHLP
                     VTICGDIHGQFLDLLRLFEVAGEIRRETSSMNYIFLGDLVDRGRNSVEVLTFLLIMKL
                     KYPHKITLIRGNHETRQVTTMYGFYDECAEKYGTVEIWKLCTEVFDCMPIAALIEGKS
                     LCIHGGLSPEIRAVDQIRLLSRRQEIPNEGPFSDLVWSDPENVDGWVVSQRGAGFLFG
                     ASVTQEFIHRNRLNLIARAHQLVHEGFKYHFDEEYLCTVWSAPNYCYRCGNLASVLRI
                     YEDHSREFVVFKEVEAQITFSDEPRTKEPAYFL"
     gene            <1634643..>1635308
                     /locus_tag="LDBPK_344030"
                     /db_xref="GeneID:13387441"
     mRNA            <1634643..>1635308
                     /locus_tag="LDBPK_344030"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864514.1"
                     /db_xref="GeneID:13387441"
     CDS             1634643..1635308
                     /locus_tag="LDBPK_344030"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864562.1"
                     /db_xref="GeneID:13387441"
                     /db_xref="UniProtKB/TrEMBL:E9BRK1"
                     /translation="MPFSLAELQNVFFDALTGCPPDAPQKTRDTAVTVAGASIFAGAW
                     QPLEATRMPVRAYLRETGEFDTEDSCRRAVVRAVDAALNDVFNDDAVNAFIGANACES
                     ADVVGACEHILRKYLLWMLDGYLHYDGTPQCPFYDALKSTVCAFSLEWGQTFGPMFAE
                     AQSPDEFFSVLVTRGARHHATAAATNPDDAKVRMVTAMSIQVFLIAKTYSPNTPFPSQ
                     VAL"
     gene            <1635850..>1637316
                     /locus_tag="LDBPK_344040"
                     /db_xref="GeneID:13387442"
     mRNA            <1635850..>1637316
                     /locus_tag="LDBPK_344040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864515.1"
                     /db_xref="GeneID:13387442"
     CDS             1635850..1637316
                     /locus_tag="LDBPK_344040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864563.1"
                     /db_xref="GeneID:13387442"
                     /db_xref="UniProtKB/TrEMBL:E9BRK2"
                     /translation="MQSKVIALLTSRPLLTAAEAAMELGVAHGDLQPIFASVAASNKG
                     VYTLLTGSVEEAADGSATAVVMRKADRLEEDTSSYALLSLTYPSNMSASSLPVRLHPC
                     REASLRAYPLVARSDMEPRAAATAPPVAAGAPAATELTRTEDSKPAAASLSAATPVAP
                     TIPPLAQDEPPRSTPTPATVTAPKKETAARTPSPKAALFDKMKEAAATKRPRTEKAQS
                     KPPRQPAKPKKVAKTENTTSLAKLARASKRKSGGTPAATGAGTAPTSMRFLDDDDDAT
                     AHFSHSEGSTSHSEAIAKEEPPIFDVVEVPASNDEVIMCDDAPPLAFRPAAPLPSPPT
                     PTPTKKGPEATKASSAAAAAEAGAAQCKLSTFFNAAVVEFQKAYVREMQTEMKVENGE
                     FVCCDVPRYKHSATGEVISEDEYHHRTAAFVRSNSQDAAANTPNRKSAGASVESPPCP
                     TAKQKTGSRGTGQKSVAQEETAATPAKTLHSFFKTSSA"
     gene            <1638477..>1639088
                     /locus_tag="LDBPK_344050"
                     /db_xref="GeneID:13387443"
     mRNA            <1638477..>1639088
                     /locus_tag="LDBPK_344050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864516.1"
                     /db_xref="GeneID:13387443"
     CDS             1638477..1639088
                     /locus_tag="LDBPK_344050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864564.1"
                     /db_xref="GeneID:13387443"
                     /db_xref="UniProtKB/TrEMBL:E9BRK3"
                     /translation="MSKQVLESLPLAKGKDIHSRIAKLALYKECLALAYLVRNKLVRE
                     HTLREVREKWLEHRGDGGHTLQLQLASCLDRIAYGRMCHSKARQRLLPNASESYDWGV
                     VNPMENHEKLIRRREERQCPDAFNHSRGKRDFVPMSNWGYGNMDPDAIAKHKELTDRQ
                     HFIGPHWRDRPRPMVLEDLSFEEELYVHFQGKPKMRKTPKKHF"
     gene            <1639875..>1640171
                     /locus_tag="LDBPK_344060"
                     /db_xref="GeneID:13387444"
     mRNA            <1639875..>1640171
                     /locus_tag="LDBPK_344060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864517.1"
                     /db_xref="GeneID:13387444"
     CDS             1639875..1640171
                     /locus_tag="LDBPK_344060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864565.1"
                     /db_xref="GeneID:13387444"
                     /db_xref="UniProtKB/TrEMBL:E9BRK4"
                     /translation="MSQLSIVKDQLLSKGINHFVVLSSSGQVVEYSGDFEIKEKQVLA
                     YAIIQQCSALFAKGESMKRVTMKFDDVLYVATTVQDSAMVYGVVAKRPTNGATM"
     gene            <1640953..>1642185
                     /locus_tag="LDBPK_344070"
                     /db_xref="GeneID:13387445"
     mRNA            <1640953..>1642185
                     /locus_tag="LDBPK_344070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864518.1"
                     /db_xref="GeneID:13387445"
     CDS             1640953..1642185
                     /locus_tag="LDBPK_344070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864566.1"
                     /db_xref="GeneID:13387445"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:E9BRK5"
                     /translation="MSTTAYALVANERQYPLQVGKNVVGRSSVPVEGVSFINLESPLA
                     AISRMQAFVDIGANGDAWISDCNSTNGTFLSIRPGPGIRLEANRYYQLSPGCRIVFGD
                     VVCTFETLSEALQAPEHPEHPLTSLSLPTRKTESLGVIDAFTDSAAKTTPLRHPSKQA
                     NAHRSNVPYLDESGSLSREPAALRETVSTTKKAPRRERREPTAPSPPLKRTKVESAAP
                     SSSLKVETAATAKATTAARAHAARPHVCLTGMDSDERAAVTKRVRELKGRVVDDITKA
                     NLLVVAAPPVRTPKFIVAVARGIPVVSVDYICNRRAALDDARHHIVGLKTDQHTYTAA
                     ELKKVIYRKDASPLLQGVSFNIAALSTKTKSVAAEIISSSGGEVVSTKKGGGTALTDE
                     QLDKLYDSILRGKVSDVL"
     gene            <1642809..>1644587
                     /locus_tag="LDBPK_344080"
                     /db_xref="GeneID:13387446"
     mRNA            <1642809..>1644587
                     /locus_tag="LDBPK_344080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864519.1"
                     /db_xref="GeneID:13387446"
     CDS             1642809..1644587
                     /locus_tag="LDBPK_344080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864567.1"
                     /db_xref="GeneID:13387446"
                     /db_xref="UniProtKB/TrEMBL:E9BRK6"
                     /translation="MASKRLRSNVDVVGGINELLNLPVRSPPHGEERLDTTSFSCQPN
                     SFVRVTETDDMRPSALKRLRTSESSAGVSSRSPRSASPSSPRTTSDSVGGDELDLLRR
                     KDEEVADMALFLAKTVGETSSRHSLAELVGLLVRSGVPRVALALKRVGAQTTFVGNLH
                     QATSFTGNERRIAVALFSSLMTHVDAEALFQKCVVTFLVKSLTLADWQEASPALAHRI
                     ASHWSARRKQKGTAQQPPSGNSCGVADGLESQVAKLCGGVAESSGSYEDKSCASLALR
                     SLLTIMFAYNTSPHIAASRHLSVPLLFANAGGLQQLGKLLSSREMQEHALALLEVLTA
                     TEELSLQNDGLLELVPALVAQLRTSAVEVPVLKVLTNITNILPHALSATGTVKPFTQF
                     ALETLSRSRALSTPDETEIFALCCAINVVKYESKEKESPEAELASALVASQDTLMSLA
                     CVMMESYRCSSTEQLVRSGYYALLLGALSLVPVAEEEGSTTLRVPVMTAVARVSDGHS
                     VGLTAGHQPMRIVVAIIQEFLLFQSSAGTLTKEAVLEMKALVDRILSSNHIDVASHGD
                     RGTTTAETITAVSTDKDDDLVLGQLL"
     gene            <1644859..>1645128
                     /locus_tag="LDBPK_344090"
                     /db_xref="GeneID:13387447"
     mRNA            <1644859..>1645128
                     /locus_tag="LDBPK_344090"
                     /product="Unc104-like kinesin, putative"
                     /transcript_id="XM_003864520.1"
                     /db_xref="GeneID:13387447"
     CDS             1644859..1645128
                     /locus_tag="LDBPK_344090"
                     /codon_start=1
                     /product="Unc104-like kinesin, putative"
                     /protein_id="XP_003864568.1"
                     /db_xref="GeneID:13387447"
                     /db_xref="UniProtKB/TrEMBL:E9BRK7"
                     /translation="MSLFLSSRSLDDCLTPHPSLCSPSRCSFHASRSTCNQLTRTAHT
                     HTHTHTHTYTRKRTHARFILAGLPRRTSVGHVRQGRRAVSPDERA"
     gene            <1650687..>1651397
                     /locus_tag="LDBPK_344100"
                     /db_xref="GeneID:13387448"
     mRNA            <1650687..>1651397
                     /locus_tag="LDBPK_344100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864521.1"
                     /db_xref="GeneID:13387448"
     CDS             1650687..1651397
                     /locus_tag="LDBPK_344100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864569.1"
                     /db_xref="GeneID:13387448"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR014764"
                     /db_xref="UniProtKB/TrEMBL:E9BRK8"
                     /translation="MKNANRPRASVSFARERIVSTAAASATKGPAMQFVSKGARSDME
                     LVFDRLHALDKSAQSDTISGKGLAQFLSEVGVEESSLECMVLLWKLGATQKGCITRSE
                     WLISVYAHGIESIVQMRQNVTEWVKDVRESGGSFLLMYNYLYDYIRGEEDRRMTLTTA
                     LSAWDVFFSKNDLYAKWKAWAVANVKGGVSRDLWRQLGIFFTMDTTAAQRFGDQISAL
                     PWPSAIADFLDQGGVPAS"
     gene            <1652878..>1654077
                     /locus_tag="LDBPK_344110"
                     /db_xref="GeneID:13387449"
     mRNA            <1652878..>1654077
                     /locus_tag="LDBPK_344110"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003864522.1"
                     /db_xref="GeneID:13387449"
     CDS             1652878..1654077
                     /locus_tag="LDBPK_344110"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003864570.1"
                     /db_xref="GeneID:13387449"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9BRK9"
                     /translation="MDSLELVCNFVGSSAAEIEKVVEDKSFLNLCNRPLPNGQYPIHA
                     LASRHNAKGVELLLQVGVDANQASEEPGNRLGFTAAHYAAIANCVHALEVLKRYNADL
                     DRPAADQWTPLHAATFRGRSAAVRALVELGANIDCATSEGHTPLVFAVNLGRIKDARY
                     LLQNNAMVQLNDAHHDNLLHYTLHYRLAQAVNGDYKLPDSQLDIAVLLVLNGVRPDEQ
                     NDEGDTPTRYVAATLPSLPKALDLIFANADKLHFMPTECNYLTLVAATTSFLVDKTGV
                     AAGQAQTLVDIMAALEKERKASRPMRTVAADRVTDAAASPSLPASHPAVPAEVLDLPG
                     GKPNSKQCPSLARAAKVQANEHAAENGGKCPHCPFAFLMMRCDKGTLLLVGTAFLLGY
                     FCGHKAR"
     gap             1654633..1654662
                     /estimated_length=30
     gene            <1655183..>1655788
                     /locus_tag="LDBPK_344120"
                     /db_xref="GeneID:13387450"
     mRNA            <1655183..>1655788
                     /locus_tag="LDBPK_344120"
                     /product="nucleolar protein family a, putative"
                     /transcript_id="XM_003864523.1"
                     /db_xref="GeneID:13387450"
     CDS             1655183..>1655788
                     /locus_tag="LDBPK_344120"
                     /codon_start=1
                     /product="nucleolar protein family a, putative"
                     /protein_id="XP_003864571.1"
                     /db_xref="GeneID:13387450"
                     /db_xref="GOA:E9BRL0"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR021154"
                     /db_xref="UniProtKB/TrEMBL:E9BRL0"
                     /translation="MPRGFGGRGGGDRGGGSRGFGGPRGGRGGGGRGGGRGGHMSEPD
                     PPENVEEVGTFMNAAEGELVYRVTAHGVVPRFNTFVYTENKAKIGKIEEILGNTTDVM
                     FSVKPSPGVQAASLSEGDKVYISPTQFTPLRVFTEPPKPRGRGGRGGRGGGRGGGRGA
                     DRGGRGGFGGRGSFGGMGGGRGSFGGGRGSFGGGGRGSFGGR"
     gap             1655791..1655889
                     /estimated_length=99
     gene            <1657308..>1657877
                     /locus_tag="LDBPK_344130"
                     /db_xref="GeneID:13387451"
     mRNA            <1657308..>1657877
                     /locus_tag="LDBPK_344130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864524.1"
                     /db_xref="GeneID:13387451"
     CDS             1657308..1657877
                     /locus_tag="LDBPK_344130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864572.1"
                     /db_xref="GeneID:13387451"
                     /db_xref="GOA:E9BRL1"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:E9BRL1"
                     /translation="MGAVALLFLLLVADPGFVEVPTALSCRCSHCGTEVDDFDHHCGA
                     VGACIGKGNMCYFILFLLFAALLCALGAVQNAAFVAATARAHIRDTGPSWTSIAALIQ
                     TVLTALRLPRILCLLVLSVAAVNGGVVCTFLCLRYTYLAYKGLSSVRRRRRFDVSGSL
                     SKVFANTFRPAFSHNFMLPRYHALADMSD"
     gene            <1659311..>1662901
                     /locus_tag="LDBPK_344140"
                     /db_xref="GeneID:13387452"
     mRNA            <1659311..>1662901
                     /locus_tag="LDBPK_344140"
                     /product="coatomer alpha subunit, putative"
                     /transcript_id="XM_003864525.1"
                     /db_xref="GeneID:13387452"
     CDS             1659311..1662901
                     /locus_tag="LDBPK_344140"
                     /codon_start=1
                     /product="coatomer alpha subunit, putative"
                     /protein_id="XP_003864573.1"
                     /db_xref="GeneID:13387452"
                     /db_xref="GOA:E9BRL2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BRL2"
                     /translation="MLTKFEARSSRVKAVALHNSATWVLCGLHNGAVQIWDYRMSTCV
                     DTYTEHVGAVRGADFHVNQPLFVTGGDDYTVKVWNYKLRRCLFTMMGHMDYVRTTFFH
                     HEQPWIVSCSDDFTIRIWNWQSRKSIACLPGHNHYVMCAQFHPFSDLVVSGSLDKTIR
                     VWDISALRHRKEEVGITHDLLGTTDVVVRYELEGHEKGINWVAFHPCGDLLLSAADDR
                     TVRLWTMSGTSCYVSRTFTGHTSNVCCSVFYRNDYLISCAEDRTIRVVHMSSGVTVQT
                     FRREVERYWIMASDSTRNLIAIGHDAGLQVFKLTRERPAFAIHNATQLYYTCQNKLHM
                     YNFETEEVASCAVTYQFYPPTALSCCPTTGGVMLSYVNSGPQVEWIPKPLATRTCNVE
                     ATMKGIDGVFFGGHKLAYVDVNGKMCIQNVAKASGKPQLTDVSCSRIFPGPVGCVLCQ
                     SNDRILLYQVAQHGAVAEATVTGVRYAVWDKDFSKVALIAKNTVTIMTKRLKIIASVA
                     ESSARIKSAAFDETRDVMYFTTSNHLKYCYLRNGETSTISTLKNVVYLVRAVGDSIYV
                     LTRDGRVLRKELDNVELNFKLKLQQQSYRDLIRIMQQGKLKGQALVGYLHKHGHSEIA
                     LHFVSDSLTRFNLAIECGAMDIAKATAIELNQPAIWRRLADTATSFGDIQLAQFASAK
                     AGHYYASGLLALLTGNTTSVANLVNTTRDDNFKLHYSMYMDDAKQRVDILCKVNQLPL
                     AYVTAKSHGLAEMAAQVLQRMEPEVAARVQAQRFHPAPQKRTVEPATENWPMLQVEES
                     VFARLLKEPGHLDIIAQPELDEDVAAGTGWDDDEDDGTLLGSAGAGAGDAGALADKDE
                     MGGGWDDDLDIDVSTALPDAGGATSASSGYVVPREHPPIMQAWADAYTLPAFHVAAGS
                     FASALRLLQRQIGLADPTPLKPYMLQLWAAVNVCRPAPNGLCVVFAMPTPPPDSETEA
                     RHAPALPDFMPALAEKLRFGYQLFVEGKFSEALDVFRSILHLSVVTVVKDDQQKATLR
                     EIMAIAPEYTRALALQLQLRTLNASSVESLQLALYFTHFRLHRAHLTLALSQAMSKAY
                     KQKNIKTAAEVARRLLEQDPPKNKAQQAAAIIAEADRNPTNAVEIDYDERNPFTICSA
                     TYKPMYKGVVSPMRCSYCLSPAHPSYKGTLCPVCKLAKIGVDSAGLVNRI"
     gene            <1664014..>1664160
                     /locus_tag="LDBPK_344150"
                     /db_xref="GeneID:13387453"
     mRNA            <1664014..>1664160
                     /locus_tag="LDBPK_344150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864526.1"
                     /db_xref="GeneID:13387453"
     CDS             1664014..>1664160
                     /locus_tag="LDBPK_344150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864574.1"
                     /db_xref="GeneID:13387453"
                     /db_xref="UniProtKB/TrEMBL:E9BRL3"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEK"
     gap             1664163..1664261
                     /estimated_length=99
     gene            <1664928..>1665266
                     /locus_tag="LDBPK_044260"
                     /db_xref="GeneID:13387454"
     mRNA            <1664928..>1665266
                     /locus_tag="LDBPK_044260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864527.1"
                     /db_xref="GeneID:13387454"
     CDS             1664928..1665266
                     /locus_tag="LDBPK_044260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864575.1"
                     /db_xref="GeneID:13387454"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:E9BRL4"
                     /translation="MTRWNQRMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDW
                     PMWEKMWHLAVGVLGIEFAVWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGET
                     FSSDIQPDRR"
     gap             1666839..1666937
                     /estimated_length=99
     gene            <1669457..>1676770
                     /locus_tag="LDBPK_344160"
                     /db_xref="GeneID:13392566"
     mRNA            <1669457..>1676770
                     /locus_tag="LDBPK_344160"
                     /product="phosphatidylinositol 3-kinase (tor2)-like
                     protein"
                     /transcript_id="XM_003864528.1"
                     /db_xref="GeneID:13392566"
     CDS             1669457..1676770
                     /locus_tag="LDBPK_344160"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase (tor2)-like
                     protein"
                     /protein_id="XP_003864576.1"
                     /db_xref="GeneID:13392566"
                     /db_xref="GOA:E9BRL5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:E9BRL5"
                     /translation="MSSVDSDKLATSIRALAGSRDERIAFVTEGVKQAKELQGKSVQE
                     YEMVVSSLLMCLESFEVVHGTSLDVLCELTVLDILLNLDLSVIQLSQCNSYLRLCLMA
                     VNEIPVAVAAAKTFAQTLSYSMTTDFVRTQIGETLEWISLSDAKSQPRRICGILVLTE
                     VALRIPMVILPRLSEVFDRAWDCLVVHDEEVRSRALCLFTLCAKLLVNRPAAIRAETC
                     DALMSHLKGNLASKSKDKRIAGLLAFEPIVINSIGTSNIRYEDLSNLLVPYIMGGGAN
                     VNADTRELLFRCLVVLCRFSAPQFVAHQLKESVRFALDSINRNIQRNTAFEMLSEIIP
                     IVGKTEFAPFVDDTCEVIKTIFEKSPSPCWKALQCFSIICKECRPSKMETYVESCIEN
                     VFVWGLSAELIECMRAIIESSSVQYRAKLEESLLDMISVTLCGLPFRQQIDAPRVSES
                     STDVSASEYQISVALNALKQFGFSNSELMGDFLRVSVLPFIDNNSVAVRNAAVYTIVK
                     LLIPPGEKGDLSIARRMCVNTVITRMLVVGLSDPNPVVRQTILSAFTEDFYPYLSEQQ
                     YLFRFYSALGDESINCRVAATEQLCQMIRYDPSHILPALREEMVVILHFITSTFNMDT
                     VQNGFRLLAAIATRAPQLVVNFTEGICEALVPYFSTLSSRSGILLSFLHCCTAVAAAL
                     RKFGSTPFSSKREIALVCELLETLPADRSYHIIRLSCLRFLSATLAPLMEGASPYVLY
                     PRLFQQLCTVLHRTEESVDIRLEALRCIGVIGALDSHVFQSFNLNEEKASGMSAVVVD
                     RVTHVKCCRIVLCAVAALLDPESKRSAGAREGLLRTGVQTMLNIFEHVPCSKSEIGLV
                     IGPLARVIRQLPGGRLFATVLFEFCNIIRYGGAVVLNDLNEIYRVFDNVWEFQVNYRF
                     LAVRMLSFVANFEASGNLHYGQQHSRILPQLFDTLNRADLRADLKYAVLEYIVRHVDS
                     LQPCTEAAVDNLLGAIQNPANPLDFVNHCVVTLKEICVKLYVDELVGAIVRCLLACLS
                     VDLARKTRGRDSIALCNNIMGVFCVLIEELQGNFLKYSTYIIQALKNYRITNTEFGVM
                     NNRVATGLRCARSAMSIQQQNAEVAALLKTCESVVMKSMSRMGEVWSYANLNDDNANA
                     GAAEERTMPINEQRLINPMKVVPLTKEEWVKWSDQFAITLLQESPFQVFRCTAVPIGI
                     NAAPLVEKSTQFVQDTLQIAFRSMWNYASSALQTAITDFFRQSFRQAMMSTTVPAEVV
                     TMLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLIS
                     LYSELHMVDSSVGILNMTSEEQRRSLLQTSLVKLARYTEALQLTQQELELEAAPLEES
                     STENLSKGCGYKNGSRGWSRMLHYTSNSDLTPSSSKAEESCRDRRVEVNARLMLCLSE
                     LGEYDRVLEQWGSMLHNYKDRVTDTDEMHVLFFVSQYAADASIRLQSWDTLEHVLDWL
                     PPDMVLYHVSKAALEVVRGNYDAALVSVTNGRKVLLEDLTSLLHESYARAYEGLVVAQ
                     QLTEVEEVIIAKQTQKALSSAAHIPHLCHIWEQRIRMMHATVPTWKQVLGIRGLLISP
                     HEDVKTRIQFTKLCRQEKARQLEKFTLAELLGFANPTLEQLTSRNVNPRVVMQYISYL
                     SETNALGPGSAFGTESDLIKKMIDVHTKAENSAVLARAYTRLGSKVDLIESVQCFKTA
                     IMYDPQWFLAWRKWAEANAQLLQTDKGEETCRNAIEGFIRSIQLGTSDSTLIQDVLKL
                     LTLWSSHCDSDHNLKELRERVFDVPSRVWHLVVPQLVARLDTGSDDSCRLVADVLTNV
                     GYDYPHTLVYPLNLCTMSDSERRNRYSNEVLGKLQERYPVIVLQGRLMIDELIRVSSL
                     IYEQWYDKLEAAATAFFGRRSTDEMIRTLLPIHETLTRVPETVVESEFLSKYSKRLTE
                     ARDWLRSYSSTRYTGDIQSAWKLYHSVYCNIDKQIKSSDTLQLQFCSPKLFEARNLSI
                     GIPDARPVREESVAKVNRFQKDIIVIASKQRPKRIGIITAEGRLQKFLLKGREDLRLD
                     ERVMQLFSLVNILMQSDSRTSKNLGFQIQRYSVTPLKDNVGIIGWVDGCDTLHEVVKH
                     FRERKSIPVELEMRMLDQIITFDNSKAYDYLTIMSKVEVLEFLSDHTSGQDIRKAMWN
                     TSPNCEVWYDRRRMYTTSLANMSIVGYILGLGDRHPNNIMLQRASGLVVHIDFGDCFE
                     VAMTRDKFPEKVPFRLTRMLRSALDVSGVDGAFRACSETAMCVLREGSHSVLALLEAF
                     IQDPLISWRLINRHGQEPESSNDHKTIEEQVNIANMRNATSTAGAESMCDSVGKRDSG
                     TFSVAKHLCGEEVDVVHQGVFIVKRLSSKLKGQDFISAGTEPLDPRTQVGQLIEEATD
                     VTNVAQSWSGWYPFW"
     gene            <1677717..>1678043
                     /locus_tag="LDBPK_344170"
                     /db_xref="GeneID:13387455"
     mRNA            <1677717..>1678043
                     /locus_tag="LDBPK_344170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864529.1"
                     /db_xref="GeneID:13387455"
     CDS             1677717..1678043
                     /locus_tag="LDBPK_344170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864577.1"
                     /db_xref="GeneID:13387455"
                     /db_xref="UniProtKB/TrEMBL:E9BRL6"
                     /translation="MAALGSDVQATSVELVSVIEKMKERKTLLEEQIAAEEAEYEGVL
                     AEVRAMQERLSALKDSLAKKQAVRADLERTISETYSAFKSILDASKKLLSTAKEESSV
                     LKAQIE"
     gene            <1678597..>1679673
                     /locus_tag="LDBPK_344180"
                     /db_xref="GeneID:13387456"
     mRNA            <1678597..>1679673
                     /locus_tag="LDBPK_344180"
                     /product="cell differentiation protein-like protein"
                     /transcript_id="XM_003864530.1"
                     /db_xref="GeneID:13387456"
     CDS             1678597..1679673
                     /locus_tag="LDBPK_344180"
                     /codon_start=1
                     /product="cell differentiation protein-like protein"
                     /protein_id="XP_003864578.1"
                     /db_xref="GeneID:13387456"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BRL7"
                     /translation="MDAPAAYPPWEEESDDVAKFGYRQQRFPQAGYSRFPVAQPQQRP
                     PQQPQPQLQQAALPQQVARLEPSQYPDVVREMLMHIQNLYHQDTRERAILTLSKKREK
                     FTLLGPTLWYSVGVMAIFLQEIVSMYPLLNTPSSAPVKPIINRVSSVLTLLQVIAQHD
                     ASRRPFMESNICLFLYPFLRATPAERSEVLRLTSLGVIGALVKADDPAIISYLLNTEI
                     FPICLKIMEQAIEISKIISTFIIQKLLMSDQGLVYACQNPSRFTAVADVLHRMVAEKG
                     QQNEHVCGPRLLKHIIRCYLRLSENERAREALPKILPEELRNNTFQEYLDEDINMRKW
                     LLQLLVNVGDEGARRISETAKHAQ"
     gene            <1680767..>1681939
                     /locus_tag="LDBPK_344190"
                     /db_xref="GeneID:13387457"
     mRNA            <1680767..>1681939
                     /locus_tag="LDBPK_344190"
                     /product="RNA-binding protein-like protein"
                     /transcript_id="XM_003864531.1"
                     /db_xref="GeneID:13387457"
     CDS             1680767..1681939
                     /locus_tag="LDBPK_344190"
                     /codon_start=1
                     /product="RNA-binding protein-like protein"
                     /protein_id="XP_003864579.1"
                     /db_xref="GeneID:13387457"
                     /db_xref="GOA:E9BRL8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BRL8"
                     /translation="MQSKGVETGGYKPSLRVDIGSADNAKEESANVTEGSPQKVITPH
                     VSTNIFVAGIPSTWDDDALRERYKEFGEIVSTKVVKNRHFGFVMFRRAESAHAAINAT
                     HLTQPTPNCGTVLHVSIAMHDEGLDDQPNDRLFIRGLPQWATKEHLRQMFSPYGVITE
                     CAVLMNPLGQCKGSGFVQFSSQQEATAAIKARDSISMDSWPHQLEVKYSESAEVRQMR
                     QERNRNRQRHWLPSPQYRGGNTPSSLPSPYPGFSPPLSLIPSPQAFPVMNAMPFPMVY
                     PPTPATTGAPTQIVYPQPIYQTIPPFYSASAVPIPAPIPLPQKGDLHFSGPPLTEELL
                     RLMLQSYGEVEAVKKLDNDTGIAVRLRDVTKHALVVQQLNGSLFPTGQLLAVGIYA"
     gene            <1683483..>1683842
                     /locus_tag="LDBPK_344200"
                     /db_xref="GeneID:13387458"
     mRNA            <1683483..>1683842
                     /locus_tag="LDBPK_344200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864532.1"
                     /db_xref="GeneID:13387458"
     CDS             1683483..1683842
                     /locus_tag="LDBPK_344200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864580.1"
                     /db_xref="GeneID:13387458"
                     /db_xref="UniProtKB/TrEMBL:E9BRL9"
                     /translation="MGSTFLGYSDEDHGLASVWGRLIFLSCITTGIFYVLFGLFACRR
                     LILRDIRWLLMAILYFSMGVCHAFFTLTLLCFAIACVLHSFEKPMQSGEMIMYSGIMT
                     IITMYFACGRKTILYSL"
     gene            <1684866..>1685843
                     /locus_tag="LDBPK_344210"
                     /db_xref="GeneID:13387459"
     mRNA            <1684866..>1685843
                     /locus_tag="LDBPK_344210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864533.1"
                     /db_xref="GeneID:13387459"
     CDS             1684866..1685843
                     /locus_tag="LDBPK_344210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864581.1"
                     /db_xref="GeneID:13387459"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BRM0"
                     /translation="MSLDIATYQLLDADHHIHFCSQSPDTKFLACALGNGVVCLVNAI
                     TFNAVARGAPGKDFLDVPATCIRWAPEQCDSAWQLVSSSCAGGVMLWHWDRNEFSLRR
                     GAAACEKHNEVMVVDVSPSGKQVLTAGSDRIVRLYDSKLTPLAQLTEGVNADGTSRPA
                     HTNRIFSLRFLTEVAAVSAGWESPIQLWDLRACRSNRQVVGVQGVSDCLEPVPSTPIV
                     LVASPKSTNTLQIFDTVTGRVLEENSNKMCSQLNVAERVLVCRIQGETGNAWCLTVSP
                     PSVIVLCVSSGLIVARAALAHTPINMTMKDASVVVGCKNGVLLQVSLRM"
     gene            <1687502..>1688578
                     /locus_tag="LDBPK_344220"
                     /db_xref="GeneID:13387460"
     mRNA            <1687502..>1688578
                     /locus_tag="LDBPK_344220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864534.1"
                     /db_xref="GeneID:13387460"
     CDS             1687502..1688578
                     /locus_tag="LDBPK_344220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864582.1"
                     /db_xref="GeneID:13387460"
                     /db_xref="GOA:E9BRM1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="UniProtKB/TrEMBL:E9BRM1"
                     /translation="MSIGPDYLSALLNCNGCLQERILRRILIIEYETDSLLALRCALV
                     PLQTPTRKRQRHTEPVAAQGTCLSLDADTARHRWSTELSKALNDEAAKANCTASLCPH
                     AKKRWYAVAEALRRAGHPSFTPYELVTKYKEMHSDPRPFSPSEACFVCQYVRENGRDW
                     QGLCQALRQRLGHVRTPFQVAQQYRQRLRCAFVENRLTSSQLLTLLADLPASPHRRDF
                     AALSVEAQRFTSHKTLQVSPLYLKRELETLDFAARVPTCHQLYWKLVNLLCNFSLSHP
                     NRLDAFQHRMPFCYQQLSLADLARSLQCEAVELQERVVHALLRLSRPPEALNYEECSK
                     KLFGTVCGARLIYQISEKLHEKDT"
     gene            <1689284..>1690123
                     /locus_tag="LDBPK_344230"
                     /db_xref="GeneID:13387461"
     mRNA            <1689284..>1690123
                     /locus_tag="LDBPK_344230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864535.1"
                     /db_xref="GeneID:13387461"
     CDS             1689284..1690123
                     /locus_tag="LDBPK_344230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864583.1"
                     /db_xref="GeneID:13387461"
                     /db_xref="GOA:E9BRM2"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:E9BRM2"
                     /translation="MEGISEEQRQREEAEIRERDRKRQQEKEEHERRLAEEKAEEERK
                     RRDEEQLRVEEEKRKKRQEEEWKRLGSDAIQDLPPVPPPVAEEGALDMWYLDDETSQP
                     PLSTASLKPGRKMGAPAVTMKALRELGVVLFRVSMSDFSVVRQIIKEREYKHTDEIKI
                     SQTAKDDSFLERWYQEHYTEDEQFRVVMDGSFFLDIRSKQDEWIRVHLKAGDLVVLPA
                     GMYHRATLDEDDYVALYRGFQDAPRFVPVKRSDSRADSNQVRLAYLMSLKKGDVATQN
                     GFL"
     gene            <1690880..>1692547
                     /locus_tag="LDBPK_344240"
                     /db_xref="GeneID:13387462"
     mRNA            <1690880..>1692547
                     /locus_tag="LDBPK_344240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864536.1"
                     /db_xref="GeneID:13387462"
     CDS             1690880..1692547
                     /locus_tag="LDBPK_344240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864584.1"
                     /db_xref="GeneID:13387462"
                     /db_xref="UniProtKB/TrEMBL:E9BRM3"
                     /translation="MYTRGVSDRISGISAADLAQRLVEISARNTAQDDAFTKSVSQRP
                     LPHCVSALLWDAKCAGAAPPRTALLRGDVVDMTSSVSDATLSCVALSHNVRFRFARSR
                     HRRLTGILSSAAASLPLRICRVGVTHFYWMDECAPGVSYDDESVLSTVLQKRIVQWAV
                     CTFARNPLLRNISLQALEAVFPALLAFSPREREELLKQAAEFLGQGTLIWYGGAMIKQ
                     FHESAASLALPLLTSSEERCSAALLFALSTAQEIMGARRADAAQALRFLLEVYGARCV
                     ALSPALTTATLLVSRAMVPLCTRRCFGAGSRQHNLLQPYLFPLSCAAVEALPWILHST
                     HTSSPELNRELVRRTREAAAAVLTTAAPFAATTAQKRQSHEDDATAFFSANHALQIRR
                     DTLVAHFSSDVPSSLSALTAADSGVVARSRLLEAAPKWWEQAAKASNSDVSRDEAELK
                     INVKAAAAALREPHGGDHALLAVMHRTRKRQRNGEQLTAQTVETALEGASIRLKRRAL
                     LQLVDILALNAHSEDRHGKARQYLEQHHVAEVQIRDFTMLLSSTRKT"
     gene            <1693689..>1696094
                     /locus_tag="LDBPK_344250"
                     /db_xref="GeneID:13387463"
     mRNA            <1693689..>1696094
                     /locus_tag="LDBPK_344250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003864537.1"
                     /db_xref="GeneID:13387463"
     CDS             1693689..1696094
                     /locus_tag="LDBPK_344250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003864585.1"
                     /db_xref="GeneID:13387463"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BRM4"
                     /translation="MNTSATEASAIQQLAKKPTDIAAHYSAETCNLDYDTNDPERGDL
                     DEVLFFAEPLKEAQNLLPNGKSPPKSPKTSMQTFLQTVPHLFTLTLEEISSLDVMVRE
                     YSEMDVIIEEGAYLEHIYVLASGTVEVMNSKKGLKRAFGHRRIGSMVAPSVFGIDDAI
                     LENAVEFTYHASSNTTLLLIPRKQFMDLFARSPIFANNVSSQILRTLPSFSVFQEFCR
                     AVFGISSSSASDAQGWRSGYCLSLPILIRLFRSSGTLLHKHANRKEVDCEALRYCTRR
                     LPVNITVTYVIILTQGVPDYLSDEFLADAANRQPGATPFIAAVDTGKRRRCAWTFGGG
                     GQTLVLMRDGFTDTIDFVSNLCIFCIEAKKLRARLQQLVSPSAAEVLRNALAPAENNL
                     SAHAHMQEVLASLPFSDDELRGLENVWGEETLQQLYNIVVHREEYVVQVESVSSKVFS
                     ENPYANWALTIVRHIKSRLCVSEVEPLPEDIIIDVLFSPNRTLKNLFCCMSADIKALI
                     ENISEESASGKGERAGNWKNANDRYYYLLTGLLERNAMIRDAYRSRLQSNGFTLMEDG
                     HASALIVDLIDVSNISPDETDPGLRACAAQASKKSREGKRHFIINVDKTFGAQIEAIL
                     RSLLLTFGSRIQSVNLSGKAAGLTGNRGDLVLPKKLIFSKQTFGEDSTDEIRLCNRKS
                     FLREDITPLLDKSCSAQVHHGTCITLPGFMLQSQPVLKFYKTVHGCTAVDMQSSYVAR
                     QLEECRRNGVLRQTIPSRYLFYCDDMPLGNENGLVLKPQKREIISTIYATARALLRKI
                     LES"
     gap             1698516..1698843
                     /estimated_length=328
     gene            <1699945..>1700634
                     /locus_tag="LDBPK_044270"
                     /db_xref="GeneID:13387464"
     mRNA            <1699945..>1700634
                     /locus_tag="LDBPK_044270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864538.1"
                     /db_xref="GeneID:13387464"
     CDS             1699945..1700634
                     /locus_tag="LDBPK_044270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864586.1"
                     /db_xref="GeneID:13387464"
                     /db_xref="GOA:E9BRM5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BRM5"
                     /translation="MKNVLLIGACGALGRAVANAFAKGKWSIISVDQAAAVQQGDGCG
                     AVNPASSIEELQQAYKSAVTGLKVDAVINVAGGWAGGSVADARTAASTELMLRQSLFS
                     SVAAAHVFSTQGEKDGLLLLTGAAAALSPTPGMIGYGTAKSAVHFLCQSIAADPSVLP
                     TDASVLAILPTILDTPGNRSAMPHADRSTWTSLEDVAQQIVEWSNGSRRPASGSLVKI
                     VTENSKTRFIV"
     gene            <1701163..>1701285
                     /locus_tag="LDBPK_044280"
                     /db_xref="GeneID:13392567"
     mRNA            <1701163..>1701285
                     /locus_tag="LDBPK_044280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864539.1"
                     /db_xref="GeneID:13392567"
     CDS             1701163..>1701285
                     /locus_tag="LDBPK_044280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864587.1"
                     /db_xref="GeneID:13392567"
                     /db_xref="GOA:E9BRM6"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BRM6"
                     /translation="MASGGSVIAIKYNGGVLMAADTLLSYGSLAKWPNIPRIKLL"
     gap             1701286..1701921
                     /estimated_length=636
     gene            <1701922..>1702218
                     /locus_tag="LDBPK_044281"
                     /db_xref="GeneID:13392568"
     mRNA            <1701922..>1702218
                     /locus_tag="LDBPK_044281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864540.1"
                     /db_xref="GeneID:13392568"
     CDS             <1701922..1702218
                     /locus_tag="LDBPK_044281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864588.1"
                     /db_xref="GeneID:13392568"
                     /db_xref="UniProtKB/TrEMBL:E9BRM7"
                     /translation="HRLAPLSPPRPHRTRRRRGPGLHSKSPRRSKSTEHKRGRRVRFE
                     SLTRLVVSRCKPDHHDREPLRHSASPALSVGTHSPQPYTRARSGLSPHRVGAAS"
     gene            complement(<1703183..>1704208)
                     /locus_tag="LDBPK_044290"
                     /db_xref="GeneID:13392569"
     mRNA            complement(<1703183..>1704208)
                     /locus_tag="LDBPK_044290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864541.1"
                     /db_xref="GeneID:13392569"
     CDS             complement(1703183..1704208)
                     /locus_tag="LDBPK_044290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864589.1"
                     /db_xref="GeneID:13392569"
                     /db_xref="GOA:E9BRM8"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:E9BRM8"
                     /translation="MNHTRSVMEAVLAVITYSFCSVSMILVNKLIMNTYDMNFPFGIL
                     VLQTGGALVIVALAKAARFIEYPAFSLDVAKKWLPLTLLFVAMLFTSMKSLGTMSVAA
                     QTILKNLAVVLIALGDKFLYGKAQTPMVYFSFALMILGSLLGAKGDKWVTAWGLVWTF
                     LNIVSTVSYTLYMKAVLGSVSNSIGRYGPVFYNNLLSLPFFLIMGVGDIMPFSAAIGD
                     TTTFGKLVLTFSVLVSSVMTFSVFWCMSITSPTTMSVVGSLNKIPLTFLGMLVFHQFP
                     TATGYLGIMIALSAGFLYTHLNIRANRAKASSDTEHQMQQAGKTTAESIVLVRADENS
                     NDTSKSE"
     gene            complement(<1705979..>1706752)
                     /locus_tag="LDBPK_044300"
                     /db_xref="GeneID:13392570"
     mRNA            complement(<1705979..>1706752)
                     /locus_tag="LDBPK_044300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864542.1"
                     /db_xref="GeneID:13392570"
     CDS             complement(1705979..1706752)
                     /locus_tag="LDBPK_044300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864590.1"
                     /db_xref="GeneID:13392570"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BRM9"
                     /translation="MLPQATRHRIMSGVVTALVKRHPILTASRVRIVVVSVFCFLLAV
                     ALRLLFRYVHLSSKDTKRISGRRSRTAKKEHSKSHGGSRSSGGGGSSSTRKKTDPSLP
                     TVLMLIGIHGSGKSFWAKRYTEIVHKSYLIISSDAVRSRLTGSINNYTREVEVEESIL
                     KEVMHTLELRRSCIVDDCQHNLSPEFRAKLRALAPDGKVNRVVKIFSVKPSYAMMRIQ
                     SDIEEGTARYAPTMVELEKQGEQVAEFEATNKDDDWMRN"
     gap             1707226..1707324
                     /estimated_length=99
     gap             1708473..1708571
                     /estimated_length=99
     gap             1709277..1709375
                     /estimated_length=99
     gene            complement(<1711035..>1712228)
                     /locus_tag="LDBPK_044310"
                     /db_xref="GeneID:13392571"
     mRNA            complement(<1711035..>1712228)
                     /locus_tag="LDBPK_044310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864543.1"
                     /db_xref="GeneID:13392571"
     CDS             complement(1711035..1712228)
                     /locus_tag="LDBPK_044310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864591.1"
                     /db_xref="GeneID:13392571"
                     /db_xref="UniProtKB/TrEMBL:E9BRN0"
                     /translation="MEAPSTLNSYLSLVDDFFRKTFRDEMCLFVALKSRQYSESILGV
                     NMFAKNAAAVSADAPPAAAMESVSKLAAADVLPATDKPPTYVSNFLSISPRMALHHDG
                     RADGKMKVAYEFSVPRVCRLQQALTLNSRGAVTVVGSVKDLIEGLTAGVRASVNTLMP
                     ASEDLTVGHVHYQRGDKYSSLRYQRNGLGSSNLLLDCGITFFNLLLGAGFERRQLSFL
                     EHKEGSGQLDVMYVGAGFTGVNWSVATKIVRLNDAWSNARLAVLQRLSSTTAVACQYN
                     FDLIDTVAKVSLGFTQGIQLRVPMFIHTKSSTPVSASASRAPPSSPSALQVDGSAVAM
                     IPAWSTPLPLLLAAKAESDGNCSATLRGLFSNSIRWGIVMRTNLLDDKPLVKYGLTLS
                     MEYES"
     gene            complement(<1713666..>1715306)
                     /locus_tag="LDBPK_044320"
                     /db_xref="GeneID:13392572"
     mRNA            complement(<1713666..>1715306)
                     /locus_tag="LDBPK_044320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864544.1"
                     /db_xref="GeneID:13392572"
     CDS             complement(1713666..1715306)
                     /locus_tag="LDBPK_044320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864592.1"
                     /db_xref="GeneID:13392572"
                     /db_xref="GOA:E9BRN1"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:E9BRN1"
                     /translation="MPLNRELLASVKLEPMSDSDWVEEGHDKTNDGRSAGADGSVHPA
                     SDADESEDQNAATKNVIHCLKIALERGITSISLPEKQRPLNPQKDFSIESTMHFSASR
                     PAKGITCCGAQATGVKKARNPQMRDARSSIIGGVYRQANRPRNDMSQILSTDNAILNS
                     DGDMDRDYGGLATSGANFDTSVARARRAHRSLTRTQTLADFSSDDEDDEDEENMPPVS
                     FTFTDFSPMCYRHIREFFNVDPKAYCDVLRNSRWHSIPTPGKSAAQLFFCGRDWVIKT
                     MTEQESDFLRKILHRYYYHVRDNPFTLLPHFVGHHRLRIGTKTQNFIIMQNVFATTNT
                     IHEKFDLKGSTIGRFASDAEKRRTTFTQKDLDINSPMHIGPERRNLLIEQIKKDCEFL
                     KRSMIMDYSFLVGIHVLPSVGDTLSSATSGGSLGMLTRSVTDGTLRTNPGLGYTMGGE
                     RPDNSGADGSEFSRNGSRLDGRCFTADQGGMMSNKVPGLRQEIYYIGIIDILQEYNAR
                     KALENVVWGSLYDRKRISCVHPNDYAGRFIAFMSSIIV"
     gene            complement(<1716921..>1719152)
                     /locus_tag="LDBPK_044330"
                     /db_xref="GeneID:13392573"
     mRNA            complement(<1716921..>1719152)
                     /locus_tag="LDBPK_044330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864545.1"
                     /db_xref="GeneID:13392573"
     CDS             complement(1716921..1719152)
                     /locus_tag="LDBPK_044330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864593.1"
                     /db_xref="GeneID:13392573"
                     /db_xref="GOA:E9BRN2"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:E9BRN2"
                     /translation="MPSTPAAGALPVTKDVVSIVFGPVKEYSKLSAQLPLDDYDYHIA
                     FPGFRKHIHDDSETLVALMDACTQMLPKRRRTSLSAEADPRSGALHLLETDRTTVMEA
                     VDSLLESVDSLLDEVKGRRLDAQEQLSVTFGSELAASQNREGGVVVADAASARAGVLR
                     LAHIRRPQLLFDTPVDNSAAPFVPYYYDASGQSHVGVAGQHPFESVIKAFSIPESQML
                     PRAEVPPVPLDACPLTFVDTSVAMQAMIAKLLLASEIAVDLEHHDFYSYQGFTCLMQI
                     STREEDFIVDCLKLRSSMGALAPVFLNPSILKVLHGAREDIRWLQKDFSLYVVNFFDT
                     GVALQTLHMPHSLAFAVDHFCQVKLNKKYQTADWRVRPLSAEMVHYARQDTHFLLYVY
                     DRLKALLLNSEGRASIGSLLVHVYNESKQLSLQIYEKPSVVPEETYKIALGRSLSGLN
                     KVQEKVARDVFNWRDSAAREVDDSPTAVLHLSSVLSIASKLPTTAKALLRCCAPATAV
                     VRDNVALLVDLVKDAVASGEDDVAANVRLALTKGESATDREARAMTAATKEWNFYRSL
                     CPMGVHRPMTGTLPSLASVAKTLAPTEVSQEERSALLSHTTPSPWFTAMQALSRVLAA
                     RPPQHVDLPGADVFAARQAAAAAAAVSVAAAQASKTAGEEHEESGAVANSRSCSVSET
                     SQKAEEDESTADATTAAPDAEMMSESIIPLDKGAFSIKQEYGIGAKAQAKKGGKGKKW
                     PKK"
     gap             1719838..1719936
                     /estimated_length=99
     gap             1722756..1723882
                     /estimated_length=1127
     gap             1726070..1726168
                     /estimated_length=99
     gap             1727110..1727248
                     /estimated_length=139
     gene            <1727574..>1728152
                     /locus_tag="LDBPK_044340"
                     /db_xref="GeneID:13392574"
     mRNA            <1727574..>1728152
                     /locus_tag="LDBPK_044340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864546.1"
                     /db_xref="GeneID:13392574"
     CDS             1727574..1728152
                     /locus_tag="LDBPK_044340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864594.1"
                     /db_xref="GeneID:13392574"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BRN3"
                     /translation="MGCKFNFLVYAILQLIAFLSVLIGTPLDMFRGDLNIFDKRPCVT
                     LWGYKVMCDSIVYVDSTDTRWNRCHNRRNRFRMAEALAVISIMVYCAAFVLGVIMLFS
                     CSLLRWVCLALNVVGLLTLGITWGLMVTEFNKGDGPLCPPLKNNYKFGYGFFLLLVAW
                     VLDLVDIVFLLLPAHTKDSVESANSNEYIPLE"
     gap             1728427..1729128
                     /estimated_length=702
     gap             1729246..1730174
                     /estimated_length=929
     gap             1731061..1731159
                     /estimated_length=99
     gap             1733647..1735788
                     /estimated_length=2142
     gene            <1735923..>1736858
                     /locus_tag="LDBPK_044360"
                     /db_xref="GeneID:13392575"
     mRNA            <1735923..>1736858
                     /locus_tag="LDBPK_044360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003864547.1"
                     /db_xref="GeneID:13392575"
     CDS             1735923..>1736858
                     /locus_tag="LDBPK_044360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003864595.1"
                     /db_xref="GeneID:13392575"
                     /db_xref="GOA:E9BRN4"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BRN4"
                     /translation="MAPTICVCVDDDLCGAVCDVLKQLEGRISAIVCGTDVSCFASVK
                     ADNDGIFMVVSGSCAHAVIKDLCDDYDKEERRVKLIYSLSAGVDAYKLSELKQELSGI
                     LFCNAQGCCSNVLAEYVVFSMLYFNRLPWRLAASKNEKKWDPFSSIELRRQKLVIIGY
                     GNIGEACGAKAVALGMQVTGIRRSGDKKTDKFGVMVRGNDALDESIREADFVVSVLPG
                     TEHTRRFFDKAFFAKMKPSAVFINIGRGMSVCEADIIEALKKGTIRAAALDVFDVEPQ
                     PVASLVSVVDDDNLFVNSLSRDTALKLWCDTQIFFC"
     gap             1736859..1736957
                     /estimated_length=99
     gap             1739386..1742999
                     /estimated_length=3614
     gap             1744629..1744727
                     /estimated_length=99
     gap             1746348..1746958
                     /estimated_length=611
     gap             1748064..1748162
                     /estimated_length=99
CONTIG      join(FR799621.2:1..1750858)
//
DBGET integrated database retrieval system