GenomeNet

Database: RefSeq
Entry: NC_018263
LinkDB: NC_018263
Original site: NC_018263 
LOCUS       NC_018263            2713248 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 36.
ACCESSION   NC_018263
VERSION     NC_018263.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 2713248)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2713248)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799623.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2713248
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="36"
     gap             920..1018
                     /estimated_length=99
     gene            complement(<1020..>1163)
                     /locus_tag="LDBPK_360010"
                     /db_xref="GeneID:13386711"
     mRNA            complement(<1020..>1163)
                     /locus_tag="LDBPK_360010"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 4"
                     /transcript_id="XM_003865070.1"
                     /db_xref="GeneID:13386711"
     CDS             complement(<1020..1163)
                     /locus_tag="LDBPK_360010"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 4"
                     /protein_id="XP_003865118.1"
                     /db_xref="GeneID:13386711"
                     /db_xref="GOA:E9BT60"
                     /db_xref="UniProtKB/TrEMBL:E9BT60"
                     /translation="MREENNAPPAWAPRDTHRADPLQLLSSPQKHCGLSSAAESGQGC
                     HSRS"
     gap             1431..1536
                     /estimated_length=106
     gap             2505..2603
                     /estimated_length=99
     gap             3666..3764
                     /estimated_length=99
     gene            complement(<3958..>4260)
                     /locus_tag="LDBPK_350020"
                     /old_locus_tag="LDBPK_360020"
                     /db_xref="GeneID:13388005"
     mRNA            complement(<3958..>4260)
                     /locus_tag="LDBPK_350020"
                     /old_locus_tag="LDBPK_360020"
                     /product="histone H4"
                     /transcript_id="XM_024473493.1"
                     /db_xref="GeneID:13388005"
     mRNA            complement(<3958..>4260)
                     /locus_tag="LDBPK_350020"
                     /old_locus_tag="LDBPK_360020"
                     /product="histone H4, putative, pseudogene"
                     /transcript_id="XM_003865071.1"
                     /db_xref="GeneID:13388005"
     CDS             complement(3958..4260)
                     /locus_tag="LDBPK_350020"
                     /old_locus_tag="LDBPK_360020"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_024329262.1"
                     /db_xref="GeneID:13388005"
                     /db_xref="GOA:E9BT61"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BT61"
                     /translation="MAKGKRSADAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVNALRKQGHILYGYA"
     CDS             complement(3958..4260)
                     /locus_tag="LDBPK_350020"
                     /old_locus_tag="LDBPK_360020"
                     /codon_start=1
                     /product="histone H4, putative, pseudogene"
                     /protein_id="XP_003865119.1"
                     /db_xref="GeneID:13388005"
                     /translation="MAKGKRSADAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVNALRKQGHILYGYA"
     gene            complement(<6203..>6661)
                     /locus_tag="LDBPK_360030"
                     /db_xref="GeneID:13388004"
     mRNA            complement(<6203..>6661)
                     /locus_tag="LDBPK_360030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865073.1"
                     /db_xref="GeneID:13388004"
     CDS             complement(6203..6661)
                     /locus_tag="LDBPK_360030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865121.1"
                     /db_xref="GeneID:13388004"
                     /db_xref="UniProtKB/TrEMBL:E9BT63"
                     /translation="MGCTASKTKTPVANVASKGADEFYALATTERHPVAQKLLEEWVL
                     FVDAQARRNAGDSSAARAYQTRLKEVWADTANHPVTHRSVDYVGKMFLEYIKEDLSHR
                     GWGGNFDYKVAGVVTQGFLKANANIDTALSDTPEEVTWEIKIHYDSLGVS"
     gap             7425..7523
                     /estimated_length=99
     gap             9096..9194
                     /estimated_length=99
     gene            complement(<10426..>11724)
                     /locus_tag="LDBPK_360040"
                     /db_xref="GeneID:13388007"
     mRNA            complement(<10426..>11724)
                     /locus_tag="LDBPK_360040"
                     /product="N-acetylglucosamine-6-phosphate deacetylase-like
                     protein"
                     /transcript_id="XM_003865074.1"
                     /db_xref="GeneID:13388007"
     CDS             complement(10426..11724)
                     /locus_tag="LDBPK_360040"
                     /codon_start=1
                     /product="N-acetylglucosamine-6-phosphate deacetylase-like
                     protein"
                     /protein_id="XP_003865122.1"
                     /db_xref="GeneID:13388007"
                     /db_xref="GOA:E9BT64"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:E9BT64"
                     /translation="MGNVTVIKGNIVTTSKVLYGGCVIVVNDLIVSVCDNEAVARKEL
                     GELENTHPGVGAATWYEAAFVLPGFVDIHNHGLGGASDVIGHWSNPEYSLKELARCGT
                     LTTLASIIFSDSHKKLVTDCIDAIEKRVGTYTKDNCILGGIHAEGPVIHDRGGLPECK
                     SEMSLGDFKRLVDSMPSLRVMTISPHIEARCNYEKIRHLLEKKVRVALGHDRAASKSE
                     IMGALKLATSEEEKMHVTHLCNVSTFNHRASSLVNTAMCPRFPNAPLYKGARPPTLEI
                     IADLIHVDSVTLQSVLASRSVEDIAIITDCISAHIPGKHVVYNGRDSVVQAGGACYLC
                     DSFGRASNTLAGGTSMLADLFHILITLFCKDVVEACLHTATVPARIANLPDVGAIAVR
                     KKANLLLFDAELNTIEKRMIHGHWTSHKPYTILHPSVTHL"
     gene            complement(<13867..>15528)
                     /locus_tag="LDBPK_360050"
                     /db_xref="GeneID:13388008"
     mRNA            complement(<13867..>15528)
                     /locus_tag="LDBPK_360050"
                     /product="PUF1, putative"
                     /transcript_id="XM_003865075.1"
                     /db_xref="GeneID:13388008"
     CDS             complement(13867..15528)
                     /locus_tag="LDBPK_360050"
                     /codon_start=1
                     /product="PUF1, putative"
                     /protein_id="XP_003865123.1"
                     /db_xref="GeneID:13388008"
                     /db_xref="GOA:E9BT65"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BT65"
                     /translation="MSSEEKLTALYARRQEILKDLSEVDTSIKFLESEIQTKATEAAK
                     RTIDENKSGNADVDRVNEVIASCVRDATGLRDALKLVEACRYVQEFGKEDDAARQKIP
                     FRNVFAQECIRHALDLSNDANGSELMQHLVPLLRSGTKPVTMGDIFYDPTTNEHDLSE
                     VLLLIRELSSDIVTVACNTNGARVSQRIIDVLCTHEEFDVYTSVLEPSIVDVAKDING
                     NHSLSKLITSARFCQLGDSDKSASGAAAIYERIFQKIADNCIDICKNRQGCCIIQKCL
                     QHAPKPYHTTIINTVLNNSLKLVQDPFGNYVVQFILDKQQDINGSKKEDADDDAVPTA
                     PNYTNQIIRQMLHHVAELSCNKFSSNVIEKCLKTSSPDVRQLLVDELTAPHVLPKLLT
                     DSFANYVIQTAISTASDDGQLTQLRDAIIPLQSLLKNSPYGVKIESKLSRRHREAARR
                     LLKKKEAATTVTQAPPAQQEPLLPPYMPPQGMSAIPMMAPDASMGQQVSFTNLNADMA
                     SFLQPQRMIGMPFVLQGQQMISIPNAPPPSFTMGMINGSGLPEYR"
     gene            complement(<17276..>18967)
                     /locus_tag="LDBPK_360060"
                     /db_xref="GeneID:13388009"
     mRNA            complement(<17276..>18967)
                     /locus_tag="LDBPK_360060"
                     /product="L-ribulokinase, putative"
                     /transcript_id="XM_003865076.1"
                     /db_xref="GeneID:13388009"
     CDS             complement(17276..18967)
                     /locus_tag="LDBPK_360060"
                     /codon_start=1
                     /product="L-ribulokinase, putative"
                     /protein_id="XP_003865124.1"
                     /db_xref="GeneID:13388009"
                     /db_xref="GOA:E9BT66"
                     /db_xref="InterPro:IPR005929"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:E9BT66"
                     /translation="MIPEQMAEPLVIGLDYGSDSARAVLVRVRDGAELQSAVFSYPRW
                     NKGEYCNPKLMQYRQHPCEYMEAAENVITRVLKAAGPAARDNLVGLAFDTTGSTPCMV
                     DETCTPLALRPSFANNPNAMFILWKDHTSVKEAAAINALAHRSTPDYTSFCGGTYSSE
                     WFWSKALHVIRSDEKVSQAAYGIVECSEWLPALFTGVTSYQKLIRSRCACGHKAMWHE
                     SWGGFPPRSFFDQLHPRLGLLRSRMSDATETIDKPVGTLSEEWALRLGLSTRVVVACG
                     AIDAHLGAVGAGIKPYSFVRVMGTSTCDMMVIDSSILGHRRVKGICGQVNGSIVPHMI
                     GLEAGQSAYGDVFAWFSEFLQYSSVRLIASTTLLDENAKAELKREIKRKMLITLTEDA
                     SRIRPGESSVHALDWFNGRRTPDANQNLKSVIGGLTLGSDAASVYRALVEATAYGSRA
                     IVERFRREGVRIDSVIAVGGIAKKSPLAIQILSDVLNMPITVCKSEQVCALGSAIAAA
                     TAAACYESIPEAQEKMASGSSTAYKPCPEAARVYDELYKRYIELAASTEQMYSHM"
     gene            complement(<19828..>20796)
                     /locus_tag="LDBPK_360070"
                     /db_xref="GeneID:13388010"
     mRNA            complement(<19828..>20796)
                     /locus_tag="LDBPK_360070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865077.1"
                     /db_xref="GeneID:13388010"
     CDS             complement(19828..20796)
                     /locus_tag="LDBPK_360070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865125.1"
                     /db_xref="GeneID:13388010"
                     /db_xref="GOA:E9BT67"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="UniProtKB/TrEMBL:E9BT67"
                     /translation="MDPVKRRLVYVADENEVLLSELSGTPPTRQSRHTQLLVPLSPPT
                     SSQQSPHSVSPPPRPVDATAEAAPVATADKALLVSYDGFLLTDGSGRFSTPRDAAQAA
                     DIRDALKTCRSFLKGFLNAARPESESTESCSSGASSSTYMEEEDSDLEETSSDDSPVS
                     RPRATKAARARPPHSHIHNPTQMTVAELKELLRNRGLSIAGNKACLVKRVQKLRAHES
                     ERALETGPLRLGAGQRTLQGSLRHETKLNSGVSVLSPPLSPLPSQRKSPNCHTTDEKN
                     NSIWGALVHAGSRLFRGGARASWGFHTRPPEDADDAPLSTRRRISA"
     gene            complement(<21739..>22506)
                     /locus_tag="LDBPK_360080"
                     /db_xref="GeneID:13388011"
     mRNA            complement(<21739..>22506)
                     /locus_tag="LDBPK_360080"
                     /product="stress-inducible protein STI1 homolog"
                     /transcript_id="XM_003865078.1"
                     /db_xref="GeneID:13388011"
     CDS             complement(21739..22506)
                     /locus_tag="LDBPK_360080"
                     /codon_start=1
                     /product="stress-inducible protein STI1 homolog"
                     /protein_id="XP_003865126.1"
                     /db_xref="GeneID:13388011"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BT68"
                     /translation="MEDYKAKGNDAFKAKRYQEAIDWYTKAIELDPNGEASGALYSNR
                     AGSWQNLNNFEKAAVDSKQCIRLRPDWLKGYFRLGVAMESMGKYDEAQKAFQKALQLS
                     PGNEEVMDKLHTVNTKVRERNEKTKSQQCKTPEEAKQLGNSFFKDGKYDQAAEFYTRA
                     IELQTEPVKEKAVYYTNRAACHQQTHMYSLMVDDCNAAIEIDPANVKAYLRRGIAYEG
                     MEKWKLALEDYTKAQSISPGVAGASQGILRCQRVLRN"
     gap             23297..23329
                     /estimated_length=33
     gene            complement(<25504..>26394)
                     /locus_tag="LDBPK_360090"
                     /db_xref="GeneID:13388012"
     mRNA            complement(<25504..>26394)
                     /locus_tag="LDBPK_360090"
                     /product="leucine carboxyl methyltransferase, putative"
                     /transcript_id="XM_003865079.1"
                     /db_xref="GeneID:13388012"
     CDS             complement(25504..26394)
                     /locus_tag="LDBPK_360090"
                     /codon_start=1
                     /product="leucine carboxyl methyltransferase, putative"
                     /protein_id="XP_003865127.1"
                     /db_xref="GeneID:13388012"
                     /db_xref="GOA:E9BT69"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR016651"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BT69"
                     /translation="MALIQTAHDACSRKVHCVRKGYLNDPFVSFFEKDHTIVNSPLMN
                     RGTWLRTTAFENCVRGFATAAGQPIQVINFGAGMDTLYFRLKHSDPQFPVQKFVELDL
                     ADLVAEKERIIKRHGEMQSMVGSQYVLVSCDLYDARGVAKALKEHLHGGTPTIMIAEM
                     VFVYIEGSVTTNLLRTVMSDVVEPGTKTMLVTYDAIQPFDRFGKVMVENLQHFGADFK
                     GIGDFPTPEAHAQRCSELGFKAVKSVTMKNLYLGVPRQIQIRLNKLEMIDDWEEWNLM
                     HEHYCFVVACTEDTPLPKLF"
     gene            complement(<27162..>30332)
                     /locus_tag="LDBPK_360100"
                     /db_xref="GeneID:13388013"
     mRNA            complement(<27162..>30332)
                     /locus_tag="LDBPK_360100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865080.1"
                     /db_xref="GeneID:13388013"
     CDS             complement(27162..30332)
                     /locus_tag="LDBPK_360100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865128.1"
                     /db_xref="GeneID:13388013"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BT70"
                     /translation="MVRVAMSSHIEQAATCLRCGNHDGAAAALRELEVGEGVRTLQTA
                     VQCLMNEKGASDDVYVRFVAFKVLAYALTRCRDGRRQQSDTVIAFLLGYAYQMTAQVE
                     TPAWTPVVSELATATAVALKLGCVGDNLDVCVEEVTAVCVGLVDLAQTCTPSPKAYLH
                     RIICQSAVEEFGLFSAPSRYRGLPVRVHRHCRKLFAEEGRLPTLIQALLRGLLVSAGE
                     SSMSVDKGLTALVSCLSWPSHQFFEEDSSTEESCGVFYVAHEEWDRLLVGDVGLESGA
                     CVTVHGVLREWYGSGAVNGVPVNRQKVIEIIQLLCSFKGSEWTEGQTLRFLVSSLSLC
                     LDVFEHLSQWATEDDFHLFPLLANAILRLVSNYVDFFFHPQAHALVSRLTALTGFLIR
                     RDTSSNTDTDVMSCVDEMLSVWFHLTSYIDRNSFSGNGFETIAQRHLISQGCQSIFST
                     YLDTKVNTDAAELELDCFADTFTNSHLHLVAQVGRLCASNTCELLIRYLRSLRSTLAS
                     TLGAGGAAPTPLFEALWTLLKIVGFFIADPLEGEQPYIPRCFLEMGSQGSALLLHLVK
                     EVDALLPLLQNPAAASPAVLAAFLDVLTQYIKTYVEAEESCTLYAYAFSGGADMVAQS
                     LLAVVGALRLTPFEEESTSAACRLLDSVADKSSRVRSFCHRQEAFQALTRAVQEIHRF
                     RFYGHTRGRLIAFVISCCSDADSVQARLRDLALSPSSEDDVNLVLELLSSLAGLFESL
                     HSQQVIRCVFPALLATGQRLIGVSASKFYEREIVIESMQCVRSMFVTCSPLLEDSDIR
                     MLLDLVVAELRYAVTALQSSSAWTSADGEGDRAEFIIATARLLSSLAQWKALDCFLSD
                     DDTRAVSIATVEAAGALLRHMDERSLSLPSLEDGIFTCMELCAESFTADFVFASCSDA
                     FLSAMLYALNSERANIQRAGISVTASVAAFLEASTPPASHASACCDLLKVVLRSLTSG
                     KVFFRNLRQISRVLLILVRGLPYDSLVATVETVMREVSNCDAFVTTIFPALQSAAGSA
                     NASESGFEELLQDALSSVHGTTIIGA"
     gene            complement(<31056..>32915)
                     /locus_tag="LDBPK_360110"
                     /db_xref="GeneID:13388014"
     mRNA            complement(<31056..>32915)
                     /locus_tag="LDBPK_360110"
                     /product="DNA damage repair protein, putative"
                     /transcript_id="XM_003865081.1"
                     /db_xref="GeneID:13388014"
     CDS             complement(31056..32915)
                     /locus_tag="LDBPK_360110"
                     /codon_start=1
                     /product="DNA damage repair protein, putative"
                     /protein_id="XP_003865129.1"
                     /db_xref="GeneID:13388014"
                     /db_xref="GOA:E9BT71"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:E9BT71"
                     /translation="MTAMSRSVRDQANSLQHFQQHSRLYFIGQWRTKMEDVFREWFIE
                     HPEWNHGTLEQQRTFVHVDMDAFFCSVQLAKPEYAHLKTKPVGIAAGKYNSDISSCNY
                     VARSYGIHAGMYVNSAKERCPQLVTLGYDLEACERVAKTLYQIIFDLFPTGVKMSMEV
                     YSIDEVMLAADTADYALLQSFCETVRRELFSATGCTASCGIGPNIMLARLATDRGKPN
                     GICVVHAKDVAQTMNALPLECIHGAGESTMEKICRALREQGIIDERTDAGGVTCGSVQ
                     KLKREALQRVLGKRQGETFYHLVRGEDGRVVTRTGDPEDQRHLGKRIPNAVGCSMNYA
                     VRPEGVDDVWKIARQLLDDVCTKLRRTDAVAQGLRVTLLERHPLHPKETQKYMGRGKC
                     VEVHLPIKLPHAMAADEVEAMELEIRKVVAPLLVASRAISDAERAAQLGLSSSEMDLV
                     IWTVAIASLRDIVVADLRGMTVQATGLRQKQQAPLTRQRISGQQMTLATGFFNAKRPR
                     TQDGVTVVEPTPAQPPSDTVRERPADSSVDAATLYLLYAQPWPRRDDATAAQWRRGCE
                     SACRQLDYPVVKAYLRCALAKLSEWPEPQEAAETFQQLLSFANTRLPAPLNFL"
     gene            complement(<34097..>36811)
                     /locus_tag="LDBPK_360120"
                     /db_xref="GeneID:13388015"
     mRNA            complement(<34097..>36811)
                     /locus_tag="LDBPK_360120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865082.1"
                     /db_xref="GeneID:13388015"
     CDS             complement(34097..36811)
                     /locus_tag="LDBPK_360120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865130.1"
                     /db_xref="GeneID:13388015"
                     /db_xref="UniProtKB/TrEMBL:E9BT72"
                     /translation="MGRRGCCMRQQKRTRPAFTTRVFLFLVVHCRFSLFPFLYLSFTS
                     AGQGCKGEDCPMSSYQFARPSDGALRTALKAVLTTSQPPTLVPHPPARNVAWRPRRIV
                     EELKALRCVEALSSFEAELRGLVGLQETRCRTKLVNRGYRDECALREVEHLLAAEAAQ
                     RRDVTKNFFAIVRPPFEALHLCLQEELTRRSLRCEERSIWRALQLRASGSRLGLTEAD
                     NRAALGALEEFSRDELRNRRLIELGDNVQREIVVQSRLAGHLRCVDHSKGAQRVRRRL
                     QWQEEMDRATVERLYSLHLILLLQDMNVDFAAAVKRDVVLLSEACRATTQQVRVADCE
                     ECVLACLEQEQRLRLTLEEQEHTGFKAVTQAFLLGWRGVYKQITKDSDVTSVFGKIEL
                     LVRRDIVDRRRVELGSLLLAFQAQTCVLKRHQAERRSLCQQYIGGARFISTEENREAN
                     QLFCDHHVWECQQATLHRATVLAIEEVASSRAIRGAEAQARLACKLKYLAEKLQLQCE
                     EGRQRVAEEEERCLGELRERYVHIFFIQGAGRLFDGERAERMLIEVEESAAAVDTLLP
                     LRQALTHSLVSDACRPLSRLEDEFRARVTVEEARERCCLVRQHVLLSEAAHRIGLFEL
                     EHNLWIRHITAQVSAMEADARRLLCSSAEAEMLLVRQCVLEDWEWERRKSIHKCEVLV
                     WESLAFTIRSPARPSLSRLTDATDMWGALEADWGDAASDVATWTANWPLHDRPSLTCY
                     STLRCEDVLLEAYLERDLIHFMEHCEWLQVLHHTSTTSSAAESSAVDRTCWKLDSLSM
                     RLEPQQRAASINVWHSNQSFDVSFPLTQQPDEAIVGERTISFYAPDAGTTAALMQRDT
                     DAGMVFFLILDDEGTVLACATMVVEVAPKCSAHLCIPLDSNRGFVRLV"
     gene            complement(<37490..>38461)
                     /locus_tag="LDBPK_360130"
                     /db_xref="GeneID:13388016"
     mRNA            complement(<37490..>38461)
                     /locus_tag="LDBPK_360130"
                     /product="mRNA capping methyltransferase, putative"
                     /transcript_id="XM_003865083.1"
                     /db_xref="GeneID:13388016"
     CDS             complement(37490..38461)
                     /locus_tag="LDBPK_360130"
                     /codon_start=1
                     /product="mRNA capping methyltransferase, putative"
                     /protein_id="XP_003865131.1"
                     /db_xref="GeneID:13388016"
                     /db_xref="GOA:E9BT73"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BT73"
                     /translation="MSQNRAAAAYDDVTRKRKDDWSSQQVAFRHFNNFVKKALIQFSL
                     DCVLANAAASPSEGAVVLDLASGRGGDIGKWFFMQSPSQSNPRALSAALHTSVYDCYD
                     VSLECINEAERRCKEMIAAMERPPQCCASFTVADCFTESFLRGTLPCSPHFGRYSVVS
                     IQFAFHYACKSLDLIRDVFSAVSDALAPGGVVLITTVDIEMLSKRAAEGTLGNELYSI
                     SFPNPPEYAAACNGNALLVTGTEYHFRLDGFVDCPEYVVPHDAVVQIASEARLRLCEG
                     MSKPFSEFVPDYSANWKANKGNKLSPAELELVTLYRALCFVKEKVAL"
     gene            complement(<39346..>40452)
                     /locus_tag="LDBPK_360140"
                     /db_xref="GeneID:13388017"
     mRNA            complement(<39346..>40452)
                     /locus_tag="LDBPK_360140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865084.1"
                     /db_xref="GeneID:13388017"
     CDS             complement(39346..40452)
                     /locus_tag="LDBPK_360140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865132.1"
                     /db_xref="GeneID:13388017"
                     /db_xref="InterPro:IPR018997"
                     /db_xref="UniProtKB/TrEMBL:E9BT74"
                     /translation="MSSDCKETESPQAGEPLAAVKLPSVNSSSSEDTDSDTYTISQTL
                     FDALTGRGFSENAIKKSIVAGCIDEATCTQWIQMHEGHPELDTALEDGAEVIIKAKRV
                     LTEAEREAKVRELQERVRRNKEEEKLELQRKERERLEVGRKMLRMKSEMEEVRRKMNA
                     EEARRENAADLEARRRIKIQIAADRLERRGHTREEALALAEKEYEEAAANARAEAAAK
                     LETLQGAQAPAQTATSSSDGTWNLSAVTAPSSAQNTLLGLFAGEAPTCAQSLVENIRK
                     RASAEQTGECVRTLRLILGNILSDPFDMKKRTLRISTKAFRDAILPVDEAVRLLRWCG
                     FDLSTDAASNQTLCLSTVVVRRLHQALALLDSEW"
     gene            complement(<41259..>43193)
                     /locus_tag="LDBPK_360150"
                     /db_xref="GeneID:13388018"
     mRNA            complement(<41259..>43193)
                     /locus_tag="LDBPK_360150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865085.1"
                     /db_xref="GeneID:13388018"
     CDS             complement(41259..43193)
                     /locus_tag="LDBPK_360150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865133.1"
                     /db_xref="GeneID:13388018"
                     /db_xref="GOA:E9BT75"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BT75"
                     /translation="MLKQLKETVVSAISSNPLNAYELATSGTTLCGRSDLFEKCDAVV
                     RANGKKVSIFTLRIKRVLERCTASEALALIKAVKESVALLTHMRHPGILSIEDQLVED
                     KKKIWFVAERVSMVLAPETVQGLPLQVKLLGLCHCAEAIRFLHEKAELLLLNFALSSI
                     YVTEDNQWKVGDLCFAVPRAQLSAPPPPPFPFHSVAAPLLDYLPTEYVEFCTKKADAA
                     NRDLFSVGAAPLVYPDSDTYGFLVVTVEVLQGKRLFNCGGNPQEQQRQLSTVEGHISR
                     YFPAGALRLPRPPISTVVITGPFATPDMKTLTGLFSFGILDSDTRFRLLKALYDGLTK
                     GDFCEAVIVSDIVPLMVQESKADAMLRFVLPILLLCAGTLSAGSFDRTLREYFVSLLT
                     AIIRAPSLQPAAVYAEQVLQKREGIHKHFASVEDRATLIIPLILKLMPSEGNERLQKG
                     SLEWFRDVLTQTPTVKLGLPKDIAARLLKVAASNADSFALAFQCLEKILTFCESETKM
                     DVEANLTRSIANTSISFTSVQLDYMLGLLRGIEEKMTPEHRAVKSIPLLCPLLLHANG
                     TVRQFAVASIVRYAQMLGSGSAPATAPPPSSGGSFSSSAANSGAPAALAGSWTQPTLP
                     PSAAPPPACTNDDVFASLFS"
     gene            complement(<45436..>46893)
                     /locus_tag="LDBPK_360160"
                     /db_xref="GeneID:13388019"
     mRNA            complement(<45436..>46893)
                     /locus_tag="LDBPK_360160"
                     /product="fructose-6-phosphate2-kinase/fructose-2,6-bisph
                     os phatase-likeprotein"
                     /transcript_id="XM_003865086.1"
                     /db_xref="GeneID:13388019"
     CDS             complement(45436..46893)
                     /locus_tag="LDBPK_360160"
                     /codon_start=1
                     /product="fructose-6-phosphate2-kinase/fructose-2,6-bisph
                     os phatase-likeprotein"
                     /protein_id="XP_003865134.1"
                     /db_xref="GeneID:13388019"
                     /db_xref="GOA:E9BT76"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9BT76"
                     /translation="MVLVHLRASNVYDVGGMNEANTIDFRHMVGVEYHTQREVVRPPP
                     SLTDTNANHVAMVSMGLYRFSNATSPVVIFVSSEERCSMPARFFCTRFVHYFRWIGES
                     VQLFVASKSFQDHRPTPYATQRDTWLQENRRCVSAALDYFDSNPKLGFVATPVAVMFT
                     DCDCADARAALVSLLPPERSFLIRHVRFAEEWESHRQNSYRFIDVSLQRQALRASRSS
                     GSVVCSSLTSFLNSMLPTLYQLYSAEPLEGAPGETLKSFPPIFFTRHGQSEYNVEDRL
                     GGDPDLTETGRIDAEDIAHFFERQVKTNVNLFDHRTTVWEEDGDFEVWCSQLRRTQRT
                     AQPTADILSHGVLKPFKSLNEIHAGICEDMTNEEVKSLYPFIQRFRHTDKVGFRYPDG
                     ESYVDLVRRLTPLLNDLNNCMKCVVVVAHQAVLRTMLSFFGGRPVEEAVHVPCPQRTI
                     WACTMNRLGEPQLAEIALSPRQTQDEGPEAHWQGW"
     gene            complement(<47433..>48290)
                     /locus_tag="LDBPK_360170"
                     /db_xref="GeneID:13388020"
     mRNA            complement(<47433..>48290)
                     /locus_tag="LDBPK_360170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865087.1"
                     /db_xref="GeneID:13388020"
     CDS             complement(47433..48290)
                     /locus_tag="LDBPK_360170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865135.1"
                     /db_xref="GeneID:13388020"
                     /db_xref="UniProtKB/TrEMBL:E9BT77"
                     /translation="MQQLQVSACVLLLALLCVTTVRGSGDLQQGTWDVSTLLPGRGAV
                     PPNYELTVQPGKWTVRERDNGRLGRLFDYAAARVGLVYAGVPSDEHALCRMPSSSTLK
                     LAAVRTDDGVRLECQTVWFSPSMLRSFENDGLLLRRFDPAEPLYSADNGRCLATPWRV
                     RELYVARMGEGSVLLTGILVGGASDTQEPCSVHLEVRHRPIASGKDSSSSGSLVSIAM
                     LLMVVVVRLLPRYILTRKGQLDKTSYRGKNPTSLTPTQRLHLLRQQKEIIEKMKAEDS
                     ANAAKRTAV"
     gene            complement(<50188..>50655)
                     /locus_tag="LDBPK_360180"
                     /db_xref="GeneID:13388021"
     mRNA            complement(<50188..>50655)
                     /locus_tag="LDBPK_360180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865088.1"
                     /db_xref="GeneID:13388021"
     CDS             complement(50188..50655)
                     /locus_tag="LDBPK_360180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865136.1"
                     /db_xref="GeneID:13388021"
                     /db_xref="UniProtKB/TrEMBL:E9BT78"
                     /translation="MDGISHFTRIKDTPETLNPITGRSIYYGMRPWRCDDRFQDWLKS
                     FTCFDSVSVQYNLLKLFVQCARSEEGQEPIDNYHRLGRAEVMYYVERYRSGMMRTGVL
                     ETYPYDQNELRRIAEEDGLKMRVWRHQREVEMESKEGKIDEVLHMNVMGRGKS"
     gene            complement(<51311..>51667)
                     /locus_tag="LDBPK_360190"
                     /db_xref="GeneID:13388022"
     mRNA            complement(<51311..>51667)
                     /locus_tag="LDBPK_360190"
                     /product="elongation factor 2"
                     /transcript_id="XM_003865089.1"
                     /db_xref="GeneID:13388022"
     CDS             complement(51311..51667)
                     /locus_tag="LDBPK_360190"
                     /codon_start=1
                     /product="elongation factor 2"
                     /protein_id="XP_003865137.1"
                     /db_xref="GeneID:13388022"
                     /db_xref="GOA:E9BT79"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="UniProtKB/TrEMBL:E9BT79"
                     /translation="MEPMFVVDIQTVEHAMGGIYGVLTRRRGVIIGEENRPGTPIYNV
                     RAYLPVAESFGFTADLRAGTGGQAFPQCVFDHWQEYPGDPLEPKSLANTTTLAIRTRK
                     GLKPDIPGLDQFMDKL"
     gap             51673..53805
                     /estimated_length=2133
     gap             55042..58313
                     /estimated_length=3272
     gene            complement(<58516..>61053)
                     /locus_tag="LDBPK_360210"
                     /db_xref="GeneID:13388023"
     mRNA            complement(<58516..>61053)
                     /locus_tag="LDBPK_360210"
                     /product="elongation factor 2"
                     /transcript_id="XM_003865090.1"
                     /db_xref="GeneID:13388023"
     CDS             complement(58516..61053)
                     /locus_tag="LDBPK_360210"
                     /codon_start=1
                     /product="elongation factor 2"
                     /protein_id="XP_003865138.1"
                     /db_xref="GeneID:13388023"
                     /db_xref="GOA:E9BT80"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BT80"
                     /translation="MVNFTVDQVRELMDYPDQIRNMSVIAHVDHGKSTLSDSLVGAAG
                     IIKMEEAGDKRIMDTRADEIARGITIKSTAISMHYHVPKEMIGDLDDDKRDFLINLID
                     SPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALTERIRPVVFINKVDR
                     AILELQLDPEEAYQGFVKTLQNVNVVVATYNDPSMGDVQVSPEKGTVAIGSGLQAWAF
                     SLTRFANMYAAKFGVDELKMRERLWGDNFFDAKNKKWIKQETNADGERVRRAFCQFCL
                     DPIYQIFDAVMNEKKDKVDKMLKSLHVTLTAEEREQVPKKLLKTVMMKFLPAAETLLQ
                     MIVAHLPSPKKAQAYRAEMLYSGEASPEDKYFMGIKNCDPAAPLMLYISKMVPTADRG
                     RFFAFGRIFSGKVRSGQKVRIMGNNYVYGKKQDLYEDKPVQRSVLMMGRYQEAVEDMP
                     CGNVVGLVGVDKYIVKSATITDDGESPHPLRDMKYSVSPVVRVAVEAKNPSDLPKLVE
                     GLKRLAKSDPLVVCSIEESGEHIVAGAGELHLEICLKDLQEDFMNGAPLKISEPVVSF
                     RETVTDVSSQQCLSKSANKHNRLFCRGAPLTEELALAMEEGTAGPEADPKVRARFLAD
                     NYEWDVQEARKIWCYGPDNRGPNVVVDVTKGVQNMAEMKDSFVAAWQWATREGVLCDE
                     NMRGVRVNVEDVTMHADAIHRGGGQIIPTARRVFYACCLTASPRLMEPMFVVDIQTVE
                     HAMGGIYGVLTRRRGVIIGEENRPGTPIYNVRAYLPVAESFGFTADLRAGTGGQAFPQ
                     CVFDHWQEYPGDPLEPKSLANTTTLAIRTRKGLKPDIPGLDQFMDKL"
     gap             61406..61504
                     /estimated_length=99
     gene            complement(<62028..>62705)
                     /locus_tag="LDBPK_360220"
                     /db_xref="GeneID:13388024"
     mRNA            complement(<62028..>62705)
                     /locus_tag="LDBPK_360220"
                     /product="mitochondrial inner membrane signal peptidase,
                     putative"
                     /transcript_id="XM_003865091.1"
                     /db_xref="GeneID:13388024"
     CDS             complement(62028..62705)
                     /locus_tag="LDBPK_360220"
                     /codon_start=1
                     /product="mitochondrial inner membrane signal peptidase,
                     putative"
                     /protein_id="XP_003865139.1"
                     /db_xref="GeneID:13388024"
                     /db_xref="GOA:E9BT81"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:E9BT81"
                     /translation="MRWRQWWSALRYSKYGDVPFVLLGVLIGWNCDVSCAVKGVSMVP
                     TLNPGEYILFVPYTMLQVRRWFNAPLVNLSDVVVVKVSDDLSVCKRVVKCTSSRAQAE
                     EWGKEHYVEVMPAPYSPPVPQHMNGDDEDSTEVDSATNSERAYFDYVARNTVRSKDWD
                     SCIDRIPNPSQWIWLEGDNKSESFDSRRCGPVPVECIRGLVLASIWPSPHALQRPPPP
                     PRASQLH"
     gene            complement(<65454..>66875)
                     /locus_tag="LDBPK_360230"
                     /db_xref="GeneID:13388025"
     mRNA            complement(<65454..>66875)
                     /locus_tag="LDBPK_360230"
                     /product="SET domain protein, putative"
                     /transcript_id="XM_003865092.1"
                     /db_xref="GeneID:13388025"
     CDS             complement(65454..66875)
                     /locus_tag="LDBPK_360230"
                     /codon_start=1
                     /product="SET domain protein, putative"
                     /protein_id="XP_003865140.1"
                     /db_xref="GeneID:13388025"
                     /db_xref="GOA:E9BT82"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="UniProtKB/TrEMBL:E9BT82"
                     /translation="MPISQRVAVVHDAATTPEQLDAFQRACPKSCDFFPAKDAAQLQC
                     VVQHIHAASPSVYEVVVNLCTDGSGGANGGVTPALATLFFHHASLSYTGCRAATLNHP
                     FDVLLMMLFYADVPLPPFALVDSVEAARRAAHRLKAPVQIRNTCGLLGLYRDCCTVQD
                     AVEATLIRALHEHGKIVAWEVNESKERAVRVLVAGGSVKGAAAAIPVESCATAPLWAA
                     RAEEAAQRFGSAVSRYVLYDCGVASLTLNTLKENPGKWCFEDLVLNPALPHLVLQEAV
                     PNLLASAPTAAELVASLLAEARKFHPAPTFEIKLHEDSRKGYHLCATKALRKGDVVFE
                     DECRSFAVVTRPHVERHWDDPLKKTFTEYAWPLDSEGHLYAIWEEDPQRWRPINHSCD
                     PNCIFAAPYSLNVIAARDIAAGEDLSMDYATFCDGTMKPFECLCGAACCRGVISADAC
                     SLAKYGEHSWLRKVPSAVKPLLP"
     gene            complement(<68442..>69230)
                     /locus_tag="LDBPK_360240"
                     /db_xref="GeneID:13388026"
     mRNA            complement(<68442..>69230)
                     /locus_tag="LDBPK_360240"
                     /product="dolicholphosphate-mannose synthase"
                     /transcript_id="XM_003865093.1"
                     /db_xref="GeneID:13388026"
     CDS             complement(68442..69230)
                     /locus_tag="LDBPK_360240"
                     /codon_start=1
                     /product="dolicholphosphate-mannose synthase"
                     /protein_id="XP_003865141.1"
                     /db_xref="GeneID:13388026"
                     /db_xref="GOA:E9BT83"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:E9BT83"
                     /translation="MQYSIIVPAYKECGNLEPLIRRVFAAVTEQGLPTQNVEMLIVDD
                     NSRDGSKEVVERLHEEGFNVHMDVRTTERGLSSAVIHGLRHTSGAYKLVMDADLQHPP
                     ECVPALFKALCRDGVEFVCGTRYGAGIEIDKNWPAHRRLISWGARLLARPLTTLSDPM
                     SGFFGIRDGVFKRHAGEVNSIGYKIALELFVKCRVQCFEEVGFNFATRTYGESKLTGK
                     VIFHYLEHLYALYLFKLGRLFYVFVVVAVMFAMYLVAFLYHSLF"
     gap             69739..69837
                     /estimated_length=99
     gap             70588..70686
                     /estimated_length=99
     gene            complement(<71527..>71856)
                     /locus_tag="LDBPK_360250"
                     /db_xref="GeneID:13388027"
     mRNA            complement(<71527..>71856)
                     /locus_tag="LDBPK_360250"
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /transcript_id="XM_003865094.1"
                     /db_xref="GeneID:13388027"
     CDS             complement(71527..71856)
                     /locus_tag="LDBPK_360250"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /protein_id="XP_003865142.1"
                     /db_xref="GeneID:13388027"
                     /db_xref="GOA:E9BT84"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:E9BT84"
                     /translation="MGVIRTVMKAGSGATPKAGQTITVHCTGYLADGKKKFWSTRDDN
                     NPFSFNVGVGQVIRGWDEGMMQMQLGETAELLMTADYAYGDRGFPAWNIPSNAALLFE
                     IELLKIQ"
     gene            complement(<72819..>73493)
                     /locus_tag="LDBPK_360260"
                     /db_xref="GeneID:13388028"
     mRNA            complement(<72819..>73493)
                     /locus_tag="LDBPK_360260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865095.1"
                     /db_xref="GeneID:13388028"
     CDS             complement(72819..73493)
                     /locus_tag="LDBPK_360260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865143.1"
                     /db_xref="GeneID:13388028"
                     /db_xref="InterPro:IPR021622"
                     /db_xref="UniProtKB/TrEMBL:E9BT85"
                     /translation="MLFDSDDDNLPEVPTIRSNTLIPLTTSGAQAQRLQQLEAEYRAS
                     RAETAAVRQRAARRCSSSRPVSPPEPRKAASHVWEERDEAAFYELHSLVPHLSPQFAC
                     SYSDAVLLIAAIQSGGAASGNRHTLADKCQSLEADRRQLEQRLEKSRAQCEELKREVA
                     EVKQKLRVVQEESRNSVNALAQRREEMRKQLLLEETRAEKLMVRNKKLEQENDSLKGR
                     VREQFR"
     gene            complement(<74809..>76443)
                     /locus_tag="LDBPK_360270"
                     /db_xref="GeneID:13388029"
     mRNA            complement(<74809..>76443)
                     /locus_tag="LDBPK_360270"
                     /product="EIF3-interacting protein-like protein"
                     /transcript_id="XM_003865096.1"
                     /db_xref="GeneID:13388029"
     CDS             complement(74809..76443)
                     /locus_tag="LDBPK_360270"
                     /codon_start=1
                     /product="EIF3-interacting protein-like protein"
                     /protein_id="XP_003865144.1"
                     /db_xref="GeneID:13388029"
                     /db_xref="GOA:E9BT86"
                     /db_xref="InterPro:IPR019382"
                     /db_xref="UniProtKB/TrEMBL:E9BT86"
                     /translation="MATNPDIETDIPRDVYQFFRGLNRAVERRDAAAMHDLYESQFDA
                     LTKNYYMAGHGQFRSWPALRLEQVSSCFRGNRMAELVYSFLFYKHLFMDNRSVRAPDA
                     EGAWKTYSELLPMLKSYELPNWMLWDIFDEFLYQMTVVYQKVFATEGIWAVPEVSRLL
                     NEVVDNSRLLELVKEPDFLDDIHRGPNTGALSGFYAIVTKSKLNVLLGDYYSALTDLE
                     PLDVYNKGRAVLTRVSPCAVSVFYHIGFSYLMIHRFEDASNAFRRCVTVKLNGRRFSE
                     RVQQDAAYMYVCARVLGGMPINNLTSYLDSRKVAAFEDDRESLRTGDEERFRDVFDRC
                     SPKFLTVPPSDGSPVKGSEGRELQARMFRRAVQQQQDIIKLRGYFKVYQNTKMNLLET
                     LLEVDDGYAPLFALKMRSRQLVHDGVTADLLQGVFTSSSEFDCIVQDDNVEVVPSMTF
                     GGIEQKLLNKIKNTQRDIEMAKRKFNQTRNRDEGGNKRRDQRDQKRRPNQQQLHGGVG
                     NNAGSANRNNNNANRYPRQKMAAQPMTSNLFNRNDN"
     gap             79231..80106
                     /estimated_length=876
     gene            complement(<81843..>81971)
                     /locus_tag="LDBPK_360280"
                     /db_xref="GeneID:13388030"
     mRNA            complement(<81843..>81971)
                     /locus_tag="LDBPK_360280"
                     /product="xylulokinase, putative"
                     /transcript_id="XM_003865097.1"
                     /db_xref="GeneID:13388030"
     CDS             complement(81843..81971)
                     /locus_tag="LDBPK_360280"
                     /codon_start=1
                     /product="xylulokinase, putative"
                     /protein_id="XP_003865145.1"
                     /db_xref="GeneID:13388030"
                     /db_xref="GOA:E9BT87"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="UniProtKB/TrEMBL:E9BT87"
                     /translation="MYAGIDIGTSGIKIALMRSDGRIADSASAPLTVSSPHPLWNE"
     gene            complement(<82843..>85293)
                     /locus_tag="LDBPK_360290"
                     /db_xref="GeneID:13388031"
     mRNA            complement(<82843..>85293)
                     /locus_tag="LDBPK_360290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865098.1"
                     /db_xref="GeneID:13388031"
     CDS             complement(82843..85293)
                     /locus_tag="LDBPK_360290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865146.1"
                     /db_xref="GeneID:13388031"
                     /db_xref="UniProtKB/TrEMBL:E9BT88"
                     /translation="MMYARRSDTMADIYAVAQDLIEELRTNLAELRRSPDVQARLQRT
                     AACKIGAGRARCHGHCPGLKSTAEKPIFCFLPLTTAPTTRIEFSHDFRRSEGAATKPD
                     DNGPLTTATTTPTTRSCSRSTVTKAKPFSTSLLSNNTMGVVLTTCPQILASQSVKAVK
                     EPNSPAGEPAGHVKHAAAAVEPSTGDDTAAATAASSEVHTDSATTAWCIPFSGVSRAL
                     VDLRRLTPLARQLYTDMQRRAAAMPAASRSVEWRRRTAGPQDAEVRRAVRDYLYRMNI
                     ISVMEAEDTSVTAPHVFGDAVLNGTALCQLVETLRESGEPSLSDPVLCRCPRTLDEVR
                     VNYAVALAALRSTPSTAQELMPRAAWTMTPEEVYLRASPTALLSLFVHLISTYLPAPE
                     ELPVWRQHMCWQPPADTADYAPVPPTELAAMEAGCCRFLHAWGVLPDGSVYQLPGDEC
                     LLPIATAAPYMAKWSGFVVRSVAPSSLSVPSVWPFLCNGVMLVLLARRSGLEAAAKEA
                     ASSSAVQPFFANPRTVACCAANITSALHSFQSASTKKLPLSFISEESVAAVIRGDRLH
                     ILHLLLHVRAAVEGTPQPPDVRSTLLSKDAIAEAGYTPAKLSSRAPDSEAVAASLSSS
                     WPSASLARTPSTVAKAALRRSAPPSPAHRSLSPRCIPAIASSSSGILRREAVPADEPQ
                     CLGRLCGWLRQQLGTEYRYTAADESFVFDAATFSWRHPCLLFSDGVVLAYLIGRLERR
                     RCSFLDCVQPTSKKPAKLFNVRRCLEFLRFNAGVVFDVPLLDEALTEGRVEGVVSVLQ
                     GMRRHYCLTNVRRSHHGA"
     gene            complement(<86336..>86941)
                     /locus_tag="LDBPK_360300"
                     /db_xref="GeneID:13388032"
     mRNA            complement(<86336..>86941)
                     /locus_tag="LDBPK_360300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865099.1"
                     /db_xref="GeneID:13388032"
     CDS             complement(86336..86941)
                     /locus_tag="LDBPK_360300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865147.1"
                     /db_xref="GeneID:13388032"
                     /db_xref="UniProtKB/TrEMBL:E9BT89"
                     /translation="MALSATSSSSSDDKIVNLLAIALQKVDDFKGKSADARHYASQVV
                     AAVRANNNTEEEFRDQIICIVANVKNLNGELGAVPQERKPGISAAELATMDANAMRSR
                     LQKRTMAATFRKRAREQTNVDKTSLHCTKCGLVRRDRLNINELALDSEESGSHFDYNF
                     DNSCACSHSSDDERSSSGDEEDDDTATSKGSCATASDRHSD"
     gene            complement(<87417..>88367)
                     /locus_tag="LDBPK_360310"
                     /db_xref="GeneID:13388033"
     mRNA            complement(<87417..>88367)
                     /locus_tag="LDBPK_360310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865100.1"
                     /db_xref="GeneID:13388033"
     CDS             complement(87417..88367)
                     /locus_tag="LDBPK_360310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865148.1"
                     /db_xref="GeneID:13388033"
                     /db_xref="UniProtKB/TrEMBL:E9BT90"
                     /translation="MRRREAESAARFYMAGMLVGLLGLLLSCGYSFGLFHSPDEVEQL
                     NAAIRTVEGRQVALLLDSVFSNGTRFDGKGHIHPLYALACVQEEETEEARRMIRNVAR
                     RFRTEPIDIGYAHHPLTAAYRHHRYAVAQALIEEWRRPAPNVSDEEAVMDEVYASSLT
                     VSELQRVDPSVHVYCRDADAVRCRALDPERIRDASNSRLEAAYRRRFGQTQELPTVTP
                     YRDTDMPSKIVAPASTVRAAFWDDPFRPLVPDLLPPRTAMVMNPGYFDNVLDQLSYTL
                     LGHMEGSSTVVAFGLFAMCTMCLFLGTWCAGVSYWLLHYT"
     gene            complement(<89107..>90105)
                     /locus_tag="LDBPK_360320"
                     /db_xref="GeneID:13388034"
     mRNA            complement(<89107..>90105)
                     /locus_tag="LDBPK_360320"
                     /product="NUDIX hydrolase protein, conserved"
                     /transcript_id="XM_003865101.1"
                     /db_xref="GeneID:13388034"
     CDS             complement(89107..90105)
                     /locus_tag="LDBPK_360320"
                     /codon_start=1
                     /product="NUDIX hydrolase protein, conserved"
                     /protein_id="XP_003865149.1"
                     /db_xref="GeneID:13388034"
                     /db_xref="GOA:E9BT91"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:E9BT91"
                     /translation="MCCHTSPLRFSYPHTVLRSNRRRRHMIRATAAAARLPQSTQGWV
                     PLMQRALDFPIESVTFPSHFYLLTVNKGTVSTVGFSPQKAPVQLTAPRQCAVLVLLSP
                     AATENGFQDMCITLTKRTATMGSHKSEMSFPGGHVDADETLRNAAQRETLEEVGLPPS
                     EYEIIGSLTPITTRALDARVTPFVAVATSPVQPYRASPAEVDSIHYLHMSTLLLRAST
                     GHARVIKYRSFTSDRPCFFPCFFASPAQTVVSSAVCRSPKATGVADDCGFDPMLPEDF
                     PGELVWGLTSFVTCELVARVAKAIMDAPEASSAAAVNALLTPSNVVARDPLADSPQ"
     gene            complement(<90890..>91582)
                     /locus_tag="LDBPK_360330"
                     /db_xref="GeneID:13388035"
     mRNA            complement(<90890..>91582)
                     /locus_tag="LDBPK_360330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865102.1"
                     /db_xref="GeneID:13388035"
     CDS             complement(90890..91582)
                     /locus_tag="LDBPK_360330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865150.1"
                     /db_xref="GeneID:13388035"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:E9BT92"
                     /translation="MPSEHWSFFGLPPFFTEQHSPATLDRQCTLWSNLLLDHAIYHAQ
                     RTAGGDTNALLRFYTTQSDIFYNPAIDKRLSPEAAHTMLQSLVARHPNHAVIVSDGGP
                     RDFSVLVCTTEDGFKGMEETLLRYILDHGEVQTTAMLSKKGTVMTFDELASGAALGYG
                     QTRPAYLARFSSAAVPVADVGRLSEEQAIRTYLHAVNHRPVSAMRPFKVTLFNLDETA
                     TQPYQGVKFGGE"
     gene            complement(<92820..>93440)
                     /locus_tag="LDBPK_360340"
                     /db_xref="GeneID:13388036"
     mRNA            complement(<92820..>93440)
                     /locus_tag="LDBPK_360340"
                     /product="proteasome beta 2 subunit, putative"
                     /transcript_id="XM_003865103.1"
                     /db_xref="GeneID:13388036"
     CDS             complement(92820..93440)
                     /locus_tag="LDBPK_360340"
                     /codon_start=1
                     /product="proteasome beta 2 subunit, putative"
                     /protein_id="XP_003865151.1"
                     /db_xref="GeneID:13388036"
                     /db_xref="GOA:E9BT93"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BT93"
                     /translation="MAETAIAFRCQDYVMVAAAGLNAFYYIKITDAEDKITQLDTHQL
                     IACTGENGPRVNFTEYVKCNLMLNRMRQHGRHSSCDSTANFMRNCLASAIRSREGAYQ
                     VNCLFAGYDMPVSEDDDGAVGPQLFYLDYLGTLQAVPYGCHGYGACFVTALLDCLWRP
                     DLTQQEGLELMQKCCDEVKRRVVISNSYFFVKAVTKNGVEVITAVH"
     gene            complement(95314..95574)
                     /locus_tag="LDBPK_360350"
                     /pseudo
                     /db_xref="GeneID:13388037"
     misc_feature    complement(95314..95574)
                     /locus_tag="LDBPK_360350"
                     /pseudo
                     /db_xref="GeneID:13388037"
                     /db_xref="PSEUDO:CBZ38473.1"
     gene            complement(<96329..>97753)
                     /locus_tag="LDBPK_360360"
                     /db_xref="GeneID:13388038"
     mRNA            complement(<96329..>97753)
                     /locus_tag="LDBPK_360360"
                     /product="ribonuclease HII, putative"
                     /transcript_id="XM_003865104.1"
                     /db_xref="GeneID:13388038"
     CDS             complement(96329..97753)
                     /locus_tag="LDBPK_360360"
                     /codon_start=1
                     /product="ribonuclease HII, putative"
                     /protein_id="XP_003865152.1"
                     /db_xref="GeneID:13388038"
                     /db_xref="GOA:E9BT95"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:E9BT95"
                     /translation="MLHAWRFVPLARSTSALGSGLLRPSRVLRQKRLAYSPFRPPPTW
                     NALQKVEVGHRQTDTGEPTLDGTLDLVGYQLYRDGLLPQTNILGRTLPVPDTSGISAA
                     TRRKLERERDVAVAHMKRHGVRLRRSIKETAVTIGCDEAGRGPLAGPVVGAAVSRIPV
                     SSFNNEFDQLYEAPEQFQIFDSKSVSERQRDLVFAMITGHVDFFDIASCKKFVVHHCA
                     GDEATSLALSSKKFDSHVKLSKLPFKKLISMQTPYLITYHGYNSAGNYVYFWSIGIAN
                     HTYIDEYNIYNASMNTMHRSAQSIWHMLSDARFSHEAAPRPRSSSIAQYLFSRFCTAA
                     NHDNEKRYQVPHHLELLKGATEYFDFEPIQPPLVLIDGHAVPGPSYDYFTSVRIGGDV
                     QPIIEGDKRSLSIAAASCLAKVTRDELMNYIDALYPGYGFRENKGYPVEQHMKYVAKN
                     GLCPIHRKTYRPCRTVLEKGLQRK"
     gene            complement(<98998..>99189)
                     /locus_tag="LDBPK_360370"
                     /db_xref="GeneID:13388039"
     mRNA            complement(<98998..>99189)
                     /locus_tag="LDBPK_360370"
                     /product="nuclear protein family a (nop10p), putative"
                     /transcript_id="XM_003865105.1"
                     /db_xref="GeneID:13388039"
     CDS             complement(98998..99189)
                     /locus_tag="LDBPK_360370"
                     /codon_start=1
                     /product="nuclear protein family a (nop10p), putative"
                     /protein_id="XP_003865153.1"
                     /db_xref="GeneID:13388039"
                     /db_xref="GOA:E9BT96"
                     /db_xref="InterPro:IPR007264"
                     /db_xref="UniProtKB/TrEMBL:E9BT96"
                     /translation="MHLRVYMVDGKRVYTLKKVDPEGKPTLSAHPARFSPDDKFSRHR
                     VTIKRRFKVLPSERRLQPL"
     gene            complement(<101200..>102711)
                     /locus_tag="LDBPK_360380"
                     /db_xref="GeneID:13388040"
     mRNA            complement(<101200..>102711)
                     /locus_tag="LDBPK_360380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865106.1"
                     /db_xref="GeneID:13388040"
     CDS             complement(101200..102711)
                     /locus_tag="LDBPK_360380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865154.1"
                     /db_xref="GeneID:13388040"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BT97"
                     /translation="MQKPRTVSATTLPQVAAVPRPPMSGVAAAALHHRSYHVAVTASS
                     RPRRVSLNAPRHVPKYIFTEPTSVPWPRSLRGAHDICATVSHSRQRTLCKTSEGSVLK
                     ARPRTVSAADSAKVLAIRGVPFAADKLGTGKDEDSSQLNDGFDGGLSSSTLTTCSPKG
                     PRHQPIQPGRMLKLQLDTAAIEDELKLSANSKSATAVSPTTPRPDKLAAYHALRLLFV
                     PIWKLYRFHKQMVRATAIVAKHVLLKVHWRRHRRSERATDTFLHLLRIPRTKLRCAAH
                     LLEGRVVRIQRAFRRHRARVQAVVELNYRKVRRDVEEAYWEAVVTQHEAELAVQQRPF
                     SPVPKAVREVFGARAEARARFGSIQRRTCLLSSAEKSSYDAAAPSCELDVYSFHMIGR
                     LPESLLRFEMTSAVFAQLRRSAARAHLMDDFSETRARRAGMESLMEPGDITPTNTAFV
                     RSRGKCRAQMPRFLPESVYAAILNNTCYLTSLMRDDRKLRAHLRQREHHLESY"
     gene            complement(<103951..>104730)
                     /locus_tag="LDBPK_360390"
                     /db_xref="GeneID:13388041"
     mRNA            complement(<103951..>104730)
                     /locus_tag="LDBPK_360390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865107.1"
                     /db_xref="GeneID:13388041"
     CDS             complement(103951..104730)
                     /locus_tag="LDBPK_360390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865155.1"
                     /db_xref="GeneID:13388041"
                     /db_xref="GOA:E9BT98"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:E9BT98"
                     /translation="MTAEQNILLDPSIRDWVLLPLIVIVLFMGVLRHYVTILMNSPSK
                     PNMARICNVNIQNYGRILLSGGAALSPESFKHRAERMLNGMLKKEVDPVNPMEMMNDP
                     NVMMGLLKNQFMMMVPNIGMMMLVSYFFSGFVVAKFPFPLSHRFREMMQRGLEIDVLN
                     CNYVTSLSLYFLIMSGNQGLLQLLLGEDVESENHSAMMMQQMPQASAQPVDFAKVFKQ
                     ISDELAFVKDHHRWGYENAPDVLLKKWRSQKRAKGTAAKRR"
     gene            complement(<105773..>107140)
                     /locus_tag="LDBPK_360400"
                     /db_xref="GeneID:13388042"
     mRNA            complement(<105773..>107140)
                     /locus_tag="LDBPK_360400"
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /transcript_id="XM_003865108.1"
                     /db_xref="GeneID:13388042"
     CDS             complement(105773..107140)
                     /locus_tag="LDBPK_360400"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate 5-kinase-like
                     protein"
                     /protein_id="XP_003865156.1"
                     /db_xref="GeneID:13388042"
                     /db_xref="GOA:E9BT99"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:E9BT99"
                     /translation="MGQVGGTATSGRGLTALQVAAALRVTAAARLKKAEAATSSSQAM
                     HSTHCSLAEQSKAIKPEDCSAVQQLTVPSTDHKGKHVKVRVTEYAPEVFSFLRQLKGV
                     TDPQFADEWSLPENRLKMEMGEGRSQAFFLKSKTMLFMCKTISVEEVRALLRVLRAYT
                     LHITAHPSSLLMRFYMLLKVSVRNEEGYILCFNDVFGAASVLHEKWDIKGRVPKNGKH
                     LHYPHLIRSGYEPDPHVTKTRKKPHVLANPAIDASQQHPGRESAVVVRGTEGAQGLPT
                     LHDKDLTRLFWAPRTARKRLVEELLRDYDFLKNAGMMDYSLLIGVAYQDDKTRPPEKR
                     YGIENTNVASSSGVAPVSTSAEVRPATLAQDNHPFGTRTTLTTFPEFANGVRSFDDQE
                     VYYIGVIDVLTTYTLKKKGANFFKSLLWKQKTLSTIPPDRYAHRITSFTELIFPDVKE
                     EANGG"
     gene            complement(<107707..>108168)
                     /locus_tag="LDBPK_360410"
                     /db_xref="GeneID:13388043"
     mRNA            complement(<107707..>108168)
                     /locus_tag="LDBPK_360410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865109.1"
                     /db_xref="GeneID:13388043"
     CDS             complement(107707..108168)
                     /locus_tag="LDBPK_360410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865157.1"
                     /db_xref="GeneID:13388043"
                     /db_xref="UniProtKB/TrEMBL:E9BTA0"
                     /translation="MSDFDGDLSNVHPQLLKLCANPEDWREQRRRAMKAKIFGTGAQA
                     GASPAAETYLPTDRTVGPSPSSAQQPSASSYSGQQGPVSQQAAESYILQQILSHKRRR
                     EEANTEKASALASTPQPHPQQPMTQQQQNPPSSQGQELSLKEKLMRKYRKG"
     gene            complement(<110506..>112497)
                     /locus_tag="LDBPK_360420"
                     /db_xref="GeneID:13388044"
     mRNA            complement(<110506..>112497)
                     /locus_tag="LDBPK_360420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865110.1"
                     /db_xref="GeneID:13388044"
     CDS             complement(110506..112497)
                     /locus_tag="LDBPK_360420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865158.1"
                     /db_xref="GeneID:13388044"
                     /db_xref="UniProtKB/TrEMBL:E9BTA1"
                     /translation="MSSKRTEGTAADEERRQTSAASSGSSSVSSTDSEEASSSVSDSS
                     SSASGSSSGSESSDSERPLSPPQRQSAAATERATSTQQLQQQRHVQLNPELRFERPDK
                     EYIPLPPLRDMQDMAKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQY
                     QQAQRSGRVMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLAPM
                     LIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS
                     GAGYKIEAVQVGSTSAAPATVPAAVAPRPSLAAAAAPMQALETRAPFAGRLPGTGSVK
                     VPVAPGVGGPRPPVKVPMKHAGGGVAHGSVTAAAAPPLASTSVKQMPPEMKHLFWLSV
                     LAHVKGGEASRAFPDDRLEALPGLLRLCEMTEHTEEMCILMDVLAASSSGVQTVFERL
                     GGLLSFRRFASHFIQSEEAEPLMQLVEQLARWRVAAWGSTSQQAWQTDMNQRRTRDLM
                     WLRTLPLIPEAKRAAWGAVLLVMEQRYIFKAPRPDDTTTADNSLKRRRPEVELGDLHA
                     VLSDNVDMQRWVVPRVNVFSAVRLPVELRVPPLCTKLEEDTVRFLNSKREYAEKAQVT
                     WRERLEKILSAQPRAPGAAVPVPLWYDPYALLSVASPQL"
     gene            complement(<114895..>116235)
                     /locus_tag="LDBPK_360430"
                     /db_xref="GeneID:13388045"
     mRNA            complement(<114895..>116235)
                     /locus_tag="LDBPK_360430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865111.1"
                     /db_xref="GeneID:13388045"
     CDS             complement(114895..116235)
                     /locus_tag="LDBPK_360430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865159.1"
                     /db_xref="GeneID:13388045"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:E9BTA2"
                     /translation="MTTVLNRRFEVLCHSGTCPSYLIDVLSLLVAHANDTELFKTELR
                     KGDGGEFGAAATGTGSVHATSSTGPSSRTDRAVGETRERQAADRRTQLMYKQVEDPEA
                     LDDALRASHETVLIAAERSLQTYTEDLKHINDIAIATSAKQLRAMRVETQQQMEAFRD
                     RVCGSVVAQTKEELEVIRSELAASVRADVSDMVRQLHQVSFSTQQQLQQLTSSYTDFV
                     AQAHDALAVAPLADAYEAVKTVEYMQEQLKCIEAAAATRSDMETLEERLKDLESIMAT
                     LGSAARTPDAGAAAAPREGFSMNVPPPLQLSQQELVPSNRSASHRSQTPKSTSPLPSR
                     LHVPRSATAKSRPSSSPPALPRPPSQRTLAERLGVTVEAVEDGVVLAEVLPGSVAAAH
                     RLGVGHIISHVGRTVVKTPAAFEEALRAIEGQAVKITAYDPFNGRVRVLTAQPF"
     gene            complement(<117740..>118336)
                     /locus_tag="LDBPK_360440"
                     /db_xref="GeneID:13388046"
     mRNA            complement(<117740..>118336)
                     /locus_tag="LDBPK_360440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865112.1"
                     /db_xref="GeneID:13388046"
     CDS             complement(117740..118336)
                     /locus_tag="LDBPK_360440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865160.1"
                     /db_xref="GeneID:13388046"
                     /db_xref="UniProtKB/TrEMBL:E9BTA3"
                     /translation="MYSDGERKTVSELQREAEATRKEIIEEAQRLERIKKATAKTQFS
                     IDQLFRFFAREVETEKEKKMLIDLLVSNPPDLHIECVPVLPVVIAIANGRMTNARRIY
                     TTDNAFLDDSAFILLVHTLRFLPQACKIDFLDISGTGVTERGMCFVLEMMIERNTPFT
                     LVAKRLSIPSAEAEAVRARYTSLMSALRDKKCCRFIQE"
     gene            complement(<119474..>120958)
                     /locus_tag="LDBPK_360450"
                     /db_xref="GeneID:13388047"
     mRNA            complement(<119474..>120958)
                     /locus_tag="LDBPK_360450"
                     /product="amino acid permease-like protein"
                     /transcript_id="XM_003865113.1"
                     /db_xref="GeneID:13388047"
     CDS             complement(119474..120958)
                     /locus_tag="LDBPK_360450"
                     /codon_start=1
                     /product="amino acid permease-like protein"
                     /protein_id="XP_003865161.1"
                     /db_xref="GeneID:13388047"
                     /db_xref="GOA:E9BTA4"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BTA4"
                     /translation="MRAHRHTTACAGMVGGGDSNLNELSPMLPHGTWLRMSHSHAAFD
                     TELNRSIGSNVRRANSVPVLTRRDRRLLTVSPMLFDRYYMAEGGGLISSAFNLASATC
                     GAGVLALPYAMQHCGTVTGTLTLIFVCNLTIYSVFLLAKVSALTKLMSYEELAIDLVG
                     PITEKVTAAIIVVFCWGVAVMYIVMMGDFIVPLFEAVGLSHKVHRRTAMVLFWALVMF
                     PLSMARKVQTLRYASIVGTVSIFLLAGALVDRFAQDRREDANSTGLDPGGHTPPRAPL
                     ARWDSGMIGALTTFVFSYCCQPVAPRIYEELKDRSVKRMCVCTVCSMTAATVIYILTG
                     VFGAMSFGDSVKPNVLVNFSNHLDSRPAQLAYFGIVVSLTMAFPMTIFPTRDSVVMAM
                     GYHAEENPAPVWLSRTIAGLLALLALLIGIALPNIRVLFDVLGGVCGGSLSFLLPALF
                     ALRSGYWTTAEVGWRHMALTWLTLAFGVVVCGLGTYNSVKSNFF"
     gene            complement(<123049..>123894)
                     /locus_tag="LDBPK_360460"
                     /db_xref="GeneID:13388048"
     mRNA            complement(<123049..>123894)
                     /locus_tag="LDBPK_360460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865114.1"
                     /db_xref="GeneID:13388048"
     CDS             complement(123049..123894)
                     /locus_tag="LDBPK_360460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865162.1"
                     /db_xref="GeneID:13388048"
                     /db_xref="UniProtKB/TrEMBL:E9BTA5"
                     /translation="MVVVLPALRAFRSCSRSDHHAPCLSCAAPAREFVLCWVPTTVSV
                     APPYFTCTLFCFRHPSPRTCRACFRVTVFSSALACSLLACVGCRLPSSPSRYTPWRIL
                     MYRQSIAGLALAAALAEIQPALTPRQEEEIWRVFDAAMQTAVADAPLMSHISVQTPPP
                     SSVGGGGYAAVTSTASELYVPASAEDGGGIDVEERAVGKPTATSRDGETPFEDSHIAF
                     PVYRLVDDEWTLLLKDPTVVVRNELGVSEKIQLDYLRVRLKDIGAQPGATQPKQARAV
                     RERRA"
     gene            complement(<125682..>127130)
                     /locus_tag="LDBPK_360470"
                     /db_xref="GeneID:13388049"
     mRNA            complement(<125682..>127130)
                     /locus_tag="LDBPK_360470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865115.1"
                     /db_xref="GeneID:13388049"
     CDS             complement(125682..127130)
                     /locus_tag="LDBPK_360470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865163.1"
                     /db_xref="GeneID:13388049"
                     /db_xref="UniProtKB/TrEMBL:E9BTA6"
                     /translation="MRRRLACWPIAAFAVARAITTNSFVSSIEQVQQQLQTAQDRRVE
                     LLRYGRQLYEVEVLDDLKTAYTPAVASKICYVASQLRIDATKGQPYTAVLEATMTAEG
                     EQAMDVASLARIVHSCLVLRSGHLHEVLFTFIPFLREKAGTMDAVTTAVLINAYGRSG
                     VHHPGLYKALCDNGATVLKDPRVPLAHIANVAYAVSRVKFLHPALMLTLRDHALRKVA
                     EASPIISLTVLDAFTELRQIDDDLFSAYEQRLLGQLNELQAPLMASLVSCVVRAGRGK
                     AEVMESLGARTVAIADTFDAASIAKVTNAYYEADVASEDVLGALAERACKVAADFRAD
                     EIATVLNALSAFDLFDAELFPLLASRLVALHRQGGYVDVADAAVILSSFAAVQERNDE
                     LIYVCTQLFAAYPGVAMDPAVRVNALWACASLNVHNEAQTKMLEEVRATPSLVMWESK
                     TDMLPKAKAMLEERTQFLAKVYGITISSSGAR"
     gene            complement(<129328..>130914)
                     /locus_tag="LDBPK_360480"
                     /db_xref="GeneID:13388050"
     mRNA            complement(<129328..>130914)
                     /locus_tag="LDBPK_360480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865116.1"
                     /db_xref="GeneID:13388050"
     CDS             complement(129328..130914)
                     /locus_tag="LDBPK_360480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865164.1"
                     /db_xref="GeneID:13388050"
                     /db_xref="UniProtKB/TrEMBL:E9BTA7"
                     /translation="MIPGGAGSGLEPVHPRSGLAHPYMDSVPTSSVPGMFSSYTGRPT
                     FSAGIGEGGIAGGGGGARAASAESSPSEGEAFTKEDRMLLRLLYHQQQAIQVQLNTMT
                     EWMQQVNYRIASLERLSRHTRPVTAVGATSSLTASAAPPPSCSTSAAEGYGTVAGQLQ
                     GAPLYSSSPALSARDAPRPQTGSAPASVYGGQGLHQRATSSAPPLSSVLESSRACTPP
                     SEQTRHQTGGAGGGSAVPSTTRSFESAMAQPWDPHNTSLQSASGAGVHSRTSSHTSAL
                     GRRANPLLSSSTTMSKLPTSTSRPNWGDPKQLSRLDASVPSGTAQTSLSSGLTSLDTQ
                     QPPPSQQQQQQSRQPPVVSPPTAAAVPYVSFPLYTSADTVVPPYRRIPPEPTTRQPHS
                     RAAGAVTVSASTASRTPPVFSGTVDASLAASGREGTLPPAQSSSMVTSSNHSDARGRA
                     ATETTAVEGSREVRATHSVAVVSRGDLHAATDLAGGVGRAARRHDGGTRLPSASNDDS
                     LSDGYGSYESRMYMKNLGLL"
     gene            complement(<132673..>134526)
                     /locus_tag="LDBPK_360490"
                     /db_xref="GeneID:13388051"
     mRNA            complement(<132673..>134526)
                     /locus_tag="LDBPK_360490"
                     /product="vacuolar protein sorting-associated protein,
                     putative"
                     /transcript_id="XM_003865117.1"
                     /db_xref="GeneID:13388051"
     CDS             complement(132673..134526)
                     /locus_tag="LDBPK_360490"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein,
                     putative"
                     /protein_id="XP_003865165.1"
                     /db_xref="GeneID:13388051"
                     /db_xref="GOA:E9BTA8"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:E9BTA8"
                     /translation="MSSVSSSKVNRGRRNCLEQAWNYLNTAFSATAGLKVLLCDDATR
                     EILSVAYSQHQLLQHNVVLVDMLANEERYPMKHFSCVIVCRPSAASLAAVYQELAEGN
                     FASYDIYFTYMLDSSLVQSLANADVLNLVSRVGELYINSIPVTEWVCLMQLKPSPLAK
                     GPSPFMNPITYSQWDPKSLERMSEGIISMLLSTNRRAVIRYREGSKVSEKLAVEVAAR
                     MKSVHATFPDLKATESVLVILDRKDDPVTPLLMPWTYEAMIHELIGFQRGNEVVIDDP
                     DAKPEDRVHVVAPQTDGFFGQHRYDDWGQVCVAVSEMVKAYKEMNQFDRNTVSLDEIK
                     NFMNRFPEARKQSVQVTRHCAITSELVAEINGRNLTRLSVLEQDIINNNNVTEHSRLV
                     LEVVQDPKTDVDDALRIVMLYHLHYERVAGNIIMQLKQELMQRQCPQEKVQLIDRLIE
                     YAGQDQRCHEIFRSSTGHMLKTVAKAVGQFGKDVQNVLTQHVPLVKKIINRVYNGTLS
                     VEKYPVQRVPGCPIPASQAPFVRAKDIIVVYIGGYTFSEAMLLAQINEGNVDNNQETL
                     MNFGKQVSRKLGTDGVTGPSTEPYTAKIEAHVSLITTSMLNSKDFIHSLPS"
     gene            complement(<135489..>136808)
                     /locus_tag="LDBPK_360500"
                     /db_xref="GeneID:13388052"
     mRNA            complement(<135489..>136808)
                     /locus_tag="LDBPK_360500"
                     /product="dihydrouridine synthase domain protein-like
                     protein"
                     /transcript_id="XM_003865118.1"
                     /db_xref="GeneID:13388052"
     CDS             complement(135489..136808)
                     /locus_tag="LDBPK_360500"
                     /codon_start=1
                     /product="dihydrouridine synthase domain protein-like
                     protein"
                     /protein_id="XP_003865166.1"
                     /db_xref="GeneID:13388052"
                     /db_xref="GOA:E9BTA9"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:E9BTA9"
                     /translation="MKVEESMFYHKTILAPMVRVCSPGFRALCGAHGADVVFTEEVVA
                     AKLATCQREVVHYPTVDTPMAEYVSYDPFKNTYKRTVVLSTPVLPDITCGGHKAERIA
                     APRIVLQLGVADPARGAAAALVCSNDIDGIDINMGCPKKFSVHNGFGAALMKRPEVGG
                     AIVRAVHDAVNSDSNVEARGGKRVAMSLKTRLQDTAEATVGMLRAILAAAQHTPTNPI
                     LHAITIHARTPDQRSEQAPLYDRAAEVVRTCRADAAFEGICLVLNGSVLSRQDGEAKC
                     ALYGFDAAMIARAALEDARCFHRKGSELRFSSAAHDSEAQSTEDAEVYAMAIMKELFF
                     YSVRYRTLFNNFKYHLTRAFPMVKALKPFMEEVQVELRSYADCYEFFRLTVEEKALAD
                     SCAHTVELLVEKSASTRKRAAVTAAASEEVGAQEHKLARVETTKASS"
     gene            complement(<138459..>139136)
                     /locus_tag="LDBPK_360510"
                     /db_xref="GeneID:13388053"
     mRNA            complement(<138459..>139136)
                     /locus_tag="LDBPK_360510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865119.1"
                     /db_xref="GeneID:13388053"
     CDS             complement(138459..139136)
                     /locus_tag="LDBPK_360510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865167.1"
                     /db_xref="GeneID:13388053"
                     /db_xref="GOA:E9BTB0"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="UniProtKB/TrEMBL:E9BTB0"
                     /translation="MLRKTNLFLFAASRALMSGGSSHGPMPYQDKSYPVQPHNLNELQ
                     QPPDSWRKSPIMSKLMDQSLPVYDDVVTGVGRLYWQEPARVWHLFEADDTLMLEEHDR
                     EEWNDRPYVAVNHLYEPPIGSEERPIRVEGTGNPGDQQIVLCFGNCAPHVPQSNYYMM
                     MKGYSKTKCPMCQQWFYVHNRPWLVMHPDWTDEPAADEGPAYTFAEIEAEFDRDFHEF
                     GVYLNAE"
     gene            complement(<140967..>142016)
                     /locus_tag="LDBPK_360520"
                     /db_xref="GeneID:13388054"
     mRNA            complement(<140967..>142016)
                     /locus_tag="LDBPK_360520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865120.1"
                     /db_xref="GeneID:13388054"
     CDS             complement(140967..142016)
                     /locus_tag="LDBPK_360520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865168.1"
                     /db_xref="GeneID:13388054"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:E9BTB1"
                     /translation="MPRPQFITCQLCGKGFGSASINIHIPQCYEKAIKRWQLNPQGPR
                     PVMPPLHGKPAAKASNGGSSGIAFAGQPRGAGMSAVRSLQMQSMPPESVEPENMNLHP
                     CSKCGRTFNFDRIAYHESVCKGDQKRRVFDSSKQRCAGGEGDDAYAGGVFGAPSEVRR
                     GRTKKLGTANTTSRYTPAPAPQTNWRQQHEEFIAAIRSAKRAGAEAQSMWGTGPAAPS
                     FSPSRGPARGGLFGATSSGYGDRAGMSARVSASTRRIPPLMAKQNETLKQGIATGGRA
                     ARAKEGGGIPAPRTGRPFGRPTPPLGRDSFGGRSDRFGSRGGGGGMGGGGGGGGRILN
                     DNKTSVGMLQAMGRA"
     gene            complement(<143343..>144875)
                     /locus_tag="LDBPK_360530"
                     /db_xref="GeneID:13388055"
     mRNA            complement(<143343..>144875)
                     /locus_tag="LDBPK_360530"
                     /product="DNAJ domain protein, putative"
                     /transcript_id="XM_003865121.1"
                     /db_xref="GeneID:13388055"
     CDS             complement(143343..144875)
                     /locus_tag="LDBPK_360530"
                     /codon_start=1
                     /product="DNAJ domain protein, putative"
                     /protein_id="XP_003865169.1"
                     /db_xref="GeneID:13388055"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BTB2"
                     /translation="MTQDEAPAASSSGKGNWEALKEQGNQAFKSNAFAEAIQHYSAAI
                     EAHPDEPVLYSNRSAAYLKRGQYQEAAHDAEKAVTMDRTFAKAYSRLHSALCNLGLFD
                     RASEALKAGLTAVSTSPKATPQDVKHLRELLNSAEQASKVVPRGRQLIETGCFAEAGR
                     ALAGPYRDFPGSSTLAFLYAEAHAPSSPDEASRVLSPFAYTHSSDPYYLYLRALVLYY
                     RGQEGFSSAQNILRETLQMDPDNTKARILLKRIRAVESHKDAGNVAFKNKNAKVAVDE
                     YTQAVECDPTNARMNATLRSNRAAAKMDLNDYKGALLDCDYAISNGATSAKIYARRSR
                     IQEQLENFDEAVRDMQQAAEEDNQFVAELRQLKARAKRAKRKDYYKILGLPQHESNQD
                     AIKRAYKKACLQWHPDKWAHASEEEKSHAETQFKEIGEAFGVLSDPKKKRMYDSGQMD
                     NDVEGANMPSGFGGGASQEDIVTVMNMMFGGGGFQAGGFPGAFGGAGNGRRRPRGGPG
                     FF"
     gene            complement(<148339..>150606)
                     /locus_tag="LDBPK_360540"
                     /db_xref="GeneID:13388056"
     mRNA            complement(<148339..>150606)
                     /locus_tag="LDBPK_360540"
                     /product="mitochondrial carrier protein, putative"
                     /transcript_id="XM_003865122.1"
                     /db_xref="GeneID:13388056"
     CDS             complement(148339..150606)
                     /locus_tag="LDBPK_360540"
                     /codon_start=1
                     /product="mitochondrial carrier protein, putative"
                     /protein_id="XP_003865170.1"
                     /db_xref="GeneID:13388056"
                     /db_xref="GOA:E9BTB3"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002167"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9BTB3"
                     /translation="MLSTTSSSVSTPATEATGNSLASPSNASFSSAMPDTADDLSASS
                     SGEEILVIPVHTIVDKVTPLCGLSVAELHALVLRYDTDGVGGLTEPQWSLFCHENRHA
                     FSSLGEELLDFDRSGEYSVLVVKHGYEGTSNTNAPRSFTKEVIRFIESFAAGGIAGAV
                     SKTVIAPGDRVKIIFQVEPTRHFSLREAVYLGVETVQKFGITGLWIGNGATMLRVVPY
                     AAITYASFDFYHSKLRFMFGRSNPDGSSDEARAVTLRFISGSLAGATSTTCTYPLDLM
                     RARFAARSSSGKRRFPSYSAAFKEATSKQGFLSLYGGLFPTLVGIVPYAGCSFACFET
                     LKHYIVKVSNLKSDKDIPTYQRLVAGGFAGLLAQSATYPLDIVRRRMQVTPRRYSSVI
                     DALRTVYREEGIRQGLYKGLAMNWIKGPIATATSFTVNDLVKRRTRNYYETTVVYSSR
                     HNIVTLPEAFLCGGVAAATAKFFSLPFDRLKILYQVGMTEKTSAKKGAQLLYQVVKQS
                     PNMWTSGHVTMLRVVPYGALTYCFFDMFQLLAERLMYSHVATPYTNFAAGAAAASLGT
                     TIVYPLDLLRTRVAVNAVPSFQSYFWLLRAMARRHGIGSLWKGCYFSMMGVGVLGGIG
                     FALYDYLKERFGCHTFLQYMAAGATSGLAGSVITYPLNVMKRNRQAERVVYAQLGTSS
                     VQSLLKSPKTVAFLYRKMPFSFTVSSLTFGISFAVNDWCRDVIAATRNDMLREMLFLP
                     SFAVSKSMLSRGDTA"
     gene            complement(<151351..>152685)
                     /locus_tag="LDBPK_360550"
                     /db_xref="GeneID:13388057"
     mRNA            complement(<151351..>152685)
                     /locus_tag="LDBPK_360550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865123.1"
                     /db_xref="GeneID:13388057"
     CDS             complement(151351..152685)
                     /locus_tag="LDBPK_360550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865171.1"
                     /db_xref="GeneID:13388057"
                     /db_xref="UniProtKB/TrEMBL:E9BTB4"
                     /translation="MENIKEEICLVANIIDRLLAANGSLRADELEPLTNRLRVAAGEL
                     SRIDQESQSGPVLSPFSRNIDDAEGIGGGGRRGPSKLQLSKSLTPLTATRKQIRGCRT
                     FSATCKKMGDPKVFVSSEISQSVCCSLYNLLEGTTRLLRGSHGHIFVKRGVDMFSIAN
                     VSRKLAFPPPQVHHRCLGSADAEVLGSSIALNRNVDEVGRKSAVLIFPVHKLLPEGGP
                     GEPIATIHVERREHVFFPFSESDEYTLYFASLFCGELMSRIPQINFLETFYDPSTQLI
                     IAPFEPHCPVVLPPIERGMVPMRGETGKQASENPEYAARAVSQLSRKISARAPEILIH
                     RESRPTHNTKPFAPGVTHMPSLLEIKAYVENLQSCWKKNMLDNVDLLELDRGTQQDLK
                     VARSELAATRRELAATADRLRLYELDAWDYKREYGAMKSELDAYMDSLERLH"
     gene            complement(<153604..>154500)
                     /locus_tag="LDBPK_360560"
                     /db_xref="GeneID:13388058"
     mRNA            complement(<153604..>154500)
                     /locus_tag="LDBPK_360560"
                     /product="protein phosphatase 2C-like protein"
                     /transcript_id="XM_003865124.1"
                     /db_xref="GeneID:13388058"
     CDS             complement(153604..154500)
                     /locus_tag="LDBPK_360560"
                     /codon_start=1
                     /product="protein phosphatase 2C-like protein"
                     /protein_id="XP_003865172.1"
                     /db_xref="GeneID:13388058"
                     /db_xref="GOA:E9BTB5"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BTB5"
                     /translation="MGDMLAKPETQKFSTVFETSHLRVGCCSMQGWRKSMEDAHVAQL
                     NLNGNKDQAFFGVFDGHQSDEASRYCRAHMLDELLKNIAIYKDDVAKAFEVSFQEVDK
                     QICKKFVSSGTTANCVYLSNQQIFCANAGDSRAVLYRGGKAVPLSVDHKPSVPAEEAR
                     IVAAGCHVENGRVNMTLAVSRALGDVDFKSCAAKSWVDQAVTACPDITVTPSRSDDEF
                     IVIGCDGIWDVLSNEECCELVKTLIQNNDIDKNGHPVAVDISLVCEQVLDRCLAQSNS
                     VKAGTDNMTIIVVEFKPPFFKC"
     gene            complement(<155098..>155523)
                     /locus_tag="LDBPK_360570"
                     /db_xref="GeneID:13388059"
     mRNA            complement(<155098..>155523)
                     /locus_tag="LDBPK_360570"
                     /product="small nuclear ribonucleaoprotein, putative"
                     /transcript_id="XM_003865125.1"
                     /db_xref="GeneID:13388059"
     CDS             complement(155098..155523)
                     /locus_tag="LDBPK_360570"
                     /codon_start=1
                     /product="small nuclear ribonucleaoprotein, putative"
                     /protein_id="XP_003865173.1"
                     /db_xref="GeneID:13388059"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:E9BTB6"
                     /translation="MADTSNATKDIPSSLVFEALHSRVTVETVEGDLYKGTLAAFDVS
                     RGNIELVDVRHHAKDSSFGFYERVTVRGSKIRIILLPPEMKAAPSLQWRRESVQQELK
                     KSLKHVPALRPVVPAPRPLRIKKAQPKNDKSKQLRKKLR"
     gene            <156616..>157248
                     /locus_tag="LDBPK_360580"
                     /db_xref="GeneID:13388060"
     mRNA            <156616..>157248
                     /locus_tag="LDBPK_360580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865126.1"
                     /db_xref="GeneID:13388060"
     CDS             156616..157248
                     /locus_tag="LDBPK_360580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865174.1"
                     /db_xref="GeneID:13388060"
                     /db_xref="UniProtKB/TrEMBL:E9BTB7"
                     /translation="MSFFDFSASSSESSSQSDNSSKVDDRIKLTYAETVVSLATAVGL
                     VIIVLLDLLYRSTSRHAMLLRVQRETRFDGAYILGKPEGNRARTILENGLKTHEFRIR
                     HPPQYSRVVPAVVSDSRDAKQDCVEMLSKVRSILSKSYGRCAELMSMRCCLACVTGAL
                     PGEQSERFLRIYERVMFCSHRVNGDEKLVTSDDIRYMHAFYYNNVLKVLQ"
     gene            <157960..>158913
                     /locus_tag="LDBPK_360590"
                     /db_xref="GeneID:13388061"
     mRNA            <157960..>158913
                     /locus_tag="LDBPK_360590"
                     /product="ubiquitin-like protein, putative"
                     /transcript_id="XM_003865127.1"
                     /db_xref="GeneID:13388061"
     CDS             157960..158913
                     /locus_tag="LDBPK_360590"
                     /codon_start=1
                     /product="ubiquitin-like protein, putative"
                     /protein_id="XP_003865175.1"
                     /db_xref="GeneID:13388061"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BTB8"
                     /translation="MAVTIKLANGSQHTVEVPDFSVTVAEFKKQIAEMLEIPASEQRI
                     IMRGKVLKDDAVLSAIGMEDGSVIHVVRSKKSGASASSTNASSTLAASDPTSSPNVQP
                     STTTPAQPVPAQTAANPYAALMSNFGAPQTQQPVPGAAGFPAAGNPFAGMGMGMGMGG
                     GMGGAVNPTPQQAMELMQNPMMQQMMQQALSNPQFMQYIIQNSPQLAGLQQDQQQAII
                     EMMRNPYMMQQAMAMMGSLGGTGGAPLATSQAPSTPAVGGGFNPAMFAPPVPQGNPRE
                     VYREQLQLLRDMGFPNEEANIAALQQAQGNVQFALERLLGA"
     gene            <159663..>160598
                     /locus_tag="LDBPK_360600"
                     /db_xref="GeneID:13388062"
     mRNA            <159663..>160598
                     /locus_tag="LDBPK_360600"
                     /product="cell division related protein kinase 2"
                     /transcript_id="XM_003865128.1"
                     /db_xref="GeneID:13388062"
     CDS             159663..160598
                     /locus_tag="LDBPK_360600"
                     /codon_start=1
                     /product="cell division related protein kinase 2"
                     /protein_id="XP_003865176.1"
                     /db_xref="GeneID:13388062"
                     /db_xref="GOA:E9BTB9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BTB9"
                     /translation="MSSFGRATARSGDAGTRDSLDRYNRLDVLGEGTYGVVYRAVDKI
                     TGQYVALKKVRLDRTEEGIPQTALREVSILQEFDHPNIVNLLDVICSDGKLYLVFEYV
                     EADLKKAIEKQEGGYSGMDLKRLIYQLLDGLYFCHRHRIIHRDLKPANILLTSGNVLK
                     LADFGLARAFQVPMHTYTHEVVTLWYRAPEILLGEKHYTPAVDMWSVGCIFAELARRK
                     VLFRGDSEIGQLFEIFQVLGTPTDTEGSWPGVSRLPDYRDVFPKWTAKRLGQVLPELH
                     PDAIDLLSKMLKYDPRERISAKEALQHPWFSDLRW"
     gene            <161163..>162089
                     /locus_tag="LDBPK_360610"
                     /db_xref="GeneID:13388063"
     mRNA            <161163..>162089
                     /locus_tag="LDBPK_360610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865129.1"
                     /db_xref="GeneID:13388063"
     CDS             161163..162089
                     /locus_tag="LDBPK_360610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865177.1"
                     /db_xref="GeneID:13388063"
                     /db_xref="UniProtKB/TrEMBL:E9BTC0"
                     /translation="MKSDDALLGPPHSMLCKYTFRITPLFSSTCRFTTAVSQLVVLHA
                     YFSCCPCIFLSAISSNMAATSYDRDAAVKVAEENYSLRKRLARMEWEEEKQRRAAEYE
                     SRFEGAVDTSANDRMRSRNSALQDEIAGLESQLKELQMINVTDLQHEYTRLDNRRAYL
                     LNEIAGLRRILANQSKEVKRATRSVNSQHELRRQNNEQHAASIEDIQMFRKKRESLAE
                     ETQHLIAKERQLMSELETLPAPGEDQEVMASRLREDNEKKDHTIAQLEATLKEKQLKA
                     GTQLAEANSAVDIQHLREEYVRLNDQLKRIKQ"
     gene            <162957..>165197
                     /locus_tag="LDBPK_360620"
                     /db_xref="GeneID:13388064"
     mRNA            <162957..>165197
                     /locus_tag="LDBPK_360620"
                     /product="Mitochondrial elongation factor G, putative"
                     /transcript_id="XM_003865130.1"
                     /db_xref="GeneID:13388064"
     CDS             162957..165197
                     /locus_tag="LDBPK_360620"
                     /codon_start=1
                     /product="Mitochondrial elongation factor G, putative"
                     /protein_id="XP_003865178.1"
                     /db_xref="GeneID:13388064"
                     /db_xref="GOA:E9BTC1"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTC1"
                     /translation="MRRSGLAYMLRSSVPLLATPAFLSNVRHMRNIGISAHIDSGKTT
                     LSERILFYSGRIGKIHEVKGGTEVGATMDSMELEKERGITIRSAATQCRWKNSTINII
                     DTPGHVDFTIEVERALRVLDGAILLMCAVGGVQSQTLTVDRQMKRYGVPRICFINKLD
                     RDNANPQRAVKQAQERLGINAVFIQLNMGTAQDFEGVVDLIEEKAVYFDGPFGEAIRY
                     EPVPSYIKEDVAAARKELVSRLAECDEEMEFIFLNDQEPTVEQIHAAIRRATIANKFV
                     PVMVGSAYRNKGVQLLLDAVERYLPSPVERHNSGYQVRRVKDEDGNVSNVKEGEVELM
                     TDDEKPLVALVFKIEETKKSGLSNYVRVYQGKMRKEHLMNIRTGKNFLPPKLVRMHAD
                     SAEVVDEVRAGDICAIQGEVDASSGDTLMKSGPQSGSQLFSCEDMYVPPRVISASLKT
                     KDDKEQSRVRERMLAFMREDPTFVYYRNSETNEDIVEGMGELHLDIYVERLKREYGLH
                     VELGKPTVNYREIITERQDFDFVFKRQSGGAGQWAHLKGFVEPLPIDMSVEKGVKNKA
                     TTRCSNGDIRESLQKTVVKHLERKIFVKGELMHAPVWGVHFHLNGGAMHEVDSNDQAF
                     KNATQELWETLLPKLKPTLVEPFMDVEMTVPAANMTDVATEFSKREGVVTETAVDGPD
                     AVIRGETALDTMFGFISDLRRLTKGQGDFSMQFKEYRPMQQYKAQMRMDERNNDLGRK
                     PFKLSD"
     gene            <168632..>170110
                     /locus_tag="LDBPK_360630"
                     /db_xref="GeneID:13388065"
     mRNA            <168632..>170110
                     /locus_tag="LDBPK_360630"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865131.1"
                     /db_xref="GeneID:13388065"
     CDS             168632..170110
                     /locus_tag="LDBPK_360630"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865179.1"
                     /db_xref="GeneID:13388065"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BTC2"
                     /translation="MRRCRMQEWHHTAAAGARQAHRGFHRMPRHDYLTDFGTHHVAMV
                     DELSRCVVSASDKSLIECFATSVSETPLSSLTTSCSAVHSNPPSTHFDLQAPLCLSEG
                     SLARASVIDLGGRSSRSFPQGMSSCSATSSCSKARRFQSYSLHPCNCGHAHRAKLVLF
                     AAQADILLSCSTKDRHMTAYHIALGVEVGRLVGHDDLILGGAVSPDDTLVATTSCDCT
                     AILWDLPSCKQRRSLTHPQFVHACRFSSSGTELATACADGLCRIWTWSASAIVNILVP
                     SDTGFNGALSSLAYSLGDKVLLAGGSARNVYVWDCESFSAPAAVFRQHRSAVLSVDAS
                     RAHQDIVMTAEEATLLVWNCATLEVLQRIDVSFCDAQSPWRRGGALTASETSVKRTTF
                     PHELYWTAARLMDSRFGLVLVAATSDKRLYLFDFVATYKRRSADDIQTQLTGTAAQVQ
                     PSALSEMLSLSLRSPVSSMDSGPPNRVVFGDSCGNRYILELN"
     gene            <174490..>175770
                     /locus_tag="LDBPK_360640"
                     /db_xref="GeneID:13388066"
     mRNA            <174490..>175770
                     /locus_tag="LDBPK_360640"
                     /product="sec14, cytosolic factor"
                     /transcript_id="XM_003865132.1"
                     /db_xref="GeneID:13388066"
     CDS             174490..175770
                     /locus_tag="LDBPK_360640"
                     /codon_start=1
                     /product="sec14, cytosolic factor"
                     /protein_id="XP_003865180.1"
                     /db_xref="GeneID:13388066"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BTC3"
                     /translation="MAATHLTFDDAKVGMRVQDYWGCCGTLRWMGKLEKDNSPNKETG
                     KFFGIEYDDESDNPLRSNGTWNGRKYFECGPRKGRLVKVGQVYAEINTERVAMLRERF
                     GERVATWHDFELVKFCIARQFDMEKVYEMLERHLQWRGRFQPCVDEYFPQTIREDYPC
                     GYTGTTDYDENLIYCERPGNAGHCQPSEFVRKYTLPVIARWHACAIEMGIARMRATNY
                     RSKRVCCIVDLLNVKAMSRSMIGFAQTLATVEQDNYPENLGCVFIVNCPMFFCFAWKL
                     LKIFIDERTNKKINFCAPNKAVEAMLPVMRKEDIPNFCGGTSNKWMETANGIIGSTNP
                     KKVYRGEDYSPPSMKSEELNETQSRADSESPHRSLREGEAPTTTRFIAPDAVSLSFTP
                     TSSSKSPEEPKMTSEAQSSSDTASGKKRKNGLPK"
     gene            <178277..>178921
                     /locus_tag="LDBPK_360650"
                     /db_xref="GeneID:13388067"
     mRNA            <178277..>178921
                     /locus_tag="LDBPK_360650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865133.1"
                     /db_xref="GeneID:13388067"
     CDS             178277..178921
                     /locus_tag="LDBPK_360650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865181.1"
                     /db_xref="GeneID:13388067"
                     /db_xref="GOA:E9BTC4"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:E9BTC4"
                     /translation="MSATHALRDKWFVSFLPLLTADMVNTDYKGNWQLAAQERTQKLD
                     WITSVEELWSTMNSLPKVHQLGMGSTLIFARNNKEPPSYEAYPNGSRIMINLLKPPTT
                     DAGLELVLAVVMGETAAEKASDGKPVCDVLRIAARPSREHSEQIRVEVWLSDSTRSHA
                     VAEFLAEAMREKGLAANSYNIAEASFDAAAPSKDKKVLAASTTLSPSSPPMMKD"
     gene            <181055..>181513
                     /locus_tag="LDBPK_360660"
                     /db_xref="GeneID:13388068"
     mRNA            <181055..>181513
                     /locus_tag="LDBPK_360660"
                     /product="ubiquitin/ribosomal protein S27a, putative"
                     /transcript_id="XM_003865134.1"
                     /db_xref="GeneID:13388068"
     CDS             181055..181513
                     /locus_tag="LDBPK_360660"
                     /codon_start=1
                     /product="ubiquitin/ribosomal protein S27a, putative"
                     /protein_id="XP_003865182.1"
                     /db_xref="GeneID:13388068"
                     /db_xref="GOA:E9BTC5"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BTC5"
                     /translation="MQIFVKNAAGRSVAVRVSAEDTVASLKAQANVTQGNLFFAGMCL
                     AEEETLAAYGLSKESTVDVVIPVEGGKGKKKKKRIFTKPKKPTHRHKLEKMRALKYFK
                     VTENDDGSYKVERTRQDCPHPQCGAGVYMAQHKDRQYCGKCHLTYKAESK"
     gene            <182680..>183462
                     /locus_tag="LDBPK_360670"
                     /db_xref="GeneID:13388069"
     mRNA            <182680..>183462
                     /locus_tag="LDBPK_360670"
                     /product="DNAJ protein-like protein"
                     /transcript_id="XM_003865135.1"
                     /db_xref="GeneID:13388069"
     CDS             182680..183462
                     /locus_tag="LDBPK_360670"
                     /codon_start=1
                     /product="DNAJ protein-like protein"
                     /protein_id="XP_003865183.1"
                     /db_xref="GeneID:13388069"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BTC6"
                     /translation="MTTFNQNSTSGKTSVLDDLFSSVNVSAPASTAGASAPPMCFSSS
                     ASATQNATPTAAADAASSVLNDLFSTPDVASSEKSDKYGSVGEAHAMIYVDGSSGSAE
                     DGVTNLFDLSKPVKKDKYNNAESFLEAFERQGKKSGSGGGRHDERKTLADLTRNKDDN
                     KVRARLLPLMNYYDVLGVAPTASEEEIKRSYKKKALQLHPDRAGRDQTQEEAELFKVI
                     TKANEVLSDAEQRRMYDASLASGAGQPAMAPSAADWWSHMQS"
     gap             183884..184011
                     /estimated_length=128
     gap             184578..184686
                     /estimated_length=109
     gene            <185267..>186064
                     /locus_tag="LDBPK_360680"
                     /db_xref="GeneID:13388070"
     mRNA            <185267..>186064
                     /locus_tag="LDBPK_360680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865136.1"
                     /db_xref="GeneID:13388070"
     CDS             185267..186064
                     /locus_tag="LDBPK_360680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865184.1"
                     /db_xref="GeneID:13388070"
                     /db_xref="GOA:E9BTC7"
                     /db_xref="InterPro:IPR006721"
                     /db_xref="UniProtKB/TrEMBL:E9BTC7"
                     /translation="MCDLRPLILSFSVSSPVCLLAAIVWPVPLSRVFVHAGHNVGVRV
                     YHVPFIVLFSLKLPRLCCGCTFNPPPAESDTLPAIPLSTSPWTYANKWQRNTKTRLPC
                     CPLPYQEQWWSLSLRVSSRLSPPMYLPLSTAPDTVLSPPTSPRPKRTEAVASIRACRS
                     THSYRAIFRHRFLWFHLRRLSVLQYRGSLSPMMLRRSLIALNWRDQGISYVKYLNVTT
                     EALHMATKDKARAKYSRFSAPNYVAMKNDSTGAMEEVKKVPAFTKDY"
     gene            <187745..>188311
                     /locus_tag="LDBPK_360690"
                     /db_xref="GeneID:13388071"
     mRNA            <187745..>188311
                     /locus_tag="LDBPK_360690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865137.1"
                     /db_xref="GeneID:13388071"
     CDS             187745..188311
                     /locus_tag="LDBPK_360690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865185.1"
                     /db_xref="GeneID:13388071"
                     /db_xref="InterPro:IPR021994"
                     /db_xref="UniProtKB/TrEMBL:E9BTC8"
                     /translation="MPWYLSTFRVGFCAIYAYFGYVQIRWLLETEDRYRRSSTWKPAV
                     GTIFDHKVVMTRGGSSYVQYKFNVDGVEYIGDRFRSGGIHKEEMVSNPTLLGAGTQLV
                     VYYNPADPSESAIKLQADRGAESVFVIGSLLSFLIAFRAVRCETILPNMFYRFLGVNR
                     RVGGISGLRQARPHAKQRMKYGKHSGSL"
     gene            <189210..>190160
                     /locus_tag="LDBPK_360700"
                     /db_xref="GeneID:13388072"
     mRNA            <189210..>190160
                     /locus_tag="LDBPK_360700"
                     /product="ribonuclease H, putative"
                     /transcript_id="XM_003865138.1"
                     /db_xref="GeneID:13388072"
     CDS             189210..190160
                     /locus_tag="LDBPK_360700"
                     /codon_start=1
                     /product="ribonuclease H, putative"
                     /protein_id="XP_003865186.1"
                     /db_xref="GeneID:13388072"
                     /db_xref="GOA:E9BTC9"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:E9BTC9"
                     /translation="MTDTPSTLSARPSTRPSGAKRPRESLIEFRVKDIMESLGVSEDY
                     LVLGIGEAGRGSVIGPIFYTGAVISLGEHDDLVQLCHVADSKTLDERRRLASLQQLHL
                     LKTFRSFTVCVSPEEFSKTITGRSGRNLNTLSHETAIQIISEATLASAGKLCAAYVGT
                     AGPPATYQEGLAGRFPHLRVTVAKKADSQFPIVSAASIVAKTTRDTAIEALGENIGSS
                     CPSDPRTMERLRSHVHRFFVFPHAYDFVRHSREPVVQLANGPAVCVPVAFEQVLEKAR
                     QQGRGGDSRQQKLSFAKPPRKRHKVYTHLLKLRYPTSLVE"
     gene            <191524..>193008
                     /locus_tag="LDBPK_360710"
                     /db_xref="GeneID:13388073"
     mRNA            <191524..>193008
                     /locus_tag="LDBPK_360710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865139.1"
                     /db_xref="GeneID:13388073"
     CDS             191524..193008
                     /locus_tag="LDBPK_360710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865187.1"
                     /db_xref="GeneID:13388073"
                     /db_xref="GOA:E9BTD0"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:E9BTD0"
                     /translation="MATATAARAAARPPVPTSAERLLLNPFVVFLVTFAARAALFTLR
                     YSVEPYIASPVIPHPSLEDIMGKAAAGAWHDVAQSAYVSGGGSQAERLVTPPPVHFSM
                     SISMMEASTWREVVYWRESGFADVGPYYLQELALWYVRFIPAVLAKPPVTGLVLSAMD
                     GLTAALVSRWSSASAALLYAFFVLNPIMILTTTSESLTSFELLLLTVTVDLCARRAKS
                     ALAYTGALVGAFTLGSHFIAVPVVLLAPLGTQSYRIAFGVAALLAAGVGAYAVLYLYS
                     TEASHRFASLYAPPDNGVLWYVRQLVLPSFARCLEVFMLQLAPMLLIPATVAFPVSYL
                     RQPLSSTAHPHLFTDGRVFLLLMAEGLSVLFRNQLTLPYCFLIILHFYSSLNPAASKT
                     VTLEDQRVVTYSPYMRVRLLVPIFIQMTSIPLEASFYAGWVLRETANANWKFFSDVAF
                     MVGATAFFVLWYTEVVEDAVLCENDGGADAVTCSASPFKTTKTD"
     gene            <197660..>198268
                     /locus_tag="LDBPK_360720"
                     /db_xref="GeneID:13388074"
     mRNA            <197660..>198268
                     /locus_tag="LDBPK_360720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865140.1"
                     /db_xref="GeneID:13388074"
     CDS             197660..198268
                     /locus_tag="LDBPK_360720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865188.1"
                     /db_xref="GeneID:13388074"
                     /db_xref="UniProtKB/TrEMBL:E9BTD1"
                     /translation="MPELGKSVFHVSFHLSRFFFAAVVAALLLFFLSGGSLAGTHIRD
                     GSPSGGAENDTTRTVTTTTTSPTPAAPVSLQEACHTEMKLYCSDHPISPLRCLVEQYY
                     RTAKSNGEEPRRLTSALYSDVCGSWLAAREACLGFVHQRGRELCGNSVTDARECLRQI
                     PPLVLPHACVTSAYYESVRLVGMLRQHQNEDARLRLLREKFP"
     gap             200346..200444
                     /estimated_length=99
     gap             201045..201414
                     /estimated_length=370
     gap             202235..202333
                     /estimated_length=99
     gene            <203362..>204753
                     /locus_tag="LDBPK_360730"
                     /db_xref="GeneID:13388075"
     mRNA            <203362..>204753
                     /locus_tag="LDBPK_360730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865141.1"
                     /db_xref="GeneID:13388075"
     CDS             203362..204753
                     /locus_tag="LDBPK_360730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865189.1"
                     /db_xref="GeneID:13388075"
                     /db_xref="GOA:E9BTD2"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:E9BTD2"
                     /translation="MTDALSSAVFIALAILFLFWGTVQTLSLKWADTIDASDGFTGPT
                     SGQGGSHAVHFRLLYSFAHPFTQAFFMFCAETSCLVMLVCTLVWKKYVAPRLYDSRKA
                     TTAAPSGELVAGEDYALPCNPSLWLLPSGADFLASIVQNVGLTLTYASVYQMLCGSTV
                     VWIALISHFWLGYRFTKVELWGMGCVVLGVFLVGLSNLLERGLDFESTSHGRHKNQVL
                     GNLLVLMAQILHAYQGVCEERLIRLYKVPSLQMVGTEGIYGIGMSLSLLAFLQLVPMA
                     TWGHNLAAVEEFLASGGPGVLHTNVTWVQQLQPALKVPYDDVVLAFAQIRESLECKVF
                     ILVYLLSGFFYNACHMSVIKYVSATATVMIGSLRNVTVWLVCLLIPSVFEEHFNVVQL
                     IGFVFLVLGNVLFHRICITRFDAILPAQVIDACPVLFRDARKDREDVVKVETRIRDTS
                     LEPQAREMRPKED"
     gene            <207061..>209913
                     /locus_tag="LDBPK_360740"
                     /db_xref="GeneID:13388076"
     mRNA            <207061..>209913
                     /locus_tag="LDBPK_360740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865142.1"
                     /db_xref="GeneID:13388076"
     CDS             207061..209913
                     /locus_tag="LDBPK_360740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865190.1"
                     /db_xref="GeneID:13388076"
                     /db_xref="UniProtKB/TrEMBL:E9BTD3"
                     /translation="MFADLLATTSCHAGDRSSDVGVAPVSPPFSPRCTSASSSAGSSS
                     GCHRRRLSAGGDDGSYSRVSPFSPLVGTANPSAHTDGRARRPGFSECPSPLSIPEGCA
                     SSTTAMVSPSSGHPEGHSLSLGGTSEPPPRRSSGGTLRNSLEGYIPTSDFSSFSSHHG
                     DSARSPPSSTRTLSLYDHGQKASGVASSTPSRGATALLPEGGASPALDGAESSADDAN
                     FVVMRSGTREGGQQSPQLFSSSKSSSPSSMLCAPPLAQPTTGAVVAEKYAPALQAPPS
                     PLRFSVLYTEEEHRVRLETRETEERRCLYQAHKAVLSVYRMWAAAGADADYGDGDRLL
                     LTSSRMDDGASTRFLEDHCYPKAPNAPNAKAAGPRAKPSPLATATETAANAVAAERVR
                     CFLKSSIDSARGRRCLGPAQEGRAAIDVLPHRSTTPRITYAGSDAETRRGSPGHVPHP
                     QASHSSSPAASRMLDYSSVQMPQTASSLMHITSEPPSLVHQARLFSPWRATHSDHHDA
                     AARHAEGKADVHLEPRTSREDGRGRPQRRQRTSLVPHLVSTSPAAVRLSSASHSLGAS
                     SVALRRRSLLEPRLSADTTAPREDLPRSAVLPPARAAAAARTSSPSLRTVLCAGVGNF
                     SRISTAQTEGPGASQTTSSPVWNASVNLVSTSAASCHMSPSAGDDTTDDHVSGGAVRY
                     PSNEALRLRQRAALPGTSSGGLLSSPPHGIDADWKTLLAVNRLQGHRRERLGSYVHYK
                     RFFDAVYGEQSASPLASREPDGRHSSAVRTSPVPPRAVRTRPFMSFDVVDGDKHASAW
                     PWRSSLSSSLYPRARSPELVAYRDLRRFSPSGSTAARRAPAAPSKEPATFCAGLTGGA
                     ASLTVPADATLFAARLTRLSTLEKLCRAELQRRCMEDQSLLLHHFIVKGTATLQRVSR
                     ATAPLHRHRQCAAGGTTEAYRIPSARTFIPNEVDGL"
     gene            <210795..>211601
                     /locus_tag="LDBPK_360750"
                     /db_xref="GeneID:13388077"
     mRNA            <210795..>211601
                     /locus_tag="LDBPK_360750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865143.1"
                     /db_xref="GeneID:13388077"
     CDS             210795..211601
                     /locus_tag="LDBPK_360750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865191.1"
                     /db_xref="GeneID:13388077"
                     /db_xref="UniProtKB/TrEMBL:E9BTD4"
                     /translation="MRHCYRLFTGSRNITTASSSGPTMSLREATRLAKIAGCVDSANG
                     SSSSLLRRCTDPACAQDRKVTSSSASWEEIKRRQHQVFNERHLTAENAIAVTVSCVNM
                     AHLSVYVHAVQCGYPASHAPGPSGEGVPGKRTIATATLTNQSCAVLLLWVSMGSPELL
                     AVRCALSPGAVETCWRAAPAAESSDTTKAGGTSQTAAPSSMLSEKDKLRRIKAWAEEL
                     TLHRWVVASGQLRMEDVYDGDLQKVVTVPVLEVARDHFKGSVRALPPGFL"
     gene            <212362..>213051
                     /locus_tag="LDBPK_360760"
                     /db_xref="GeneID:13388078"
     mRNA            <212362..>213051
                     /locus_tag="LDBPK_360760"
                     /product="MP18 RNA editing complex protein, putative"
                     /transcript_id="XM_003865144.1"
                     /db_xref="GeneID:13388078"
     CDS             212362..213051
                     /locus_tag="LDBPK_360760"
                     /codon_start=1
                     /product="MP18 RNA editing complex protein, putative"
                     /protein_id="XP_003865192.1"
                     /db_xref="GeneID:13388078"
                     /db_xref="GOA:E9BTD5"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR017084"
                     /db_xref="UniProtKB/TrEMBL:E9BTD5"
                     /translation="MFRRLSSAAATRPMATMEHPLTSAMQSQSVINTRAAVSRVAMRA
                     CSITSGTSSGDVSATKGAAFSASRSGQRAPSINCVTLVGVVHDIQTGYVFEDAVTQFT
                     LTTTSLDAANQAQECVVEKDHHTVRCYGDVFSREVRAKLSEGNVVCVNGRLRLNPQME
                     PSCNKYYYFPYIQVQPPHGQVSVVYGDRRSPPSPVNAATGELNNGNDNPTSSAAPAED
                     GDASATTQKTP"
     gene            <215383..>216162
                     /locus_tag="LDBPK_360770"
                     /db_xref="GeneID:13388079"
     mRNA            <215383..>216162
                     /locus_tag="LDBPK_360770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865145.1"
                     /db_xref="GeneID:13388079"
     CDS             215383..216162
                     /locus_tag="LDBPK_360770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865193.1"
                     /db_xref="GeneID:13388079"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:E9BTD6"
                     /translation="MGTDKALSEKLVLEKTKVKSLSDVQRLDMWGEGLTDISLVAKLP
                     RLEVLALAANNVSSLKALQGCEMLQELYLRKNKVANLREVTALRVLPTLSVLWLRDNP
                     CAQHPYYREFVLHCCPGLRQLDGVEVTADERKAAAKRLTTKALDEILGRTASADAASS
                     PRPKKSSGAGSSPAKATDVTPSSTPGGVSDSTATIEERNASGRSVLFTTVAAQRAMLL
                     SIVSLLSELTVESLELLQREVQERVEKQKEKLTKYVQENSQ"
     gene            <218838..>220208
                     /locus_tag="LDBPK_360780"
                     /db_xref="GeneID:13388080"
     mRNA            <218838..>220208
                     /locus_tag="LDBPK_360780"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003865146.1"
                     /db_xref="GeneID:13388080"
     CDS             218838..220208
                     /locus_tag="LDBPK_360780"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003865194.1"
                     /db_xref="GeneID:13388080"
                     /db_xref="GOA:E9BTD7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BTD7"
                     /translation="MSAEIESHIVKKYEIQAQLGQGAYGIVWRALERKHNRVVALKKI
                     YDAFQNSTDAQRTFREIMFLHRLHHPNIIKLLHVHRAFNDRDIYLVFEYMETDLHVVI
                     RANILEEIHKQFIIYQLLKTMKYLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSI
                     LSLEGEQASRPVLTDYIATRWYRPPEILLGSTRYTKGVDMWSVGCILGELMLGKPIFP
                     GRSTTNQLELICSVTGMPSAADVAATNSQFAHAMLRDIHCAHRRTFAELLPSASADAL
                     DLIERLMCFNPNRRMTAAEALEHPYVAAFHRPDDEPVATEPITVSLPDSQRLPLAKYR
                     DAIYEQIAALRRSSTSADQRQRAERQAAGSTASRKTSVSSASAGGSRGGTGTSGVTRP
                     ATSSSSSAAAGAAPQRSVVKPTSTSAVNEASSSKAYARPAFRSATSAASGLESRPVAR
                     EAAVRK"
     gap             223704..223802
                     /estimated_length=99
     gap             224796..224919
                     /estimated_length=124
     gene            <229573..>231090
                     /locus_tag="LDBPK_360790"
                     /db_xref="GeneID:13388081"
     mRNA            <229573..>231090
                     /locus_tag="LDBPK_360790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865147.1"
                     /db_xref="GeneID:13388081"
     CDS             229573..231090
                     /locus_tag="LDBPK_360790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865195.1"
                     /db_xref="GeneID:13388081"
                     /db_xref="GOA:E9BTD8"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BTD8"
                     /translation="MPSGNPQHRNWSSSNSGEVGSRQSPVSTSEGRRSPNGRRSYQER
                     ITTVRFIQPSTGETMCTKLNRVQRTKTKPENDAELCESFLKGHCDSGNGCQYVHVPKQ
                     YLWRLLSPHVDPKTLFYYPGFNVRCYTPDMNVYYDIPSEFIYQTKGSDRYVELFNDNG
                     DNFKDKCRLCPNLQSHGICDNNEQCDDIHCAVADLDQFPHIATHRATKEAVARYEHMP
                     PELIVRVYQPNTPGDGMDFNGDDVLRTAGATQYEDAYKQTGGIPALKMQHCAHFQTKK
                     LCRMGDGCRFLHVVSVALASPAPDEEASIRSSPAPATTTASATSAPSAATPTPTAAKT
                     PTATTITATVTAGRQLREEDVAMNAAAEMAAIAMAAEEPLYIGSHVDNTVPQGSRNGR
                     LHKYGTQAIVPQQPQPYQPPQQPSSIYPYGPVSMGAVKERVSPVQYRSSGRLSPIKVV
                     VTPGQMEGAPAQRLSPMSLPSGGSSGTPTQQPHSRTSPLRRNNPYSLSPSSTSLN"
     gap             240674..241480
                     /estimated_length=807
     gene            <247331..>248959
                     /locus_tag="LDBPK_360800"
                     /db_xref="GeneID:13388082"
     mRNA            <247331..>248959
                     /locus_tag="LDBPK_360800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865148.1"
                     /db_xref="GeneID:13388082"
     CDS             247331..248959
                     /locus_tag="LDBPK_360800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865196.1"
                     /db_xref="GeneID:13388082"
                     /db_xref="GOA:E9BTD9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BTD9"
                     /translation="MFPMDIANSGNQQMVYRNNQPPQQRQQHQMPQHHLQQQHHQMPP
                     QQMFPSQYGYQQQPYLAYPSTAGPNAGKGAMDFIPSQQYMPQQQMFPYGYTQQHQSPL
                     NQQFFPSVMAPQTQPPPPPMRYNQQGNSNSTNQYMGGHAGGHPRYHGGRGRGGMHSGY
                     GGQFHRQVHNNYFYNQQHHYSSNNAVPEKTPTVHLIHPETKKIISIKLNRIYSTMADI
                     RPQLHQQSHSNGASASNVPSVIEDSKSEKTSKNERPKEKNDSSLAPKFDPKTTKLVLC
                     LSFLCPKGCMHGSGCDKVHIAGLEYTWPQVEAKEVKKEGKKAYSAGFFVHCYDPTLTR
                     YYKVPSGSVYVTKGSAEYVNMFNDHGDNFKMKFKLCAPILEGAECEKGEECEDIHCSV
                     SDLEAVRENSANATHINNIEAMADVPRLPADMTVRVFNQNSFDTWRDYPGGNLLITEG
                     AKAYQKQYEQEMNTVPTRKRMQHCAHFRLKDMCRLGESCRFLHVLPTEQELKERKDAE
                     AAEAAAQAAAKAMEGVAGEGIMKSDEKDAGVAIE"
     gene            <266297..>270169
                     /locus_tag="LDBPK_360810"
                     /db_xref="GeneID:13388083"
     mRNA            <266297..>270169
                     /locus_tag="LDBPK_360810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865149.1"
                     /db_xref="GeneID:13388083"
     CDS             266297..270169
                     /locus_tag="LDBPK_360810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865197.1"
                     /db_xref="GeneID:13388083"
                     /db_xref="GOA:E9BTE0"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="UniProtKB/TrEMBL:E9BTE0"
                     /translation="MSALSPSATPVTLRSVSGKSLLVTPPVTLATVLTVATGPPFSFT
                     PESVKILLHGRIVRLLQYQKQHGSDVFKLPLDASAYTPPRTIAKCENSVALASSSSSG
                     AEFKAEPRSVIVYGVPQHIRATASAPHTGAQEPAALSTPFAEAHGKSLPISTSPRVGQ
                     QECSDSTCTTIAATPTTAKASRRASLMRLPVNSPTARATPIKGPLPYPHSPDGLRELD
                     KICAEFDSDDDEDLITLLQGAPPSIYNHPTVLYMSNKVKGDLVILQAAMEQIARVSPV
                     FFDWIVENPQRFLSALNRGGERSLQQVKDQLRMLAMRAMADQMSGETPSRHVMMLEVN
                     TRDGSPDVYQVEVQVGDFSDASTPSDSLTPNSLADNNSAEEEKGDGEDSVNTDDEMEE
                     NDTAASSVDAFDEDGGVAGGTEEEEEGDERHRGAILLPSTPGPLEEAPSAYPPSGTVP
                     SPDRAVTGAMLSHGGSVTKAEERASAEERELPLTPSNPADAVAAGVARRSFPPLPSTS
                     SAAARSTPLDVAASPASPAVSPHEDSDAEDVRLSGLRKELEHVDSLTQQWAHQATIDA
                     AHRAHAAISKLRRDVFTVLNDLITNSSTPASSLRSFGDVRRLAVLACNFFSAAEEFYV
                     QLDEQGVRSSAFGETPQDSVAAFAAVAALSRLLVCDVDAAVERQLQEGTPGLSRVGAL
                     RSLRHVHSIRESPALRWTTAEGPEKLLMALLQLCRQQRAVVLWYSSHYVLKEVGKTIQ
                     TIAYILGGRGEGQQTVSLQRLKVTSKTHKQDEVADCITALSDALADTGTLSDAMRCQW
                     FTLMHSRYQRLVLPIEKDLPAPHMTSDPLYVCDTRHVLPPKGSGAHPDTLHGTMDSAA
                     RWWAGYCDDRHTCCADKWCLALTERLWNIVTAMENAAAEVTAENVVLVLTGDGTEASA
                     ANSPSLEAAARGWLGDITWIPVDSVVAPSVATASTSLSRSVARHSAVLFEQVWPPAEA
                     KDGIAAADPSSSVAGVHGMLPLFSGDVHMVDVAAVAAGHRPVLELAGGAALPTYLATV
                     ARNFVLPASAREQIFVRHLFGMFAKYPRIPVAAAVRDAALANARCQDSPWLVSEYVLY
                     DYGGALSTFTDADEKADTAVAVGAAVTTKPASSTAAAALPSPMTDPSAECASDTFVRM
                     PSVPLSKRLSTPRPLPPTQLRPVRATLRSQLARAQAAAGAMAKRQYARSHAVDELYEM
                     MLGSLLEHRPTGEANVLDHLVHYVESSQDAMRGRVYKRRAEAAAAAAAQKVAHSTKPS
                     HSAVGGGSSCTQPQPPGGKPNSFARRRQ"
     gap             270529..270580
                     /estimated_length=52
     gene            <274046..>276598
                     /locus_tag="LDBPK_360820"
                     /db_xref="GeneID:13388084"
     mRNA            <274046..>276598
                     /locus_tag="LDBPK_360820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865150.1"
                     /db_xref="GeneID:13388084"
     CDS             274046..276598
                     /locus_tag="LDBPK_360820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865198.1"
                     /db_xref="GeneID:13388084"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BTE1"
                     /translation="MTRSSTLNRPVLLTKDASRAHPGAAYDTSSVASAAAVAGARASP
                     LPSPSVSSGDLCDTKGVSSSETRTCPAAATVQSVYLSRPSPPTPPPRPAGHRRSRRNS
                     LISVKTNSSASFLYHEQNFSPDEEATATLRFFSIMPDLSAAKEEPCCSSPDEDLTMGT
                     SSSVLGGTGNIPFAAQSGSSEAAATPVCGARKGGSDGGDAGGHSHDATNFAGPPPSPH
                     TKGSVYAGGTAGIVARLKERGNAFLLREEFELAIATYTEAIRLDPAHEALWGNRACAF
                     LLSFRYLPAVADCLYVLHIYPGHTKACWRAAKAYAAAYRLVEAKKYYQLAQQACERDG
                     MWRGSASTSRRTASLSSMRSDKGGDETPDGPLARDAAGSSSAEAAGACCRHDSRLLKS
                     QRERQVLAAEEAALEMVETYWQHLRHERWADALAAMDKVLTLASYTGPTAVSWQALRL
                     EALLHLHPKKALSEAEALYRAYPDSLELYPVLAKSIFYDVHDAAATKRCLGLLDEAAE
                     KRCAQNHLLKVHVRYCATQLRERLPADAGKTTAVHMEAWGKLHYLREDSRTAELRHTI
                     EKFARHRDAGNAAYEAGDWDAAASAYTRCLETDRLNHALLAAVYCNRTAVYMQAGRWR
                     DALSDADSAVSLSPQYATAYARRGRVKLYLLAQEYRGQRAVLASCSAAPWTAAMKERL
                     QGYADAAVTDLTRAVELSPTIEHKTQLQQALAQRRAIKASLKPTCETPKSSMPFSSSS
                     ASEGERHRGQSAHSPPPHADARRVESAALCELTDQLKLLGLSILAPSAPGEFGRLPEP
                     KVIAKAYREAALRWHPDKWVTATPHEKQQAEQQFKSICVAYQALRERSGVVF"
     gene            <278281..>279597
                     /locus_tag="LDBPK_360830"
                     /db_xref="GeneID:13388085"
     mRNA            <278281..>279597
                     /locus_tag="LDBPK_360830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865151.1"
                     /db_xref="GeneID:13388085"
     CDS             278281..279597
                     /locus_tag="LDBPK_360830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865199.1"
                     /db_xref="GeneID:13388085"
                     /db_xref="UniProtKB/TrEMBL:E9BTE2"
                     /translation="MATDLDSFSTYIDHLILLLAARFHAPLDVSVEELLPSSLNLSVE
                     AQCPWELVACSVQQALRTPQTAQERLLMRHLDVHHFSASVCRERARYMQWKLQECRRR
                     RGEKQQLVQSAAVPSAARTNTGSTAAANAIAAGQPCDVTCTSLHNDACSLYKLVRQSL
                     PCTLGGTESDDDDNEDAQAPTASVKSVAFASEPSAFERVHEVFMRTPSEQERDELVAR
                     ARDEFLSQVQALQSAYYDKYHRWMDVPASVLDPPPASRKQPASTDAAAAAFESAAPQH
                     GSESERAALLGALGAAAPPPPRPRTQANYTNTSGAADRTEKPHTLASMLRQVQLRRPL
                     RPSAVPDDVLESMYRARAESEGAPKNLCISSGLRSSPPAASTSATPSFAVGSADTITA
                     EAVAVASSSSQPSSSVAAVRKDTVPPASRRGRWQIVEYDDDDDGEG"
     gene            <281381..>284743
                     /locus_tag="LDBPK_360840"
                     /db_xref="GeneID:13388086"
     mRNA            <281381..>284743
                     /locus_tag="LDBPK_360840"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865152.1"
                     /db_xref="GeneID:13388086"
     CDS             281381..284743
                     /locus_tag="LDBPK_360840"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865200.1"
                     /db_xref="GeneID:13388086"
                     /db_xref="GOA:E9BTE3"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:E9BTE3"
                     /translation="MRRPGVEYWSSTCSVHRPSRTSSSPDPTSVSCTSAAGYCNSSKD
                     EIPPPMSTVWLAPPSLSTPVICEADSGDGDGAQRRMQQQRVLQRREEEVARLEAILAR
                     ERVDNANSLNALRASLKREHLLRATAEKERQAAQAEGRHLRTALRALLAQPPNNSNNE
                     PLSSTVPVSLYEEARRLLLRCDKTFAELKALQLRSTDAAGLEVLRRYDIPVLDEIPPA
                     WPPGTPQCSGKEEDDHARRRARAGGGPNSTPAAREKASSGTTPLPMEETLTGLEISEL
                     TALSPDTPCSPSSATRQVSAVTAAGEASETWREKGCVPPVHSSSNGKAKPDAGGETLS
                     ADGRRRPRPTLLSPPLPSSETSAAKVVQPWMGPMHEFAGSTPLLDATPPQELSAEHPT
                     RLSELGREDTIRDTDHLLRSLAEEIAMLATSQGLRTASEVAALCRRRGLHYVDAAFPP
                     VSETLGFDSSGGCRGCHTDRRTSFVVEWRPRDAVVPRGRKAELLTSAGIDPDSLRCGR
                     LGDAGVVAALAALAESAGAVLSVLASTTSEDEDNGIYVVWLCVHGWWTRVTVDAYLPC
                     VIEDNRLVDLYGCSSTTTYDLWAPVCEKALAKVLCGYHALCSLTAETAIGNFTGGPVE
                     CWDWWHRRSSTALEEMEAALSTNARGAGVVLLSTFSTAALRDTSTRSVAVAGAHAAYQ
                     RLGLRPGTSYRVLAVADNAEGEPMVLLRNWTRRCEQRENGQARCLFDLDSAFGGGDRR
                     NLSPRRDSNDGTAAVKGWLAKPLSQSSAASSQCDSCVWLSYTKEVLPYFDGCHVCFDC
                     RRYHDLRVPIAFTGSRPAIPAQLVRVRVQEGLARPPHRVTRFPTRLWIGLHQPFSRVD
                     TSDAAHACFPWGLKMTLVAQEEAPVPFGGGGGCARPARRSYILSESFLGEPKELPAVW
                     MYLELEPVVDSAPHPVTDLKDEDAAAATTTTEFFVVPHMEWIVRKDRAHTGQDDDGLG
                     SLGCDVPSAQHRRSVGQESQRRRLGTDAAPHSDQSGCASGAEKAVWHQCSNRHPASLA
                     ELSLGNATTAIVAVLAERRESVLVDVVNAPEELRAAVYHDVLDRIDFSDCTVAGGSDH
                     RQPSHPSQASAATAPGGVRCQLNGRCMPTFSW"
     gene            <288812..>290497
                     /locus_tag="LDBPK_360850"
                     /db_xref="GeneID:13388087"
     mRNA            <288812..>290497
                     /locus_tag="LDBPK_360850"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865153.1"
                     /db_xref="GeneID:13388087"
     CDS             288812..290497
                     /locus_tag="LDBPK_360850"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865201.1"
                     /db_xref="GeneID:13388087"
                     /db_xref="UniProtKB/TrEMBL:E9BTE4"
                     /translation="MERDKPPPALRFARQWTLPSSSASDAGFATLAYPSWHTESPSPF
                     NRSQVPLTPSPDRAGRRQPLEGSLAPGSPSPLPPSELSALTSGGAAHHTDASLQRASR
                     PVPAAPSASNVAARCVQPVMLASDADGKSFWRRQAQRLEAKCAALEEELKTVYRVLGK
                     EANDIPRALEASSHTSLMAAGCANPTYETVAQERDMARLELTREKEKNFLLRHRLREM
                     DAEVHRLQSRHARDVGKQRVGDASKRASPSFKSVSKMGVLSSRHQRASSRCCSSSCSS
                     TQSTRDVRRSPIYPRSRSITRPYTSSSAKREESPRPTPAPVSTSSAHYSDNSMITRSS
                     TASTSSSTRRESGRRAANTSAAAPAAFGKPRGRSTHSPLKPSRQATDPYEAEARDLLT
                     WLLSARPSSSSPSRCQPFVWRKGAAGSRGPEPLRRSNLESPPRRVRHNDLFSATVAVS
                     EGEGNGGRLAHGTARGAAKARPAIRDSRLLSPIPLQQERDAADDEKARDHPTGAVRSL
                     CAMPLQVRAPRSAADPSRDALSGKGALRGHAGDGEWIAWQPHVIAPGQQSGGA"
     gene            <291336..>293009
                     /locus_tag="LDBPK_360860"
                     /db_xref="GeneID:13388088"
     mRNA            <291336..>293009
                     /locus_tag="LDBPK_360860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865154.1"
                     /db_xref="GeneID:13388088"
     CDS             291336..293009
                     /locus_tag="LDBPK_360860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865202.1"
                     /db_xref="GeneID:13388088"
                     /db_xref="GOA:E9BTE5"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="UniProtKB/TrEMBL:E9BTE5"
                     /translation="MPSSSSALDVPLVEVICSYPTREGLCAECPALLLLVYQHVVAEL
                     QAGRRAVDVFRGTSRQDHLSELLGVRSLSELFEHLYPLSQSCTLDESTAGSQFWRQAR
                     ATLEAAWAPPHDAKARALLTQVRGQPRFRFCGPRDAETPGEGYPLHPVSLERALATSK
                     RFLRTAMTCALDGSTDALAGRQPELRAVLQLAHLVPDTPSTGAPPRKEVTPEGISFCM
                     VSLQQRWWVLVNAALERVLLLTRAAANGNGNTSGSSGVTKPLLWQLLAVLSVLDTAHY
                     VFAFPERQQDLAAHHLLARLSEVGLVYPLLSNDRKCFVLSPDFLHAIHWHASTPLSLT
                     FNHHLLRSVSGVSDIRREDTDTIITETNFRLYAYTDDADLLNILNQFAKLEEIVNGNL
                     HCYRVTRDSFASAMRKGITAAQVLRFLSLRAHPSMLRRHGEREENGDTTSPSSAGGAS
                     SSFTFSASPRRRAVAGTCGSTTSIDAVSTLVVPQSFCDQMHMWESECRRVVFEHHVVL
                     LRNMSTEQQKAVTAYLIDAGEVDAVAHAERGYMVIREEVFERLVAPLLR"
     gene            <294040..>295239
                     /locus_tag="LDBPK_360870"
                     /db_xref="GeneID:13388089"
     mRNA            <294040..>295239
                     /locus_tag="LDBPK_360870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865155.1"
                     /db_xref="GeneID:13388089"
     CDS             294040..295239
                     /locus_tag="LDBPK_360870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865203.1"
                     /db_xref="GeneID:13388089"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BTE6"
                     /translation="MEWVELHDVDPETMSLELPPDMLFGPLEFPKQMRFLLAALRADN
                     ELADGYLARVIIDRMDLSLDPPILSEGDFLAAGGKELLDFSVEDFTGTKSRAQRKHIF
                     FQPDQFLQFINVIAAYPSLTEYFVNEKDGVELVFQAYRHSKNPYARVMAMRSLTLFSF
                     TQAVDGTVERRILQSNGVKTIVDAYKQSTGDPTETRFPTLLLSSIMRHYPKEGGKEFI
                     DADGVEAVVNNLNICRYKGIPQHIRVLHDAQRLPKQSIGKKSVDARLEEADFLGVAMG
                     LLDSFPEFYEATGDLLKLMTSVVPAHADPLELLEYRAMPILSKYYVRWREDQSFQTDG
                     TRTLVAKLFELMLNDKTCQRCYDPSVASYELLECLRTAKLAVQDEREKRVTRFPDPQR
                     QPASAAA"
     gene            <296272..>297177
                     /locus_tag="LDBPK_360880"
                     /db_xref="GeneID:13388090"
     mRNA            <296272..>297177
                     /locus_tag="LDBPK_360880"
                     /product="ADP-ribosylation factor-like protein"
                     /transcript_id="XM_003865156.1"
                     /db_xref="GeneID:13388090"
     CDS             296272..297177
                     /locus_tag="LDBPK_360880"
                     /codon_start=1
                     /product="ADP-ribosylation factor-like protein"
                     /protein_id="XP_003865204.1"
                     /db_xref="GeneID:13388090"
                     /db_xref="GOA:E9BTE7"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTE7"
                     /translation="MSKDDASIAYAKKHKIHHLFELMATKVLLNRPENPFAYLRNLLK
                     DVEESEKNRVPYDPTQVHFNNDVGAAAPAAGSSGGSAAAAPAAALTSAKKEKRTVTLA
                     TFGLDRAGKTCALSVLESGEADKKYTPTVGFAPIKFPLDDYNLCVFDLGGAANFRGIW
                     VHYYHDCFGIVYVIDSAASDERVAESLKVLHETLQHPYVKGKPLLVLANKKDLPESRG
                     VGVVPQGFLEEAMGESGAPHRVLATCAIEDDPALVEGIEWLLEAVSKEYDALAKRVAK
                     DSNEVKNEKARQRAARLAAIRGEDK"
     gene            <299919..>305729
                     /locus_tag="LDBPK_070760"
                     /old_locus_tag="LDBPK_360890"
                     /db_xref="GeneID:13388091"
     mRNA            <299919..>305729
                     /locus_tag="LDBPK_070760"
                     /old_locus_tag="LDBPK_360890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_024473494.1"
                     /db_xref="GeneID:13388091"
     mRNA            <299919..>305729
                     /locus_tag="LDBPK_070760"
                     /old_locus_tag="LDBPK_360890"
                     /product="40S ribosomal protein S9, putative"
                     /transcript_id="XM_003865157.1"
                     /db_xref="GeneID:13388091"
     CDS             299919..305729
                     /locus_tag="LDBPK_070760"
                     /old_locus_tag="LDBPK_360890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_024329263.1"
                     /db_xref="GeneID:13388091"
                     /db_xref="GOA:E9BTE8"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BTE8"
                     /translation="MPTSSQASASSRRASTTKPGPPPRASSAAPPLPARFPSHSQAPL
                     PSATTSRRGSAIPELIGTRRDSSIGATSTNPRLRGGSVIDAAAAQRSSSAPRNPIDFA
                     SKESQEAMNRLRRLFLPVMMRVILRFRRRSRWKDGQPPRQYTPGSVVAAIMSTKSLLA
                     DCPQRMVESLAAGATFMSLTPKEIIVYANESHVSCGIVVLLYGQLEERRPEPGGKKPN
                     AGGGGGSTRPICTQPHRLHKAMSVLCLMPVMCEDRATSFLATRESEEADVAIISSRWF
                     WEVTYSMAQASLTTADVMGRTLREVVLPHRRDLLLADYFPTSVVLLRSWMWSMLTASD
                     RVKLSRSMEVRVLSVGDVLFDEGDYCPYIYVVRRGALAAIVKGETLAVLEAGAAVGEE
                     SVLFHDRRNCRVVAITVCELYALHAHHLLRRFLKYPESARRIVAAAIERQVWWMEEGR
                     TRDVFGLVSILSGVPCLGHTTDAMRDEIARCASVLILPQGHTVVSANTPCTFFCVIGR
                     GSVTLISSMKTAAVAETPSSVNGIDSKGESQLGMRRSSAMKPMSNPATEMRRESRSAG
                     DFFGELCLKPHLWPYDVMCDSTVSLWQFDREAVLGVLERNRADAQALEVCRQGIGLYR
                     TQRGETSIIDGFEPPATPNAPANGWRSCIGGQRSRAQSTDFATAPPGARSSSAGSRAG
                     RRLSLSHAAAPEWLSRGSPSEGRTPRGGRRAGVEWTPEQWTTYAMTRLQDGLRAEDAK
                     ETPPAPSRELRGVDKEVEKTMNEKVLQLVAVQPETPPNPADCDISGDSSELQSIIVGQ
                     LFLIMTEKQSRFLRQVKDSNVRLITEDEGMQLVGELNDSLDDMSGMDALHNSEALVEV
                     TEVMQLEDISASPLEGSHFLPQRAMPSLSVRDSTDATDYINVHRVDDALSVEGSGGAL
                     AGWPMPNASIGRTRRSTSVGALGEASGVLGASLNPRSSLNRSHFVRPSSAVPPSPRCA
                     SGRDDFLSPGAIGVVRPASSSEPRMMPPARTRPASVDFNQFNNKLSVDRSTSMLDRYV
                     KIEDQNYFDSFVKVLPLQRDEMWAPDGVNTDSEMGTGSMVLLLLHVRKCDYLSAKVMQ
                     RCARPIVKVTLGERVLVRTSVMENRTAPRWPIEHSSFISFVRRGTDIVFSVCDAGDEC
                     RIVYQASFSTASIHENGGVEQRTMPLTELSVTGFPANAEMDADVKSVESVGRMQRSAK
                     KPRMTMTMLAVTANKYKALRQYLETKEKVIVDPPGTPESTKLFLQVMSVEGLKHRIEA
                     TVTASLYNGATSTTVLKTERVIPKTRSPAWPGDTSFVIISGEGGILSFDLHHRDAVIG
                     STETTVDELIFGGVGLRRLPLLQAQTGRLVIGHLVVGVLGARLGDSVESRNRDWVTHL
                     AVEELSLAREGFSINPDPFIVLRSGTGAELMRTPLAFSAFEASWSMSEASCLLQCPRL
                     CGSTVSYQLEVCDSDEKEVIGRATILLSDRGLGPGHLHDLSLDPPGRGVVRLRSLCLP
                     VLELPARGAAGKASSAAALCPPFSSHLHLSESATLLLLHMGGCTNLPGGATVELQIDA
                     IGTLSVDAQPYLRTAVQEATTALQWPLSKASVLLRIPSRGDVDDRAAEAVDLRQWQCG
                     HQCHFAVYDGVVDDVSQIGQVAVPLSQLLNTALHTYPLFPRCMDADGGGLDQQPSVGT
                     TTRPRAAAERTLGNLQVFTLLGSLDHQVRGTAEQETDTLLTSVPAAGGHAPPDQLPYY
                     NPESADITAARLASALPTTVVLSVSNICHVLPSASEKYVQIVVRRGATVVLSVERQMG
                     VLSHAEWSPTEASAVVSCGALPADAALVVELVAMDVVEGRSDEEEDGITPSAAGAKAE
                     STARDKTRRRTITKGNASAANLPLGHAELPVSRLSSVQAGEVRVVTLMLSRSQRSSSL
                     SETTGRLPRVTPSMCALKDAQVVWPTVSFCIFGNRA"
     CDS             299919..305729
                     /locus_tag="LDBPK_070760"
                     /old_locus_tag="LDBPK_360890"
                     /codon_start=1
                     /product="40S ribosomal protein S9, putative"
                     /protein_id="XP_003865205.1"
                     /db_xref="GeneID:13388091"
                     /db_xref="GOA:E9BTE8"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:E9BTE8"
                     /translation="MPTSSQASASSRRASTTKPGPPPRASSAAPPLPARFPSHSQAPL
                     PSATTSRRGSAIPELIGTRRDSSIGATSTNPRLRGGSVIDAAAAQRSSSAPRNPIDFA
                     SKESQEAMNRLRRLFLPVMMRVILRFRRRSRWKDGQPPRQYTPGSVVAAIMSTKSLLA
                     DCPQRMVESLAAGATFMSLTPKEIIVYANESHVSCGIVVLLYGQLEERRPEPGGKKPN
                     AGGGGGSTRPICTQPHRLHKAMSVLCLMPVMCEDRATSFLATRESEEADVAIISSRWF
                     WEVTYSMAQASLTTADVMGRTLREVVLPHRRDLLLADYFPTSVVLLRSWMWSMLTASD
                     RVKLSRSMEVRVLSVGDVLFDEGDYCPYIYVVRRGALAAIVKGETLAVLEAGAAVGEE
                     SVLFHDRRNCRVVAITVCELYALHAHHLLRRFLKYPESARRIVAAAIERQVWWMEEGR
                     TRDVFGLVSILSGVPCLGHTTDAMRDEIARCASVLILPQGHTVVSANTPCTFFCVIGR
                     GSVTLISSMKTAAVAETPSSVNGIDSKGESQLGMRRSSAMKPMSNPATEMRRESRSAG
                     DFFGELCLKPHLWPYDVMCDSTVSLWQFDREAVLGVLERNRADAQALEVCRQGIGLYR
                     TQRGETSIIDGFEPPATPNAPANGWRSCIGGQRSRAQSTDFATAPPGARSSSAGSRAG
                     RRLSLSHAAAPEWLSRGSPSEGRTPRGGRRAGVEWTPEQWTTYAMTRLQDGLRAEDAK
                     ETPPAPSRELRGVDKEVEKTMNEKVLQLVAVQPETPPNPADCDISGDSSELQSIIVGQ
                     LFLIMTEKQSRFLRQVKDSNVRLITEDEGMQLVGELNDSLDDMSGMDALHNSEALVEV
                     TEVMQLEDISASPLEGSHFLPQRAMPSLSVRDSTDATDYINVHRVDDALSVEGSGGAL
                     AGWPMPNASIGRTRRSTSVGALGEASGVLGASLNPRSSLNRSHFVRPSSAVPPSPRCA
                     SGRDDFLSPGAIGVVRPASSSEPRMMPPARTRPASVDFNQFNNKLSVDRSTSMLDRYV
                     KIEDQNYFDSFVKVLPLQRDEMWAPDGVNTDSEMGTGSMVLLLLHVRKCDYLSAKVMQ
                     RCARPIVKVTLGERVLVRTSVMENRTAPRWPIEHSSFISFVRRGTDIVFSVCDAGDEC
                     RIVYQASFSTASIHENGGVEQRTMPLTELSVTGFPANAEMDADVKSVESVGRMQRSAK
                     KPRMTMTMLAVTANKYKALRQYLETKEKVIVDPPGTPESTKLFLQVMSVEGLKHRIEA
                     TVTASLYNGATSTTVLKTERVIPKTRSPAWPGDTSFVIISGEGGILSFDLHHRDAVIG
                     STETTVDELIFGGVGLRRLPLLQAQTGRLVIGHLVVGVLGARLGDSVESRNRDWVTHL
                     AVEELSLAREGFSINPDPFIVLRSGTGAELMRTPLAFSAFEASWSMSEASCLLQCPRL
                     CGSTVSYQLEVCDSDEKEVIGRATILLSDRGLGPGHLHDLSLDPPGRGVVRLRSLCLP
                     VLELPARGAAGKASSAAALCPPFSSHLHLSESATLLLLHMGGCTNLPGGATVELQIDA
                     IGTLSVDAQPYLRTAVQEATTALQWPLSKASVLLRIPSRGDVDDRAAEAVDLRQWQCG
                     HQCHFAVYDGVVDDVSQIGQVAVPLSQLLNTALHTYPLFPRCMDADGGGLDQQPSVGT
                     TTRPRAAAERTLGNLQVFTLLGSLDHQVRGTAEQETDTLLTSVPAAGGHAPPDQLPYY
                     NPESADITAARLASALPTTVVLSVSNICHVLPSASEKYVQIVVRRGATVVLSVERQMG
                     VLSHAEWSPTEASAVVSCGALPADAALVVELVAMDVVEGRSDEEEDGITPSAAGAKAE
                     STARDKTRRRTITKGNASAANLPLGHAELPVSRLSSVQAGEVRVVTLMLSRSQRSSSL
                     SETTGRLPRVTPSMCALKDAQVVWPTVSFCIFGNRA"
     gene            <309836..>312196
                     /locus_tag="LDBPK_360900"
                     /db_xref="GeneID:13388092"
     mRNA            <309836..>312196
                     /locus_tag="LDBPK_360900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865159.1"
                     /db_xref="GeneID:13388092"
     CDS             309836..312196
                     /locus_tag="LDBPK_360900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865207.1"
                     /db_xref="GeneID:13388092"
                     /db_xref="GOA:E9BTF0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9BTF0"
                     /translation="MIYKVYGSPENNSGNTHMYSMYAPPNAYVQGQGGSRTMYGYPGT
                     GGHGSGHPFGYHANPSMGAMYEYNGGNNVHHNGSAHLAGGGMNGRDRGVDVVGSRNPH
                     GYDQQSTSDYEVHDNQLKAPVVVTPATVVSTLGSARLFSKPPKPIVYGSRCVVRICDA
                     FQEGRCAAGDRCHDIHVRPEYLAETRMEMSSWLYDRECEFRQTMEMDSEKTFSIFVAD
                     LKEVVEVPINSLVFTKGLYVDPATRAKRARGAGNHAHAHAMMQVPTSCGLYSTDPLQC
                     KWERWCNQVHIDHRWMQAKKAEFDQWFIELQNRYFSLAPDDTFTVHDPQLKSSISLPK
                     FSIAGFSRGLFQGSMKKLASVCLLFQRGKCTAGSCCNQIHVFPQYLSLAREFAAMEQS
                     PEALPEEKQRLRREMELLRGPLMKQELQEKRETAAMESVSLPNVVSLANGGTQSDAMD
                     VKAAAEEDLGSCGALFEHVQVDEDVEPVSHLVSANTSLTRRMNASAPDISLSGARHMN
                     SDGSYSFNPYGSVTSLPDGSTSYNRFPGTRGSGQPMDGNGSVQYTPGSVQLLSTGTKG
                     MRRLVALVSPESGNGVVESHRNGDDMGIGGHAGDGGGATGAHDRAPQFAAVHRSNGGY
                     RAVAHPLGDEGGRYDGGAQGEQSCSLHPLDFDASWHFSPTPLLGFDASTTSTHRNGSI
                     RDEDPATHTHLRLAASNSSYVYPGSSTTSQQNLLSTPMQRGMTSNATTAAKVRLAASA
                     ASSRTHAHRSATSMPDSSTNPAMGGSVSSIPTARPTFVGEQHGGTR"
     gap             312767..312865
                     /estimated_length=99
     gap             314352..314450
                     /estimated_length=99
     gene            <318801..>321467
                     /locus_tag="LDBPK_360910"
                     /db_xref="GeneID:13388093"
     mRNA            <318801..>321467
                     /locus_tag="LDBPK_360910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865160.1"
                     /db_xref="GeneID:13388093"
     CDS             318801..321467
                     /locus_tag="LDBPK_360910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865208.1"
                     /db_xref="GeneID:13388093"
                     /db_xref="UniProtKB/TrEMBL:E9BTF1"
                     /translation="MWSTGVDVGGREVHVRLSPGVYRAAYSAPLANIDAGPDCASTAA
                     MPPKDVAKALSDARSRFHQLRDLRRELSGRHLPNTDGFSAAAAPAVHASSAFPSTLPT
                     ATLAQASLSVTCTPSAASFGLPLDRLSADDPATRSVLRTAAAERALRLQQAENDELKR
                     AMVTQQQEAAQMQCLIDRLSSELTEMRQTVLRQTATMKSLAAEMERRDVYHLIKEKHR
                     SQAAASAVATANASPGTLSSQSSLSHQQRLAQLEHQLEQLTKEKAELQQQVSHLSSRH
                     GGKRQSTPAIEVIDKDDDLVGEGSGADGSVLSARVELQRLVQALGAILQAGASPLARI
                     GAFSEPIYELELSRVTRLSPARTQRDPDDDARAPGKVNSVVCICGPYSMRDVLLRVQL
                     VTENAGSLMRRSRGLEGVPLQSPGRCVLYAMRDTCSAVRICLYKGVANTEVETGEPCS
                     TESPAPTATATVAVHTLIATALASGNELETRHAAYSVHTVHLVDDKGGLRDTVTFWVR
                     VTEVQHRRYSGYRGISCIDSDVDGRRCASPFQSPRTLEPGGVRIRERSATPLSSADAG
                     SAEGESVTKNLQRGQRLGPMLSPSRNDDATPMKGQRLFTHSSFSCSTAPPAPTDDADS
                     RGSAEKAKGILEQVEPQTKPLPALLTPSEDSKKAVTRAAAAVFCSGSKTPITFDGTSE
                     SQITDDSALAAARTTTLLPVYGTPAPMPPRLAASSDPSSTVGVRPTPSAPNLSWPPPP
                     PVAVVPAPPLSSTPTSTPPADAAYAMRMRIKEVHFLHEGCEDDLVEDMLEQCSLQVVV
                     RVDGEPVFTAPTRRNSSHAVWGAEEGSFTRTLTTGQEVRFEVLHGDKARSQAVLPASE
                     ILNASGEKELTLLSVSGGSPCGLLTMVFEGSV"
     gene            <323545..>325122
                     /locus_tag="LDBPK_360920"
                     /db_xref="GeneID:13388094"
     mRNA            <323545..>325122
                     /locus_tag="LDBPK_360920"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003865161.1"
                     /db_xref="GeneID:13388094"
     CDS             323545..325122
                     /locus_tag="LDBPK_360920"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003865209.1"
                     /db_xref="GeneID:13388094"
                     /db_xref="GOA:E9BTF2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BTF2"
                     /translation="MSRLKINLDAIERDGASATEGFCADGVRIGSLLVSSEGVRDNQG
                     NSCVLSLSDLEVVPETEGGFLGKGSSGSVRRAVHRGSNKVVALKEIKVTGQTHINEIR
                     RELETLHAGDFATPYLVSFYGAFAHEGSVFIAMEAMDGSLHELYKPVPPPVLASITRQ
                     MLKGLTYLHRTRHLIHRDLKPSNVLYNSRTGDIKISDFGVSSNLECTKADAHSFVGTV
                     TYMSPERLRGEYYSYGADIWSLGLVVAELAVGVCPYAGLRGGSSEARFWALLQHLNGD
                     GAALELPPEMDSDLADFISACVVKSPERRPTCTELLRHPFILRHTAAAPEAEAQPFST
                     TTSTAPAPGGLFSPLNRASPVAGSAVPLASEGSILKATSPSRAAAAPLPLPSPLERHD
                     GETDADVADRTVVARWIHAVMARKVLHRARGHGSEDPHLEPLAAVSASTATGLGERGG
                     AAGVSAVSSEDPQVAQLREFRAERNLERHSGDGGSAPVEQDCIAGVRSLTCDDLRRTS
                     TGEPSVNLDDELNRLLF"
     gene            <328313..>331147
                     /locus_tag="LDBPK_360930"
                     /db_xref="GeneID:13388095"
     mRNA            <328313..>331147
                     /locus_tag="LDBPK_360930"
                     /product="DEAH-box RNA helicase, putative"
                     /transcript_id="XM_003865162.1"
                     /db_xref="GeneID:13388095"
     CDS             328313..331147
                     /locus_tag="LDBPK_360930"
                     /codon_start=1
                     /product="DEAH-box RNA helicase, putative"
                     /protein_id="XP_003865210.1"
                     /db_xref="GeneID:13388095"
                     /db_xref="GOA:E9BTF3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTF3"
                     /translation="MDKKALRRAQQASRAAFLRKEASQRQKAANTVVEQKLRDIEQGV
                     VPASVTEADFLLHRSAEVNTASELFDVARRRQALGGEGEALDRWSELAAELPSHPHSS
                     ASPADAFKVTEEASDVSGAGVVSAPASAVAMDATSRPLSSAGYVAMSEAEVAERVARH
                     AYVREKTFAELQEDRAAALQGQKERLQLQRRSLPMHQAREELVKLIRDNRVVIIVGET
                     GSGKTTQLLQYLYEEGFHLGPKARKRLLTTPAGAAASSKVKAEADGKGDRAMVDEEQE
                     EELRLICTQPRRIAAISVAERVAQEVGCPCGSVVGYKVRFDDKTGPLTRILFVTDGMM
                     LKEFTNDPDLSSVGAIMVDEAHERSLSTDILLGLLRDVIRRNPDLKVIVASATINAEK
                     FSDFFDKAPVFTVSGRTYPVELFYSDEPVADYVTESAQTVLGLHLSKPLPGDVLVFLP
                     GQDAIETCAETLQSYMDEAKGRLRPLLILPIYSSMPPKEQARIYERTLPGTRKVVIAT
                     NIAETSITIDGVVYVVDCGLCKQDYYNPQAMVEELRVVPTSQASATQRAGRAGRTQPG
                     ECYRLFTAYTFHNELPPETIPEILRCSMSAVVLQLKAFGIHNLLQFDFLDAPSTASLE
                     RALDHLFLLGAMKADGRLTVTGRRMAEFPLEPSLSKCLIRACTLGCGRHMAMAAAMIT
                     LDSIFINTRDAKERQHIKSAREHLFGFGNGDVTGYIRLMEEWLRAGPRAGEFCRSNCI
                     NARSMLRARDVLDQILKTFDRIGLDVERVPSKSHSDGKDLDDENDALEKVLSAAANQI
                     DVEAVTRALLSGFFFNVAKLEADKWSYLVVRPMDTSVPTGAKRLESAGTAEASVAEIH
                     PASFLFGAGRKSNAHRTPSVTTDAEAGVPPVLRERPGLVVFLQMRRSTKRFMTHVTAI
                     ASAEWVLQSAPVNYFRPEELETGLRKRQRA"
     gene            <331669..>332568
                     /locus_tag="LDBPK_360940"
                     /db_xref="GeneID:13388096"
     mRNA            <331669..>332568
                     /locus_tag="LDBPK_360940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865163.1"
                     /db_xref="GeneID:13388096"
     CDS             331669..332568
                     /locus_tag="LDBPK_360940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865211.1"
                     /db_xref="GeneID:13388096"
                     /db_xref="GOA:E9BTF4"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:E9BTF4"
                     /translation="MYRCPSPPCPLPSLVWCLPLRRCLRKAARCHGLRVFVSSMLRRT
                     VCRRMMQLHAQRTPNPLCHSFTIPADSFESFVPQGQSCEVAHRGLAWVHPLSQGLFEQ
                     YPQELMSVFIAPRHVSISVYTNVDWSKIEWSISSFLGHYLIFTNACISPAKEYTLIED
                     DLELKDTDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCP
                     SSQNTLKDGIERVMKHFLPEVTEVIEDKEHQFYEDYGLLFDSEKALFKEAARLDRERQ
                     AQLRHKLTPMVLSYDALNEPDGD"
     gene            <333727..>334476
                     /locus_tag="LDBPK_360950"
                     /db_xref="GeneID:13388097"
     mRNA            <333727..>334476
                     /locus_tag="LDBPK_360950"
                     /product="Eukaryotic translation initiation factor 6
                     (eIF-6), putative"
                     /transcript_id="XM_003865164.1"
                     /db_xref="GeneID:13388097"
     CDS             333727..334476
                     /locus_tag="LDBPK_360950"
                     /codon_start=1
                     /product="Eukaryotic translation initiation factor 6
                     (eIF-6), putative"
                     /protein_id="XP_003865212.1"
                     /db_xref="GeneID:13388097"
                     /db_xref="GOA:E9BTF5"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:E9BTF5"
                     /translation="MTLRTRFESSDDIGVFSRLTNAYCLVAAGASQNFYSVFEQELAN
                     HICVVYTSIGDARVIGRLTVGNRHGLIVPSITTDQELQHLRNSLPDSVKVQRVEERLS
                     ALGNCVVCNDHVALIHTDLSRETEEVIRDTLQVQTFRTSIAENALVGSYAVATNKGCM
                     VHPKTPAQDMDEISSLLQVPVVAGTINRGNAAIGSGLVVNDWAAFCGLNTTATEITVV
                     ERIFQLRREAAGGDEGNLLQNVRETLVDELA"
     gene            <338517..>340889
                     /locus_tag="LDBPK_360960"
                     /db_xref="GeneID:13388098"
     mRNA            <338517..>340889
                     /locus_tag="LDBPK_360960"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003865165.1"
                     /db_xref="GeneID:13388098"
     CDS             338517..340889
                     /locus_tag="LDBPK_360960"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003865213.1"
                     /db_xref="GeneID:13388098"
                     /db_xref="GOA:E9BTF6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:E9BTF6"
                     /translation="MADGYHNKPAAPKVGQRFGPYQVGDTIGRGTFAKVKIGYHETTK
                     VRVALKIISRKLMESDARSALKIKREIKIMRVLRHPHITRLYDVVKTKHDIVLVMEYV
                     SGGELFDYVTCKGRLEEPTARALFQQLTAAVAYCHRYRVTHRDIKPENIMMEHGCHSV
                     KLSDFGLSSITHDGRFFETSCGTPNYASPEVVSGRLYGGPEADVWSCGVVLYAMLCGT
                     LPFDDSNIALLFKKIQTADYAIPSHVSAQARDLLHRVLVVNPLERATMEQVMQHPWLR
                     PDFPRYLLSLHFAAIVETTRFASTYYLTEDMLDEEVVRVVASRFRVSPQEVASIIMSE
                     EERIPSMRAVISDEDNPNSMARRYPAANYFEMYSNVLDSKLWPTPVEIAAAEVALRDE
                     AHDIYVSYVILTQKKQNKLAPQEHAANPSFGESANSLLQSQAQQGYGSLNANSLQQLT
                     GNSSFTGLSFKETSSRSHTDASSSPASKKSNHHNGKALQNLSSPLQHIMNSTVPAAPP
                     GDPWQSGYNVVAAPFLPLHAKGATGTVLGQLLRVQELPVQLLMSRRITVKPVKKEASS
                     TMFLSPGLPKSTPGFDCISDTGAAPTSMPTAPQGNLLQPQRSPTTRTRSAAPTLLHPH
                     SKVEVGLSDPHSPIPTGRPMRSIGADARHNLATAGGETALDTLYHAETVTRFGNDFIR
                     NGVAFVNSTSHETLQEVYEAMKEEGLLWKVIYDYYFSVVRYPNIKLQVKVYKTKSDEQ
                     LVDVKVSAQSGMAAYDVALSLLERLRTRAVNKRNTQIRESHASALTPDTT"
     gene            <350173..>354864
                     /locus_tag="LDBPK_360970"
                     /db_xref="GeneID:13388099"
     mRNA            <350173..>354864
                     /locus_tag="LDBPK_360970"
                     /product="mitogen-activated protein kinase-like protein"
                     /transcript_id="XM_003865166.1"
                     /db_xref="GeneID:13388099"
     CDS             350173..354864
                     /locus_tag="LDBPK_360970"
                     /codon_start=1
                     /product="mitogen-activated protein kinase-like protein"
                     /protein_id="XP_003865214.1"
                     /db_xref="GeneID:13388099"
                     /db_xref="GOA:E9BTF7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9BTF7"
                     /translation="MPSSSSVTQPEPEATQGIELPACARKPRDPDFEAPASLHAQSKE
                     SNPLVLVPPPSPILCPEHERKMRRTSKSCIVPPPRQRQFMGDVVGLKVPDLVTGWKLP
                     RKSSAHRCFLAAGGDVTVEPQPSSLAGANTKCPVRVPACAGSPTCGPRGENGVLIVSQ
                     DDRPAGLVNSRRRYSKESKPAVNGEDGVLLSEYEEDSADAAVRQTVARVRSKNCVLLI
                     VLLVIIIVLAVAGGVGVGFVNKHYTTLTHRMYLESGERIVLNSSVMLLKNYHETLRAD
                     ARHLLSFVRSSMIGRKPESIAVVQNTLYLPFFEAWSTWLFSSNVPSTHSIYVSMCGEP
                     LANTVDCPSMALTIVCMPNVLQAACFYMHSDEVDRSRMIVNRIEVNESGIPRIGAFYK
                     YVPLKVNYAHYQTNNDYGYFLDQDCAASLDGKVHTTLTIRRQIVVGDLVIICDASGFF
                     ERWFQRFEKGLQKKKDSHSVLFVNDGTVLAYDCGATPRRRHVVSPCSMRLVPHKMGDC
                     MAGKADMIDRIVDTFTVAMERNKLMKRGGLSKDHVALTERVGDYIVVYQDFLSFRVGD
                     GEPKTVFIAAYAVPLDTSLGRDGFVQISICVVIIIICMFLLGGVAMVAVNQMMRVVEV
                     ISQLSTHAATYDTKRMRSVLDRQKPGMLARVITSADIINCEFQHILTNLNAYRPFLPQ
                     SLLTKSSYSFSDEPLEPPSLWRCDVALGGSAADDVVVNEDGVPAKPLPRFHLKNTLEG
                     SVSNPVENWRLLQRGFHRTKSTILVVSLSNVALDAGESVDAVNLFVQTVLNHAAIANG
                     VVEVIEFQKIVVSFNSHFPVPRHQEKACLCALAIREEFRDRGCSISIGIASGYNYVGT
                     TGTEQQKARVIMGESVVVAQSLTSLKNYLGCSILATDQVVFEALVTAVAVDVVQLYYE
                     HNHQWVQYGVSEIIGNRYAVLSPDMQLVKSVFKLVRYRQAEEALEAVRRYMDAAAERR
                     ETPSWPVRRIHALVERQQLLIKSGYRRQRLQWQALEGDEIIMKHLSEENQSYNSKRQP
                     RLMATVSTATVDSLAKLSTHANAAPCELGFVSGDVLNAGSEAELARALVGEQSKLSMT
                     RRQLAPIPSSCFSEDALFPVFTVKSSDGDEEERSPGSSRLSSQHNRGTDGNAEASGAD
                     SEEMRPVLLVEPQTLRSEERHDVRIGALLPPFTVTTSSPFLPAHDMEYPCTTAGISSM
                     LSNSRRHSALDRQRHIAPTPLHDGTCHASTYATSGALGGVSGGKSSIGASLATTSAGN
                     LGRTADSALKQSSENVAGLAKMHCSYKLPQRIVSVNGQVFHRTSQLVGRGSFGEVYVA
                     ISETGSLGAMKVFPLNDNNAPQLIREVETLSQMRHENIVGYDCCAVQDNFFFIICEYL
                     AAGTLGSLIQKLGVIPERAARKYACDMLFGLGYLHQHSWLHCDIKPENILVTSDGTCK
                     LADFGAASLGRSLTDAVSVRGTPRFSAPEAILGTWNQQADIYSFGITVAQMVTGVHPW
                     HKYTEPDHLFVAHYAGEIRHSLQTGMPCAMQPDLPTNLQDKELESAIHRCCEFDPARR
                     PTAEELVTLLS"
     gap             355688..355786
                     /estimated_length=99
     gap             356461..356559
                     /estimated_length=99
     gene            <358458..>360206
                     /locus_tag="LDBPK_360980"
                     /db_xref="GeneID:13388100"
     mRNA            <358458..>360206
                     /locus_tag="LDBPK_360980"
                     /product="RNA editing complex protein MP67"
                     /transcript_id="XM_003865167.1"
                     /db_xref="GeneID:13388100"
     CDS             358458..360206
                     /locus_tag="LDBPK_360980"
                     /codon_start=1
                     /product="RNA editing complex protein MP67"
                     /protein_id="XP_003865215.1"
                     /db_xref="GeneID:13388100"
                     /db_xref="GOA:E9BTF8"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:E9BTF8"
                     /translation="MVREWWVNAAQEAVISRKAISRAERIVSEADDPRSGKRHFYDSD
                     ARLCLVCNARLEGSYSTHSHSVDHKPRVALLKRTIGMILTFLEQAASSPSLPPPQESD
                     SSYSLAGSKRFSRSVSTHTGTPAAPAPSCFHALYAESPLFAEDGVPSRALLYHRPLTL
                     REFDLVDVIMRRWWNTLHNPPPRRGSLSFDRLLSLSSAELQMRRWRVRYLLHFLKSRG
                     VLRSCLTLRSDQVNEAPSPNERIHRGEAFERLEMVGDFFFKSLTPDRMHTVFPADEGG
                     LTAELQYFERALDSNHGLLAIYDYLGLDDIAGCFLANNKAKADVVEAVIGELKVLLWS
                     TEVVWGMEYYAVPGERATHVYLRALVAHTIAELGHTVLMWQLESTLRNCRDFILKHTV
                     EEYLGAEKGNERRASGGGDECDVPADLPKYAPLPPLLAWNRRRPGVSVRRGEVPFASK
                     RSRSSIPPSPQDPLRRLAPTASCIPEAIRDHYAVGRKKWSSCACKAAIQALCGSLTQT
                     ALQHGNGHTADALSSNSTSASLPLSPQPQPSPTAPASAGAPRSVLRTLVTANCVVIRN
                     SAPLLARNTLTRRVAE"
     gap             362177..363600
                     /estimated_length=1424
     gene            <366730..>367230
                     /locus_tag="LDBPK_360990"
                     /old_locus_tag="LDBPK_361000"
                     /db_xref="GeneID:13388101"
     mRNA            <366730..>367230
                     /locus_tag="LDBPK_360990"
                     /old_locus_tag="LDBPK_361000"
                     /product="40S ribosomal protein S18, putative"
                     /transcript_id="XM_024473495.1"
                     /db_xref="GeneID:13388101"
     mRNA            <366730..>367230
                     /locus_tag="LDBPK_360990"
                     /old_locus_tag="LDBPK_361000"
                     /product="40S ribosomal protein S18, putative"
                     /transcript_id="XM_003865168.1"
                     /db_xref="GeneID:13388101"
     CDS             366730..367230
                     /locus_tag="LDBPK_360990"
                     /old_locus_tag="LDBPK_361000"
                     /codon_start=1
                     /product="40S ribosomal protein S18, putative"
                     /protein_id="XP_024329264.1"
                     /db_xref="GeneID:13388101"
                     /db_xref="GOA:E9BTF9"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:E9BTF9"
                     /translation="MQPFLKLLAEYPRMSLTLIPDHFQHIVRLLNTNVEGKRKVPFAL
                     RMVKGVGIRFAYLVCKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQR
                     DPKTGKTEHLSSSMVDTRLREDLERLKKIRAHRGVRHAYGLRVRGQHTCTTGRHGKTV
                     GVSRGK"
     CDS             366730..367230
                     /locus_tag="LDBPK_360990"
                     /old_locus_tag="LDBPK_361000"
                     /codon_start=1
                     /product="40S ribosomal protein S18, putative"
                     /protein_id="XP_003865216.1"
                     /db_xref="GeneID:13388101"
                     /db_xref="GOA:E9BTF9"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:E9BTF9"
                     /translation="MQPFLKLLAEYPRMSLTLIPDHFQHIVRLLNTNVEGKRKVPFAL
                     RMVKGVGIRFAYLVCKKAGIDVERRAGTLTAEELEKIAEIIADPAKFKIPDWFLNRQR
                     DPKTGKTEHLSSSMVDTRLREDLERLKKIRAHRGVRHAYGLRVRGQHTCTTGRHGKTV
                     GVSRGK"
     gene            <369003..>381521
                     /locus_tag="LDBPK_361010"
                     /db_xref="GeneID:13388103"
     mRNA            <369003..>381521
                     /locus_tag="LDBPK_361010"
                     /product="dynein heavy chain, putative"
                     /transcript_id="XM_003865170.1"
                     /db_xref="GeneID:13388103"
     CDS             369003..381521
                     /locus_tag="LDBPK_361010"
                     /codon_start=1
                     /product="dynein heavy chain, putative"
                     /protein_id="XP_003865218.1"
                     /db_xref="GeneID:13388103"
                     /db_xref="GOA:E9BTG1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026975"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTG1"
                     /translation="MATNLSVRGEVSRAELLQRKRQRIDTGPTLSELLIARGMHAAAA
                     SDLVGNPEDGSAGIAPCAAAGDYATWLPVEAFDDAFRFEELSPEDWAARVAAAPSGLP
                     CVFWKLDHRQHHKGGIWTSGRVVEVDVDKQLYYVLPDDGRDLRSSQKQKADTCGSAED
                     TRPLALPRVFVCFAAEDPENFANRFAAAHKRRTIAEAALRTELYVDFIPLDEYAALDP
                     LVIRRVLDAAVSTPALVECESNLNVAGVLEEVRAGYSRVMNADLFHSITQGGGLSQLT
                     GPSATSSTMLSASPLFMSGTARPVPLYGVSSHQAERFTATVAAFRQQCFWNTSPALAA
                     LTRAVCRADDALLSRCVFVLYSTTKMKRPLSLMELEEIETTATRDSFLHARDQWLTPT
                     ADMVKRTLSTFSSTDPVHLHHYDVNTYAGCSTERYLRQIQLHMQDTLQHYLISSLEAL
                     IRFVEHAGDNHVTVHGVAQVEVTRGAHPAPRTPFGADERITAGFLLPPPHPLPPLLSV
                     VLLCTKRVSDAGAKAAQEALETPATETQAPKPVAGDLPEEDEGSAKTEKPSAACLSYS
                     CSVESIRVSLQGLLKRCLTQHSTLRTVERVLFDFLYDPATAFLNVPAASSMLMESWVQ
                     RINVVLDRVAVAMKSYRETYTPFTAVIELDLNAYMATFDERFPSTRGVEAEVQRFLTL
                     QQQVLDGIPVSADLGLVRVDCSELRRELSKKCAMGAAKVLDVMAARALRKEIEVTDRY
                     SELYATLLKPTETPEEVVATKDFIKTIPERVVDLETAIEESKEIHELLKGFKRPLSEE
                     EFNKKWKAIGWPSQLDNAVNERVEELEETKRRLLASMNRAQDLFEQEVERIQKIVEHY
                     GQHRNAHRMTEIAEDVMRVQEKIRQLRSQASTFNTHESLFNMEKTDYSAVHQLATDFE
                     PYEALWITSASWSASLKKWHELPFMSIDADEVERVVADTLRIMNTCVRNPQLRPELVQ
                     VAEHTRENVQQFRPLVPTIKYLRMEGMHERHWSQLSKELGQAIEPAVTLQSLDDVVRM
                     NLTQQNDVLMRISEIASREFHIETSLAKMKAGWADMRMSVTAYKETGCLVISKDVVDQ
                     MQEKLDDQMLLTQSLSFSPFKQLFEDEIANWETSLKLVQDVLDAWLRCQKSWLYLEPI
                     FQSEDISRQLPGEYKRFQVVNKNWKFLTNKAQEVDLTLEFCTTTERCLELLKENNDTL
                     EVVERGLNQYLENKRASFARFYFLSDDELLAILSEARDPQRIQPQFRKLFENIARIDM
                     RNADNEMFGMYSQMEEYIPFAQSVLPRKYVENWLTEIEHMMKISIRLQLEAGVKNAAT
                     MKRQAFVLQSPGQVAIAVNQIMWTHECEMSLKEQGSLAPYMETAQRNLMVLVETVRLP
                     LTNLQRMNLSGLITIEVHARDIVEQLAKAGVDSIYAFEWVSQLRSYWENNDCVLRQVE
                     AQFRYGGEYLGNTTRLVITPLTDRIYLTLTGAMHMFLGGAPAGPAGTGKTETVKDLAK
                     AVAKQCVVFNCQEGMTYASMAKFFKGLAQAGAWACFDEFNRIDVEVLSVVAQQVSSLQ
                     EAARTRQFRIPFEGTEIVVDPSYSVFITMNPGYAGRTELPDNLKVLFRPVACMVPDYA
                     MIAEIRLFSFGYSDSRKLAQKMVATFRLSSEQLSSQDHYDFGMRAVNTVISAAGLMKR
                     EHPDEAEDVLLLRALRDSNAPKFLEEDLLLFDGITSDLFPGVELIPAGYGDFLAALEA
                     KASSMRLQPTEMFVKKCVQLYEMSVLRHGQMAVGPTMGGKTSATRVLQAAMTHLRKEL
                     KSTKFAEVKTYCLNPKSIMMAQLYGGFDEATGEWRDGIIGEVFRVAARDTTDARQWII
                     FDGPVDALWIESMNTVLDDNKKLCLISGEIIAMTPYMNCWFEVEDLAVASPATVSRAG
                     MIYLEPNTCVGVRNFILSWQQYRLPVTMDPYKEYLQELCEQLFPSLIHFVQTEVTEYS
                     PSTWPNLVVSCFNLFDCFMSPYTPTRTYEVPQDKLDLLREIHLHLLIFSVVWSFGATG
                     DRPSRQRFDKFLRDELRLRNVNIELPVIGCLQDYQFIPEERRWIAWAERLPPFTTQVT
                     QSNFSDIIVLTADVARYKYVNRILLEHSYHTLCCGPTGTGKTVLMRQLLMHEMPKECT
                     PIFFTFSARTSANQTQDLIFSKLEVRKRASPQVWGAPLNRKFIILVDDMNMPLKEQYG
                     AQPPIELLRQFMDYKGWYDRRTREFFSIVDVVLAGTMGPPGGGRHFITQRFLRHFHQI
                     AFPEIEDDSMSRIFLSLLESYFSLFAEDVRGKLSAVVMASIEVFNTAVKELKPTPARP
                     HYLFNLRDLAKVMDGLTNATPATVKTVPELVRLWLHEEMRTFQDRLTNDADRAWFQEL
                     LGKQLHKHLKLSMNDVTQRHRGDGCAAADSKNPQTPAADMNTLMFVDFMGGKSEQRIY
                     QEAADFDAVVKTLEQQLRDYNQQCIGGRQLDLVMFADAAQHVCRIARVLRKPNGHALL
                     LGVGGSGRQSLSRLAAHLNEYELFQVEIAKGYTMNAWREDVKAVLQRVALQKKQVLFL
                     FADTQIVHEAMLEDVNNLLNSGEVPNLFVGQELEDLLNSMRHVCVAEGLPVDKVTIFA
                     RFVRSCRSQLHISLCMSPLGEVFRSRLRMFPALVNCCTVDWFSAWPQQALRSVARNYF
                     AMVPLLAQQAKAVEACTEVCVRIHVSVDAVSVRFLAETQRHNYVTPTSFLELLHTFRA
                     LMETQTEKNQTTKDRFINGLAKLRETEDAVAELQQTLSQSQPALLEKNESIRALVAEM
                     ELQTTEAEKTKKEAQKEREAVATMQAECAAIEGAAQEQLAEALPELDRALESLKNLKS
                     SQITEVAGYKAPTAGVVMTMQGICILFQIRPQMRAASLMEKKPDFWATAKEQLLNNPN
                     LLLQRLIQYDKENIPEKLIQAVMPLVTSDDFTPKKIAGASQACAAMCQWTHAMVRFHE
                     VNKKVAPLRQELAVAQQANQKAQQKLKEAETQLADVAERLADMQRRKEEAERELEELG
                     QTVKRTALRLERAAMLIDGLAGEKRSWMQSLERIDESAQYLMGDMLVAAGQIAYCGPF
                     TSVYREELLESWGKELDQRSILHSAQYSIYHTLQDAVETREWILNGLPMDTLSIENAL
                     FAKSARRWPLLIDPQTQGNRWIRRTYKDSLEVVRPSQKDLIKRIEYCIRAGRPVLLEN
                     IGEDIDASLNPLLERRTFMEGGTEMLRISDTPIPWNPKFKFFMTTKLPNPHYIPEVMV
                     RVTLLNFFITPRGLEDQLLGVVVGQERRELEMRRSDLIQKNAAMKADLINTQESILCK
                     LKEVQGDVLDDVELIAYLNESKEKTLEITTRVAEAEAAEVELTASREEYRPIAHHSSC
                     LYFCCSTLSNVDPMYQYSLQWFVQLFIASIEQARRADDVAQRLENLKEYFTYSFYQNV
                     SRSLFEKHKLMFSVYLCVRLMDQRGQVDAAEFRFLLQGPTLVADAKDNPDPSWITPAT
                     WNEWCYLDQNFGPFKGLKAHLCAHLSHYKELFMSSAAHRQPMAADWADKLTPMQHLMF
                     LRCVRPDKLMERLQDFVLAEMGEKFIRPPPFDLLTSFKDSGPAVPLIFILSQGADPYD
                     DWKRFADAQNMSKKLYDVSLGQGQGPRAERMVQEGMENGSWVLLQNCHLATSWMPTLE
                     RLVEAITPNTHPSFRLWLTSMPNAHFPVAVLQNGVKMTNEPPKGLQANVSRSIGAYSG
                     EFLESCQKSVELKKLFFSMCFFHALLQERRKFGPLGWNIAYEFTSGDLGCCAAQIKMF
                     LDKYAEVPYTVIRELSGNIHYGGRVTDEWDRRTLNTLLERFVTPDVMADGYLFCPRLE
                     EYQSIPVTNRQGYLDYVASWPLNTNPETFGLHENADITCARTETFETLQAIVLLHGDE
                     GRRGDGVPSSSAAASTPDDMVKTFAEAIHRKVAAPFDVDQFRRKYPTKYEDSMNTVLV
                     QEAIRFNRLVTLLHQTLEQLPMAIRGEMVMSKELEEVYLALYNNQVPALWSDKAYPSL
                     KSLGAWVDDLVRRLAMVQNWYANGHPKAYWISGFFFPQAFLTSVLQNYARTLHISIDT
                     ISYEFEWMSTDPASVTTPPEVGCYIHGMFIEGARFDPATLTLAESLPKVLYEQAPLLW
                     LKPVVNRLSPASGIYECPLYKTVRRAGTLSTTGHSTNYVLAVEVRTPPKADAKHWIRR
                     GVALVCALSV"
     gene            <384902..>387652
                     /locus_tag="LDBPK_361020"
                     /db_xref="GeneID:13388104"
     mRNA            <384902..>387652
                     /locus_tag="LDBPK_361020"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865171.1"
                     /db_xref="GeneID:13388104"
     CDS             384902..387652
                     /locus_tag="LDBPK_361020"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865219.1"
                     /db_xref="GeneID:13388104"
                     /db_xref="UniProtKB/TrEMBL:E9BTG2"
                     /translation="MSVHRNQHDGACSLLLPTPPPTEPLPMSGCRKVQCRRGSWKQAF
                     CSLPGKTTAGVTYLRALAAVLACFSTVSAMLYICILGLDDVYSVQNSQNVYYSNESLA
                     VASDALGGTANTAESPTLLFPQLRATVGLHTVCVGFNCVLRSRLTGVSALVASAAQGT
                     TGRRLPRELAAAYEEATYQYIFGFDIGAHCGTPWSKTQSLSTFGVAALTLSLVLSLAL
                     FAVSMGLCFVVGKTDFLASNTTADGDFHLTNLNALDVPAPYGMRQIDRHLRMKTPLLL
                     SAGILSLCAFFTSVCTMGVTVALNRSKSKCGQSVCGAFKQGMERFYELADSLHVNVSI
                     PRTYSCEPGSSYILVFVTFCSSAVCLTMGSAIFFCYRHSRHHEQMLEMRDQLRRITEV
                     QGLAGGRSVARAESRRGTALANTSSLIVSVSSPSQAYSDMHHSDFFADGGLARRRHFG
                     SPAEDAQRRPRSVGAGIERYRLLKQFMAAEEHSRGCIKATESVHFQVFLALCETVWLA
                     ERLCRLHMFTLNCFVGPALEICVLETQCRQQLIREYHAGVTEVLASLREDAGVVPSQP
                     RQPRVKGAVLQEQERAVWDERVRRWQQVRAEMSRSFQRTASHAAAEARLRRRPSSPAH
                     SRTASCAGPNMNEWLEKLEELDATSVDKLFLAGSLAEPPPRRNGQHKEAGTSTSFSSP
                     TRSRAGLPFSGGDTFAACDAARSNVCTDGVSATGSAEAYDPPYEQQGRLHEGPSERPH
                     KVPQQSDVKDARLECSGSACAKVAQKGKENRYLELLTRTSARSTYSLRGSVSLPPSST
                     HVASESQSLRPAVSTSKSNSQVDPINAAGDGVRLQAVSHCTDNASAAAEWHKVFQGAS
                     EKEPEKGTILDCKRLRSWTGPTFSSASTKQADTTVSCATPAAAAPLTGPWRKRRDVQN
                     LL"
     gap             388932..389030
                     /estimated_length=99
     gap             390032..390130
                     /estimated_length=99
     gap             390863..390961
                     /estimated_length=99
     gene            <392357..>393043
                     /locus_tag="LDBPK_361030"
                     /db_xref="GeneID:13388105"
     mRNA            <392357..>393043
                     /locus_tag="LDBPK_361030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865172.1"
                     /db_xref="GeneID:13388105"
     CDS             392357..393043
                     /locus_tag="LDBPK_361030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865220.1"
                     /db_xref="GeneID:13388105"
                     /db_xref="UniProtKB/TrEMBL:E9BTG3"
                     /translation="MCAPTSTITQDTDRSAYTGSLLFVVPSKAKMSSKSIDVFNVSQN
                     RLRAATFQDEEERQNAEYAERHNLQALFSEFAAQLREKDPKTEHEAERVLLDLLSHRK
                     AERDRAALRLHFVASFEVNLDNGRKILKLTSGSETSTLHIVQKTRSVAVDETFTVSLE
                     EAEELTEMFYELGRFVVESGKGELNGFISIDDRDVFLLAGGKDCSDIGDELFNMAFLM
                     KASSKNRGTE"
     gene            <393937..>394395
                     /locus_tag="LDBPK_361040"
                     /db_xref="GeneID:13388106"
     mRNA            <393937..>394395
                     /locus_tag="LDBPK_361040"
                     /product="40S ribosomal protein S10, putative"
                     /transcript_id="XM_003865173.1"
                     /db_xref="GeneID:13388106"
     CDS             393937..>394395
                     /locus_tag="LDBPK_361040"
                     /codon_start=1
                     /product="40S ribosomal protein S10, putative"
                     /protein_id="XP_003865221.1"
                     /db_xref="GeneID:13388106"
                     /db_xref="GOA:E9BTG4"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="UniProtKB/TrEMBL:E9BTG4"
                     /translation="MWCARTRTGSHSHHPTQPGSPIDCAEAAPRRMSTYVPKPSRDNV
                     YRFFFTEGVIACKKDRMGTWTGTLGGNTFTVPCIQVMQLMRSLKSRNLIKEQYAWRHY
                     YWTLNDEGIAYMRSYLHLAPSAMPNTQKPSSVNFEKVTEGRGRGRGRGGRG"
     gap             394398..394496
                     /estimated_length=99
     gene            <395473..>395979
                     /locus_tag="LDBPK_361050"
                     /db_xref="GeneID:13388107"
     mRNA            <395473..>395979
                     /locus_tag="LDBPK_361050"
                     /product="40S ribosomal protein S10, putative"
                     /transcript_id="XM_003865174.1"
                     /db_xref="GeneID:13388107"
     CDS             395473..395979
                     /locus_tag="LDBPK_361050"
                     /codon_start=1
                     /product="40S ribosomal protein S10, putative"
                     /protein_id="XP_003865222.1"
                     /db_xref="GeneID:13388107"
                     /db_xref="GOA:E9BTG5"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="UniProtKB/TrEMBL:E9BTG5"
                     /translation="MSTYVPKPSRDNVYRFFFTEGVIACKKDRMGTWTGTLGGNTFTV
                     PCIQVMQLMRSLKSRNLIKEQYAWRHYYWTLNDEGIAYMRSYLHLAPSAMPNTQKPSS
                     VNFEKVTEGRGRGRGRGGRGRGEGRGRGRGEGRGRGRGRGFGGERTNYRAAAAASDGE
                     AAPAPAAE"
     gap             396075..396173
                     /estimated_length=99
     gene            <397250..>401140
                     /locus_tag="LDBPK_361060"
                     /db_xref="GeneID:13388108"
     mRNA            <397250..>401140
                     /locus_tag="LDBPK_361060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865175.1"
                     /db_xref="GeneID:13388108"
     CDS             397250..401140
                     /locus_tag="LDBPK_361060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865223.1"
                     /db_xref="GeneID:13388108"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BTG6"
                     /translation="MRTSVRWSETADAVNGIRPPINSLCYSPSGDYVVASCGVRVLVY
                     AASTGTLLHSLKGHQNTIYCVDYASDGKCFASGGADRTVIVWSNKGEGIVKYQHKESI
                     QALAHNPSSSHLASVSSTDWGIWSPDQLKVSKYSLPSKGLCAAWTPSGKTLAIGLLNG
                     IIMLIDKTSDETVLIRRPAPVWTLAFTPLRDKGIDVLAVGSWDQRLSFYNLSGTPVGR
                     ERELDFDPCSLSYFNDGEYMLLSGSDHKVTLFTSDGNRLIQVAGADDWIWSARQRPRH
                     KQLCYGTNDGTVSCIDIAITTVHAIHDDQYVYRKDMTNLVVHQLLLDRKMVIPCNEYV
                     HKIATFLDRLAVQLQERVIVFEFFYDEERNMRYQDIAQVRRRLECSLLCVTTNAIVVC
                     NDRRITMYDFQGNKRREWSMESAVQFMKVAGGMEGREILLVGLTGGQVMKVFVDNPFP
                     TLLHKGSAPVKSADFSSSRSRLAVIDSCNTLQVLRLGEKNELLFSEDNVTAAAFNVDL
                     EDSIAFTTGDNTLHIKTGSLPAYQQAVRGLVVGFKANRVFNLHYSNVMVVDVPHAHAL
                     YKYVEMRDLDRAYDVACLGVAEADWKMLGLHAMSQLRLDIARKAFTHIQDVKLVELLK
                     SLELRRRQSRVEDGVPPTARNGSAVSATVVATTDKGGAGPGGESTAARAAAKDSVLYG
                     SILAFQGKYHDAARQFMKAGCELKAVEMYCDLKMWDNAKKICTNEKVLKDLIRQQARW
                     AEDSQNFIEAASLYESCGDYAKAIGMMGQAGQVEKLMKMCRSLPKSEVTLITECANFF
                     RKHNAIPFAIEAYEKVQDHQALIGIYVARGDWRNAFTILEKAPTLAREVYVPWASWLA
                     DNDKFDEALEAFRAAKWPKEAMRLMETLATNSVTCRKFRDAAFYYIHLAEEYGRFEDG
                     EKPTDVEKAARIRRSKECVRRADIYYAFSSVYAHTTQPLPYNELSLFRAAKYLFGMCA
                     ECAIPMNVGKGAILYTLSRIANRLEMVRTARAVFEKLQGVILPVSMMEQVDIETLIVR
                     SKPVKDREELLDRCFRCNQLLAQLPMAGDRCPNCFHQCVRSFVNFECLPLVEFILADD
                     LADEEAERIIVSGIGRRKSADDEHNNGQSDASDAKALLKAKEWQSDSGANVISFDDGN
                     IDYEIDQQLVAMGRSKAAANKGNDPFFTQLQYVLRPGRPTAAYQPFVASADILKGFRR
                     DEVFIVRPRYGTLPVPNRYYRLMRSDVNVCLCSGCQHFFIAEDYEAECTKGSGCPLCR
                     YRPGKQVSRSMKQILFDMDAAAAVTTTSSTPVTL"
     gene            <402370..>407304
                     /locus_tag="LDBPK_361070"
                     /db_xref="GeneID:13388109"
     mRNA            <402370..>407304
                     /locus_tag="LDBPK_361070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865176.1"
                     /db_xref="GeneID:13388109"
     CDS             402370..407304
                     /locus_tag="LDBPK_361070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865224.1"
                     /db_xref="GeneID:13388109"
                     /db_xref="UniProtKB/TrEMBL:E9BTG7"
                     /translation="MVRRRHVAQPRRCWLGILLIFSILLVSAEGVRLETGTFLMDEDV
                     EWPWLPQLDLPLPPDFMSGQRILSTPEQWMVLAHVGAPFRVVTDTKMDLMRLLEVVKF
                     MLPADAGVCPRYSTTRRIVHYWFHPEQLSLLFGEERWSALQRLQRPAAWSLVLKDDAG
                     PAVRAAERFIAKLQALDPPGQITLISRRQSSSLRTTRVSLADFKVLSRLTRMTNTIEY
                     RLTHLTVDAEAPLHRMQIQRLLRAKLRYHEHIKAFDEAVAEAQRDLHVSLQELLKSEQ
                     AAYADHVHFKRSYQRFLVERQSRLRAEKGVKDAADGSDGESSMGRDAGSRRTAATSIH
                     RAAGTSLPSPLDGSRDVSCRKVLAAWSTLRAAGVCHEAEIRVAQLRRLHSRHRCKEPL
                     PELMVASSLVRGEAGLSPAAAHVWRDGVAEMKAQRRKSGASPTPAQVFAILYGVWEEA
                     KAATQAAGHAREATSAAGVVTTAVAVNEAFNASAFAAFVEHLVQSGDALSAAPNSRLP
                     RWIRAELHYTLALLQLIRPKTRPSEKHPATVSSSVRAVVHLHESLSAGSHHAAGALAT
                     LREHGIFARQQSKAAMMLLLQSMEQAPTHLWRELLLRGSPCRSHEAARAASARADPSR
                     LLRFEQFYAVDHTFSEVDDPFMTRQSIATLIAVTSENIHTGDEEPEMEDVYREAEVGR
                     GDDEYEGRLTARLNRRLLKASMLFSGFKGVQRDAREAQCELLVILRRLGYVCDLDLRR
                     FYTSGVPSHVPDSPPASSAAPMTIIGVPLPDSCAEHETELVDVMSNSRHTLLSCPNGV
                     PFPPRRSRRQLDVPNSEALFELLLQTLLALSYVQLIHRHRYDMSHLYASLALEMSLRV
                     PRATVERCAQAANMSAFVEAHHHPGDSNGSWARSFLEAVNRVADSDSEVAWAAEVLLD
                     QLQSIKNAPSQARGDGAALGHRVQRVLRRFASVADSPFVSTESLLLIGTSRWAARGPL
                     SGAAAEVAAFEKDLAEWTMEPFSLFHRLLQKRPRSSSAAATQQTPHPSHSGAVPGSSM
                     GVSLSTTVVDVHALFLVCLAAMKRWRSDFPLVHTLDATTYSARRTDPFVLSSFLLRAR
                     DTATGAPLISIEKLRDVAYAASPHFLGESPQLLPLVDDTVDSYAARLLRFAARHIHAL
                     EPCVELLRSGGYGVRRTDAGGAASAGMRMSGHWGSSLDDGPPRKSRLQTLRKVKQHTM
                     ENADLQPLLYAADVHDYMNKSRWTSVATVLSAVYKAVLYPFTTTAAEALIADMEAQMQ
                     LVTPEEHGAELSSRRKAGTEESPSQETAKGTARSAGTGVSAFVDAFAKDAALREFFIA
                     GQLLTVALESGMPEGFSLVLLEAADRGNRYLRPIAEHLAESVFGRMAPSVWTEHHLTA
                     QWQREEEELVGEGPLFVLDTRTPFRYASVEARQELFARVSRWNAAKAQQGDIGEVYGA
                     RERQRTRVSQALDQLLWCAGFLTRRVYRDTHRVYPYAYEGSVFPASDLECVADMNRLL
                     RSQRPAAETSASVVTEREPAWTLAEWRHAQKNGTALLRDLSERLGYVYDTVEGAPARR
                     FPLSAADFSRNVTVEEHALLLAERNQDYPSRFARVSTQLVEPWNRLSKDYSEQVVAYG
                     EGFYYNQRLHRISGYRWGAILHIWWLRVRNMWPW"
     gene            <408334..>409980
                     /locus_tag="LDBPK_361080"
                     /db_xref="GeneID:13388110"
     mRNA            <408334..>409980
                     /locus_tag="LDBPK_361080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865177.1"
                     /db_xref="GeneID:13388110"
     CDS             408334..409980
                     /locus_tag="LDBPK_361080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865225.1"
                     /db_xref="GeneID:13388110"
                     /db_xref="UniProtKB/TrEMBL:E9BTG8"
                     /translation="MFARFVCVAAIVAALGLLSPISADTAHPHHSRSHTVTIESGTLP
                     EAKAFAPLRLRAGEWVYNFNPGEEAFFFEPEDAGNRQWQQWKADLRLLQAYQEKQRLS
                     NYPSGGEKTDTPDKPGNTERREPGALPIAEYFSDRNVQRRYAERLKEQSFHNLSDAQG
                     AADARALVEGEIAAMWHLVRSAGSSDSLNDQQFLGLVERHFSHTIANTSAAAAAEATT
                     PSSFPFALLRVPLVLEADVLPFMEREMAHVRDLWKSRRAGAATPAASSVEVESQLQRL
                     SSAVENSKTVGTELAALVEPLADAAIGWVASTLTTTREAIVANDESTEAKRSELKQLL
                     KMQSRLRKVRPILEKHRKVYQSVLQRGQLPNAQATLFALQLIAKQRFGDDVSGLVEAV
                     PLLSTTAPLTGLLEQEWRAHVLAPYGMCVLVTAAFVWVCEEIKERFMTRVRARRLCMP
                     LVMPASASGCTRQMFMLVSFLELVVPPLLPVIALVVHLRGARVWMWGMIALMRPSQRA
                     VCLASVTLLMLSAYLVATMVRRVFQIIDPSVYRRRLAKKK"
     gene            <411403..>416430
                     /locus_tag="LDBPK_361090"
                     /db_xref="GeneID:13388111"
     mRNA            <411403..>416430
                     /locus_tag="LDBPK_361090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865178.1"
                     /db_xref="GeneID:13388111"
     CDS             411403..416430
                     /locus_tag="LDBPK_361090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865226.1"
                     /db_xref="GeneID:13388111"
                     /db_xref="UniProtKB/TrEMBL:E9BTG9"
                     /translation="MRSLCFRAVGSLHPSQRAASHHDTASSTRCAWRCLSTATENSQE
                     NAAADCTPPPLEQAFASPLPGPVAAHSVSLSPIGSAILCSHLSQRQMRQRQRRWGALW
                     RYRWESHSPRAMPTPLLVTSALISGSPRTSICAPHADVPEDTGAKTAPCDAERGSLVN
                     TSSPSHSRSLSMASAECEAKEGTRPRAHTGSAGAAAAAAADSVALSSTRNAAAGASTV
                     EDPLLSFLDSHEEDAALLLAMWTSLHRSCVFGSTLSESLVLQVRYFLHSLLRHRAIGA
                     AVTFYYRLMGIGVQLRQSDLLLLFSSLTYENAASTEEAQLRKAAETAAMESHRKIWAQ
                     RRRQLRLSAARTRTADAPGQSQREGGGEGRDKVLAGQTGVLSAGVKKTGAPAFCEEGP
                     TRVNATATESVQETASHTRIVRATHIAEGGSVAVSSAPRWARGEVGDEVRPPGSIARR
                     TAFHQQPEWVKRWILYEASMGTLDDLDEVEDASRPSTPSTSSSTDALLSTSDAQADTA
                     AQPEQVMRGMEVAAIVEHLHLLTLGAMQRDHLSATEANIPPPSPRRPQRCTSKLSRSW
                     SIERAYWKEALDLVRSAYSAAPRHRALSECGGTLFPRAAEDLLLPTEVVLALQSMLRE
                     VQSWEGTLSLLRLSVPEAKRRDAEPPRAVGMSSDCFRRGAVLFMALAAPAQPWKTQAK
                     VEAWMHRVMLPRLARDARAQTEATSTATAATAALHALWLSHLCSVKASRPDEFVALGE
                     EAAAYLTSPSVQRAIHGDLTVMMEEICVSTERAVDALHQTAQRAVQHRRASEVLAKSI
                     RTGAYRVENGKGKHELGRDPENDHMTDPLSMTSVAAPPTVMDGMRCSLLSDYATKSPL
                     SPSALLSSDSVDAFALCCAAVKETVWLRFTTAASTSPAAVAVEVLQFLEQNVHGPSGL
                     LNVFQLLYGSSASRMARNGKGSTLTPTENTPAAPECAYVSCVLAITLLQLVQLLCSPP
                     GQQQRRYGCHMWSGAELVLLAEHAAKVLERIAAAQVQQAPWRWAVEERLKELATVTAR
                     TVRLVVRQLDIHHMNEKVMFGAVADQDVELFALLARVLNTSSELMVASCASDASRVSS
                     YSPVWRILTSTCSPRILQGVHLCFRSSSALGKRVRYRLCRRDADNLEHWIQPPRSRQR
                     TSACLRGAGGAALLSSKRSVKAIDAGGAAAVGRYTGRDFPLMLSLRDSVYKIMSRERT
                     SAGVGRALQRLAAATANWKASLLLCELVTKDVSLARGTCTVDFFATALDRMAQDVARS
                     SAAAQAEARTPRSQGNDVVPSRKRCGTLAAPRASGPPNLWLSAIDVFWSAVDHVGQAE
                     AAAAQDSDSSALANSARTPASNPVSVDAQERAVLARLLLPLLRFSRAVNQREVGRQWR
                     RTWAAMYATQEKKNPQWRQQNIEALSVLGDAAALTHCVADYHICGSEALLCSVAVRHG
                     DWHAALVTVFQTYGAVEERHATGTPYSLVVARTILTLLAKSPMNLSNTAMRLRTVQRE
                     TWDEECSLAVVRLLLRGRRWRLAIAHVDEALGLPDMQRVRALVLVDPAGCLRQGASPS
                     APTAATLVRYAQLLTAVLRATAIGGDSERAPAYYDAFKALVRYVFGEVVDIDTLHTAE
                     DTWQRGDDALDAALDMTHFTEREEKHASGSEDQVHEAVRELAPRARILFFRAMTKKML
                     ASHAGKG"
     gene            <417840..>418700
                     /locus_tag="LDBPK_361100"
                     /db_xref="GeneID:13388112"
     mRNA            <417840..>418700
                     /locus_tag="LDBPK_361100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865179.1"
                     /db_xref="GeneID:13388112"
     CDS             417840..418700
                     /locus_tag="LDBPK_361100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865227.1"
                     /db_xref="GeneID:13388112"
                     /db_xref="UniProtKB/TrEMBL:E9BTH0"
                     /translation="MAQCLTWQVLDQRQTGECLDAVDLEALRAVIKRIDDDHGGALLH
                     SSERTATQVNVLLDLYGHLVLFAKASQFSPFKTSTLFGIVHRVHEASIADRLSRFHSY
                     DLLRELVVRHSVHRPPYSTMVFNVREVQDIDTYMMSTYYRHYKMYVYCFVPREVASLR
                     TVMLNDTAEAPPVQLPPLSAAIREDAWKEKMQEKVRTLEEAEMEEQVIVSDAVSEAQR
                     NAATLDNSRFMAGVRAQLEAIRDAVSTKSSERLDLIEEKLTAIEAKVNEAQSSGSRSR
                     QGSRGSSKRK"
     gene            <419910..>421673
                     /locus_tag="LDBPK_361110"
                     /db_xref="GeneID:13388113"
     mRNA            <419910..>421673
                     /locus_tag="LDBPK_361110"
                     /product="RNA editing complex protein MP61"
                     /transcript_id="XM_003865180.1"
                     /db_xref="GeneID:13388113"
     CDS             419910..421673
                     /locus_tag="LDBPK_361110"
                     /codon_start=1
                     /product="RNA editing complex protein MP61"
                     /protein_id="XP_003865228.1"
                     /db_xref="GeneID:13388113"
                     /db_xref="GOA:E9BTH1"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:E9BTH1"
                     /translation="MNRCSVKRRLSLRLPVVPTAGLLRRAPRAAGTRSGSGALCVAAA
                     PIGSSTSLVSSSGRKAPVYYNFATPVSVLRDAAGGESVSHRRQRREAPAREGRLLLVA
                     PRTPNPNDPLQRLNIFRREFSDFSSAAKLNQNIMVSVDTSTRRFLEMFCDFDAKRCKL
                     CNETFLQWHIHANGIPHVGREGMLLELVRPYCGTPDELIDMWWQRLNSCAAFHRIPAL
                     SHDNPHERKRRLLYLLKVLKDRGILVETFNVSDNQSTNSARSWEFERLEFVGDNVVKY
                     VLNSIISCAFPPHEGGTKGKMTCFQFVMDGNDGLARGYDHLDLQQLASSPRVVSKFKS
                     DIVETLFAELQMYLWSTQHDVGTCPLVFPFTKDIYTLRALVQHALYELAIELFLYHIR
                     HINGMLQRVMRENHLQFVKADSTLKPRAGARAGSLGVSTRRGDWSDDDDDYDCPQSYG
                     APAVPAPTAALMKVRCERTHLKGTGAALFFASTNYDSFKHVVPIGGLLPRPFAREDLS
                     VIPNYMPHLRRDGAMTLRMRRAGNAGWSTLHGTAAALATREGVAGGLALSAGITPRVG
                     SEPVRLSVPRLKDEELIPELI"
     gene            <422950..>425973
                     /locus_tag="LDBPK_361120"
                     /db_xref="GeneID:13388114"
     mRNA            <422950..>425973
                     /locus_tag="LDBPK_361120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865181.1"
                     /db_xref="GeneID:13388114"
     CDS             422950..425973
                     /locus_tag="LDBPK_361120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865229.1"
                     /db_xref="GeneID:13388114"
                     /db_xref="InterPro:IPR018501"
                     /db_xref="UniProtKB/TrEMBL:E9BTH2"
                     /translation="MITARSPYQVYKATDVNGTVANFNSLPSEELLPYKILSSEETLL
                     ASLFVVEGNEEQRERYAVSALHAARVYISHLISYIPLSARSQTAKKVQINIDAVVRTV
                     MLFAANAELLQSVKKMVLTNASGEQVSLKDLSDLEGALNAMEKVYRQKAKGAGEKVDM
                     LRKVAPEPVIVSSSAAKSQGTTPLTAGEDSGNAASNSTGCSRQRRRRSESTDGPAGHA
                     DLHSDAAALKVAKIEGGTDNAPLAAVYAPKVSGGPKSVRTGLRGGLVWGRLRGLTNNE
                     KKVAAMLQAMIQVLGHIFATKFNDLVPIFDMLDERLRAVQAIIDAERAQYKAKEDKRI
                     PEPFHEVTLDAVQLALQHSSETFRNDEECRYELDEDLLHPIAHACLRVINHIEGFSTE
                     PFKGPTPEELLKKQQLRDAARAKREEAKRRILEKAEAKAELERKKEEERQLMRRRLGD
                     GSDEHEKDLEEDTTLVTPSTLGYVAYTAELPLGTPELFEKALYVWSMLSSVPRALNLS
                     QMHFATFVKGIECVDQDANGLMEEVTKCLLDVSMESVRLRSPGTPRIVTRGKNWFDAL
                     VEFVGVASGNKKKRRQQQRRVSSTEDEEEIDSDSDSDASSSTSSSSSSSFSSKETDAK
                     TSAEEEDTPPEKPAAAMATRGEGAAEAAAEEEVDTDPFSLELKATMDKIAGLRSLASW
                     GNVDAIDRLNLLQFCVLEALGSDEVRNEADRVQKDREEEALNAEKKLREIREEAEKEL
                     KALLRTLPSVASTAARKKKTQNSTQKAEPVTKEDNQHTNNAEDEKKGIDEAEGDSETA
                     TGKDVRETAQRNFEAEREAILQEVDRKREEVYARLLGVQDGKDDGAIVEPLGMDRYRR
                     LYWRFPMERVVYVQSVPNLTAVTFPVLAEPPELKQRRASSRSLLLDDEEEISMLGGRR
                     RGGRGATAAGDAARAKDDKGVGQTRWGVIPHEYLSTFVQTLDRRGEREAPLRHALETL
                     EPYLTALEEPREGRETRARAHMFGYMNLLKVDFTS"
     gene            <426479..>426535
                     /locus_tag="LDBPK_361130"
                     /db_xref="GeneID:13388115"
     mRNA            <426479..>426535
                     /locus_tag="LDBPK_361130"
                     /product="ribosomal protein L24, putative"
                     /transcript_id="XM_003865182.1"
                     /db_xref="GeneID:13388115"
     CDS             426479..>426535
                     /locus_tag="LDBPK_361130"
                     /codon_start=1
                     /product="ribosomal protein L24, putative"
                     /protein_id="XP_003865230.1"
                     /db_xref="GeneID:13388115"
                     /db_xref="GOA:E9BTH3"
                     /db_xref="UniProtKB/TrEMBL:E9BTH3"
                     /translation="MRTIECEFSHFAVHPGHGR"
     gap             426536..426634
                     /estimated_length=99
     gene            <427707..>429443
                     /locus_tag="LDBPK_361140"
                     /db_xref="GeneID:13388116"
     mRNA            <427707..>429443
                     /locus_tag="LDBPK_361140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865183.1"
                     /db_xref="GeneID:13388116"
     CDS             427707..429443
                     /locus_tag="LDBPK_361140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865231.1"
                     /db_xref="GeneID:13388116"
                     /db_xref="UniProtKB/TrEMBL:E9BTH4"
                     /translation="MPPTSTRPTVAGGRRVYHLGNAVLSAVVFVITLVLSMVMLDPQR
                     NSHLLSARRRTPPIDFTDSVLAGGFTPVVVSVNKHTVLVVPAAPIHGTRYVSRSLDSF
                     FSVGLGSANGTSSAGYHEEAERHSQGAITLSDVYSAVLLHEGVADATQAPDETAETVE
                     TFPLSSRRPSVLHLCSALSCVTPYVAQQWSDRAAAALLLANKTKDGATADRSRARPVA
                     NFALVFGEASESLAVMRELGEHRVLTAQIPVAHSDHPQSAMPLVGKLELADLQASCSS
                     LKQCSYRSPVKHAQLETLLKAQAQQLPAEASRKRLFKEWVRRNDSHSGGLAWGAVDVL
                     PFTFVTFGKSNTLHGFPLDLVHVDVGSGDSVAALAYLDALASDTAMTENLKPRNLLVS
                     VFASEWVNAIVETLLLLEVGQRYSAIPLHDSCVGLERHFTPRQRWSLSHMLSWMGKQA
                     LEGTYLSPSLERSRAAQIPLCTVLLSRQVNTLDELLQMASKAIDSYPPAASPVERFFY
                     YSLGISPKDEELLTPLPEAASGAKAFALPSTPDVAREVIGFLVQYIYFLIPIGVGFSL
                     TRNLCRRRGVCG"
     gene            <430859..>431320
                     /locus_tag="LDBPK_361150"
                     /db_xref="GeneID:13388117"
     mRNA            <430859..>431320
                     /locus_tag="LDBPK_361150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865184.1"
                     /db_xref="GeneID:13388117"
     CDS             430859..431320
                     /locus_tag="LDBPK_361150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865232.1"
                     /db_xref="GeneID:13388117"
                     /db_xref="UniProtKB/TrEMBL:E9BTH5"
                     /translation="MASFLRTFAILCIIAGVLLQGSTARAPPRAVRAFETKFNSVSQA
                     CRGVLETECPSDGLARTDCLMEHIVDNANHECKMWLSWRANCFAYATVYLIPQGKCNF
                     KPHQATSQLIRNCLRNTEKSELPAVCSGSPYYKSLTLRVPRRMDSDAAADL"
     gap             432200..432530
                     /estimated_length=331
     gene            <433260..>434879
                     /locus_tag="LDBPK_361170"
                     /db_xref="GeneID:13388118"
     mRNA            <433260..>434879
                     /locus_tag="LDBPK_361170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865185.1"
                     /db_xref="GeneID:13388118"
     CDS             433260..434879
                     /locus_tag="LDBPK_361170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865233.1"
                     /db_xref="GeneID:13388118"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:E9BTH6"
                     /translation="MTSTVTAVNQTQSLAAIRNFVRASVSCITYARGLCSDNAYEQRP
                     FLGLPLRQLIPSTTESVTISEWIEKGAFDALNRNYLKEMSLCVYDAACRELLESYCFG
                     FNYTGDGERAQMTLNAAQTIADGANTTAVSQSSGGAVGIPTYRKRRCSKQEIQHLLTS
                     ILERLMDVVESLPPMLSERVLTMRLTYYDAVTPASYEPPCFAPASEHMARLYQDEVKH
                     HVHIGSVDTSHHLFSVAIRHPLLQQIHRQMTGRTTSAVATATGRVPLAVDESAAVSMP
                     SDPLRSGWESSFSSDPAVSSALAPAGATVTHGVVANHVSCGRLLCADGEGAAFDAESA
                     GEENAACSSLGEVSRGSAGRARTGEALRPCEVAALDGVHRLMEKSTSGGERRLLRPSE
                     LTYLLFAAFVFTKAPSARGGRGELKADEVEAYRVLRCPFDVSAEAVLLVLQRLSREDF
                     LQPCNARGAPTPKKPRAQDGSTPTPAIREWLVPDPPASLLQQLMQVDALTELLTHESH
                     LVLQELSVYLTREEWRRAPRAMTAKRRLRAA"
     gene            <436376..>437455
                     /locus_tag="LDBPK_361180"
                     /db_xref="GeneID:13388119"
     mRNA            <436376..>437455
                     /locus_tag="LDBPK_361180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865186.1"
                     /db_xref="GeneID:13388119"
     CDS             436376..437455
                     /locus_tag="LDBPK_361180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865234.1"
                     /db_xref="GeneID:13388119"
                     /db_xref="UniProtKB/TrEMBL:E9BTH7"
                     /translation="MLRCASTSRPTLAALPRSAGSAAASSAAYAAARRGYHGFQFASF
                     HGWTLPYGGKSTRVTKEELESQRFFTQRPREKWDYHRVDENINSQSEFRSREGREQFY
                     QGSREDNSTMSHGSLHTPHKYRLYEYFDEYTKPGVDRKVAAAYAVKEQWDAEEFYYPG
                     EAWQRNRPGFRSVPKELLNRQTWYHWSHTLTKWDEIQPTIRTRSWNPDWPPPGYEVPK
                     LQCKKEFYFGIEEEGLVSEVERYSWFRSWSDNNMRVGWREIPLFMMLFGTLYLFARNA
                     MSVTAMRAMSSNMYYPGRSLIRPFGVPKDWETECFWWQRPLEEFPNQDQVWYWTQARF
                     GYMNHIKQRDAREKAMADAEAAATE"
     gene            <438619..>439986
                     /locus_tag="LDBPK_361190"
                     /db_xref="GeneID:13388120"
     mRNA            <438619..>439986
                     /locus_tag="LDBPK_361190"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865187.1"
                     /db_xref="GeneID:13388120"
     CDS             438619..439986
                     /locus_tag="LDBPK_361190"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865235.1"
                     /db_xref="GeneID:13388120"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BTH8"
                     /translation="MQSYHRHMTLSSNPVVVFVFDHQGSAVTNFWAPLMQSVSKGFDA
                     FGIEVAHAPTSSEIGQQLLGAMNAGSGGPIILFFQGVGDTPAEGGKALKMPIAYEGNI
                     DIAHIMSWGLSCISSSVTHRVHNDVDLARFFAQYPQYPTLPHVLYFPSTSYTPGGYLA
                     LSQHFALDAVFGVVPNAFAAANATLIAQRYNITSKDELPVLLVLHRAAADDGGGAGES
                     DHVVRMPATATSLSYREALAFLSTHITDTVAALVAKAESTQNQHFLEVAESRRVYMMG
                     QLIERQLDIAEEERLQMAREPILVKDQAAWAKECVQLPKKHRCLAAFVDSAQDSAAKD
                     NAVKVLALVSVKLLEIMGREAQKVSLVVVDRQGSDAVREYFDVGHNGFPDVLFLSLDR
                     PAKYYNFVGTFSAEGVTQFIAAHDAQLTHKDVRGGHTFIPRMVPKLEEAVAVTRGSDE
                     DEDDL"
     gene            <441104..>442021
                     /locus_tag="LDBPK_361200"
                     /db_xref="GeneID:13388121"
     mRNA            <441104..>442021
                     /locus_tag="LDBPK_361200"
                     /product="short chain 3-hydroxyacyl-CoA dehydrogenase,
                     putative"
                     /transcript_id="XM_003865188.1"
                     /db_xref="GeneID:13388121"
     CDS             441104..442021
                     /locus_tag="LDBPK_361200"
                     /codon_start=1
                     /product="short chain 3-hydroxyacyl-CoA dehydrogenase,
                     putative"
                     /protein_id="XP_003865236.1"
                     /db_xref="GeneID:13388121"
                     /db_xref="GOA:E9BTH9"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022694"
                     /db_xref="UniProtKB/TrEMBL:E9BTH9"
                     /translation="MLRCTASALFKSLAVWGGGTMGSGIAQITAQAGVPVTVVEVSQA
                     RLDASRKAIETSLLRIANKKCDGDQGKMKAFVDTVLSHVTFTTDEAVAAGGAELIIEA
                     IVENIGAKKELFGRLDKMAPTSTVFCSNTSSLSITEMASATTRKDRFAGMHFFSPVPM
                     MKLLEVVRTEEVSPAIIEQLTAFGKKVGKIPVVAKDTEGFIVNRLLVPYQMEACRLVE
                     RGVATFQDVDTAMKFGCGYPMGPFELCDSVGIDVIKFIVDGWHAQYPNEPLFKPSPLI
                     NERVAAGKLGKKTGEGYYKYDSKGRKIES"
     gene            <442823..>443341
                     /locus_tag="LDBPK_361210"
                     /db_xref="GeneID:13388122"
     mRNA            <442823..>443341
                     /locus_tag="LDBPK_361210"
                     /product="endonuclease/exonuclease/phosphatase, putative"
                     /transcript_id="XM_003865189.1"
                     /db_xref="GeneID:13388122"
     CDS             442823..>443341
                     /locus_tag="LDBPK_361210"
                     /codon_start=1
                     /product="endonuclease/exonuclease/phosphatase, putative"
                     /protein_id="XP_003865237.1"
                     /db_xref="GeneID:13388122"
                     /db_xref="GOA:E9BTI0"
                     /db_xref="UniProtKB/TrEMBL:E9BTI0"
                     /translation="MNRVDGSANITESKTHTNAPQSACVRDTRHLSSIRPGWAFTGQR
                     CRKRDESTPDVHRRVLQSLPCEASPHHVMACRGWRRLRRRSMAHRQDVQGLGGAWPGA
                     GGLPPCAHPACTWSTRGVRPRACHPGRGPLCREACSPHRVSVWRRLDASFHFNCRTTR
                     PPPGGGGSGAGGG"
     gap             443344..443442
                     /estimated_length=99
     gene            <448457..>449569
                     /locus_tag="LDBPK_361220"
                     /db_xref="GeneID:13388123"
     mRNA            <448457..>449569
                     /locus_tag="LDBPK_361220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865190.1"
                     /db_xref="GeneID:13388123"
     CDS             448457..449569
                     /locus_tag="LDBPK_361220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865238.1"
                     /db_xref="GeneID:13388123"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="UniProtKB/TrEMBL:E9BTI1"
                     /translation="MKPHKQQRTCTKHPIPSHNTSATARHSSGRLFQNTVQPSATRMR
                     FVRPATHAAPHGRGWYEAIPERLKVTIDDYFSEATHCYDEEGHECARMTGLIAPHAGM
                     SYSGRTAAEAFAVFRDYLYAKGSKGSELERIFILGPSHTKGFEGCELSAASAYETPFG
                     RLRVDTAVVDRVITDLRKAGVGAATASRRTDEAEHSIEMETPYLSHILHYPPTTTGAP
                     AQPAAGRVAIVPIIVGWTDRQDEKAICDVLKPYMDDARNFFIFSSDFCHWGERFSYTY
                     HYKRSEYPNIGDSIIAMDHAAMELLEKRDLERWYAYLQMTKNTICGRAPISIGMQRWA
                     DEMNKARVKFVHYSQSNKCKDADDSSVSYAAAIIME"
     gene            <451326..>453239
                     /locus_tag="LDBPK_361230"
                     /db_xref="GeneID:13388124"
     mRNA            <451326..>453239
                     /locus_tag="LDBPK_361230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865191.1"
                     /db_xref="GeneID:13388124"
     CDS             451326..453239
                     /locus_tag="LDBPK_361230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865239.1"
                     /db_xref="GeneID:13388124"
                     /db_xref="UniProtKB/TrEMBL:E9BTI2"
                     /translation="MKTHRRHATVEEVIDPSPFDYTLLSHLYVHSDGTDVIDFSGLAP
                     GKESRCRVNSFLKNRSFAPGMTEAEPEAVGSYLHLRIEENDRSTVDDSECCKIPGAHT
                     SAPPRGGSAPASNLVRIEDSAEHWWFMCQAAEDTAPYARLFHGAGDLLSYLEQHNLQL
                     PTGRSWMSDPSTDAGLPHGGQPQPHQHSSNSVTGGTTSILPLTKWLDIQIDRSNPRSA
                     ERVAQLLNRLPISQETKDSCLYLSTVDSIDISLLTTSDVSSTMSDYVFLNLMCTPVVE
                     NDVNCAGATTATTASDEKRFLHGLGGGNFGFSSTDKKKRTAKSGKTQKRSAAHVSSQG
                     TLSATRSVMEMRFEAVRMGAPRSSVPEPVAVAVIVFADWMFTIHEKPFAEMDDMLRMV
                     QLHCAPSEVTTSHLRYAAALSPTMQRRFTAPFAMSVLLQIVVGHHLDSITLAKAVDAL
                     GDCVFDVRERKRDQDAVLKHITAVRRCFGECGTETARREVLFASLLQPMFADRFFVAD
                     PTIRRELENAQAHLRHFQRDIADCRDTVALSNWHNNVAIQWVLLRRGNRALRMVLLLA
                     QMTNIMQPIVIVQTLYAMNVPLPFEADGDPPHTTLAPFFVLAAIFLIYCGLTVGSIRH
                     VLVRKSFETRLLA"
     gene            <454663..>455670
                     /locus_tag="LDBPK_361240"
                     /db_xref="GeneID:13388125"
     mRNA            <454663..>455670
                     /locus_tag="LDBPK_361240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865192.1"
                     /db_xref="GeneID:13388125"
     CDS             454663..455670
                     /locus_tag="LDBPK_361240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865240.1"
                     /db_xref="GeneID:13388125"
                     /db_xref="UniProtKB/TrEMBL:E9BTI3"
                     /translation="MLCGSRATFARTAVAFFNMKHFQTKKKYNLTPQNIYETFSTVLL
                     PRDRLLRQSVSGGGGSRVLVLDAQQRVKGVYLPVFCMPHPSTITNGSNSLGVAVADYT
                     RSIEAASTIHKAGGGGTASTLPTVLVVLSHPQGLAYGTFRADGTPGVPMKNLALSPIL
                     ANARTQQASTNIASTPLRTSGLGTVMPLLNVSRGRAEVIRDIYKELNECEHVAELAAC
                     STFVWVQRDNMSSMTFETAQSSERYWEREKNDGDGAAAPPPGAISFLDRRWVLLMDVA
                     LHPDTGLGLYARDPATGDRIVNATGVQSALCRGLLLLDHVPRTAADPTRAADSDTGSS
                     G"
     gene            <456878..>457300
                     /locus_tag="LDBPK_361250"
                     /db_xref="GeneID:13388126"
     mRNA            <456878..>457300
                     /locus_tag="LDBPK_361250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865193.1"
                     /db_xref="GeneID:13388126"
     CDS             456878..457300
                     /locus_tag="LDBPK_361250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865241.1"
                     /db_xref="GeneID:13388126"
                     /db_xref="UniProtKB/TrEMBL:E9BTI4"
                     /translation="MRRVTCHAFVRCAQPAAALTPVRTIIAAKGIVENRITKHYTNRT
                     VDESKAERAESMKKTLHPNPRNRKEELSHLTQHCSYEYVPEFQRWANDMMAVYSDPQG
                     YGHDMAYHYQRIWKAKSLTRRGVEDGSGAFDVCRVHPH"
     gene            <458734..>460614
                     /locus_tag="LDBPK_361260"
                     /db_xref="GeneID:13388127"
     mRNA            <458734..>460614
                     /locus_tag="LDBPK_361260"
                     /product="GPI anchor biosynthesis protein, putative"
                     /transcript_id="XM_003865194.1"
                     /db_xref="GeneID:13388127"
     CDS             458734..460614
                     /locus_tag="LDBPK_361260"
                     /codon_start=1
                     /product="GPI anchor biosynthesis protein, putative"
                     /protein_id="XP_003865242.1"
                     /db_xref="GeneID:13388127"
                     /db_xref="GOA:E9BTI5"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:E9BTI5"
                     /translation="MDVLGAFSRWPRPLQSRWLLLLLLLYRVTLCLTLQTAESPDEWW
                     QSEEVAYKMVFGRGQLTWEWDEAIRSYVFPAIFAAPLLVLKCTGTDTALTVWASSRCV
                     QAFIFFAHDCTMLALAQRLDDLRRCLNSRRSGRHAFSAPLSSTVSESTGAKCRTPTIA
                     STTLAMVVVEWFLINTGVRSYSNVPESLFFLLSLYQTSYPLFLLWAGVACAMRVTAAF
                     AALPVFIVHAWRLCGEMGVARCLLIAFTTVGMVVGISAGVCFVDYIFYHRLVFTPYNF
                     LKFNYLLGVSKYYGVHAPYWYFVTLPAMAAPFVFFLVWMPVCWCWMQEAEKHHMSGSA
                     PHAQSTLFSGSSSRTLRQEIKRWAFVGAPTLMIYSSLEHKEMRFVYFLLPLLLLISSV
                     VVVFLCTSSLSALKQSSRVRRRSWCLAVPSADMVRRLFTLSWAASAVFTIALLYGYRR
                     GAPTLFREIRGADRHFGHLETLAHCYRTPGFAQLHGKVDRLEWVDCRMRLDAVSGVPV
                     VTQDRLFTEQPKAYALWRYLRVASRLDVEDGGKESVGKLSKDAWWREMLRVMPKGEAP
                     ALPDAIILFQNTAILLEADLLRPMGYRRLVVVFHSLHSFEEHEDRYLELWSRETAQKS
                     ES"
     gene            <461349..>462113
                     /locus_tag="LDBPK_361270"
                     /db_xref="GeneID:13388128"
     mRNA            <461349..>462113
                     /locus_tag="LDBPK_361270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865195.1"
                     /db_xref="GeneID:13388128"
     CDS             461349..462113
                     /locus_tag="LDBPK_361270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865243.1"
                     /db_xref="GeneID:13388128"
                     /db_xref="UniProtKB/TrEMBL:E9BTI6"
                     /translation="MATSSPRTAISSSSAMKQYLQQAAEDDVVCAFGPDYFHGARAGA
                     CVGSLFSATLCWYTFRLLKEDQREADFLAGLRQGQRNRHFSTWTLLRGLRTQPMLTTG
                     CIALATTSAMKCIKCYLANQRCREFFIDDVQFDMISELSETDSYAAAFLSTVFHNATG
                     CGAGAHDAFTTLREDRSEGQPTQSPAPRASASTSTVNDLLHAHISKLDSEKVALIHRA
                     PTYYDGVAVAFLGSVLDCYLPQKPVQRYYSMRAGTW"
     gene            <462670..>464160
                     /locus_tag="LDBPK_361280"
                     /db_xref="GeneID:13388129"
     mRNA            <462670..>464160
                     /locus_tag="LDBPK_361280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865196.1"
                     /db_xref="GeneID:13388129"
     CDS             462670..464160
                     /locus_tag="LDBPK_361280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865244.1"
                     /db_xref="GeneID:13388129"
                     /db_xref="UniProtKB/TrEMBL:E9BTI7"
                     /translation="MESSTDRATTRPLGAETAAHATRETNDVDSEDGMLGSPLQLDSS
                     TMGTAELNSALESLSSATVPNTASCIQNNLSLAQNFLADKGDTTTKSWSADYDDAAAP
                     LWQRYTTQGERQHFSVSSVTGKHGSSVRGAENVKVCVKAPAGGQETLLPGGVPPTTAS
                     FATKCDTSHVAAPTREFSATWSPQGLLGGTPETLDARPAVDDASSMVAVVLGEEVPDD
                     LPRAPSAYTEPRSCPSTPLVNTIHLNLQYTRVTSFMSISSPFSASVQSISFLRTSVQH
                     LMSNSQHFYASSSSCAAANEVPLFGEVGAAEPRPLCASLPETGSVAAQSALEPAKLRA
                     VTFAHSSVEARDSSEGIPLIDPSAMSAADNASTAQEASPHNPGAPTLPCTPVARRAVN
                     TSVERCLVEEEQERTELVEDQASGFETILAHEVSAYLAMSRQQRMIARQRSECAGVTE
                     QRKSVEEEASQLHDSMRARMRMAEDEHENFMSNYRPIQQVQLHSAG"
     gene            <465971..>467725
                     /locus_tag="LDBPK_361290"
                     /db_xref="GeneID:13388130"
     mRNA            <465971..>467725
                     /locus_tag="LDBPK_361290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865197.1"
                     /db_xref="GeneID:13388130"
     CDS             465971..467725
                     /locus_tag="LDBPK_361290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865245.1"
                     /db_xref="GeneID:13388130"
                     /db_xref="GOA:E9BTI8"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9BTI8"
                     /translation="MNAFPLQHKMMQRLKLPYIHVGTCEVMNLASSYNMDSFSVFNGK
                     NRGLYQSTAAAAAQRAATTPTDGTAAWSLSQCQEPFLGEMVAGGLLDSYTGREASTFV
                     SSYLAKALSMHTVLPTELRILRKEDPSDPLLAIMMAALARRRGMHTESGSLVTEWELQ
                     QYAISADAAFFRACKAGRRPPYLSSAQEKRGRDAGAEDPRPSPLPPEESGCRGVWFSA
                     TVTPTWLAEQQRQALTEHKQRLAPSPQRILACAEAADEREVRELLAHTPFCLDVAVGC
                     VGNSRAFGVARNALTGGMQSRLDASRERTVPLSIDHSPLRTSEYRRVVQAGGIVDSTV
                     GDMIDGNPYYNVARSFGHWSMKKDGRRSPVEQKMIALPTVKTWRMLAGDALVLCNHAV
                     FETRHQDDSSMDELAKVVGRGLSLDLPPEAIAASLCDFAVRFGAEHSLQVMVAVAGPA
                     AGTAPCAASGDDSGMSVPEFSEWVDPGPLYLGACQRFPELRRRLQQDCARCEMTLASL
                     IRRRWERVRDLLPTRHSLSLLPYYGKECGALQQIMEEEAIFFEHEILRDVTDVNDPRL
                     DAVFQKLAKRLQPSAPVA"
     gene            <468261..>470582
                     /locus_tag="LDBPK_361300"
                     /db_xref="GeneID:13388131"
     mRNA            <468261..>470582
                     /locus_tag="LDBPK_361300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865198.1"
                     /db_xref="GeneID:13388131"
     CDS             468261..470582
                     /locus_tag="LDBPK_361300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865246.1"
                     /db_xref="GeneID:13388131"
                     /db_xref="UniProtKB/TrEMBL:E9BTI9"
                     /translation="MRCSSSTPTATPTVARSSNLRHYRALLQVMTYASQREQTAEQVV
                     RDAMVGGVVVPFTVTHNANAPAVAMKTGDSPCITPLDAPVSGDSSSREEVGIITLLMP
                     SSKFIGTAASLLADGFFSFAPLSSTVDKSRSTSYQHRSECQVRDLFTLIMLLFPDCFI
                     AETLPRTLLEMREAEGSVSETQSSNRAESEVQHPSSVSRVSPPISPTPPILPRGRCTP
                     SAQRIQMSVTEGRGIAVDAESTSNSVDDATVGGLQAAPLEGSLGVLTPAKLVTTDAGA
                     TDGERLGVSSASASMTANMMPLPIVSAVPLSLDVLDVLLESRRSLAVVLLSLINDALR
                     EVQYRQLEQSHTSATATRSTAAARLPSCEGGVLQFSAEVLLTAKLLLMSVISASALWR
                     QRFSKTMESTKAVLQGAALLPSPPPSPFHVFSELLGEDAEGATPFLTLPVERWSWGKE
                     KDALGQWYDRLLDRLLAATDGAGVRVDAYLKSAKSTAVSCGRSVSAFPALLLHRPSDG
                     QPAVEMSLASVARLSGSVRLPSLPIQQGELHLLLCPGVPEGKTGLLQARGHELLLDAT
                     ASPTADFFQACVSSAFTEAQLQPSGDAVPRLFRQRFTDLSSTEQGIVTAALCDPATLS
                     VVLEKNAAMLARLTLWCRNRWPPSLDASTMLASTTSQSDDVVKENEGPKAAHSIGDQV
                     EQHILFQRPFSAAVGRYVRELVTLRGLSKDVLEAWMRHVCTGADAATGAAVDGSIPSP
                     HRAMFSALVKFAVLHNRWRLNPEVEALQKEYAM"
     gene            <472335..>472907
                     /locus_tag="LDBPK_361310"
                     /db_xref="GeneID:13388132"
     mRNA            <472335..>472907
                     /locus_tag="LDBPK_361310"
                     /product="40S ribosomal protein S9, putative"
                     /transcript_id="XM_003865199.1"
                     /db_xref="GeneID:13388132"
     CDS             472335..472907
                     /locus_tag="LDBPK_361310"
                     /codon_start=1
                     /product="40S ribosomal protein S9, putative"
                     /protein_id="XP_003865247.1"
                     /db_xref="GeneID:13388132"
                     /db_xref="GOA:E9BTJ0"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ0"
                     /translation="MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRV
                     NMTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPD
                     ILERRLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIAFADA
                     SPFGNGRPGRVKRVRAKAAKRHAGGGDDDE"
     gene            <473844..>474959
                     /locus_tag="LDBPK_361320"
                     /db_xref="GeneID:13388133"
     mRNA            <473844..>474959
                     /locus_tag="LDBPK_361320"
                     /product="fructose-1,6-bisphosphate aldolase"
                     /transcript_id="XM_003865200.1"
                     /db_xref="GeneID:13388133"
     CDS             473844..474959
                     /locus_tag="LDBPK_361320"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphate aldolase"
                     /protein_id="XP_003865248.1"
                     /db_xref="GeneID:13388133"
                     /db_xref="GOA:E9BTJ1"
                     /db_xref="InterPro:IPR000741"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR029768"
                     /db_xref="InterPro:IPR029769"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ1"
                     /translation="MSRVTIFQSQLPACNRLKTPYESELIATVKKLTTPGKGLLAADE
                     SIGSCTKRFEPIGLSNTEEHRRQYRALMLEAEGFEQYISGVILHEETVGQKASNGQTF
                     PEYLTARGVVPGIKTDMGLCPLLEGAEGEQMTEGLDGYVKRASAYYKKGCRFCKWRNV
                     YKIQNGTVSESAVRFNAETLARYAILSQISGLVPIVEPEVMIDGKHDIDTCQRVSEHV
                     WREVVAALQRHGVIWEGCLLKPNMVVPGAESGQTAAPAQVAHYTVMTLARTMPAMLPG
                     VMFLSGGLSEVQASEYLNAINNSPLPRPYFLSFSYARALQSSALKAWGGKDSGVAAGR
                     RAFLHRARMNSMAQLGKYKRADDDASSSSLYVKGNTY"
     gene            <475562..>475984
                     /locus_tag="LDBPK_361330"
                     /db_xref="GeneID:13388134"
     mRNA            <475562..>475984
                     /locus_tag="LDBPK_361330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003865201.1"
                     /db_xref="GeneID:13388134"
     CDS             475562..>475984
                     /locus_tag="LDBPK_361330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003865249.1"
                     /db_xref="GeneID:13388134"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ2"
                     /translation="MEILSLPSLRAYTYTSIYIDIYIYIYIFARYWWHRCVCTGPLCW
                     FSFFSFPFFLFFFFYSSLWRCIPSYIQAGTRVHTRTCTHKEKKRNEVGLFVHLFECVP
                     SKAKKRNTTTKELKKERRKEESCWKNDASTILKKKEHSV"
     gap             475985..476083
                     /estimated_length=99
     gap             477019..477117
                     /estimated_length=99
     gap             478904..479002
                     /estimated_length=99
     gene            <480654..>481235
                     /locus_tag="LDBPK_361340"
                     /db_xref="GeneID:13388135"
     mRNA            <480654..>481235
                     /locus_tag="LDBPK_361340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865202.1"
                     /db_xref="GeneID:13388135"
     CDS             480654..481235
                     /locus_tag="LDBPK_361340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865250.1"
                     /db_xref="GeneID:13388135"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ3"
                     /translation="MIENYDTITAGKRLTPEDLDQHIKRLTAPRREVELRDPFEVCPT
                     KRISPEALSRMTDRLYTQSLQHKQERLAAAEQAAYGAHTRGTLLRSAPLSPQDQETSV
                     RRLFNDALERKQTNMEQLRRQHQYHRPTNETKVPLNMFVQHMYYDRLEAKKKTEKRLY
                     DTYLAPTEIHTGTISREKADEASNRLCTTKAGA"
     gene            <481719..>483545
                     /locus_tag="LDBPK_361350"
                     /db_xref="GeneID:13388136"
     mRNA            <481719..>483545
                     /locus_tag="LDBPK_361350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865203.1"
                     /db_xref="GeneID:13388136"
     CDS             481719..483545
                     /locus_tag="LDBPK_361350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865251.1"
                     /db_xref="GeneID:13388136"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ4"
                     /translation="MYIIFHTAATHYWLRSRHTRRHLKRRGPSHPTPFVFPFLFLPTA
                     YCECNRPRPSPTRADHPVFDMADAAAYLKLGKKIQSSRFGRAGVAREEATVIKNDGCA
                     AAASDGGTPGIDVTSNSTTSGLVVVQVNDAQREVQQLPMKKKRVAKRSRSGSDEKDRP
                     AAPPAKSNSMVNATPATSTGQPPSEDLSTRGVVFEDGLNLTNVASPTAPVPPVEGVAQ
                     RINLMAKWFPASLQERKLDAAVAPSMMFVEATVDRVNKMREYVLILRYGIEDVEALLE
                     ESRQTQSNVWGKESADGNSTHQRPRREYWDLSSSEVRELVRSVGLPTFAQALAEFSDA
                     VFGSHWSAAAAVYRLLSRRRRVCAPMDYNIKAWHEYLNTHGPEGGRPPRLSDVLWLSA
                     ASTSAMFTATASRLLRGARCCAEQISVSDASLDDRASCTASEGDSGPSDRPRFFDNTE
                     TAAEENEPVSTRVWLMSAPVIFPPTLSHEQRAVLSFLRFLMPTSHSLRERTTSVGYGV
                     WLFAAFSALDIPLDPDTDRLAHDLFRTCCRHLRTLAAWQGVSGSTRDLLLSKLHPRRP
                     DAAPPLYTSLDDIRREDVLALYTIVVVLARFFRQNQDHFMPL"
     gene            <485057..>485830
                     /locus_tag="LDBPK_361360"
                     /db_xref="GeneID:13388137"
     mRNA            <485057..>485830
                     /locus_tag="LDBPK_361360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865204.1"
                     /db_xref="GeneID:13388137"
     CDS             485057..485830
                     /locus_tag="LDBPK_361360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865252.1"
                     /db_xref="GeneID:13388137"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ5"
                     /translation="MFTLLCCADLAGNKVNLEIALETFPATLRCLESDIARIFSREVE
                     ESGTVEHRTNVAEPFQVMSVVIYDDVLLRWTKLKSLAQLHEYDQLYVFQPQTQWHVDL
                     QKELPPPRPPARSRASSLTGTSGALASLHVNGRASSPWPRSGLSTRVSAAADVDTSHS
                     PVPSRSPARAQLEEHRREEERLAHRLATLRRERELLEREAQREEEEERRRRSLETYRL
                     LKCKEEEIWSQRDALARAEEEFRQFLAEKQRLMGQSPTP"
     gene            <486671..>487939
                     /locus_tag="LDBPK_361370"
                     /db_xref="GeneID:13388138"
     mRNA            <486671..>487939
                     /locus_tag="LDBPK_361370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865205.1"
                     /db_xref="GeneID:13388138"
     CDS             486671..487939
                     /locus_tag="LDBPK_361370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865253.1"
                     /db_xref="GeneID:13388138"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ6"
                     /translation="MSCGSYAAFHSLGNALRRPKSDYSISLEARGRSEKKIPHKSTSA
                     SSYTAVEQTGPHRSSPRWSFVRETAGVMQPATAVARRAPALLSTPRDQRTPTPQHAQT
                     SPRSEQHVTIAGSDAYMDEAASALLSELQQVVVRVSHQMVEERRRAAQQRKQICALEV
                     IVAEQEAMLDALRAQRDAAQCENSRLLKSYQQKLRWRGADPVQAARRSPDICGTSGTR
                     VSAAQVDNVVQAEFRRLSTISEPCSFSGFDDVSPGVAAVLRSLATQVLQLQGAAQKDE
                     LEACNISKDAQPAPVQPHAASSSLRASARATSTSSLLPAFNRSAPADDHGKAGVVDRV
                     TPVAALEKRKKASVFAAATAGPNYSPSERAGHTNGEEAELHCVDLDAGTNGDAHAAAC
                     MASEASASVGSSVCEDAASILSDIRARYGL"
     gene            <488833..>489780
                     /locus_tag="LDBPK_361380"
                     /db_xref="GeneID:13388139"
     mRNA            <488833..>489780
                     /locus_tag="LDBPK_361380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865206.1"
                     /db_xref="GeneID:13388139"
     CDS             488833..489780
                     /locus_tag="LDBPK_361380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865254.1"
                     /db_xref="GeneID:13388139"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ7"
                     /translation="MSARRWCATPPPHGTGSSGSQSIDEEAVVRAAKWSSSNFEERLG
                     FRAGETITEERLKRHYRILAKHYHPDTSAGSGSSNGVGCEGETSAGRDGAFQSIKEAY
                     DVVNAAVKQGGRRGGNASRGFSAEDFAGGFEFSDEARRRSQMRLLGDAVLLFVFMTVA
                     FIGIVSSHNKSRMQSRYLWHLVGIFFIIQLFPRLFAAAILFAVHSMHLLEKATLQEQA
                     AISLIVERTENACSVQLDGLRTEAQPNVVVQVTTTADADNEAAERVSSTLTFDKGVTA
                     FTLPVPVNLSCVYHVKAVDEARKIVLVDRSLSARMPATV"
     gene            <490737..>492872
                     /locus_tag="LDBPK_361390"
                     /db_xref="GeneID:13388140"
     mRNA            <490737..>492872
                     /locus_tag="LDBPK_361390"
                     /product="N-acetyltransferase subunit Nat1, putative"
                     /transcript_id="XM_003865207.1"
                     /db_xref="GeneID:13388140"
     CDS             490737..492872
                     /locus_tag="LDBPK_361390"
                     /codon_start=1
                     /product="N-acetyltransferase subunit Nat1, putative"
                     /protein_id="XP_003865255.1"
                     /db_xref="GeneID:13388140"
                     /db_xref="GOA:E9BTJ8"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ8"
                     /translation="MSSAPSTLSADQQRLFDRMNREYSNREYSKALRTSECILRVVPD
                     HVDTFAGRGLVLYNMERQEEGYESIKQAILLNPKSMVAWHALGMCQRLDKKFGEAVKA
                     FKRALTFDPANTEVLRDLASACIQVRDWPLFLEAREKMVTAKASVRANWVALSCGHRI
                     LGHSRIAAAVMDTMTSIMDAGDNPVEVSEAQLYRVELELESGAPQRALELLKKHDSEI
                     IDVETKLLLRAKAHAQLGQRMEAEKRYIEVISMGVSEADSIAALAHLRKIPLDRYLRP
                     AAGYTEKYMEIIDRVLKACPKCDYAKRHALDCVPIAEFSERLAAFATPYIQRMIPSLF
                     SVLKSLYVDAERAAIIGDVFAMMERELEAKDFSRFGGEANPCYILWVCTFLASHYRRT
                     GEYALAHAYIEKAINHTPTLELLYLEKAKIFAREGKTAEAAEQADLARRLDLQDKYLN
                     SKAAKYYFRDNQVERGEATMQLFYKPSVVAGDTYLTALESQCYWYEREVGEAFYRRGD
                     YISALQNLLMFERHHEQNHCELSDFHNYVFRRNTMRPWFDVLDCDDNMGRNKFFLKFC
                     PAIVRTYMRIHEKGEEAVRAAHVPRPELKFDAIAADEVKRMKQQQKDYYISDVDLSEP
                     LVKASRYMGYLLAHRNTQASTHTLAIELYTAAAKPLLVARSLLSLHRQRYNKTKELAV
                     AFKTGLYTTTTMDSRVQAVVDEILATLLE"
     gene            <493628..>494488
                     /locus_tag="LDBPK_361400"
                     /db_xref="GeneID:13388141"
     mRNA            <493628..>494488
                     /locus_tag="LDBPK_361400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865208.1"
                     /db_xref="GeneID:13388141"
     CDS             493628..494488
                     /locus_tag="LDBPK_361400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865256.1"
                     /db_xref="GeneID:13388141"
                     /db_xref="GOA:E9BTJ9"
                     /db_xref="InterPro:IPR001510"
                     /db_xref="InterPro:IPR019406"
                     /db_xref="UniProtKB/TrEMBL:E9BTJ9"
                     /translation="MSYVRVMIDRNQRISLSASAFFFLTHASLRHGELLPKQKVQRRR
                     KSAMPKLCVEYSKSGRAKCSNTSCGKKIEKHELRIGTEVIMPFSEEGVESWKWRHLCC
                     FTERQLSNARSSGDIDAIQGEGDLAPADKALVQKMREGRLVGDTSILGRIGDIAHSAV
                     SEELKGKGSKATKPKAKASGSADDGGLPSASAGEKRPPAPPRKTKIPNTKKQDDDADS
                     EATEEYEVAVEAVTGKPKCPYGAHCFRTTEEHFRQYTHGDDNGTAADAAVPSDHSSAK
                     LKPVIKRRKL"
     gap             495923..496021
                     /estimated_length=99
     gap             497356..497495
                     /estimated_length=140
     gap             498241..498339
                     /estimated_length=99
     gene            complement(<500831..>501493)
                     /locus_tag="LDBPK_361410"
                     /db_xref="GeneID:13388142"
     mRNA            complement(<500831..>501493)
                     /locus_tag="LDBPK_361410"
                     /product="adenylate kinase, putative"
                     /transcript_id="XM_003865209.1"
                     /db_xref="GeneID:13388142"
     CDS             complement(500831..501493)
                     /locus_tag="LDBPK_361410"
                     /codon_start=1
                     /product="adenylate kinase, putative"
                     /protein_id="XP_003865257.1"
                     /db_xref="GeneID:13388142"
                     /db_xref="GOA:E9BTK0"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTK0"
                     /translation="MPLFIILFGPPGSGKGTVSHLLVKEYGFVHLSAGNLLREEVLKK
                     SPLGLRCAEIMSEGSLIPDELVVDLVCNRLSEPAAQKHGILLDGFPRTLRQAEVLRAR
                     GFKFDMMILLDVSPEILLNRCLSRRLDPVTGRIYNLKSDPPSPDVVDRLQIRSDDTKE
                     KHERRMQIYNSQKATLIAHYSDIIIEIDADPEINVVFKELQKKINKRLQGTTTQVPLA
                     KL"
     gene            complement(<502978..>505332)
                     /locus_tag="LDBPK_361420"
                     /db_xref="GeneID:13388143"
     mRNA            complement(<502978..>505332)
                     /locus_tag="LDBPK_361420"
                     /product="Transitional endoplasmic reticulum ATPase,
                     putative"
                     /transcript_id="XM_003865210.1"
                     /db_xref="GeneID:13388143"
     CDS             complement(502978..505332)
                     /locus_tag="LDBPK_361420"
                     /codon_start=1
                     /product="Transitional endoplasmic reticulum ATPase,
                     putative"
                     /protein_id="XP_003865258.1"
                     /db_xref="GeneID:13388143"
                     /db_xref="GOA:E9BTK1"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR005938"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:E9BTK1"
                     /translation="MADAVGNTNSKVKLNKLIVEEPYNDDNSVVSLNPKRMEELNIFR
                     GDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKDVPYG
                     NRVHLLPIDDTVENLTGDLFENFLKPYFLESYRPVKKGDSFVCRGAMRSVEFKVVEVD
                     PGDYCIVSPDTIIHSEGDPIHRDDEEALDGVGYDDIGGCRKQLNQIREMVELPIRHPE
                     LFKNIGIKPPRGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKMAGESESNL
                     RKAFEEAEKNAPAIIFIDEIDSIAPKREKAQGEVEKRIVSQLLTLMDGMKSRSQVIVM
                     AATNRPNTIDPALRRFGRFDRELDIGVPDETGRLEIIRIHTKNMKLADDIDLEKVAKD
                     SHGFVGADLAQLCTEAAMQCIREKLSIIDWEDDTIDVEVMNAMCVTQEHFREAMAKTN
                     PSALRETQVETPNVVWEDVGGLLDVKRELQELVQYPVEYPWKFEKYGMSPPKGVLFYG
                     PPGCGKTLLAKAIATECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFF
                     DELDSVAKSRGAHGDGGASDRVINQILTEMDGMNVKKNVFIIGATNRPDVLDPAIMRP
                     GRLDQLIYIPLPDKASRVAIIKASFRKSPLASDVDVDQIAAATHGFSGADLSGICQRA
                     CKMAIRESINKEIQLEELKKIGQLDENADIDPVPEITRAHVEEAMRGARRSVSDADIR
                     RYDMFKTSLQQSRTFGASNPPPAEAGAPAGSGAPPPADDDDLYS"
     gene            complement(<508407..>510224)
                     /locus_tag="LDBPK_361430"
                     /db_xref="GeneID:13388144"
     mRNA            complement(<508407..>510224)
                     /locus_tag="LDBPK_361430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865211.1"
                     /db_xref="GeneID:13388144"
     CDS             complement(508407..510224)
                     /locus_tag="LDBPK_361430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865259.1"
                     /db_xref="GeneID:13388144"
                     /db_xref="GOA:E9BTK2"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BTK2"
                     /translation="MHMCSHRLSFPPRRGTRLVSEGLKLDLQVERHTSLARRVRRRLC
                     THKTRAGKLVPMTSTLTNSNRINIPAVCRLRERNTNKTVGSGVLVAPGLLLTSATAIP
                     TQSRATHVVATFFEGTKKSAVDVQLQPQRYYFASRYPPEMDYCLISCEEAPLFNVTPV
                     HMALTEKGWAPVEEGDVVLIVEHPIGDVAGTAAAPLDGKATFSSTLSATGEGNFDSVQ
                     APYVEQKRFEEVLRCRGNVSFLKSNGGWRTAGCPAFNEHGQLVGLQSQSRADGEGVVN
                     RILSLISIVKHLFANVQLPHLPQEDVTFEDVWDTWYLTNDITRIIAILANFKGKSMTR
                     QVIWRLCELTAKPQLVKSIASNGGIEVILQNLSLFCSDEKLSEIGLRALWNVSIGEEA
                     HLATIIKKEGVHTILDVVESFPANETVLEFGAVLLHNIVGCRAAPNFSEAHGARALKA
                     LYPGFQQFRESVVLQKFALSFFATLARLSEEFARDLVQQHVIEHITHLIEEKPKQIFL
                     MEIVVGFVAELAQYPHTVELMCNNTPEYAAASMAYLIDLLIHIILEYKDLDSLLVSGN
                     RALWGLGNVPTCRGIILENPRGIDALRISLPALIASTHR"
     gene            complement(<510888..>514220)
                     /locus_tag="LDBPK_361440"
                     /db_xref="GeneID:13388145"
     mRNA            complement(<510888..>514220)
                     /locus_tag="LDBPK_361440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865212.1"
                     /db_xref="GeneID:13388145"
     CDS             complement(510888..514220)
                     /locus_tag="LDBPK_361440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865260.1"
                     /db_xref="GeneID:13388145"
                     /db_xref="UniProtKB/TrEMBL:E9BTK3"
                     /translation="MRFSIVGGPLASTISLEAKQSDSFESIFKKVQEAAGKATPLDAY
                     DLYTTRRSSLTGELVAAAGPLRPTDTPSALQLDFEQSDSHILMLMQSGADAERGSTQN
                     QLLCSTAAAGDASRLDGTTIASTSPSLMTTPRATDEYRRRMRAMYIKYDPGQIHKVEV
                     ALDRYRGYEEDVLQQLVKRYGPEPALGEVDLSPKALVLPSSGPDARESTQSHSASADE
                     ANPHTKPSYYDRLVAIYSTYEPAKLSKVNGTLRRYAGREEEVIQQLVKKYGPEPSTER
                     VATTKVPEAAREQLAPASGVGRQLTSLATHAEASAHASPAVPAVEKQVAAVPEVKEGA
                     AVPLITTAKVVAATIPAAPPVASAYGDSTVGTQLPNTDRRPLATVTSPLDGSLPRHTA
                     ASTAVAPPNKASAAESMAIGGNYRERLVAFYNAYNPAKLHTVDGTLKKFSGKEEVAIQ
                     QLVRRYGAEPAPLNREEAHRLLTTAGAGGVSNTPPSASPTTTNAPGSAASSVGRVESI
                     LETYKSGEEEVMAQSEVRYAAQCAKNIAGEPTTSGASSSAESGSFGAVVAFAQVSAAA
                     PSIAVSVPPSHWNSASGTASASTPSTVASTTAASPVSPAVALVATPQTTRVGTVVPAA
                     AAVPHTEESKASQGGPPQRKALPLAALRVAAAHVEGTAHMSLRERYWAIWRTHHAQKR
                     AAVLLQQELWVEVPGGAAGRYRLNDSVEPAYTVANLSVVVAQEEGGGCSAQGRALTSE
                     LQIAMRALLASLRHCVESRVIQAQSSEEHQQADALLTHWAAPENLCPVTDSPELACAL
                     HQAAHLIGKLEDLVTVIRTQAGQLRQLKALHRDVLERMEHAHANTQALGRLQAQLSAA
                     NSDRRALEQELKRISAGGAESHARPAALCRLYPTAEERKDAQIAKLQQELAKTRNLLF
                     LSKEAEDKLKVQLQLSHTREARRKHEEWHRQGKSSRYSISDRAYAQPRSRSARAGSGA
                     HSSPSNSPYRRYTPVSTPRGAFSYAIAHDTPRGPSTLQVHVNGHPVSSIRRPDAATAE
                     QDRTSISVNSSTPWPSSRYVMTPTEVERGPCPNCLTPLTSCCREESGTSSEKAAFCFS
                     CRRYFTFGELWTRDAREVMGQL"
     gene            complement(515072..515488)
                     /locus_tag="LDBPK_361450"
                     /pseudo
                     /db_xref="GeneID:13388146"
     misc_feature    complement(515072..515488)
                     /locus_tag="LDBPK_361450"
                     /pseudo
                     /db_xref="GeneID:13388146"
                     /db_xref="PSEUDO:CBZ38583.1"
     gap             516308..516760
                     /estimated_length=453
     gene            complement(<520943..>522295)
                     /locus_tag="LDBPK_361460"
                     /db_xref="GeneID:13388147"
     mRNA            complement(<520943..>522295)
                     /locus_tag="LDBPK_361460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865213.1"
                     /db_xref="GeneID:13388147"
     CDS             complement(520943..522295)
                     /locus_tag="LDBPK_361460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865261.1"
                     /db_xref="GeneID:13388147"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR023379"
                     /db_xref="UniProtKB/TrEMBL:E9BTK5"
                     /translation="MTESRWITEALVQFSASPIWLTPIDNFVDDNCCIFSNESEMQLE
                     YTVVHNKFKKLIDSLLTCFLMELGVSMETAVEALQSSLVVSAQTSEGRSEQQAAKKLL
                     KQIFNADNFSRFHTMMVKRNLELDILANAALSSDKVCGDGGAALSAEEVEKETPAPAR
                     VQRAIDLNGDVNEDDALRRAIEVSLQDDHAQQQVQAYKKACIQEDADLQMAAVEHQAN
                     REKAQLEAALQTQPAQKLSDGEHCRQNHVESINKQKKSQLQPIHDLAMPGTGQKGCEE
                     AEPQKADFNSPESPFPLPAQQVAAAPASVAAAESAPVAAPVSVPALPSIGQRQAALPA
                     IPSTVTASVSKSTPSAPAHPAHGTAVSATPAPAPAPTNEELEKRAQYMREQREKLLAR
                     NRASRQEQLSTFLQNNSSSTATSSSAALAATGAAQSVTVEIARRLRGDLIGEARKSSG
                     "
     gene            complement(<523858..>526476)
                     /locus_tag="LDBPK_361470"
                     /db_xref="GeneID:13388148"
     mRNA            complement(<523858..>526476)
                     /locus_tag="LDBPK_361470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865214.1"
                     /db_xref="GeneID:13388148"
     CDS             complement(523858..526476)
                     /locus_tag="LDBPK_361470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865262.1"
                     /db_xref="GeneID:13388148"
                     /db_xref="GOA:E9BTK6"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9BTK6"
                     /translation="MQAPQSLYQHSALLRATLRAPPAIPPLLRRHRLQTLSVPWRWNR
                     DYNSRPSDASAHQSPAQEDMLVRMLIQDAFHPASTSSLAKSCEDVAGGDEQSHSTTAG
                     TESRSCRPSQCDTPATEGGGAGDTLGTEVQTLGGGRPQPPPGVAPRSGMSAHVQDGLG
                     GREISGSPVRVDEAAASVTDSRAPNAAAEPFATIRRGKRGDYLLRALEWLCCACHTYN
                     SLTSSSATCRKCEAPAVTSYRSAFPPLRHVAIAPTAWVCQNCSHTNRQTGASAQPHAD
                     RAGVARAQREKFICDQCRASFGGVQDWVCPACDHFCPRAATQCPSCFADRPLAWTCHC
                     CDAGVQNSVFAVKCRGCGRERRQRYSNSVVRCTACRGWNDVRWELCAACMAPTESLLL
                     AREKRPGAEEATLPTPPLSESALGDTINVALAADSAGMLHSKTVAQATELLEAARTSG
                     TAATARGLRHDTQEPSSLSPSPPFSPVHADDKQPRVAVKLPDNAWWCFTCNVAHRRNV
                     TFCDICLESRDAMRLRNKKELAVMPASASSPSTDVTSSAVSSDPAALKDVVDVMIMPA
                     TAEGDWQCPYCRKLLRVTQHQCCGHRREVPYGYWLCDHCCSTNRNDRSLCLGCNERRE
                     SVCPWTCQECEWGNDAANAVCLQCGLPRTPCETAERGTTVSDDSALSTSISCAVCSAP
                     NHFEKTACYRCRARLRDVEWTCDACGHGHRTRNALRCEGCRAIRQFDLQEEVWLCEVC
                     TTPVFSGGEIPVRTHCPKCNAQRAPTATHYPSRWKCECGLFNRSRVTECPECGARRRL
                     ESLSTTATCPRCFRDTPIDIQEKCTYCSASLADCFSRWESNITLLADTPELAEACDES
                     EADEVPDDSDDDVVTA"
     gene            complement(<527913..>529598)
                     /locus_tag="LDBPK_361480"
                     /db_xref="GeneID:13388149"
     mRNA            complement(<527913..>529598)
                     /locus_tag="LDBPK_361480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865215.1"
                     /db_xref="GeneID:13388149"
     CDS             complement(527913..529598)
                     /locus_tag="LDBPK_361480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865263.1"
                     /db_xref="GeneID:13388149"
                     /db_xref="GOA:E9BTK7"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:E9BTK7"
                     /translation="MRPAVGTITQRVVQAAAVCYPWTPLWRVSLVASWCSSHFSRGCG
                     TRSARADSARPYTTLTRSLRQSWKSRSLRPWMCAKESCRAVNQGIRKECESCGTEKPQ
                     LLGWKCVGCSTINYAGVRKCKKCADAIDKSKEFWMCAVCHENNRVDEIEDNSRCGFCG
                     YDMAPHSVAEEEILRRATEKTLMLQQQQEHFDSVSYTEADEQFMNPLEGAEALDPTLR
                     AIHPGSEAPITGRVLKLSAVAPFVAGGVPETRHSPLHQRRKVHPALQTVLEGATAPEG
                     PPGFDWMCRNSSCGHINPGDEESCLRCGTHITPAEWECPLCASLNHLARSRCFYCKNR
                     IPVCWTCSACQGTTSIYDKACRGCGMDRPAAEPRTVRELERGGGDHVGGYVPQGNRAR
                     GEWYCSTCNALNFSRRTECFQCTSPRPAVPDQGVADPFSAAGWGGTDSPGAAAVAAPV
                     QHNNWMCAYCQASNFRTRHDCWKCGRTSERAEEWSSQALSPQYEREGFQEGANTKSAE
                     GAMNASWKSAGDWLCAKCYSKNFRNRLECYRCGARKHALPATRSSSVRKPVKL"
     gene            complement(<532014..>532649)
                     /locus_tag="LDBPK_361490"
                     /db_xref="GeneID:13388150"
     mRNA            complement(<532014..>532649)
                     /locus_tag="LDBPK_361490"
                     /product="translation elongation factor 1-beta, putative"
                     /transcript_id="XM_003865216.1"
                     /db_xref="GeneID:13388150"
     CDS             complement(532014..532649)
                     /locus_tag="LDBPK_361490"
                     /codon_start=1
                     /product="translation elongation factor 1-beta, putative"
                     /protein_id="XP_003865264.1"
                     /db_xref="GeneID:13388150"
                     /db_xref="GOA:E9BTK8"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:E9BTK8"
                     /translation="MSTLKEVNGRLNAQPFVSGFSPSSEDARIFNEMFGSNVNVIQWV
                     ARMASYYQAERDEILNAGTEKKATESAKKAAAPAPAAAAAAEEEDDIDLFGETTEEEK
                     AALEAKKAKDAEKKKAKKDVIAKSSILFDIKAWDDTIDLEALAQKLHAIQRDGLIWGD
                     HKLVPVAFGVKKLQQLIVIEDDKVSGDDLEEMIMGFEDEVQSMDIVAWNKI"
     gene            complement(<533572..>550383)
                     /locus_tag="LDBPK_361500"
                     /db_xref="GeneID:13388151"
     mRNA            complement(<533572..>550383)
                     /locus_tag="LDBPK_361500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865217.1"
                     /db_xref="GeneID:13388151"
     CDS             complement(533572..550383)
                     /locus_tag="LDBPK_361500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865265.1"
                     /db_xref="GeneID:13388151"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:E9BTK9"
                     /translation="MLEGHVAELLARHLSRFIKNVNASQLQISLWSGNVVLNNVELCS
                     DALERIAALLHGERSGVETKDAGASASAAAGTPSGSSKSHEGGSSSSTLSVRMLLAPF
                     TVVKGVIRQLAITVPWASLESEPVRVDVAGVELVLGPLRARPFNAREEQEREQAIKQR
                     QLERYEKERHRLSREGAEETVSETSSNMTASMESRHVKRGDGPAIAGTSRASGASWFS
                     WLWDFDRLSQIAVRNVRVNLQDVSMRCEFDYEGLHPSCASAFCVFVKQVQLTTADEKF
                     KDVFNKELLTPLCKKIALSEVVVSVHAIRQSPRGVFGSARESGNGPASSAASEPASCA
                     AAYDTYASRWALSAAILRVQTLQLQAKLVPPGCVSKNAIVEEMPILSASSTELRVTTA
                     DSIEVDVCFGVVQVLESMWRNYQQSLPCARYRKRLHLLRPTGGHATHTRVLRQASEPN
                     SVSLSQDAATAWRPSVQQRWRFALRCVLDDVRQHRQIFGLHEWKRCEVVEAMVQFGQL
                     RRVYTEYWKRAKGVIWAPPLSALEEKRLKSMERQLSLWQVIYLRCLSHAQLVVEQESY
                     ARQQDYIEEARQRIKSGLLSSSGNDGGGRPTSFLWDWLFGRSTRKNDTATLSRKSLAS
                     IASRDGVGVISVPTYRGFCFRDLVALEWDLGRRYTSPHYARLAHPRAPQNRLPELAAE
                     NRLYFTLRALFPKLIVRIDPIYWPLTYDSSVPATPSATPLQRVEQRLVAQLRAMELFY
                     TTIPDDRPEKASLSFFLGSASLTFEGALRSVLLQSKQQFREDYVVVKRNAQRTHIRVW
                     VAPQLVICQPTHEWAWWYAEVSAFVHWFRAVQRAFYVSGVPEASPGSMPALAESAQSD
                     LHGTASVGSRMSASSSCTSTPRGQSSQMATGTTVPRASPAPRVLNVTIQSLDVCVPLF
                     ARDIECTDLEIFSRQPSAFSSAALPGSLPGTVPRDSTLKCGESQRQLSTEIASGDGDA
                     GDGRPRDEATLQSGDAAPAALWLRTTDSIQSFAVEGDTDGEEYTDSSCSSPSASPDMF
                     ARVATERCFLKNETCLVLSVSTTRLWTVAPPTKRYKGTENEYCLCIGDQSKAVRVFCQ
                     NGHNTHTPTSSRQLELLSFVAGEVRLNPKELTVLLNKGIDAVADPCAFALVNDALLKP
                     TVLAAADAHGQAVRALTAEVRQAECRWSGTRGAAAPWRLATSTCVELRADSESPPVLR
                     EVPLDCARHILSALSAPLFIARSSATTADHAISRGELATGVFGGRVCTVGVCVARLLI
                     RSEANVDLGELVLVAPEHLPPTTEPYREALSALGAEEPRAIELICNFADSQWHAVERS
                     SYDPLPLCPAREKVCPRLLLSIPDITMTTTAGRKLLTIEHLTLVQTCTAPRKPEAALT
                     IQTVSAFCDIVLVELLEVLIGTMCTMRSIKLPPQAAPYVLTGALRSEAADSEMPQSRF
                     FGVLPISVRAHTARFQTPLSTDDVVDAPYVEVTTTIEDALCTLEPLTGGTGRGGKHMH
                     LRFSVPEAMQIADYIGGDPEVRSLISAYPWAACTGDGTAHALHCVVDVTLPGSCVGDT
                     DTSTLPRPGVPPSTTCRATLVGGAIHVYCPFLYFYAAAIKADERIVRLDELARSPLLR
                     HGYTHAPCFADGTPRSRVVGGARASREATTPLPLSVEATISDLDVVLATDAAVPIDMT
                     KPSTFCVVHVEQIVCMLQQITSASPGASATLETQTHASVDTNRVQLLDVLSAPSRDVC
                     LPDVKLRAHRGVLLVPKEDLTGYAYQRGAPDDWAFLVGVHPACAPYPQGTASVHEAAS
                     STASRPSDVTIRMSAQQCRSLVRFFLYNVTRLPIHSTRRTPRVGGDHLQRTSTPPATV
                     TFPMGGPKPLSSLYHGAEAPSHQQAALSPSVTLLLTIPAVSILIDTDDYVAPDRNARQ
                     SRMPRTTEEDESEFTAPAAPPPRLPSTRRVSYEVGLRRGGQLYSAAGGCWSTSPVKNG
                     QLSGLELVAREEKLENSTGDADVTETTSTHVLLTIDLVGMAFLERRAGRASSEVDDDA
                     RNDAAVVKVAAAVRHAHFRVPHIKWWLLLYSIFAGVCSTQGSRQSSAARTPGKSGSAG
                     TIARFGEAGQHGNEGASGEGSSAFGDHRGTSRGEYMDGDKGASPTRERHLASRQRRSR
                     RLHGTVEITHTEVSFCTVDCANGDRQPLCRLTVPEARLTASPLPALQEGGRAHVNNAG
                     RLYDKFVLEVPHCPELLLLCVSGESDGAAGLESQLSSGSSYASVLRRQSAEAPSTASA
                     APVVKSSFWRQATAATVTPASKPPLLPARSSEACISLGLVCFSDASSLRSLRYGRCYQ
                     VTDLTLHRTSVVQVRLQRMLLDIPAVLLFSLAREVVRQVMETQSIEGMKPHAHAAPRD
                     GRDAESPALTYIGIEAELTDVEVRLSAEAIPPGEPAASCDAGRGPVSWSVAIRSARLT
                     TSVQLQSVLTNTRMPASLIGDGLSRGWRVQIWHMIPQLVVQGVVVSTNSDTQAWRTLP
                     DVRIKVSLPLKRSIICVRGKGATAKDDGLELSSSADESALRWRHSSTANGFQMEPTAL
                     TALNGLHYHVLASLHVDVGAVGTAPGHDAASVQVRLSTIFTLISAAARLVALWRQTRR
                     TCESSVAAAVTAGTTSRHAGWWRPGARQRHGLITWYEFELGLSGRRLELIMDTAAATV
                     GEKAASALTNDCALCVSVGGAITVQVDREAGEEAAEPTTVFGIVQRDGGYNETMTECD
                     GRIDNEKAVVGGTHTLFRLRSAPVHVHDGAGNLLLHVSAVAQGGMADAMVADYASAEA
                     LLDINAGRVVIHASSLTAASMVCWWKAYRALKQRWESAVTCMRQSSTCPPEATRKPEL
                     AMGSEGGCKRCWLQQINVEVRHTELVLAPAARVCAQQAHTTFSPTDVGVGLDAAAALE
                     LRCEEVCMYSMLPQPGTAYGTAPIVLARTVSPVLVVTRAQKQRLLVQYRTPFVSIMNG
                     DNHSWALCAFRIAKVVTGTVTALAARAEVTPLHASESDPPTGGAASSWSAWIPRAEVE
                     IHKAELLCFAPHSKRTCSAAPVVCLEARQAVLHCVDSASLIESSSVGTVVGVRMESSA
                     VVSATYSSGPSTEVKAHPLLDDVKTTFVLSSSSQSASDPVEVTLSAAAATEQNAVCLR
                     LPAGDSLEKTVAALWLLARQKVPRRYAQARAAKDSAAPGDRVCCGAGTLWHVRANVPR
                     MLLRCVVASAAMSSSEQTLRHLCSISVDDVRAELRTRRGGNEGDDRRPHAEVWVGSVV
                     GKTVVTDAAEALNEQAMEMPSTFLELRPLVEPSGDRAPGAAPATGGATSTRSNNRAGF
                     SVVQRSLSLSTGGEEHGGAAQDIAADDATALVIRLHALHVHPSMRFLKMLMEHALHPC
                     VAGISAANADASSTHILDDLEHTVLRVGSATAVLPASGALNRHAGRVRVVEVATDWQL
                     CEDLRLGGEGGFQLHFCGSAGRSVITVRGGGAGDEKVQGSAATIFLSLPVGANGEVCP
                     AIRVDPDMTVRFENVRVVVGEEAQAVRRDACVLEAYVELGERSLCLLPPPLVGVSASP
                     STAATDAQVEKAAARVSQANSGAAANDTAVPQVPTTSLWAVSTMFSVDVAVGFEVSLT
                     AGARRLAATGAAKGRYRFEEKRNAERTLRSEHEGECTIVLHTCLSESGPLTDTPVAAT
                     AQMCLTAAENQHRVMLDWGSTLWRLPLGHAHMLIELGRLAQQVLCQTFSPSPPRRPWH
                     PPAAGDGLARGPTRRATTLDVRANVPSWALTLTSDAGSALAILLVDHARLQCSTDMDV
                     SDVALTAEATVSLRDSIELDDESGEHQGATVRYAVERSSVASAPAPMAARVLFSAQPH
                     LYLSFTRFSPGCRSLSVSVQVDSVIATLPLVTAARLLRTSARETDVGKRVFWNDSGVE
                     MEVAESAPHAGAPLRSVSRWRLLAEPGRLLHTSIPASCAVVMLTPVAAPVSDVSSTAG
                     RKDDEGSDGVAVNLEALGDGTVARVSLPGYTSALGALDLIVRKSVRDRLEVVHLTSSV
                     VLANVFYAGPADGSAAAPAAAGIVSVTAHGARLTVPPRSARYVPLPLLRECLTLELDG
                     GAYAPAAKMLTWAMMADAMTLLADQAAGGGGETSGGLGNGAAVSPKSGAAAGFMLYGN
                     MDALGRDRGENDNGHGGTLRAPAFCERVRALDAFTLSFPMLLSPLTTIPVKPLCGDVA
                     GGGVNDATFASAPARQSEVAVSPTENTARNGRVVQLTWRRRCSRMVGPLFSGRLSPRE
                     YTVAVGPVWTLWNWTGCRLRLRLRTSRDGVVSSPVKAPQGTSSPQLSLLKSRSSDAVA
                     TADVENGACFQWTPTTLDALQGTVFAFFQLMVPSLAGGSTTLPNSPPSMQWWSVAAPI
                     SLQEPPPLYIRLQQGSDTTRGAVRIEQHGPSSVVVRCAALLRSALARPVYLRDAEQPQ
                     PLLGAGAHGCVLPQQQVPLFYSEYVTTFAPHADRVGFTVATNPVTSTGARNASLHESD
                     AYYLTTPVVAALLSAQELAYCTRFYTVSAVPDARFERSAATLHGKDEKDLGEQCVPAE
                     ALSCLWTPEPPTVVQLSSLCRIRNTHAHRTLLAMPFDASAPSNAEGATTALSMVTLIP
                     PGEEREVTEFCRHAKEPEMQFCYCTSGGNAPAHAWSPPVRLLSLATATQPLVLKHTCV
                     SRDLHEVESDAEAEEPRFIMNPVRRRVGEAVALAVEHFRCLTVMSSMTSVSLCVSVAL
                     QAAPPLKIVNRLNTTLQFAQCAVTTGSDVAPSPARRGTVTTALCSCAPRPCSYVVAAG
                     TMSYGCWEVPVLELPGLRVTLYSNVRQGFTVSQDVDLLRCAAAPSSGARVGSTDAYVY
                     VSLDNRRRQYTVTVASSRQLEGRMLFQPRRLTQLEVYVHSCTVYVAAMTLPRAGPFAR
                     KSLIAQGARGRLRLRRGASSGESANRDTVPLIATDEDVLTFLEEQELDVVLVRLLGFY
                     GSATLTERHLMGSASLALLEVVDCTTVDAAYPVILRVGPRAGSGSATTMAGNTVEPSA
                     EAEQGRASSPILPDVFGGGATLASSTGVPHFKDPSWFALEIQLTRPGQAAAADGVVLL
                     PVPRLRVTVPPIVVRADDDILFTLRATAERLGEEWSPAASSERAVHAAERRGSLFSTR
                     GDAVADSATHLPHRAYIVFVYALQVSPILAEVTYTRSGHWRYNPFKGLAQIPEHLIPS
                     VEDLSISLKEVRLQEVELRWSHSLFGIAKSFLWPLYRTQLLLQSYKVLGSMDVLGNPR
                     ALLGSWSRGVWDLVTNSSGQSRWTDTREFLRTTTSSTLHSVGVLARSIGNLAGTSPIT
                     VAPRLSCGSSSSDFSGHAVLATSQRRGVLGEVLHEVGGGISDAVTKPIRGAREGGVSG
                     FLIGIAAGVAGLAGRPVFGFFRGVSVTSEFYARLLGGLGELTEHEARHLGLERNYLIV
                     STSARGAPVSEATEGVEREVSGTSAAGHVNRVPRASLPRDQYILTYAMYDQVFADVPR
                     WRRGDETNVRLAVDRVGIYNTALHTPYAALCTFLSPSEFRNALPCALTALLAGNIISL
                     LARNCTVDSFRGSAGVDQGNDKAPDEPGTGEGQVTRARLAHECERASYIKASLGVRAL
                     HTYVTDEVFVHVCSLEEIEASLKETEAQQKYSRALARAICAAGERLLAP"
     gene            complement(<552319..>552786)
                     /locus_tag="LDBPK_361510"
                     /db_xref="GeneID:13388152"
     mRNA            complement(<552319..>552786)
                     /locus_tag="LDBPK_361510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865218.1"
                     /db_xref="GeneID:13388152"
     CDS             complement(552319..552786)
                     /locus_tag="LDBPK_361510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865266.1"
                     /db_xref="GeneID:13388152"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:E9BTL0"
                     /translation="MSAVASDDSAGHVVDPVQHTHRYIQEHKLNELFGHLLQLVLYHR
                     PDDPRAFLAEEVRRIREEKVSSSLFTERDLETMFETIDVTAQRWITVAQLRNTCRNLA
                     TASSAGTGSTGGGGLTAEQEAAIAGAGDAAGRVTMENFKGVLSSLLLTKNKWS"
     gene            complement(<553935..>555899)
                     /locus_tag="LDBPK_361520"
                     /db_xref="GeneID:13388153"
     mRNA            complement(<553935..>555899)
                     /locus_tag="LDBPK_361520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865219.1"
                     /db_xref="GeneID:13388153"
     CDS             complement(553935..555899)
                     /locus_tag="LDBPK_361520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865267.1"
                     /db_xref="GeneID:13388153"
                     /db_xref="UniProtKB/TrEMBL:E9BTL1"
                     /translation="MPSSRMADSTVDRDASAPAPRPNRDQEPFSEPAHESAKAADTLA
                     PTQRGDPRRGSAGSIRVIGFHAPGATSDSEHVCAVTTSSGHAAPLSLEARLAALRSRR
                     LAREARAIGAAASVVSASIVPAPLPVALAEPACNGVERPCLGHTLPTFPPPPGPLAPT
                     RTSTSPAGASAPAAQSAAAPFTFAPRAANDVNKAAAAVDATTLGDARSTRYATTSRAE
                     TPNAASCSSASVHADKAGQPAQVGRMASQRRFPSTTSAVMTTAFSESPVPNHASTAFS
                     VRGSPPSHAVGAAPMNNAKSEPAPQHSEQRSAAEVPSLRYHPINDTQAARRLFPNDTA
                     SSIYVSPLDTAADAIRGTSPEHVQGQHLSPLPALHPPCMSALAQDGGCLSSNTSTPER
                     ARLPSLVEMQTFLPTAISSSTGLPTASHGMVRRHGVHASLRRTTGGSPSSTDTAPIRP
                     FAPFARLITTPPRESCPSPQPLSDDKSWPSRRDFIVPSVCSHRDSPHTGCTQSKSHEC
                     SYPRRVTSAETTSSTEAWSARLRSSSAERDTSLSSAFSGKMPIFSPFRHRVIPSLTNR
                     VSSSPSRSHASARHSLLSSAVYTALLATTTRSKCKLLDDITTVSTEESAERDTIAEKL
                     AIQRRLSHLKSELTRQRMEQRRRGGHISTL"
     gene            complement(<556740..>560129)
                     /locus_tag="LDBPK_361530"
                     /db_xref="GeneID:13388154"
     mRNA            complement(<556740..>560129)
                     /locus_tag="LDBPK_361530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865220.1"
                     /db_xref="GeneID:13388154"
     CDS             complement(556740..560129)
                     /locus_tag="LDBPK_361530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865268.1"
                     /db_xref="GeneID:13388154"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:E9BTL2"
                     /translation="MSTSLRPSAPLAALPSSNLAASTPHPRNGNATASPALTMLPTLS
                     LDNALKRTTDDQGRQRDGAGAPDNNTSSAHRRSLIGVRGSVLPEKKGGLPKTGHIGVC
                     YHQNVYVFGGVNSKGQFSNHVFCYEKRTLQWREIRGVGVVPRGRANHAAVLIGNKIYI
                     HGGHRHLEVFDDFFAYEIETGRWEKIGCERSQGPGPIFLHSMVYIPPLDSLLVLGGIH
                     QREQNNCLGHLFDVRNRVWTGVPPPSSVDAQHLQMVTAAYHAPSAVVVVLGLMDADVM
                     QEGAVTTPHVHVFQPATFVWRRVDTSTAPMSPLPFRMEAMWESLLHFLIPGGGGVYDP
                     LLENWMFPLPSTETDSVGDDGAVDQSPSTPGFGLPPLPLNKYGFLVLDLRSMSWSLVP
                     CNLSRKLVAELNAVNRVTREKMERLVLRNNAAAAAIALSGNSSQSKSAVQQPADSGAL
                     LGISSASLTHGPSGVASRHSSVFRHQSSQWPRNESSSTNVPWPRATGSRAAMASGSND
                     GKMAALLSSSRYRRLFFFDDAPEFMRKYTLVVVRDEPTKSGKLRPLQYVVLHGGLTEP
                     MDYAMLMFAPILTRPHSNAATPTGRAGLMARSNSLRGRAAASVGSRRGSAYTQSRSEE
                     DGGYGDDSFDDVTSLLSSGTLIAAYSTQSNHRRTAPHTPLRDAEALAHLRGGRYSDDD
                     EYDTNVHERMDNGGAAHKSFLLPTLQSGRTRRNYYRFALQFTPGNSIQKESLLPYANI
                     PVAVLQTPKDVQKWSRNYYTDQRRWLSERIKEAMIEDRKLRRLRQLNKAQVATASGAQ
                     GNAAWAGSAGRDDSSNSESEFMDGLYLAETFIGDPRTHGGAKVSSLLAYEDQLALDAA
                     DAALTQAGAPKRRLRDFFEQHGLDAFEEADIQQQHERMQLRTALAGRGAKHDRRRKDA
                     RLKERAVVAEGANAKAAKRSETSPLVKKSSVSDGSMPLASEVQMTDSGFERLRMKGWQ
                     DVGRERMAAAVLHGSFINGLAGGTTGSELDFRKLAAYALLRRAIARLRADGNPYEMRR
                     RRAQLRWRYLRTLVCTGEAAYLLYLASQADFKMRGIMVTGTQGLMLAPELHFLSPLQA
                     YRVPCKPVPYNVAAASAPAPASSSRFAQVTASGMVVYHSLK"
     gene            complement(<560822..>562057)
                     /locus_tag="LDBPK_361540"
                     /db_xref="GeneID:13388155"
     mRNA            complement(<560822..>562057)
                     /locus_tag="LDBPK_361540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865221.1"
                     /db_xref="GeneID:13388155"
     CDS             complement(560822..562057)
                     /locus_tag="LDBPK_361540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865269.1"
                     /db_xref="GeneID:13388155"
                     /db_xref="UniProtKB/TrEMBL:E9BTL3"
                     /translation="MELLTRVFQRHPPALRLHRELTIALADGDSARAADLASVLATTV
                     QRVVAAEEADSSDAATPPEGPASTEHFSQSDIPVAGLEDVEEAVEKTRQALLHEATVQ
                     VSSGVARDTGGGAVSSAPAAAERSLPFWRDPERLCVTVLESTFETEVLGGESQDTLTP
                     AGNRAAEHEAEQVRILDAYLDKEDARWKAQKAAIAKIVLDVTRSLGLTPEDLQAFEGI
                     SASAGAGAAAAVGERKLNVLRHSNLVIRGEMPSAPLSNAASERVSEGVEAELRALEER
                     MSSLGQPLTPSEVRMARYELQMSKSKMRYVVGVHKELQLALDHSAALRASLREKSTAE
                     VTFSTGAEVFMAEVIRALNEGADAYSANVTAAGAQLTVSNVKAREAVESPVLPFTFML
                     KCSLWFTTAPPRPPSSSSD"
     gene            complement(<564022..>567624)
                     /locus_tag="LDBPK_361550"
                     /db_xref="GeneID:13388156"
     mRNA            complement(<564022..>567624)
                     /locus_tag="LDBPK_361550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865222.1"
                     /db_xref="GeneID:13388156"
     CDS             complement(564022..567624)
                     /locus_tag="LDBPK_361550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865270.1"
                     /db_xref="GeneID:13388156"
                     /db_xref="UniProtKB/TrEMBL:E9BTL4"
                     /translation="MEDEEELSMVVPVPGSGVSSQRAASEQSVHAGKSSAQDASTSAC
                     TAGTPFSRSRTPVPFRRAPSAARGSDEQDQVSIPTPSIQRMKPSMSPKVDESTAAPTQ
                     RPSGRSAASSTSIVFSGADSTTGTSILFASGDASSDRVMSGEVSPLSRSPCVAKKDKS
                     GNVAAPKPQTKYDEVAQDAAAVVDLTSDSSFDLHIEEDEQAEEPPAVAAAADEAPQDE
                     REPSKASKNPTPGSSKLASSISKKEATDKRVEKAGKSTSRATPAVPSAHPAPRGSRAR
                     RGAKVTVPSQQASAARASRGHPGTSSALERKANTPRAEQQLASSRDHDLVASPSPSSR
                     ISSSGGSLSHPESRGSVNSVGEESAERFPNRERHGDRRLRPTPAEDTEDDEDRRSIST
                     PERVVGHGASRNHKGVTSDTGERGRSSRARRGAANEHSRRAHSGPSRTDRCRGRELSR
                     EGHHHLSSRSPVRRHGSRRLTVESLHGGALAHECLMELWQHNREGDFDWPRPHRRRRS
                     GEAPPHHRCHCRSESSAEAPLHLCADHVPLHRVSYDDYTDNDVYAAAAVTSHERFGGL
                     TERFRRRSSREGGDDGYGAAAVQSARSAASSVFSGDDVEDKEELLTSSHVNDRRSSTR
                     GRRVDTELSPRSKARYADSRPGQTICRQELLRYDYGNRRASELRGGGSMHRRDGTAAR
                     DHRRRGAEWEPDYYYLNAPRKGYSLDSGGCGSSRCLQSCHSPRLAAPPARESPLLSRC
                     GIYRPDLPSDALSGEVRYQSLPPSASSPVRRHRARSAASGKQATPLRRASQSLASSVA
                     SISLPEKELLGEVEWKLDALEKQIADEDAERERVMMRSPFERLYHLNNRRDRDERRNK
                     VFQLNLLERIRDRIVSGSLKEDIARKEERLRKQEEMLTSPNGVFVRLYQNSSPRRSSN
                     VAVEGSDCKSAGEGNRDRRASVNTTGVSSQRASTARSRMSTAESQELCNRLYETAAIV
                     KQKKEAMRKQSVEKRQRQQAEELLIARLAGQIQLERSRARASSKRRPKTPAQLEDEAR
                     AELEKLREEDPEGYEKKVLRGRVLSPAERNMQAERLWKHGYISKAKLEAQKKVLELKK
                     CTFQPTINEFPASAGIAGREQTRSKGGGGANDAKHLSAGTDRAQRHRKADRFEELYHK
                     GMQAKVRGETLRDERDREARLSILRSRMVSDHHFRRRVELDPSLAERFMKSLVV"
     gene            complement(<569265..>572111)
                     /locus_tag="LDBPK_361560"
                     /db_xref="GeneID:13388157"
     mRNA            complement(<569265..>572111)
                     /locus_tag="LDBPK_361560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865223.1"
                     /db_xref="GeneID:13388157"
     CDS             complement(569265..572111)
                     /locus_tag="LDBPK_361560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865271.1"
                     /db_xref="GeneID:13388157"
                     /db_xref="UniProtKB/TrEMBL:E9BTL5"
                     /translation="MGIPDFVKFIARSSPSALCRVPKGSSRHEPLIFDFILIDATNAA
                     QTVGLDNLRAFLNPDHVVARSAVIFALDSQRDRSGTARAHRHALVGIGDLDVHVQKLC
                     GQLADAYRAQQGSNNGLGTGSRANPYVLTSGRGVAGEADYKLLDLQRCLVTCAIASGA
                     TVLPTFLFISEDSDVLCGVLCGPAPQQVSIATKLQDVLFEPSILRLDRVLAFVATCTD
                     AFYAASEEEEEAAAAAAAKMKAMAERNAAEPNRANSFATAPATKRAGKQHSDEEVELS
                     VKDTAVATATATAARDDGVVRRRKQDGPMVATGVRIELADSSDDDQPEHVETKPTKVP
                     TATAGATAKAPVSEMEEVPIDDGKYVKEASAAPTEGELLVSSITHTSCVDMVFLFMIV
                     MGNAVNVPSLVRGATKVDSGSCWQAYCKHKYKNLSTADAETGRALLTPSVNTHSTNRG
                     SLVLNCQFLHSILDAVHYADAEPRPPVEEEKSSAITYLSNAVYATLRYIVGCNLDKTP
                     TLKQTFLDSRPLSETAIMLPSLSAVMWVLGQEATRTFSFPLHGLAKKELLVAASGGAS
                     ATIDAANASSRLDANHATFARDASSSTSELDVGEHLVAPAASNAWAVRGARTSNVSLA
                     ALMQNFTSGVDGASSAARSGHYTAAGMRSAHLPSVREMLKKALQMVSPASLAKANLLF
                     SLMTVWAYALGLGVRRMATLTKAAASVAKAEVGESAFSSAHPPSLAGAAKASRATPGT
                     TPVGGHYVYSFELRRMAPVLQAATSQPPSSITAASGPSAIPGRVDSTASSSSEKSAAQ
                     QAIFAALGVSYDYSQTPRGPANVVNLPRCAVDEEDIAELQRLRKVAKKERTLSALVVD
                     AVPGKKRSANVDDNDGTLSDNDDGNIGRTTSRKRAEDTKNGTSKAKKRRGKRERLKQQ
                     KATAKAAAAEADGGSPRHVGRAARVNAPATAETS"
     gene            complement(<573024..>573548)
                     /locus_tag="LDBPK_361570"
                     /db_xref="GeneID:13388158"
     mRNA            complement(<573024..>573548)
                     /locus_tag="LDBPK_361570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865224.1"
                     /db_xref="GeneID:13388158"
     CDS             complement(573024..573548)
                     /locus_tag="LDBPK_361570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865272.1"
                     /db_xref="GeneID:13388158"
                     /db_xref="UniProtKB/TrEMBL:E9BTL6"
                     /translation="MLCRNLSSCCGAHRRCRPSLGVAFCALLVEPPQAAYLRRCAASS
                     RGTGTAALLSSDHALLSVCKRCEHTATMATPPKRDLTTKEQVDELMDSFAEACELITD
                     AKESVGTTYFADDMEDAEKQTQDVLNRWESLQAALEHKGTAEELQKVRNMYDLKIKQL
                     KAELETVREAGGAG"
     gap             574005..574535
                     /estimated_length=531
     gap             575229..575327
                     /estimated_length=99
     gap             576699..576924
                     /estimated_length=226
     gene            complement(<579486..>581018)
                     /locus_tag="LDBPK_361580"
                     /db_xref="GeneID:13388159"
     mRNA            complement(<579486..>581018)
                     /locus_tag="LDBPK_361580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865225.1"
                     /db_xref="GeneID:13388159"
     CDS             complement(579486..581018)
                     /locus_tag="LDBPK_361580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865273.1"
                     /db_xref="GeneID:13388159"
                     /db_xref="GOA:E9BTL7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BTL7"
                     /translation="MSGGNAGDAMIGRVCRNFPDTFAKDEATAREQDKKYWISRVLGS
                     GATGTVLCAKRVSDGEGFAVKCVDMEGMSEADKNRAQAEVDCLLNCDFFSIVKCHEDL
                     AKRDANNPEMVQMIALVLDYANAGDLRQEIKSRARTGRTFREHEAGLLFLQVLLAVHH
                     VHSKHMIHRDIKSANILLCSNGLVKLGDFGFSKMYANTVSDDVGRTFCGTPYYVAPEI
                     WRRCPYSKKADMFSLGVLLYELLTLKRPFDGANMHEVMHKTLAGRFDPLPSNISPEMR
                     DIVTALLSGDPGRRPSSSRLLNMPICKLFLSGLLEIVQTQPAFQGGLRDSISNQIQET
                     KRLLVTEKRHIQRMMEESSGSSVAASTTILEGATPLTTTLGGLTIHEGTVKKQSSDMV
                     WKKRYLCIRAELADGQTVLDMNPKFKTLDMVLAISKETMEQQCISTPFTELEDAFPVP
                     AKYTGCNASFVFAVAFKTGKRLSFQTKSEVERDLWMEKIQDVLGIGDGDDDDMSALPA
                     KE"
     gap             584078..584176
                     /estimated_length=99
     gap             585349..585447
                     /estimated_length=99
     gene            complement(<587346..>588851)
                     /locus_tag="LDBPK_361590"
                     /db_xref="GeneID:13388160"
     mRNA            complement(<587346..>588851)
                     /locus_tag="LDBPK_361590"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003865226.1"
                     /db_xref="GeneID:13388160"
     CDS             complement(587346..588851)
                     /locus_tag="LDBPK_361590"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003865274.1"
                     /db_xref="GeneID:13388160"
                     /db_xref="GOA:E9BTL8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BTL8"
                     /translation="MAAPSDALIKKVCNAFPATFGVDTEEDRSPAEGRLSRPFRYYLD
                     TVLGSGTSGTVLYARRVRDDYPFAVKVMDVEGYTPQEIMRASGEVCCLLSCDYFSIVK
                     CHEDFVYSDERNPESVSMMAMVLDYANAGDLRQEIKNRSKTNRPFAEHEAGLIFIQVL
                     LAVHHVHSKRMIHRDIKSANILLCSNGLAKLGDFGFSKHYAATVSDDVGRTFCGTPYY
                     VAPEIWRRRPYSKKADMFSLGVLLYELLTLKRPFDGEDIEEVMHKTLAGRFDPLPDSI
                     SKEMQTIVSALLQSEPKKRPSSKTLLNTPTCKLYISVVREIVQSGEASGFSVEQETTI
                     TRQLKQTKEELQVDRRRPPLSMEDVLRTTVKVPLSDSPDRIGFILYGGKVMKQSSDLS
                     WKRRYVCVYGEVEKGCTLTGDVASCLVSLELVQAVSRDTLEQQCISTPFSDLEDVFPV
                     ISKYTGSDAAHAFAVAFKNGRRILFDADDDNDRDGWMRSIQSFLGIGDEDD"
     gap             590489..590587
                     /estimated_length=99
     gap             591464..591562
                     /estimated_length=99
     gap             593660..593922
                     /estimated_length=263
     gene            complement(<594354..>597161)
                     /locus_tag="LDBPK_361600"
                     /db_xref="GeneID:13388161"
     mRNA            complement(<594354..>597161)
                     /locus_tag="LDBPK_361600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865227.1"
                     /db_xref="GeneID:13388161"
     CDS             complement(594354..597161)
                     /locus_tag="LDBPK_361600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865275.1"
                     /db_xref="GeneID:13388161"
                     /db_xref="GOA:E9BTL9"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="UniProtKB/TrEMBL:E9BTL9"
                     /translation="MSLLQKNAVLKKYRREYREQDVARSSSKDEGQTEEGGDDDTAVY
                     PNVDAFQVLGSIAGGALASPSPSPRLMRCEENTQMPAIGAPSVKCWSSGVSSGFHGTT
                     AAFESMHNNATATATAGPSTVSTIRSPFPHEDGGNEANHAAPTRPSWPRSHTVRAGAG
                     AEDKYFDLDNFTAPLGPLPLPPPPADGAPPALAPLGRRGAGSTGPRCWISWSDLSGEE
                     DRATADTHSQSAPTDPSVSPTTVTIGGEAFMSVTDVPEAARSNHVARATATSGLVPSV
                     GESCGPASSVGGLSSLALAASKPRTPTGGGAHVRSSPQVLTAVQQPIEVLTRVHKDPS
                     EEVSSSSSSSSSSFTVTELEGDCGDADGKPTTLREEAVRQLDLAYASETCEPHPVEGC
                     KNSAASAAMRLDVSDTLLQPPTSILSEPSTTTVHTKDKSAMSYRSSGGAAANGSVGSR
                     RVVYAAEGADASDEGAFSPVSGMDDNERASYAGMAGDRNIPYADNRGAVFMQQVLSFS
                     GTNHSLPRIWDDEDVDVDPLTTDSMRLPARALPPITFYEAYLDLTKAIRRGDAKGACE
                     AEERTADRACSSSIVLPQAPPPVMALPTLKKAVRAAIFWCCGGSASRASTVAKQPQPS
                     TAACSGPNRDELSGVAPVDETASAPGGPEEHLRVIRALKSQSVSLQLTTHRRMLLTVF
                     NTLTGKIPWPSRNVNSSESTPVTSSPPSSSTAVKWESIGFQGSNPATDVRATGVLGVL
                     QLLYLIDYYPAFAQRLWQLCRNPADEGASHSPSHNHRGGEALVAAKRGRVSNELPFVL
                     VCFNFTALVLDAAGQHILDEEVQKTANGKRPSPTSHEAAAKTTEPAAHPSSYAGMHVC
                     CECYVGALALFAEAWRSRPKGGPTGDGSMTKSTVPANRPSIADFGDIKARLRGKLLRK
                     GAAKIMREAACQVRGPAEQQE"
     gap             598338..598573
                     /estimated_length=236
     gene            complement(<600901..>603447)
                     /locus_tag="LDBPK_361610"
                     /db_xref="GeneID:13388162"
     mRNA            complement(<600901..>603447)
                     /locus_tag="LDBPK_361610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865228.1"
                     /db_xref="GeneID:13388162"
     CDS             complement(600901..603447)
                     /locus_tag="LDBPK_361610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865276.1"
                     /db_xref="GeneID:13388162"
                     /db_xref="GOA:E9BTM0"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="UniProtKB/TrEMBL:E9BTM0"
                     /translation="MAKRTVSELAVERDHCGKTAVPGASICSLTVDDEDASQDRPATA
                     LALCEETTWTEAAAEGALSVPLSWPFLCPLCSAVELADPVDLHEPVKDTLSPSSLHSK
                     TVDEAVHCLACRACVEQWLSAVRAFSEDQAETMDHTGGATGATMFSPLSASACDCATL
                     LACPLCNTTCDATILSTSGPIAGAARVPDASVVRNRYTGSQPLSCITRTGGGVGPPSA
                     PAASASPFCSICEEAKAMCVCLQCDFGMCDTCHRATHAKGGFRQHEVLSCEQARRRAN
                     QRCTQHAGMALDLFCDTCSTCVCVTCCFGGAHRGHEVFPLADVVARAAAALTQHSTEL
                     AALQRVADATGVQFSSLWPAYEAKVDDVRTEIQQCFSSLRQVLQAREDALLSRLSEVS
                     AVVGRRSSELRSAMHAISNLLGSTGERLRRLPGSVSPATLMRIFETVQEQQQWVSRVS
                     TRVIEEATAVAKGWSYHISSDGANGCRMASFVLLNSDTPNDDGLRQYKRVLADLGRLD
                     ASADVQLPLAEQGSAGSVGTAKGHDNREKEGAAHHLWGGMAEDCMEPSDGLTNDAPVA
                     LCGDSDANFDAVANAGEGEETLLVRPSHIRPATPSLPGQAAASPSREVSMAYRGRDRG
                     ESRQRNLSASTVQSQPKPPHLFSIGASTQSTHGPLLTYELNVDPSVKGAGGVTGSAAD
                     ATTASGTASLNGVASKWGDVKQALWEVGGCGSFAAELGALGRQTPGCAAAARGVRDTI
                     PFRVALPPRLIESHDRMDDDDRSVREADDQLPWRALKLHHNSSVQDGVRSAATSLPRH
                     GSTARLQYLKELDLRKPSEVAHEALDSSLSAPKQGRAESQRRTTGLQLEL"
     gap             604177..604485
                     /estimated_length=309
     gene            complement(<605766..>607277)
                     /locus_tag="LDBPK_361620"
                     /db_xref="GeneID:13388163"
     mRNA            complement(<605766..>607277)
                     /locus_tag="LDBPK_361620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865229.1"
                     /db_xref="GeneID:13388163"
     CDS             complement(605766..607277)
                     /locus_tag="LDBPK_361620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865277.1"
                     /db_xref="GeneID:13388163"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BTM1"
                     /translation="MPAAVNACLSAAVPWRGDGVAVPTPAAQSGEMQDLTLEELKSSL
                     SDLGYNPYGDLVYTRSHLASKHLRALPGLQRYVHLQRLCVDDNGLTELDAVRYMPQLV
                     HLHARHNRLTSDVFVSLAAAAAGCLEQLHLDDNCITSLDGLETLPFLLDFTCCRNRVQ
                     HLPARCLAAAERLRHFSLSDNALKTVDINAFAATRPLRVLDLSNNLLSSIDFLYSVAP
                     QIEKVNIANNHVRHLSAALKQLPCLTVLDVGGNELSGLKELRVLRCLEALRTLTFAGN
                     RALEQLSHHAAGEGGRLGDPLATTVQGTEYDAEVVMSDGEDNGGSLCYGGGSGGFNAA
                     TRTTAATTGVASAEVVATEGDGAPDTSSTLCSSASAISKGTRNADDAAGDRRAGTKTI
                     TGWKSSHSSPARVTTPTTAAYVDLAASETNAFVHSVGSARRDAVLDVRVHHQKEVLAL
                     PQQEQVYLWTLSVLPQLTEMNGRLTRPEEVAKAVFLFRADTTKQEPEKGVFTE"
     gene            complement(<608442..>609872)
                     /locus_tag="LDBPK_361630"
                     /db_xref="GeneID:13388164"
     mRNA            complement(<608442..>609872)
                     /locus_tag="LDBPK_361630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865230.1"
                     /db_xref="GeneID:13388164"
     CDS             complement(608442..609872)
                     /locus_tag="LDBPK_361630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865278.1"
                     /db_xref="GeneID:13388164"
                     /db_xref="GOA:E9BTM2"
                     /db_xref="InterPro:IPR010597"
                     /db_xref="UniProtKB/TrEMBL:E9BTM2"
                     /translation="MSATQSMAESGVSSLQRSGLSITVGDTKSIVLALQALQSKIRSL
                     EQDRDFHQDQYEVALQAHERYKLDMERQMEQERAAHRKREADLLELLRRAREERAQLE
                     DTLSGNKEDLGGFRRELEQMIASEKELASQRESKINMEVAKLRSEIKEEQTHRAALLV
                     TVEKLKEEREAALKTNEQLRIAMDGLLTRYEQLQRRRPAPQAVPRRYPSSGVSCETHS
                     RAAPATGAHPRRSVSGRTRSLGYAPPRELQRSALPARQRKVSPSLHHNYEDPTCNSIL
                     RDVRIVPEEAPPCAYPSANSSMHHSQQEAAETTGKAIAARSGQGLRAQATAAPSRSGR
                     PSPARRPPETGVAGPSAHRTTAIDEVEAQLRQELEELQHRYDDTIERGSSEEVPREVL
                     AAALHRISALLEQKKEQLKLLKEARMELEEAVSFSASRSTNTNWSMNGGGGGSPSTLA
                     MQDKHTRRALLVNELRSLLAEAAKGG"
     gene            complement(<611488..>616974)
                     /locus_tag="LDBPK_361640"
                     /db_xref="GeneID:13388165"
     mRNA            complement(<611488..>616974)
                     /locus_tag="LDBPK_361640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865231.1"
                     /db_xref="GeneID:13388165"
     CDS             complement(611488..616974)
                     /locus_tag="LDBPK_361640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865279.1"
                     /db_xref="GeneID:13388165"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BTM3"
                     /translation="MAGYVLQTPFPATRLAPPSSPLGASAAHHSILLRRQALRPVSAE
                     EDARLFDDLPMPCFSASQHRTVSPTKHDARKAGLEVSRAVFTDASLQMSPGTAINNSV
                     RVSSLRSGSAGLGESLHVPPLSAFEHPDAWLREYAFLRAKLKRPADSVTVYHDYAAPL
                     NSRATMRHACVVHPLPDLEKVQEALRRRFQAHAPATSYDVCEQQCAADSCAPTEWDDD
                     AVSMAAAPETADAVRGAHREQRNDMFLPPATLWCVGGSSYENEIVVRNTVTGQRLLRI
                     LDPKMRVAVTALQHAPFRGFMKTHQLHVLPVREPHDVLRLKASQLVFTDYMWCGLQDG
                     SVRLVPANHHHIRACGASSLFSKAPSAALVYELPRYQGGAIVSIVCSPCHDAACAFGD
                     SPKWGLPNRLSNAIQCMTAVLSAGADSAAAAGQADGEPVDPASRQHLSLVCIAATDAS
                     VVIWDVRQVYEAVATAQQQRQEQNEGTHISGASVFRHGAAGPLTVGGTATSGTPFCFD
                     ASASLSGATGVSSDVITFDCSSPVPGLQNMQVRSSCTLIQVKPLARLSGGFAGLTALR
                     WVSSLVVAGGCDAAASRHARMAARDPCTVPCRGEETPRIELTQTKTRFDKREEQRGEL
                     ELTEEEMQGVERELEHMMPPLAAEPAQSLRVNLLVASDCMGTVHLWNLDEELHRCSEV
                     KESALGWPASSGAFYYSSLRSMSSRSDGRSAASHGSGASQPTSGISNASARRTSASKG
                     HGGTRRSDRVPKSRRACRGLGLAEARENRARLSELPSNRPTLGHKSDGEAATIHKNLQ
                     RPSIGRSSTEEHDSSQSAQGRSPQLTAEREGGRLSDGHGTLPALPASHKSLVAPSATV
                     QQHPPLHNALPPNHPSSAKNAVPVSGPVKAKKLKKSRNPVHETSASMFRSSLQSTSPS
                     RGSAHRPSTSPCRLSESRHPAQPQTGMHSRASVQRGASITARNACGTGSAGQDLLMPT
                     QAAKCQIRFGQGAAAAIADVAVDLPPCIRTTLRRIPKPSNRVASWQHRPTEEEVDSRI
                     LENEFEELTEEKALFFAFQRLEMYVAVDGAMSTVRCVPQWLLPDEDEQELFRQRNSDD
                     WREAGGDLTTQETTGAAVRGWMAEAAMPDRVSMGAFDLHLRKRLLDVHAQPITQLFLD
                     PWQGLLWVAREDGFASIFATRDKSVVSRMPHPSADALLAPPSAQEWAKLQEQALTRSH
                     PNDARAANGFGLECHKECRDLPPTHLTQVLPIAVRRQRALLLGCSAAGGCHDRRSDCL
                     AAATVTESPGRSCQRTLALAESVAARDPPKSSALKLVPSLFCSSDTTKSNSGVFSAPR
                     SCDAVALVCVDGRSDMKNLAKSREAQQWRWLRQLQLCRAESAAVCQAQRHRYYALCEA
                     IGRKAVHVIQELGHYAIQSRLRTYFHLWKDHLALFHHTHLMRRQRTARLERERALARR
                     LECARMAQVRGAYYARWQRLLAGRKCRRQEEALTRFARAAATVSHGRRTSRGSCCRGP
                     LPTAAMMGRFHRLSALRACWRTWQAWADTKRLQRHRHKDLNALQEYPPPLSRTRSLTS
                     LAASMATTPRCVVSGHRGCADGVAAEGTTAPFHSIHSGGVYVRAASLSSPQGSAYRPT
                     ASGRGAATPPSARTPGLTEAVPTAPPPALEVLLAELLRARVFVFHFSDARSSATSVLD
                     ESWSVILENAESGAETDDDDDRRFSVFRFALLPLLQGLISTAEEVLPNLFNESVAEEV
                     LSMLVGIVLAMDYVTANAEGTWWTLREAAVLTGCSAFVDGTDPMRSAFDASLLVLRAY
                     AVRAFALDPEAAEVLRGLAKGKKVLAQFLDFAMERAVARRMEHL"
     gene            complement(<619575..>623201)
                     /locus_tag="LDBPK_361650"
                     /db_xref="GeneID:13388166"
     mRNA            complement(<619575..>623201)
                     /locus_tag="LDBPK_361650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865232.1"
                     /db_xref="GeneID:13388166"
     CDS             complement(619575..623201)
                     /locus_tag="LDBPK_361650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865280.1"
                     /db_xref="GeneID:13388166"
                     /db_xref="InterPro:IPR013721"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR020839"
                     /db_xref="UniProtKB/TrEMBL:E9BTM4"
                     /translation="MSAKKSTRARGKASSRASQYSDEADAVSQAYDVASLPMDDAAAT
                     PHQCSGPLPKKVSKKESQQDSSAAAAEGEIIATPQPTLGEAETASLAESTLQFLVDGT
                     SVVSSVTEAILSVYRSGAKERALCAVLNVLAKAAGVAEVELDASALVDGVEIGPLLEE
                     LYARVPEDSEAYLLVNKDVKYKRFRRTFPEWCASLMQDGFASDVLLDGTFLPILSQWI
                     IAMSESKSRSFRHTATVALLAFVQALSSVAANLQSQLSLLRSKKTISVVQRKRNKVVE
                     WRDHVFSQAIHQRLRDIAPDIRLAGFQALRRWILEYPEEYMTNRYLRYLGMPLHDKRP
                     ELRAEALDTILQALAHVPDAYSRLHLFLQYFTSRLVELSNDVDVRCTELAIRVVAMMV
                     RSDSDVPEGSELLSNERVDQVLLTLFDERPSIRAAAGILLKVFIHCRTAAEESEAAQV
                     SAATELLCSFAATLRSQYREAMPEKYLIDALWTPERPPLLLTDFQPILAAAQSDKPLD
                     AVVGLQLMAALLLKVQGRLTLGPLPKDDRRGGTVTASKKIPPAAKGEAEALLHRLSED
                     AVHALSTILEVHCGSEDVLQAAAEVCAALDFSTFSSQRHQAALSALLIELRKATLNAS
                     CTALEMRESLTKAWHQLAFTEHPLRNEAHAHLQELLKNVMAQFSQAVRAPSRSSEGNS
                     LADAADLLHAWARVNLASALVPMGAHWPQIQTALTGILAAQPAADASLVMLVVGAAVQ
                     CLLWQVHSSADEANPALSLSQLKAHVRGVVAGVLQYQAETEEEAQATASPGAAADGAA
                     VLARAEVFVYLCDLLALPYYNLAQAQQEMLVRLLRGLYERVSAELRTAQDYLKMHVLE
                     HRAQQQQCPSQAASWAPASLTELVAARRLCSRVEALQLRLVTGVARLFLFKRFDAILA
                     APFLSLWTHTSSKAVSDAFKSLFHTLRDRAGDDGFTLERDILLAAYHHCVEVGATPFS
                     VEALYQIGLKLSSVHFIGTDRLYSCCPAMVRFGADFAASTDPLLLQAVSSYAGKLRPA
                     DALHVLRDQLSRCSLFTEATNSYVLAFVTALRKAAKLDDSTAPSSIAGGKRRQALAGT
                     TQLAEEEGMLNAITQGLPDCSNAATAGASSSALTVGPGQRISVASRVVTADGWHVRAA
                     GASQGNAEDAVEVEVSQGQRTSAAARPRRSVVNVPTTQETALSSLADGLDSDEVFVAT
                     EEYE"
     gene            complement(<624586..>624957)
                     /locus_tag="LDBPK_361660"
                     /db_xref="GeneID:13388167"
     mRNA            complement(<624586..>624957)
                     /locus_tag="LDBPK_361660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865233.1"
                     /db_xref="GeneID:13388167"
     CDS             complement(624586..624957)
                     /locus_tag="LDBPK_361660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865281.1"
                     /db_xref="GeneID:13388167"
                     /db_xref="UniProtKB/TrEMBL:E9BTM5"
                     /translation="MPRKAAAATKKERSPSEKSVSSVDSISSLPAIKEARTEDATVAA
                     AQVPPRPLSPPASSAAMPAAAEEVVPLAALVAVNVDRNEEASFGLLKEPGPPSADVRR
                     ATKEGEGAPAIPTDLLQLLSG"
     gene            complement(<626025..>626819)
                     /locus_tag="LDBPK_361670"
                     /db_xref="GeneID:13388168"
     mRNA            complement(<626025..>626819)
                     /locus_tag="LDBPK_361670"
                     /product="proteasome alpha 1 subunit, putative"
                     /transcript_id="XM_003865234.1"
                     /db_xref="GeneID:13388168"
     CDS             complement(626025..626819)
                     /locus_tag="LDBPK_361670"
                     /codon_start=1
                     /product="proteasome alpha 1 subunit, putative"
                     /protein_id="XP_003865282.1"
                     /db_xref="GeneID:13388168"
                     /db_xref="GOA:E9BTM6"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BTM6"
                     /translation="MFKNEYDSDITTWSPTGRLFQIEYANEAVNNGSATVGVKGRDFV
                     VLAALKRSPVAELSSYQEKVFEVDEHVGMSISGLVADGRVLARFLRTECMNYRYMYSH
                     GMPMNQMADMIGEKHQRHIQFSGKRPFGVGLLLAGYDRQGPHLYQTVPSGDVYDYKAT
                     AMGVRSQASRTYLEKHFEHFTDCTLDELVAHALKALASATSEGVELNVKNTTIAIVGK
                     DTPFTIFEEESARRYLDGFKMRPEDRVAAADDEEEVLHEQPLDVEE"
     gap             632670..632768
                     /estimated_length=99
     gene            complement(<632771..>633118)
                     /locus_tag="LDBPK_361680"
                     /db_xref="GeneID:13388169"
     mRNA            complement(<632771..>633118)
                     /locus_tag="LDBPK_361680"
                     /product="universal minicircle sequence binding protein,
                     putative"
                     /transcript_id="XM_003865235.1"
                     /db_xref="GeneID:13388169"
     CDS             complement(632771..633118)
                     /locus_tag="LDBPK_361680"
                     /codon_start=1
                     /product="universal minicircle sequence binding protein,
                     putative"
                     /protein_id="XP_003865283.1"
                     /db_xref="GeneID:13388169"
                     /db_xref="GOA:E9BTM7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9BTM7"
                     /translation="MSAITCYKCGEAGHMSRSCPRAAATRSCYNCGETGHMSRDCPSE
                     RKPKSCYNCGSTDHLSRECTNEAKAGADTRSCYNCGGTGHLSRDCPNERKPKSCYNCG
                     STDHLSRECPDRH"
     gap             633475..633573
                     /estimated_length=99
     gap             637091..637210
                     /estimated_length=120
     gene            complement(<637211..>637321)
                     /locus_tag="LDBPK_361690"
                     /db_xref="GeneID:13388170"
     mRNA            complement(<637211..>637321)
                     /locus_tag="LDBPK_361690"
                     /product="universal minicircle sequence binding protein"
                     /transcript_id="XM_003865236.1"
                     /db_xref="GeneID:13388170"
     CDS             complement(<637211..637321)
                     /locus_tag="LDBPK_361690"
                     /codon_start=1
                     /product="universal minicircle sequence binding protein"
                     /protein_id="XP_003865284.1"
                     /db_xref="GeneID:13388170"
                     /db_xref="GOA:E9BTM8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9BTM8"
                     /translation="MSAITCYKCGEAGHMSRSCPRAAATRSCYNCGETGHM"
     gap             638633..638731
                     /estimated_length=99
     gene            complement(<640220..>645301)
                     /locus_tag="LDBPK_361700"
                     /db_xref="GeneID:13388171"
     mRNA            complement(<640220..>645301)
                     /locus_tag="LDBPK_361700"
                     /product="clathrin heavy chain, putative"
                     /transcript_id="XM_003865237.1"
                     /db_xref="GeneID:13388171"
     CDS             complement(640220..645301)
                     /locus_tag="LDBPK_361700"
                     /codon_start=1
                     /product="clathrin heavy chain, putative"
                     /protein_id="XP_003865285.1"
                     /db_xref="GeneID:13388171"
                     /db_xref="GOA:E9BTM9"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012331"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="UniProtKB/TrEMBL:E9BTM9"
                     /translation="MDSPSISAEVFQLNSVSGGLRPGSISFKNVTLESEKYVCVRDVQ
                     GDGPTSLVIVDLEKRESIRNNVKDAESCIMNPKSKILALRSGRNLQVFDVDASRRLKA
                     TLFHEDVAYWRWIDDRTLGVVTAKAVYHWSLDTAADDAPQHIFDRSADYDSSVQVLSY
                     RSDEQKKWLVVTGVARDPSGIMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKC
                     NVMCLAWNSPQQGGQVMIMELPTGSKTDLSMLRRVYSVNIQPGDFPVAMNVSDRHKLL
                     TVATSRGSFALMDIFTGTILVEQQFSSSVVFCGAADSKVGGVLCVNNQGAVMRIGPND
                     NGIIGFVKNRMHNAELALRIASTANLGGVDDLFKVQLDNFLRNGNVEEAVRMCLRAPG
                     NSLRTREILMRFMQMPQQPGQPPAISTYFKIALAETSLNECESVELARAVVPKGGIGY
                     VKQQFEEGKLTASEELGDLVQQADSNMALKIFHQGNAHTKVLNLLLQRNETQKAVEYC
                     KRANFSPDWRVIMNNFIRVAPQDAVNLGLMLYREMGDRPVLTADEVVDMFVSAQQIQQ
                     ATEFLLEILRDHNDESTMELQTKLLEMNLKYSHPSVADKIFVRKICQCYDGMKLAPLC
                     ERAGLHQHAIDCYIMAQKQDSDLNNLASIRRCLQQLQNFNPEWLVDFFGKLNKQDSLK
                     CLEDLCTNSRHNFKVIVQVATKYSDALGAADLIDLFLEHSLYDVLYYYLGAVVPYTRD
                     AEVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLKSKKLTDMWPFINVCDQHN
                     MVNEMVHYLVETGNESCIEQYLTRRSPGKTPQVVQALIECNVSEEFIKNMLTAVGTMC
                     PIEELVDCVEEVGRLHLIKQWLEDRRSEKKTDKALYNALAKIYVDIGQSPEQFLSENE
                     YYDSEVVGKYCETRDPNLAYIAYCRGHCSEMMIDLCHRNGMHKQLARYLVKEQNLDLW
                     ASVLGQNSAERQQLIESVQQIALPESESSEEVSTTVRAFMNANLTEELTSLLGQIVVH
                     GRFRRNRFLENLLIMSAVRARKDKVMEYVTTLEDYDAKDIAHVASGAGMHEIAFVVYT
                     RHNMQKEAITVLLQDMNDVSRGRAFAQKTDAAVVWSVLGEYLVKQDEVHEGIECLIRA
                     KNPDLVVEVTSAAERTNQFGDLIKYLTMARQCSRAKDNKIDTALVITYAKTGRLEELE
                     EFLKETHNVKIGAIADKCFQDKLYESARVLYTVANNYARVASTEVMLSNLSAAVEAAK
                     KAKSIHTYKEVNLACIEAGDLKLAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVL
                     RNASSHQGAHMSIFTEMGVLLAKYRPEKLMEHVNMYAKKINTHKMITVCEQYHHWVVL
                     RVLHINNEDWLAATNSMMQHHADAFDHEIFKDAVSHLGASDLLYTAIGFYLKTHPEQL
                     NDFLSSIFKRVDPERVMTETKKVAPIHVIRTYLEAAQERNAKKVNEALNNLYIEEEDF
                     KALRHSVETYNNFDSEELSSRLEKMELFEFRKIALLLHRKNKRYSHAVAVAKENELFE
                     EAIDTAAESGDSELVSSLLDYFVKDYPECFAACLYTCYDLLKPATVLQKAWLNQRTEM
                     AMPYMIQVLQDYSNKIEKMEKSMMDAQTAAKDAARRAGPVQGPGSVPLMIEQGGGMPM
                     NGMPVGAPPQLGFGMPPQFGSGRPF"
     gene            complement(<652197..>652604)
                     /locus_tag="LDBPK_361710"
                     /db_xref="GeneID:13388172"
     mRNA            complement(<652197..>652604)
                     /locus_tag="LDBPK_361710"
                     /product="poly-zinc finger protein 2, putative"
                     /transcript_id="XM_003865238.1"
                     /db_xref="GeneID:13388172"
     CDS             complement(652197..652604)
                     /locus_tag="LDBPK_361710"
                     /codon_start=1
                     /product="poly-zinc finger protein 2, putative"
                     /protein_id="XP_003865286.1"
                     /db_xref="GeneID:13388172"
                     /db_xref="GOA:E9BTN0"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9BTN0"
                     /translation="MVCYRCGGVGHQSRECTSAADSAPCFRCGKPGHVAKECVSTITA
                     EEAPCFYCQKPGHRARDCPEAPPKSETVMCYNCSQKGHIASECTNPAHCYLCNEDGHI
                     GRSCPTAPKRSAADKTCRKCGKKGHLRKDCPDA"
     gene            complement(<657235..>658050)
                     /locus_tag="LDBPK_361720"
                     /db_xref="GeneID:13388173"
     mRNA            complement(<657235..>658050)
                     /locus_tag="LDBPK_361720"
                     /product="universal minicircle sequence binding protein
                     (UMSBP), putative"
                     /transcript_id="XM_003865239.1"
                     /db_xref="GeneID:13388173"
     CDS             complement(657235..658050)
                     /locus_tag="LDBPK_361720"
                     /codon_start=1
                     /product="universal minicircle sequence binding protein
                     (UMSBP), putative"
                     /protein_id="XP_003865287.1"
                     /db_xref="GeneID:13388173"
                     /db_xref="GOA:E9BTN1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9BTN1"
                     /translation="MSETEDVKRPRTESSTSCRNCGKEGHYARECPEADSKGDGRSTT
                     CFRCGEEGHMTRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYNC
                     GQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQG
                     GYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSNG
                     SGDRTCYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPSS"
     gene            complement(<659120..>660028)
                     /locus_tag="LDBPK_361730"
                     /db_xref="GeneID:13388174"
     mRNA            complement(<659120..>660028)
                     /locus_tag="LDBPK_361730"
                     /product="proteasome beta 5 subunit, putative"
                     /transcript_id="XM_003865240.1"
                     /db_xref="GeneID:13388174"
     CDS             complement(659120..660028)
                     /locus_tag="LDBPK_361730"
                     /codon_start=1
                     /product="proteasome beta 5 subunit, putative"
                     /protein_id="XP_003865288.1"
                     /db_xref="GeneID:13388174"
                     /db_xref="GOA:E9BTN2"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BTN2"
                     /translation="MFADFESVMSSNFTLDDCPRVGPFTYHNMDEDTLEEPLSLCSYR
                     RAPQQTTERSPASCDAVTADPLDSSRYLHGENRCWTLTASCPVPRAIPKIDMKKGTTT
                     LAFRFNGGIIVAVDSRASTGQYIASQTVLKVLEINDYLLGTLAGGAADCQYWERVLGM
                     ECRLWELRNGSRITVAAASKILANITYAYRNHGLSMGTMLAGWDQFGPSLYYVDDKGS
                     RVKQDLFSVGSGSIYAYGVLDTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVY
                     HVHEKGWTKISRDDQTKLYDRYFPSQ"
     gene            complement(<660999..>663632)
                     /locus_tag="LDBPK_361740"
                     /db_xref="GeneID:13388175"
     mRNA            complement(<660999..>663632)
                     /locus_tag="LDBPK_361740"
                     /product="tRNA pseudouridine synthase A, putative"
                     /transcript_id="XM_003865241.1"
                     /db_xref="GeneID:13388175"
     CDS             complement(660999..663632)
                     /locus_tag="LDBPK_361740"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase A, putative"
                     /protein_id="XP_003865289.1"
                     /db_xref="GeneID:13388175"
                     /db_xref="GOA:E9BTN3"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:E9BTN3"
                     /translation="MESAHPTHPRKLPFSEGEGGFCVCVSHVSLLSPSSHNKDTDSGR
                     MRSSLLSALLPRQAARCCLADRTVCRLHFGGAASVRWGTTRGAETPLPSSTAQTASPR
                     DNATNSQGSSSNIAGEPRRSSSSQESRRERRGGSRRRLRRERRPPRRITTRSSTSSPQ
                     PATLPDVDAAPLPHSLDISAAEDIADVEKYFPRAMAHLKAVPASAEAAEESRARRWHD
                     TTHEVNADGIVTPGKRAERERRESGLGSFFDEGSLDVRGGMSDKLRSGAYGSARDAAE
                     RDSPDILKLTGGNARRHGGLNLATESNAAPADQTIEGDRGDAGAYREFGDTPVQLTDM
                     LRERLMELRARKLREERSETFLPQRLRHRPAGELLMLAQQGEAAGVEAGGRVATLQPT
                     PAALQRKVAQLRSGAAATTLADLVPKEEEEEEKATLLGDAARDDARRGTCDRAILQDG
                     VAPARVANAMQAVSGTDDSVPGASPHDPLRRLVAIAANTGRRASVFGTGDGASVSAEG
                     VERAGFVHLLRTLPRAGFCSRREAAAIIASGQVRVNNVTERNPFRLVQAQDDVHVAGH
                     QSRLRFAPPRLWIYHKPAHVIVSRNDAAGRTLITKHARILGMDHLVPVGSLPMRAHGI
                     LLLTNDGELSRFLENPKSMVQRTYLLRVRPAFDPVLVHKLNTEGIQINGRLYRNAEFF
                     VNPATKSRYSVKVKVRGESMPIAHLMQHLGRTVERGGRISFGPFALSNLAVGSVREVT
                     IPPFYSQHLGAVWQPFVERDWPYFRRQRVSRLRRLCQHRELTPKELEELDNYTYEEVK
                     DALNFESSELQTLAEQRAQLLRRARHLRDDMLPLPDDFPKESCRRSVGDVTVDGAAAP
                     FADADEEEDEDAIVEDITSFR"
     gene            complement(<664402..>665724)
                     /locus_tag="LDBPK_361750"
                     /db_xref="GeneID:13388176"
     mRNA            complement(<664402..>665724)
                     /locus_tag="LDBPK_361750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865242.1"
                     /db_xref="GeneID:13388176"
     CDS             complement(664402..665724)
                     /locus_tag="LDBPK_361750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865290.1"
                     /db_xref="GeneID:13388176"
                     /db_xref="InterPro:IPR019438"
                     /db_xref="UniProtKB/TrEMBL:E9BTN4"
                     /translation="MVVAIDFCHWAEVPCEAGGTAIASVGEEVTGFAGFYAAVDPPSV
                     ASALGNGGTTDIAAVVELFTEPPSAAPKELGTLPTAAAAAPTLLRGSAAMMYLLRRAV
                     EVHRLPWFCPEFLQRFRGDTAAATSALRVCFLGCEQDGVTPLWMPCTRERVELLLSLA
                     DAFVARQTSYYKLLRACGGFLFAPDAAAAATAPCGFVPTLVRLHPRYADFARVPVEGP
                     GCLGGNTGETSPDVCIVPVLKLSQLTALAIEQALPALWRYQAASSASSKSPLSKPPPS
                     APANSWLTDRAARIARSGAESRTTEPESSLSGVFADSAKLSICCDYQIPKALRAAGLL
                     VYDDHLARIVDRHVLLLPGSAEEVSIRVATLIAAERLLQFLNTPPQRQSSLAREPGST
                     AAEVPGAPAQLPVKRLCSVIHLDYALWYVGRYMLPSEARHHLCRTIMY"
     gene            complement(<666742..>669090)
                     /locus_tag="LDBPK_361760"
                     /db_xref="GeneID:13388177"
     mRNA            complement(<666742..>669090)
                     /locus_tag="LDBPK_361760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865243.1"
                     /db_xref="GeneID:13388177"
     CDS             complement(666742..669090)
                     /locus_tag="LDBPK_361760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865291.1"
                     /db_xref="GeneID:13388177"
                     /db_xref="UniProtKB/TrEMBL:E9BTN5"
                     /translation="MHQYLQRTVPVVPVLLSMSGNSSTEGVHADAAPVLESRFLRRLR
                     AEVDRKERAEQLRKGTAARVIQQALRRWLQTRQLHHRHLSIHSSVRPSYEFDPIRAAE
                     LDAALCSIQASLRMCASSRLVEAHRVKLFQQITSTVLDAACPTTLRCTASIRHIHDRQ
                     LREVLWRQEAVERRDLLRRHFVFLVCCHQAFFNDPRMWDAGVSIRRIPLYPHHGLLST
                     ETLPVIWGTRTSSARLNSATADSVALRGDAVASPPPPESSPFSATATVDGCIKGWGSP
                     AQLDSSLLQAVGSGWLVGKEEDGGRFDIDAALRLGEYRLLFSPEEWRLLKELKAPSLH
                     SASSLFSSSSDGRRAAPDAAGLLEAEAGALAAPPGQLQMAPTEAAAKAACSLSYANAF
                     ASALTFLRHPRIADPSVRCTVQHLHDIRSSTLEMQQELRVHGFLFAAQVAPLLNLGFH
                     YQGLARGDADLSCFTTTSAMKTCRPLVAGRVACAATELRRCLIGAVHDSGGAAESVLP
                     VALEEHKCSLKAAARTPSQVLSPAGVSRSMLSPPRAAPSAGLMRDGFANPATEALYHA
                     PAQTTRRTCGADPTCGSSHTASRHGSTIGIALAAEWSRRLASSADEVGPYWCEFLSST
                     GVEALVTAAGRQGETPGEADAAYQTGASLPSSPLPMRVRRGLESHLVPGGSSYLLQDF
                     MPSLMRRRAYSGAGPQALDAAAGSVGVAVACAGSSPSISVSTSTCRMVHPGEWWDAAE
                     RLLLREYTNRRELLTNEAVQRSSIDVLRCTAHPSADESAAEA"
     gene            complement(<670204..>671136)
                     /locus_tag="LDBPK_361770"
                     /db_xref="GeneID:13388178"
     mRNA            complement(<670204..>671136)
                     /locus_tag="LDBPK_361770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865244.1"
                     /db_xref="GeneID:13388178"
     CDS             complement(670204..671136)
                     /locus_tag="LDBPK_361770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865292.1"
                     /db_xref="GeneID:13388178"
                     /db_xref="GOA:E9BTN6"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="UniProtKB/TrEMBL:E9BTN6"
                     /translation="MGLLSSSSSSSSSAGTGAGAAAAQTDAQEVKRVDSLYNPHDVCE
                     AAVDYVLRHVNTVQYMIQSIEEITGKPFLRDRIKCLPAVPRGEASCNSAMGLTPDRVL
                     AGYMWRSARPDCQAKDVVLLEDHIARLFNTKHAAAFLKKDKAVNERAASPPTTSDATA
                     AAASLPSTTATQSQLLRLLAGSQLPVLEQVERNIRHELVHAFDDARGAIESSDCVHQA
                     CSEIRAARLSGDCFVGQEMRKGRFNFFEGGQKCVRRRAVMAVDRNPVCRGFSERAVDT
                     VFQKCYSDYEPFAAPIYALGSYGDSQFANGTLKL"
     gene            complement(<673858..>675498)
                     /locus_tag="LDBPK_361780"
                     /db_xref="GeneID:13388179"
     mRNA            complement(<673858..>675498)
                     /locus_tag="LDBPK_361780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865245.1"
                     /db_xref="GeneID:13388179"
     CDS             complement(673858..675498)
                     /locus_tag="LDBPK_361780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865293.1"
                     /db_xref="GeneID:13388179"
                     /db_xref="UniProtKB/TrEMBL:E9BTN7"
                     /translation="MLSDNDLTFHIPSAGLRRMDAWTATNPSAFSHLHLVGNPDWMSS
                     FSASSQVAAARPALAPPAPVAIEPSTPRLLAAPAAIDAPAPAAKKSFLSMFYRGSSNT
                     VSSTAMPPKASSAASTLMSAPPKALDAFDTPMQRALPVDAQLSVEHLSKLDAVDATIS
                     AAPRREPPRPMALGSDTWNALSSVPLPAKTTAGSARLLAPPASIDAVFSRDSKPLWSD
                     LSFTSCFRSTAPTLEAFRSAPPAPILSTPPRSPQHQATSSTATVATAFIPVPPKPVTA
                     SPLRDAAVSSAEAAAPAAIPAARRELRAMAHPLVPVGEDAPAVVTPLLKPVEETPMVS
                     SKSANLAPSTVNATPPVWGPEPLSLAGSEPERSASPLPTEFAKSISRPTMQQAQRDEA
                     RAAANVRNFISTLFSGGGSDETDSPTAGNRKADGFNALEFVTNRRGAQAKASQPVDYS
                     TFFNTSLFEDDHDEDSEEGLEKLRRVVLMVMQSAKNSEGNSVPQPTGQSCRRGGGVDG
                     TGVAPLTTFPSKYTEFSASYQTANNNNADDNEWMQFAR"
     gene            complement(<677276..>678439)
                     /locus_tag="LDBPK_361790"
                     /db_xref="GeneID:13388180"
     mRNA            complement(<677276..>678439)
                     /locus_tag="LDBPK_361790"
                     /product="phosphatidylinositolN-acetylglucosaminyltransfe
                     ra sesubunit c, putative"
                     /transcript_id="XM_003865246.1"
                     /db_xref="GeneID:13388180"
     CDS             complement(677276..678439)
                     /locus_tag="LDBPK_361790"
                     /codon_start=1
                     /product="phosphatidylinositolN-acetylglucosaminyltransfe
                     ra sesubunit c, putative"
                     /protein_id="XP_003865294.1"
                     /db_xref="GeneID:13388180"
                     /db_xref="GOA:E9BTN8"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:E9BTN8"
                     /translation="MSRQFSSSETLDSSQQRLEAARYAASTEEESSLPESGDYDRRSP
                     ETGHYSSRPGHLQRVPSKQITSVSPSWRKVLYERQPFEDNYVDPQQFLEELSHNKDIK
                     NYEYATVVINTLAITQEISIVVLFCHAFMGVFTNSIGKYSLLWIDVLSVLAALVCYVF
                     YQCHQDACKETAERPASLSTRCSPPPRQPSRWLFHAWNFGRQVVSLVTMLALLSPIFS
                     TLTVTYSDDTIVTLSILTMSLHVLLTDYSYLNAYTQRFDPNLSVNMAIYCVTLMASRI
                     SSPLASGALICFGIMCFSLSPIVRHLVKHYSFTAHVAITFGLVGLAIGCLTQIPILAI
                     LYTVTVLMISFGIPWLFVRMHSSVKTQINGPWDEAKPTNSAAAAEWANSGFLA"
     gene            complement(<679469..>692572)
                     /locus_tag="LDBPK_361800"
                     /db_xref="GeneID:13388181"
     mRNA            complement(<679469..>692572)
                     /locus_tag="LDBPK_361800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865247.1"
                     /db_xref="GeneID:13388181"
     CDS             complement(679469..692572)
                     /locus_tag="LDBPK_361800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865295.1"
                     /db_xref="GeneID:13388181"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR023362"
                     /db_xref="UniProtKB/TrEMBL:E9BTN9"
                     /translation="MYHYLVNALKGKSGKADGLVARSDPAITDSKAGLNARLREEEQA
                     QRVLRDRRRAYSDFMTRTPLGRVLADQMPAVESMSTAPATAFAVCQTSSSLDTRATGT
                     SVSLATGGERPSSTETGLAHTKLELTMYEALAPLLSRRTAIMTRRVLELAPQLAPAAP
                     EAARGEQASTTFTLPPPFPCQRPFVTLEEAKEALLPFLLVLVQLRHWQACLASLSATL
                     SSEAAARSESATTASDRLVKALQQLSHVLVAITCATELQTAAMRSHLDLLGGEVTACV
                     ATTLQFLRRLTRSCGTEEFSLLLGRVPAASASAAESIPRESEDAIGGGDRRDGTSTPH
                     PVSVEVVEIQACRLLSLFLYWLHVVHDISTPSLAIEELFLTSSTARFNAYAATVATAK
                     GATAGTAEAEAEEMHRCTGLSNAALLRQTGPAPSCVPLAMLSLSASDASGGSGGDKSP
                     SEGSSPLLASSSNVAGSLTALLLFASKGVVEHAQANSEAHTVMVEGLAVEEDSDLGLI
                     LVLTSRLLRYMFAAGASPHLVQVTKAAGPLQSALSLLLVRFIAGDRNPSALRAVAEKT
                     EASQSASLRSCGAQPHLDAAADFSFPRRSSLASTSQPPSPARSRCSSRASVPSEQSGR
                     LTRQLRLLGQLSCGLVLLTTLLQQNAMIVLDIMDHSFFFDALVTVLQVVGSRFTEPSR
                     QGAMAARVLDAAGRRDSDAWADWVRGVETVAAQGTAAEDISVLLNHALGSPLQFSLTL
                     LSSDPYVDEFLHAYLGLLAACRVVRSTPLAFIAPPPRGMLLGSNGAITASARESRALD
                     TLDQLELTLLKTFLTAYDTSTEDAAPAAAAAAMELSITLPPCPEQHSVDSEATDALPP
                     SGDMNATGSLTFPLASCIYNLLLKHTLWCLGEQERRRGQPLPPPPPPLTPPQAPVPPQ
                     QHHLALPLFQSSVSSAVLRLSIDNPASTATDTPRLVAQPPPTHPPVSPTLSPSTITPA
                     NLQQSAATTLPGHSSLAAITGTGSSDYDPFVLFLVRHGLFRILLHDEHFASAFALAES
                     TAAVNAADSPRGRSCDEEAADKPTTTRQRSYLVLYLLSHFLQLRPCDAGSSDGEQIAQ
                     PAGAQEGGGASADPNVSCRSACSRSSSNAALSADEQQLAQETAEALMTVLRVSSVSVS
                     PPCCAVVRCRRRRWCNCLLALLSAATAAPGAAAFAPIHVREELRAGIEIDAPSAADAK
                     TTPAAAAAVCEALVRAGGAEYLLRAAAVAADAGAAGQPANTVSCAWAMQAARSLVKNS
                     TASVHISTNCVESLLLPLLWHPSLRSDGQRLLETLLCQPLVGSGMAVDTNVDMRELSS
                     SMVSSTGKVGSDSAAADMHAVPRHCRKLCEGVWRTLCECANGSAVGGSGVEMPDAITS
                     GTRAVSTTNADKGGRQAVLRAVLGALGTAFRKLSGQRFSDAGEHSGELLPLRTLQRAL
                     FEASKDDGQHIYEFLLHELAQLWKAVDNPGTSSRPPPLNTADVAEVALSPPFPVPFLI
                     AASDAPSAPDTSPAEATEASADAVATCRAGREMVRLIVIALVGMTLANPSQREVLYRA
                     TVDEEALVRCIVNAWGTTGGSGALPFSRSMSEGDACGMVRVCSYLIYESVDAVDAFFD
                     EDGESGSQDAAPRRRGCSHDASWAWSLQNTMLLAAVLRCFTRLGSLTDDQQAALRKLL
                     VSLTRTVESCYVSLYLAASSAVHDVLAQLLPVVALLPKPATLRFSSSAETEAALPRLD
                     VVLVRLLAVLTHCHVDARQLKQLLLLVIHSRHQRDRRALVPLVLQVLSEAVQPPLNMT
                     LLHAARRDPQHFVSLHRGRGPAGFCAALPDFPLEGYSASLNVRWEGDVTSRNAAGQAA
                     GGDTTLRQYDDCACIFSLRTADRATLLAFMVERRTGRLFVQYRNLQQQELRVYLAASL
                     LPREWTHLCVSHRAAAFLTATAGGQLTLFVNGAEAAVIPQVTYPLMSRGYLYVGCLGH
                     EVDRLSVAHAFYGQVSTAYFFPYVLPEREREVLQTTVGVADTAAWMLSSSTATIPPLR
                     PGSFAPGRRPGSSASESAADADGAEQWLAGRAVVCVDTRLSDRGHLYNLSAVLRGRTG
                     RESRLLTLEGSLVCSTQRLIDSMGALGALPSVLMPLCVLLVNPNLPISSRSLAAAAPI
                     GSLAHREPGLPPFSSLGAAAVSASRASDTINASVLRVLDLVPPLASAEAIRTEMAEAR
                     FFVFLGQVLQLLGPSLQVVVPAAFVQLLEALAPFPRLFEDALTNLFLSADVIRAAPRA
                     VQLTWVKVQRFFLSAHPDALPCLRTLGTSMFVAAELLRVTAEEASEEELAQEDTLVLP
                     QTQDVVTHPLLSPTSSTSRPLSAVAGDVSRASSSATTSPFLPSSTPPPPPPSCSLQDL
                     ENQWMAYFEALAVAPVTLGDAEALQYFVGNLHLMCPKASVQLRLLRRVRQLLVTSNTP
                     YLVQLLGRRNYVVNLMPYLTSASSEAVRLEALLQLLFMVFRSKRTQELMNPVLLASKD
                     TVVHVVEEVSLSWLKDVLQRFPVNLPVYLALRCGLVERFDVLALPTQYVPLDESHAIR
                     FAAVLLPLLMLMKRSTDTKLKGYVLTDMAVLLKSDAQAWRRVITVRGWYVSVVGLFAS
                     SCASSPVPAPSSLQEARACQESSVPGAVSSPTIPTDSAARERVQTEGSGLAFATISMI
                     LSYTIYQVLLHETYGATELELVVAYLREQRLHRLLHQVLCRVADRYRSRLMAPWRGER
                     RGGTGDREGPGAPRPSNGCAFLGLGSATAVVNLCHFLRVVEVVLFYAGLAPRRKEAIM
                     APVKPAVSPFTPVGAASGGEEFGTHLPVRVGYSEWEQLTLVRSADDPPGGVAESDVYY
                     AGEVDDPHGNVRRAVLRSPDDRWLHLPLAVKCAELLCSHSALLHLGSNGNTTSLSVGG
                     AGSVVGSGSAGTGGPGDLLWSVVLGASAGTGVSSSPTSPKAGGVGGVGLGAGGGGATP
                     VVLRGGMLRLFGRLFKVLCQMTLRSGTALSSVVELTDAFVHRVDRGQRGSGFLLLKRA
                     VNAEDAREHSPIAITMTLIYCVHNLLLRRLHAAEYGNTSTHFNANAALVDRLKSLVVM
                     FRYSFEQLSAFAPSPRGRRGAHSSVFRQPSLLAAASWLTRGDREDSGGDRSSGRNSTA
                     SRARSNSTYLDDLTGETLTAGVPTLQWLCDHRANPRRTVEAFAEVASRVDYNAFAERC
                     LLAVEREQSTDKALAAKLWSEQRASLRRLQELFAENSMSRRLVHDKIQTLMAAFNSQK
                     TTGAAGETDSDAGAAGLEGHSSTRTDGFATASFTSLFLPCAARRATAAARANAWTRFT
                     VALRGTVWCADAAGLHNTLKYVKLSSQEQQFLVHRKLVYDRDGTNYCGRAMTSYSAPS
                     SPVCDDLSSVNVTSFRAMPALLEDEGESGGGLAFGGSMSANTSRASYLRLRGGEGVLL
                     QAIDDDDAGLEEDMMNFSLDGRGDVSTAAAASFSECPLLREEAAPVSKGIGPAPTSKV
                     DDFSAVPSLLSVPCEVPYMMHCWSGSFTVRGSEVIVLIDDDNKAYNQVVAEEARAYVL
                     RPRPFSFHLSHITQIAPARRFRMRRTALEIWTRDRRSCFVNFADTATMNAALQAVRCG
                     ERSSYMLTAPSFLRDAAGAATAALPTLLHEGTGGVRWHSAYVLQENPRREPLRLRATA
                     LWRNRLLSNFDYLLVLNLLAGRTLNDMTQYPVFPWILSDYTSETLDLTNPETFRDLSM
                     PMGACGNRDRRELVRQRYMEMRSLGDVPSHYFTHYSSPAITLYFLVRLPPFTTLAILL
                     QGGHFDHADRMFHSMQATFRAVMTSTQDVRELIPELYYLPELCINENHVDFGRRQDRT
                     SMDDLQLPPWAHNDPFTFVYRMREALESAHVSAHLHKWIDLIFGYKQRGKDAIDALNV
                     FNWHSYEELDRNREAGSIDQQLLVDSLDNIGQTPVQLFRRPHQPRLPLEWADPLQLPI
                     RVKVMTLRWGCARVARTTVLSTDRVLVVAGSGAAASLRMHLTPIRQPSVLQIAAATPP
                     AASTAAASQLRRASARDGVAASAPSQTEMTATHASSHVNAPAAAVPGHPATPVAVTPV
                     MNHHAPPAMDSGSFDVSEEYERRLAPIPAGVIPNNSAYADGSCTEASTALLCYDSEVF
                     LVLGGLFDNSVVIRALSGAGGDARLRAHRGRVVFVAGSEDSRYLVTGAEDTTFAVWSC
                     QLQPARQRLEVTMLFTIYGHEGMPSAVDVSSTLDVVATASLNGTLMLHSLSTGGLDRV
                     IRHPYGAPIHRVLLQTTCYVPNIVFLSHQDEKVYQYSLNGAALRTFSPPGRVATWATT
                     ASQCLLLACQPLASVRGGSSASAPGGGPQDGDQTSCILYLHSFFLEVLKTVPVRAEDV
                     VSSVSAHPTNPQVVVAGTESGQLLLLRSVLV"
     gene            complement(<694703..>697558)
                     /locus_tag="LDBPK_361810"
                     /db_xref="GeneID:13388182"
     mRNA            complement(<694703..>697558)
                     /locus_tag="LDBPK_361810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865248.1"
                     /db_xref="GeneID:13388182"
     CDS             complement(694703..697558)
                     /locus_tag="LDBPK_361810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865296.1"
                     /db_xref="GeneID:13388182"
                     /db_xref="GOA:E9BTP0"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:E9BTP0"
                     /translation="MAAKPTTCDAGEETSLMRQLELLLVPLHHRFRYPLPVPAHFTAG
                     EGDGASIAAALTRAPGSPALAGAGATGSSYADPAGTAASHFAGDSAQLSEQQQDERLH
                     RSALRVVEEHVPDLLTWQARVQRGATQAGNCYQVLERVRSSVSAMQRVTESVQKQSDH
                     LSHNASAMMVRKAKLELVRDALEQNLAHFTHIDDLCREAGNPFLKAGSARFSTLLQDI
                     AKEMEFLCTNTQYKSAKPYAMKLAVAQQTVSATLKDAVRTSFRTMEAETLASPAFRAA
                     TQVLQEDSAIPSDSPLTRASTSPSTVSMPATAAPPLQLRPHDVAGSFEEFLAAVNDVF
                     VKSGDSFTSLRRMAELRQGGFGYSGAEAFGEEMLTAGGRLEADPGMREVMNSYCEARV
                     GVVVPLLRYWLTLWYYLDAQRNSQADAKIVGSVAAAAAAVGAKSPADTGAARHQLSGV
                     AEAHTLPQLAEHICGLLQRSLAAESDVLARLWLRDDIVSHLLPRLVPSIAEEVYYMFR
                     SRLLCIDDVGELSRTVESIQRVSLLHNTGVQDSQVVSDLWVRMIQDTQERLVFRTSVY
                     LRQTVSRCTPTREIASVYLRCGTDAYTAEPAASTGDAAQTRMFYIPGVVHALKLLDWL
                     YPTLEFSVFSVFAEEAVHHSLDLIRQLMRLMRQMDSSDTLRDSKAFLCQLAHLQHLQV
                     TLSHVDANITVVEKHISLAALRNRRLELEQSSRESKKEVEMDLLKCSEHLTTAMFALV
                     TQPVSGAAKKSEAERIQLVSEMKGRAAGMERMIAFYVEHEETQQDLMHLLRERVAELA
                     AEMSVDVHAVPAAPVKMAMSEAESSTQNALQRSATEVGVAPPPPASAPQPANTAAGDS
                     ADSYHAPPQSFAAPAGAAQPAASAPVASAGATDQFAALPTHAPRAPPGFPSPPTERVT
                     YASAPPATTVCHQSPLQDYAAPTARARPSTQDGTDII"
     gene            complement(<698392..>703896)
                     /locus_tag="LDBPK_361820"
                     /db_xref="GeneID:13388183"
     mRNA            complement(<698392..>703896)
                     /locus_tag="LDBPK_361820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865249.1"
                     /db_xref="GeneID:13388183"
     CDS             complement(698392..703896)
                     /locus_tag="LDBPK_361820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865297.1"
                     /db_xref="GeneID:13388183"
                     /db_xref="UniProtKB/TrEMBL:E9BTP1"
                     /translation="MNRASVRLLGNYSRTSGAQQHSQAAHTPSFSATRSSSVLGSLVR
                     MRNQFHRLRHAQQQQAIAAVLARYQLQPALRTPAPSTSRAAGQIDGDDSVGQEGSGDT
                     GGSTASSVLQTAIILCTEALRLLNGEVRCRDNLSDVPKSSPMYGSEIGKLLNIAAAFG
                     ASTTFPRVQHALHWIKLNKESLQTPRQVMSLCMPLLNLGDGRTAGVAFVLEELYEPLL
                     LALQDVASTSLESAAESANNAPSDATAAVQQHLVAITSAMGMVAKWSSLRLGSKSKDS
                     LTSLPSEVHTAAKSDATAEELDKMLRVAEACAAALRRQSDRCRGTGPDEAFAAMAHLS
                     PSDVLQWIQCLHGLEKMYALVAPTLGVSRAQAETASRRLLLCYRALLPLTQRTLELTG
                     GGGGATVAAASSTTLATGATAANVRVTDVVELIQVGLQTSIEPTHVDLALSYGLQALP
                     GALASATVKDLSDAAQVVNKVRQKRPSALPAPLLLSIQAAFRPALFLLRETHALQLRA
                     SDCGVLLSSLSRWEEVPGVTVSADIVELLSQRFGEQMHVVGASQLVPFVASLARFEER
                     NRSPQRGGAAGHAVENAAVLDEDLAGDGAQLAYSGVAWKTSEGRADGLTSSPVHGART
                     RGAEGVRYRFCTTSRVVSQCVQRAIVLAGDIETPGDPAVPPRLSAADAAQLLTHFVQL
                     SAPQCADFFNKVEPLLVPAMQGSADTPSPASAAIRLRVVTGDAVQRFVRYAAQQREHT
                     WAQRTNSTTQETRKEASVVEVRRATALLSGMSRDLTKLIREAATPKDLVLACSLLRRR
                     LLDKGAAAGAVVDSDEGARKKLKSTKTSTAVARARARAWTRKELELATVFAAQAAKMA
                     PKCKGVELGALASVTSSLCTAGVLPRSVAQEFMRAVWARCAAGLAVASRGEAAGPEAA
                     AALTLSLENCKTIMDASRSAHLARTVPPVIFLEAFAAQCSELREGRLGVVGGEESPST
                     ARGTARAYAEAVTKLRRTADLGRSLVSYFGSLRPSRGAAEGDAAMQSTTWREAQVSAL
                     ESYLEVAHSVAEAYATEATLSETWWAELDGGSPPPMPLELLSTTANVMAQIYRLVHRR
                     VGSTKRVSSIPATAPTVPDEVPDAEGDVLDGSLAAVDDAGAAVLSELESKVLEDDVEP
                     SLLVDDSPANLFTATLDQAVHDILGLLGDTIVALARQQQQQLSSSVSANVSGETATED
                     YGGRLTTAPGHALVQNPKHLLMLLRAFETVDHPHPEMLYSVLPELRGCADRLDPLELS
                     LLIRALTQLGAWNSRLLSALATAVASKMNQCELRQCYTLLHGLCRSGCTSPDTYVELR
                     STPHRDWDSGRGGASNKAAAQEPLQRLAENTLLRLDAFVRTKDAFMSLSRTAAVADLV
                     GVVKALRFFHAPPPATYDAFVVLAVRRLASQAKLLSLGTVVQHTMALLNAVSELRQPE
                     QQRVSAQALWTVLRRAFASSTEAGEPGALTAAAGDAFAGVLHLPACWELTRFAALHSL
                     QYGREATRDFFAPIAASTTEQRAVSCAHLTQTRLARFIDTYASDLTAHTRSPSPPLTA
                     AERAALRRYALHASPCLVRGDRELDVYMCAPLKLARLIADGDPTTLVHAATTAAPAAQ
                     ARRCIRLLACLLRTDLWPPSISAATADTQMLVAALLRLWTAAELHGLLRHSPGAFSTE
                     ELLVLAAAADRVHQHSVDAGNLQDDFAVTVRQLCAATTEWRLPAAVDAWMLFAMPFMA
                     SSSMPSAALTNFSDELFLMLVASGDVLVTRFAHAQRSWATRGARMLPELLRLFRGPGQ
                     LDVAMLQSGAVGSDTLSFALPHTAADAPAARARFLEMYKELLRCFTLCLA"
     gene            complement(<705497..>707131)
                     /locus_tag="LDBPK_361830"
                     /db_xref="GeneID:13388184"
     mRNA            complement(<705497..>707131)
                     /locus_tag="LDBPK_361830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865250.1"
                     /db_xref="GeneID:13388184"
     CDS             complement(705497..707131)
                     /locus_tag="LDBPK_361830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865298.1"
                     /db_xref="GeneID:13388184"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="UniProtKB/TrEMBL:E9BTP2"
                     /translation="MPPRSSHAVVTLAAALLLAMFACSHSGHALCPSNGNTHTVYVTS
                     NMGDNIWSFDTLGNYLGPVLNKASFPPGVRVDKLRSMRFGPQGHLYVSSARGSYSRVF
                     AVSGNGLLNGTMEENCTRDYLFTVIEQDKENPFLDHPYDITFHPATEDMYVSNQNSVT
                     VTRYTRYRTADVTPKAGAGGSQHAFYPAWKPAKNVKAAVEADEETVSAEETVVAPKNI
                     PDSSGLFASSWSSSYSMSSVRGLAISPLLPRALVEGGAPSGVFAVTNESTMYYLLVCD
                     VSSNTVHVFDPESGERLFGLNVPSPIQVMFPNRYYISDSSSLSVSAAGVHTQRFDVPY
                     IYVTSKEDGMAYMVRFSSRQGNTNNNGMQGGAFGEDFIRAHRLYTINHPTPLHAASGI
                     YENSARDVLLIADRNGRRIYSYASPFLTDYTSGYGPSPFLGFFVKHLPDQPEFIMSTL
                     LEHQENIPFCYELNKDGKFRYVALCTAASIWSVALALVLILVPSFIAYRQIQNCMYGQ
                     KQQRRQRYLDEDASALYGSGSSSPLLGRRAPNYGSA"
     gene            complement(<708441..>709970)
                     /locus_tag="LDBPK_361840"
                     /db_xref="GeneID:13388185"
     mRNA            complement(<708441..>709970)
                     /locus_tag="LDBPK_361840"
                     /product="aldehyde dehydrogenase, putative"
                     /transcript_id="XM_003865251.1"
                     /db_xref="GeneID:13388185"
     CDS             complement(708441..709970)
                     /locus_tag="LDBPK_361840"
                     /codon_start=1
                     /product="aldehyde dehydrogenase, putative"
                     /protein_id="XP_003865299.1"
                     /db_xref="GeneID:13388185"
                     /db_xref="GOA:E9BTP3"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:E9BTP3"
                     /translation="MSKLFRTVGAKGFQPFDWANAAQYASGTTPMMREPACYINGAWV
                     ASALSDKTVTVEDPCTNQIIGAIPCMGYAETTAAIEAARAVFESWREVMPRQRAAAVR
                     RWGELMRKHCDVVANILSRESGKVIAEGKVEVLYAQGYADWYAGEAERIYGDIIPGPR
                     PGVQTTVFREPVGVVGIITPWNFPAAMIMRAACGAIAAGCTVVLKPAELTPFTAMALA
                     QLADEAGIPPGVFNVVAGDAPKIGDALAESFDVRKVSFTGSTRVGQHLYRRCSETMKK
                     VSMELGGNAPCIVFEDADLPRAADQLIAAKFRNAGQTCICVNRALVQASVYEEFKSLV
                     ADRVRALKVGNSFDPAVKVGAMIGSATLERMTRVVEDAVEKGATLMVGGKAVKGGGYF
                     FEPTLLTNVPHDATLCCHDELFGPVLPLVPFDTEDAAVKMANDTRAGLASYFFTSDYR
                     RQHRVARALRYGMVGVNDSALSSPAAPFGGVKESGLGRDGSKYGIESFVDIKYVLFST
                     V"
     gene            complement(<712226..>712546)
                     /locus_tag="LDBPK_361850"
                     /db_xref="GeneID:13388186"
     mRNA            complement(<712226..>712546)
                     /locus_tag="LDBPK_361850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865252.1"
                     /db_xref="GeneID:13388186"
     CDS             complement(712226..712546)
                     /locus_tag="LDBPK_361850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865300.1"
                     /db_xref="GeneID:13388186"
                     /db_xref="UniProtKB/TrEMBL:E9BTP4"
                     /translation="MFRRALGASAGRSLSSISAAVSRRSYTELSHMKFPVYYGAVGVV
                     LGYFVVMWIIFLRMGSKHTARSEFKNDYLRVWRRRLGTGYQWADAWGPQMDTFFKDLP
                     EEVE"
     gene            complement(<713551..>715788)
                     /locus_tag="LDBPK_361860"
                     /db_xref="GeneID:13388187"
     mRNA            complement(<713551..>715788)
                     /locus_tag="LDBPK_361860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865253.1"
                     /db_xref="GeneID:13388187"
     CDS             complement(713551..715788)
                     /locus_tag="LDBPK_361860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865301.1"
                     /db_xref="GeneID:13388187"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BTP5"
                     /translation="MPLLPLSSTLTSRAWGDPTSSITAFKVREKHEAGMRLLQGGLVY
                     EAIQLFQEASFFDAENVRPIVALAECYVFLCDLRSAVRCYRRALLSLHKKDMDDYCRR
                     ANENPTDTVDEVSATHSCRVDAPNSPERTWRNGGKTRSSDVPDDMRGGTWEARLKTAQ
                     DPAPASFQSAGGSSPSDCSIQGFADGLHSTEMAARFSEQQPSLAKSVDSAASEVPATT
                     LSLPAPGAAPTLKDIRARLAGVLDALGLSLYQLGSVEQALRCTNEALELLDAAARVGE
                     GEDEDIPSSKSPQFLVDPTIALHRGVYLIALQRDEEAEALLEDHFAIFPRWRPQTAAL
                     LVQLYCNRQAFRKARVLLEAQEEKEACNTDSSKAPIEVHGNVHEGLCSARRRTLAPSL
                     PSSADALGSLAVAKYLFTELYARYRTAALASNDEASITRCLSIYSNDFDLLFRRAQLN
                     VAAGKHKQSVKDLFRCVRETNGEHKEAIEVMTTVLFTIGSSLNGEAEVQDAVTYYSES
                     LKWRPDNVLVLLARGDCYTKMECFEEALADYEAVLGLESDQRDARQRIASLHDLWGRK
                     LFAQNQPEQAEVEFTNAIKTDGRNPQFYYHRALCRLKLDQGRYALRDVLSCKELHPTA
                     PHLRAFIARYLEPVQPPEASQRRNTPHAAKRRAAAASVCAARAPPPLSDCEELPALQR
                     RRDSDTADTSLHPANGGASTATGVLPRIQRRASLQKRSAVVGWVQGCQTTLHRRETGV
                     HAPVK"
     gene            complement(<716917..>719556)
                     /locus_tag="LDBPK_361870"
                     /db_xref="GeneID:13388188"
     mRNA            complement(<716917..>719556)
                     /locus_tag="LDBPK_361870"
                     /product="exoribonuclease 2, putative"
                     /transcript_id="XM_003865254.1"
                     /db_xref="GeneID:13388188"
     CDS             complement(716917..719556)
                     /locus_tag="LDBPK_361870"
                     /codon_start=1
                     /product="exoribonuclease 2, putative"
                     /protein_id="XP_003865302.1"
                     /db_xref="GeneID:13388188"
                     /db_xref="GOA:E9BTP6"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:E9BTP6"
                     /translation="MGIAGFFLWLQRWYGDCIDNIPQDVVDAAFKGQTLPHSHASAYS
                     YDNFYVDMNGLIHPCCHDTAPLPEPENEEEMFERMFDQLDLLVRVVRPKKCLVLCVDG
                     VAPRSKMNQQRSRRFRAADERLESDAISNACADRIVSEYHLPRPRVRERWDHNVITPS
                     TAFMERVALALEWYIMKKLNEDAAWRHLTVVFSDAHVPGEGEHKIMQYIRGLRSQPGY
                     DYNTSHVIHGMDADLICLGLSTHEKHVCILRNQLTETFQPDHNRFCYFNLSTYREKLM
                     QDFSNIEGMQFERVVDDFIFLCFFVGNDFLPHVPLVSIKTRGIEMLLDHYVRDFALHG
                     YLTQLGEVDYAHLHIFLMNFTSKCMMKLTKEYYGVVRAKERAKQHVEERVTKTEAQVS
                     EVLGTLLPDRSNAQEVSDALLALMSSARKERTRLVVDKQPLGFSYLDKAYRDAYYQHK
                     FGWDPSANRAAFESHIRLCCAEYLRGLQWVMRYYTKGCPSWEWYFPYHYAPLLQDLAA
                     FTATVNVEMRMSAPLHPVEQLLAVLPRLSVHALPEELHEAVNDPKSVLGKFYPAIVDV
                     DFSEANFSYQGVLRIPFINCEALSKACRQLVELEEDFGSTFLYCHESTSLAKQLDALT
                     GPSNSALPLATSLAPPVMPIPASVASTMPVAGRVGRYEAEWPRHEELQCPDPGMAKST
                     RYGGRIKSNQVNQYRYELSTQADYRPVLMGEEKATKNGAAAAAASKTSKRLEKEQSPP
                     RHRKRGRDADHVVNSNDAKRKRGSSRHDDDRDRRERHRSNGEREQNGGSRRRSKDVDT
                     CGASSSSPHTSSSKHRSKEEEKKRSQHETGSRESKSEAHPAPLSSSSRRAKKSREAKK
                     ELRPSEKVTPTKPSRHAHRQRRA"
     gene            complement(<720770..>721516)
                     /locus_tag="LDBPK_361880"
                     /db_xref="GeneID:13388189"
     mRNA            complement(<720770..>721516)
                     /locus_tag="LDBPK_361880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865255.1"
                     /db_xref="GeneID:13388189"
     CDS             complement(720770..721516)
                     /locus_tag="LDBPK_361880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865303.1"
                     /db_xref="GeneID:13388189"
                     /db_xref="UniProtKB/TrEMBL:E9BTP7"
                     /translation="MQRMEKIVRLLAKRISREANTMAERARQALTEQQRLLQRNFRKS
                     WKTKMLVYEENASAMLAAAEQHHYAERVREDARAHEELRSARAGGSVAHSWSSKVQHL
                     QSELQMYLRQHRYREAERVQAQLSRFEKQEQQAQQRNITHLQEQRLQAMRVKQEEQLA
                     KIKAAHQQEKQEIARTCRAELDAMTRQHEAALQAVEERRLFLHERVQAILKAYNDADA
                     LDPRATGLKLIRISQLLWTSREVQQPSEHI"
     gene            complement(<723050..>725866)
                     /locus_tag="LDBPK_361890"
                     /db_xref="GeneID:13388190"
     mRNA            complement(<723050..>725866)
                     /locus_tag="LDBPK_361890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865256.1"
                     /db_xref="GeneID:13388190"
     CDS             complement(723050..725866)
                     /locus_tag="LDBPK_361890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865304.1"
                     /db_xref="GeneID:13388190"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9BTP8"
                     /translation="MTTTTARPTTSSSRSCLMNMSAPLDLQPTMVDPSSPFPVDGKVG
                     AQHSVSYFTVALTQPALVVIRMKEGNTASRCALFLSCFYPKPDANNAAWRLISPEPVK
                     QIVLHPADPAYCVDTLHIAVHYLEPSGQSNFQLQVRVQSEFFAMWLRTNEEMRAATGA
                     AAADHVTAVKTLPSPGTLASGKCSEANAVALPAVPTLHAMLAASAARLSGCAAISAGA
                     PFTSLYVGDWRGDQRDGLGFQYYAAPEEVLSQTMLTKNDVTDVEHSIAGHTDGRDCDA
                     ICTSTSQQAVTVSGVDVAQPLMLLRAFSERHNLPWSAWSIPDTLTPEELARLGFGFCF
                     HSTSRARGGIAATGSKSDHAAVPVKGAATPSPTGDFSLAGTVTLPPTLPVAPCSTAAE
                     GMAALGGFIGSFLVGEIMSDEADDWKVLPVQPGVEVYAGEWVANKKEGKGAYQWLDRS
                     YVGEWVDGRREGHGFLRRQDGRWYRGQWERHVPHGHGEARLTPEGLLYKGEWRDGRRH
                     GSGALTYPNGMTVHGMWIGDELQPCVRVVYKDGSTYDGLWDPEEACRQGQGTWTDTQG
                     CKHTHEWQHDIRVGAGQEVYPNGVVLDGVWRAGELVEGTYVFPNGDRHVGSLDAVLHV
                     REGVGTTVSADGASVYTGAWHQDKRSGYGVQTVQRPPLACKSGEPAERPSVERYEGEW
                     LDDLRSGQGRLTDDDGIYEGEFALGYRDGSGVQRNTRTGSFYEGSWRANRRCGAGTYY
                     SATQGITYEGIFMHDRLTSIGTATNTALAEKYTGSWLDGLQQGHGSLRLANGDVLRGV
                     WHRGVPDATATVEYIDADPLADGPRRGVAAVSRYVGGWQGGAREGTGTQVFRDGSVYE
                     GTWHANKQQGRGRLTTASGETVECEWRNGSIVDGCIGDVHFADGSAYHGHVNVAGVPH
                     GAGVLTYPDSTVFDGQFFNGVYQL"
     gap             728352..728450
                     /estimated_length=99
     gene            complement(<728712..>731333)
                     /locus_tag="LDBPK_361900"
                     /db_xref="GeneID:13388191"
     mRNA            complement(<728712..>731333)
                     /locus_tag="LDBPK_361900"
                     /product="ras-like small GTPases, putative"
                     /transcript_id="XM_003865257.1"
                     /db_xref="GeneID:13388191"
     CDS             complement(728712..731333)
                     /locus_tag="LDBPK_361900"
                     /codon_start=1
                     /product="ras-like small GTPases, putative"
                     /protein_id="XP_003865305.1"
                     /db_xref="GeneID:13388191"
                     /db_xref="GOA:E9BTP9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTP9"
                     /translation="MAGDFSMSCSTDESAFMPEIRVVVLGDAKVGKTSLLRQYLHHEK
                     PSRSTGYESTLLDSYTHVDYCGTQPYRLIFTDCSSAPSFHEHRAAYLAKCDVVILVYS
                     ARHRKTLLNLRHWMEEVLEARGLTGPARCASTTGDFGEVPIFVVGTHYREKDSSEATN
                     PTSTDEAESITKECLQSAGYFINENDADTEEALRSNSVRSQKAQQRRQQRQGPKERRS
                     PRAFHDFLHKLFHSNADGEGRDAATLKKATSDEVTACQQHQPASPVSNNGCLSPASST
                     PMLPQVKSGIANDKTKSSNATSALRIPPGASTRLPLFQLSNTDGKAVDMAMRAALTLH
                     LWLQRHEGDSVALSAAHTPHSSSATASKPEDAAAQSAPPHESSKSADDGAGAAIESTA
                     EPLTVPPATLHAHAISSASHMSYVSERSVASFIPPMLALYNVGVSGSVCGESTETPTL
                     RHSRGVSYVMQTAGSSPSAAQQPPQANSITEPSRESAFSCCGNGSSEVTMGASNEGKA
                     TDQRALGEVCSQALERRGKRTEDRAPSYSSNVNSVCKEGKKDDAAHPGHLQESMPKTA
                     ALVSSSELGGTAASGASIKAGELMKGKTHSCLSLPDTISAAAPDTDSREANGVAGKVG
                     GKFSTISGPMMPDGALPLSTAPSSATSLRADAVTGDGIVAVSQQPTLRVRKEMDVGKE
                     GDGVGTGCCGDRPTRKSEPVTKLPLECEPDSDPNSFPMLRRSRENGSAGVSAVRAASA
                     EPLASSVHTTNNRNNAPFAAKLSPRDECVSSRSPYSTPNTGIGAVKNEAAGNKSAQER
                     EPVALPRQPRSSSAAREPKVSQSEPSRPQKGRQTKSKGKRDPKHQRRSATSTRILIGR
                     QQKQKTTQCIAGGCAGM"
     gap             732774..732872
                     /estimated_length=99
     gene            complement(<735056..>736765)
                     /locus_tag="LDBPK_361910"
                     /db_xref="GeneID:13388192"
     mRNA            complement(<735056..>736765)
                     /locus_tag="LDBPK_361910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865258.1"
                     /db_xref="GeneID:13388192"
     CDS             complement(735056..736765)
                     /locus_tag="LDBPK_361910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865306.1"
                     /db_xref="GeneID:13388192"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ0"
                     /translation="MWRRSGRGAELPELLRPTMQPESVVLSDSDDDDVTAPLSRRSSP
                     IVTAVDEVRGGSRFQRRRRVDEDPSGAGGVGGTAALRGPCDVRFAQVSSLSESLADIV
                     SSSRSTAHSSLTSIAAAAASSAVAQNRISSVGHGSAGDAGEACIPRRSATVMDPNFSS
                     ILPDEEELAIRRRLQRGRNRQAPHSRSNSDIRGAGVAALKQERQHPVGARVGAGNVME
                     LFVIRATQPAPLDWQQPLQPEVRRRTSSRCASGVSVSAAGGMAATASVHQSIASRAHA
                     ADVWPPQSQRRSASSTLLSPPWLTVAYVSRLTVALLSALVCVWCVAAVASPLMALQPR
                     YALLVVARADSVAAEAQFVQTHANSVAELQALYKIAPTSLGADAVVRLHHRTLSEGVE
                     RLERATQHLVPDDNAPPWRRLFYLRAMIRAYLALSRNCELYARSRDASHWRRYVVYPL
                     ADMKLYGVRRFGSIASGSSITTSAAVAWRDRVWTTVACSAQSEVLACPSVLYVEEAMA
                     RDAAQFVYTDVNEAHESPHRKRKLQDWRVRLHRDWTSEVYLETLLRYIRSGVQGLTRN
                     YNR"
     gene            complement(<739483..>741459)
                     /locus_tag="LDBPK_361920"
                     /db_xref="GeneID:13388193"
     mRNA            complement(<739483..>741459)
                     /locus_tag="LDBPK_361920"
                     /product="DEAD box RNA helicase, putative"
                     /transcript_id="XM_003865259.1"
                     /db_xref="GeneID:13388193"
     CDS             complement(739483..741459)
                     /locus_tag="LDBPK_361920"
                     /codon_start=1
                     /product="DEAD box RNA helicase, putative"
                     /protein_id="XP_003865307.1"
                     /db_xref="GeneID:13388193"
                     /db_xref="GOA:E9BTQ1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ1"
                     /translation="MSARAPTSLWLGDHNDKAAVAAAEQSTKKRRRLRHHRCKAAREA
                     ASKTADGPYDELAETVENNDEVKSVEETPEAASNVASTKRSEKRRREDDSDDDEEADA
                     DATASSARPCNPQKRGAAEGGKTSSPSASASPAASSSPNGPTAVSMTQRSKELAKSIP
                     AVTDYKSLQLNPHIVSALEQEFKFKELTPIQSRCIPAALQGRDLLAEAKTGAGKTLAF
                     LIPIVEIVCRSGFRPSNGTAAIIIGPTRELCLQIEGVLLKLLKHFNGSLTFLCCIGGQ
                     SRNQEGFKLANGVMIVVASPGRLLDHLKLTTDWHTKNLLLLAVDEADRVLDNGFEEDM
                     REIVALLPKNRQTFLFSATQTTRVEQLARISFHKTPIFISMKSKKDKATVDTLEQGYV
                     VCASEQRLLVLYHFVKKNLKKKVIVFFSSRNSVSFHCELFNYIDVPCIAFHGKQKQHQ
                     RSATYMQFCNAPSGVLFTTDVAARGLDIPEVDWIVQFDPPDDPVKYVHRVGRTARAGR
                     CGNALMFLLPQEELFLKYLYDDAKVKVNEYTFDLTRLKGNVQGQLEQLVSSNYYLRTS
                     ARQAYEGYLLSYSSCQLKNVFNIQNLDLAAVARGFALSEPPPIKMDLSQSAAHMNKKS
                     RHEFSAMRHTKDAKRRDVNAKSMNKRHQNISGEW"
     gene            complement(<742644..>744227)
                     /locus_tag="LDBPK_361930"
                     /db_xref="GeneID:13388194"
     mRNA            complement(<742644..>744227)
                     /locus_tag="LDBPK_361930"
                     /product="DEAD box RNA helicase, putative"
                     /transcript_id="XM_003865260.1"
                     /db_xref="GeneID:13388194"
     CDS             complement(742644..744227)
                     /locus_tag="LDBPK_361930"
                     /codon_start=1
                     /product="DEAD box RNA helicase, putative"
                     /protein_id="XP_003865308.1"
                     /db_xref="GeneID:13388194"
                     /db_xref="GOA:E9BTQ2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ2"
                     /translation="MSSAPRKLTTAMREDDDGGNRGNRTSMQAWSTSSVKHQSLGSEL
                     LDDEEFKTKTFQDLGLCQELCTACADAGWQHPTRIQASAITVFAEGRDLIGVAQTGSG
                     KTGAYALPLVNWLLAQRKTPYLSVLVMVPTRELAQQVTAQFVLLGRSVGLRVATLVGG
                     ADMVEQACELSKRPHVVVGTPGRVKDHLSNTKGFKLVKLHALVLDEADKMLDMDYEKE
                     IDAILEQLPQNRRTMLFSATLSTKIDRLQKASLRDPVLLQVHRKNTTVDTLKQYYIFA
                     PFAQMLSYLHLFLTKETGNHILIFCRSAALVHKITLTLRILGHRALPLMGRMDQSNRN
                     IALTKFKEGKVRMLICTDVAQRGLDIPHTDVVVNFSLPDHVEDYIHRVGRTARAGAEG
                     KAVNLISQYDIVLLQKIEQQTGVKCVEYPFLPESEVQLVLQRVEDAEQEAIREIREDA
                     EERSLEKESRQLTTARKGKRDRGDADMGYDDAKHGTSDFATLRMRREHESIFEMTKKE
                     QHKSLWAKRREAKQQAKSR"
     gene            complement(<745098..>746393)
                     /locus_tag="LDBPK_361940"
                     /db_xref="GeneID:13388195"
     mRNA            complement(<745098..>746393)
                     /locus_tag="LDBPK_361940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865261.1"
                     /db_xref="GeneID:13388195"
     CDS             complement(745098..746393)
                     /locus_tag="LDBPK_361940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865309.1"
                     /db_xref="GeneID:13388195"
                     /db_xref="GOA:E9BTQ3"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ3"
                     /translation="MLRPTCPVAKNLTSFATKGTMRGGIPRIYYTWMKPGSATRRRFE
                     KMRNPFVNLETGTSLYFRDTRDSAEAVAHAADSKGLKGMDNGIDLYNEYKIVPDLYPE
                     GFQWKHKLNTEYNQWRSNTWLTPELIPQEHRGRFLCNFQLNIVAYDMRVVKFSPKDHR
                     QWIYCVLYVGTGKGIAGFGRAVAPSTQEARNEAIREAFSNIIAVDLEQEGPMYPVRIN
                     ADGARVLLYPARRIIANFRVADILCAFGFQNAGCKINLKASNNPKAPTHTVEGVFEAV
                     KALRSVSEIAASRGKVPHSLVYNIYPYLEEMRRRKGMMAMHPPGKDGIFMPNRVVDNR
                     MPDHLKKGYYDDVYWKDFFAGSKEQLNEPKMGLRGDELRAQLEESQGRAAKRSNRRTL
                     DDVLRRLGKTPRDLGALQVVNPRLDAKLPTHVKRNYLLH"
     gene            complement(<748050..>750680)
                     /locus_tag="LDBPK_361950"
                     /db_xref="GeneID:13388196"
     mRNA            complement(<748050..>750680)
                     /locus_tag="LDBPK_361950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865262.1"
                     /db_xref="GeneID:13388196"
     CDS             complement(748050..750680)
                     /locus_tag="LDBPK_361950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865310.1"
                     /db_xref="GeneID:13388196"
                     /db_xref="InterPro:IPR002499"
                     /db_xref="InterPro:IPR021870"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ4"
                     /translation="MTETVLRLGPQEYAHLTNLNTNTTELILGPLNRPVASHESVALP
                     PTKFVVVPPTQYCLVANPHRTAIDPTTGIAQPVRDAYGQVQVRSGEEEYRWHVPPFPL
                     YPEEAVVKIEDLKVLSARAALQIQVLTAYKVPACSASDSTPSPARREAGERYLFCGPG
                     TYYPRVEERIEEEVTAYTVERGSALWCTTSETFTDSVTGLKHYADDKYMYVAEGMHFL
                     QPFESLQRFAKGIVLSTEEGLHVQPTKTYADPRTPFREKGITRKANEPFLVTGDLCPC
                     FVLHPYDQLLKTVKRTHVSASQYAVILNPVGDDGKASVGARRIVTDAFFFLKPGETLE
                     KDHPRSAYLLCEQEAVLVTALGSFTDSSCTPPVQRYDGDRWLVQGPCSFIPSDLMRVI
                     PNEKTGAEVRRPYLLSEGDGLYVRNGVTGVVRCIPGPCSYLLTAEEEVWEKPLPAQVE
                     RHLAQLVSHAAYIELERDKERKVLQGQTERAVSYHIPYRSVTQLYNYKTQMTRIVFGP
                     DRVLLEPDEAFTVVSLSGSPWDPAKPTKCMPKHTNYITALHLFLGPSNMTDVVHVETR
                     DHAQLALQLCYDWYFDVTPGDTETAKECFSVNDFVGDACSYIASRIRAAVASMPFEEF
                     HKNSARCLRRAVFDVNPATGQPNGLLRFPANHLVVTSVDTQEMEVLDERTRQGLQKSV
                     KMAIEITTHAQEAEAQQVAMAREQEARGRLERQRMHDKVANEEQRRVLLHAESNGLAI
                     VSSGKSKAMAEALSCASRIESEASVEAATMRAAKELLLYNTMNEMQNKKRLLLAEQEE
                     KVAAMTLAYEKELEEVRHTLMGRVVAALGPETIAEIARAAPELQAKLLASLGLEGYLV
                     TDGSSPINLFKAASGLVGHV"
     gene            complement(<752204..>754105)
                     /locus_tag="LDBPK_361960"
                     /db_xref="GeneID:13388197"
     mRNA            complement(<752204..>754105)
                     /locus_tag="LDBPK_361960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865263.1"
                     /db_xref="GeneID:13388197"
     CDS             complement(752204..754105)
                     /locus_tag="LDBPK_361960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865311.1"
                     /db_xref="GeneID:13388197"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ5"
                     /translation="MQRYLMNTSYLQGQLKSLYSLHNKTVADYGELVQNLNEECTILC
                     DVIPSYRISNTLASEDGGGQRKQKEVYNIQKLEHEILTQYTHFLQLLRKLSRKSHPEQ
                     QALGSRLCARLVKSSAPEFNHADALLSLAIDFANSKSVRVAQPCQTALSEVLDGQKVS
                     DTTEHVVGALLRIVRKRSYAMNPKLLNLLLHVRVAMVDVHREDLAEEKAKNKRLKKED
                     KELARQLQKSKARRDRAEIAAKQTRILHRIFVIYLRVIEASKACSPVHQTKILAPTLE
                     GLVKFAPLVNLELYQQLMEALKDLVKGGGASRTRLRVGGIEGGSDGDNVDDKHEKTAT
                     SVTTRLHALVAVATLAQRDATATASEWRVDLSYFHEVLFRCLGEALELPSAESSSSAK
                     MTREEEQEASNGDMDEVASQGSTSSAGSLSSQAFSIAQSMTQGTFVHQNASREWTFHV
                     GLVLRAVDLLVLTQKHLPVARVTAILRRLIQAAPSCPPHIAMSILALCHRIVLRYPLA
                     GGVIVGGSDNVVAGRGAYNPEALQTASANADSSFTWELSLLLHSYHPTLRQVAETMCK
                     HYHKVSKHQHGQAPIVTKQLDSLGPYEVMEEYDPSLGDLKPAAPLPTALKAEVRKRQR
                     EEAQAYGVA"
     gene            complement(<755279..>755818)
                     /locus_tag="LDBPK_361970"
                     /db_xref="GeneID:13388198"
     mRNA            complement(<755279..>755818)
                     /locus_tag="LDBPK_361970"
                     /product="endochitinase, putative"
                     /transcript_id="XM_003865264.1"
                     /db_xref="GeneID:13388198"
     CDS             complement(755279..755818)
                     /locus_tag="LDBPK_361970"
                     /codon_start=1
                     /product="endochitinase, putative"
                     /protein_id="XP_003865312.1"
                     /db_xref="GeneID:13388198"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ6"
                     /translation="MAACAGLRLGVVRVLLVVAIVCGLRAAVVTAEESSLSSPIVCTC
                     RCCYQGGCSPLTNVSWTVSSCNECSTKMCNDYISSQQVRADTARLFEGIQGEKPLNDT
                     VVVQECEVIAVLEAATCTTKSCKRTSTIKAECYDRNAPLIKYSIISFVLLTIFAVILG
                     IIKNYIPAFQSLNEKYFNY"
     gene            complement(<757333..>762300)
                     /locus_tag="LDBPK_361980"
                     /db_xref="GeneID:13388199"
     mRNA            complement(<757333..>762300)
                     /locus_tag="LDBPK_361980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865265.1"
                     /db_xref="GeneID:13388199"
     CDS             complement(757333..762300)
                     /locus_tag="LDBPK_361980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865313.1"
                     /db_xref="GeneID:13388199"
                     /db_xref="GOA:E9BTQ7"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ7"
                     /translation="MVLNLFSGAALNGHGSTNRRGRASSSLSSTGTGRRPQQQRRQAS
                     RSATDGASMQTDGAEQSGSGVRAEAAEDRVLFNNCVAQVQRHLKTHADSPSTLHTLAS
                     YYTKTEPFIEGRPFCVTLSYATFLFHMQMARISVADVELYVQLVTSVLSQITEDDQLH
                     HPFVQQVLRDHVFGLPSPTCRGAAHSVVLLSPQQYRAFATMTTALISLAVVPLSIVYQ
                     FHDRLETYCECASPLVANRALALLVQTVGEVRMDEQVTALQYVLKTKPVKMNVDFLLA
                     CYERLKRAVIDPAHGPSFGRALSIHCSELFLRFRSPVRRDYVERFLYPSLCHSDMAGF
                     LEIPATRKHLLRELLSQCTPGMGTMNPFYMCLCAVLQSCFDNETDGALETVALINCHM
                     PHAAYFMSTLAVDSHMSVPMFAKVMISLARGAGMAMTGRETPDEVAASINENRTSVYN
                     VLFLLREVVRSCSTTASRRATDMLKALRVAVAPKTIEALGKLSSEAFEAVSDITLDPQ
                     LLCAELAMVLHQDHIAEAMDSAVEYFRDVRSRCPYCAAARSSSLLCPVNSTVHVAGQA
                     SVSRVLSTLSECAGAKAVEEKLIGYLRDPALQMESAVHYLIYHIIANGGQHRNTLFVA
                     VEPYVRSTLLALVSADRSGVRGLVDSTLKANVLMLHVKLVTLLASSIDPSYLESILKV
                     FSELRVRNNHDALALWYMGNVLLRSCRGNLELLPTDPQENNYCVAFPGCAPASATTAD
                     NAQLVLKLLHRAHSFSPEMNKLVGCCVCKLIQDFNMQAPNICSTLLSPFGFFPVGLES
                     LNAFALPAGAGSTFWSFFLQQMRSSAPARTAFMATLAKSLSRRFRIASPRDALAPHGV
                     EPTGHLFVIMVYEAMKRNPPLARVLLYMVSHWMKQAGHPPGKLACLVYVCVQLITVVV
                     DRAEGPAAAEVEAETPQDRQQFDDAVKKAARVLKSQQARLDKLAPTARRDNIEFFHLL
                     RRLQRRVRCTVAAASGEIVVGDEAAEECDDHDDAFDASSAGGHVRQDSITDAVCAMQE
                     LQNAADNSVFDDYADDVDHEDDGAYGNDDGACDAASPGLGRSAQTEGSGDRAEGPPAP
                     MRIRHLPQGITSILRSPARSSPDKSDRGAASVETGSTTSVNTYREANRQIDVEDVPHD
                     ADGAGAEMRSRHGKAAHSCALGAEPRTRSTSRGVQTDTSLTSPALSGHAPQRSVGTSP
                     IQPAGTSSHILVTRRDGIQLPCRAPADAGSAHTLSSSLYQPQRSHTRPPEADSVLSEG
                     TRTPAQRGSTWREPDLADYVDGDTTPIDDYTGVPRLQATTTSDGIVLPSGMVLEYLRT
                     HQGMDSLQHELRQFDQQWMMQQVAEYVSQNGGMVGAAGPSSALRGGVSSVQSVTVEGR
                     TNNYSRPHADPTELAPTRTVRTEVRMAGPATSYSRPPRQEEHGPVVAAAPGLPEEEEV
                     DVVDGEHPIRAVSGPPDDSDFAGGAGDDETTKRRRVEATEGNATTPLPPPVSPTSAFR
                     GRNFFLNQHTQQEVSSTLQDIHYLQRRQQANMSALAKAQSAAETAESTGDDEAPRKTP
                     HQGQSSTGVAGEGVPPTTPYGQVILPTWIVEQRNDTAIRELRQVMGAHNPNDSRLSTS
                     AGKRSRIHGSGTGDGSGNSAAWWAEMSSAPMPNYAADPQYSMELF"
     gene            complement(<763650..>764894)
                     /locus_tag="LDBPK_361990"
                     /db_xref="GeneID:13388200"
     mRNA            complement(<763650..>764894)
                     /locus_tag="LDBPK_361990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865266.1"
                     /db_xref="GeneID:13388200"
     CDS             complement(763650..764894)
                     /locus_tag="LDBPK_361990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865314.1"
                     /db_xref="GeneID:13388200"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ8"
                     /translation="MKRRDVSAPPHRSYAASTGSSTTTMSSASPPAISTMCVDVRELL
                     RHTAAASKDAPSDAQAAVSGRQRYTAVAPSAAPSQPPRQPQATPPPCPKESTFWSPSY
                     PPWGGFAVNSGPPPLSPTDATILHSILGQPTVQKTVLSGFDQVIARTSSPLTREPRTR
                     RPSVASTSLPPMDNSPTWGTPAYAGDSVQTFEVGAATPLSSLSEKDTPPPTPLRDMME
                     TYLDGEGLHSAGAAASMDFSPAAQRTMKSILEQLNSYASGLAAAHTRAATEMPTSSYR
                     GGVAVWPITFRQAAMQVSAAGPSAASPLPFSGASVHRRKGGAVATRSTVAQLWRQCPA
                     LAASTFSRVDTSPQRSQDTVQAVVAPPQGLAYDRPHAAADRSTVPLRKAVQSLPRTVP
                     PAFRRQLQFAEEAPTTRRPKRR"
     gene            complement(<765918..>767297)
                     /locus_tag="LDBPK_362000"
                     /db_xref="GeneID:13388201"
     mRNA            complement(<765918..>767297)
                     /locus_tag="LDBPK_362000"
                     /product="T-lymphocyte triggering factor, putative"
                     /transcript_id="XM_003865267.1"
                     /db_xref="GeneID:13388201"
     CDS             complement(765918..767297)
                     /locus_tag="LDBPK_362000"
                     /codon_start=1
                     /product="T-lymphocyte triggering factor, putative"
                     /protein_id="XP_003865315.1"
                     /db_xref="GeneID:13388201"
                     /db_xref="GOA:E9BTQ9"
                     /db_xref="InterPro:IPR025593"
                     /db_xref="UniProtKB/TrEMBL:E9BTQ9"
                     /translation="MPPKTATAAAGGQQREKGKKDGAAAADPVKELRNMEDIHEVLAK
                     AQQLRNYFQAERDKVNGMWDITKKELENEQFSLQNAESELEELEREHQVEMKVYQQKV
                     RHLLYDQKVAVKQLRDESDAALRQAEAAHTQRMHQLEVERQRRMTGMQSAREAQESRI
                     VDQRDGHQYMLTVTKRRNHEKELARLQASYEAKLSTLREDLELRRRAEVQDAEERYNL
                     HINHLIQQHEDKFNEMKAYYNHITHNNLEIIQSLKDEIATMKKNDEHNEGLMFEIEKE
                     NENLVAPLEQLEKEVAELQVKKQQHIQDKQSLRSFRTRYKLLQQQLCALRQEKEMLED
                     QYKNVYDEREDLRAKFESALREAMDVVADRNNSLQQNLIEAHARLEQRDAQLEGVLRA
                     MGLEPAAMELISNEIDAEVQAKNQVIKDLHFEMRRLEKKVNAMVEEYERRCRAVGVPP
                     LDRASVMQV"
     gene            complement(<768388..>769878)
                     /locus_tag="LDBPK_362010"
                     /db_xref="GeneID:13388202"
     mRNA            complement(<768388..>769878)
                     /locus_tag="LDBPK_362010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865268.1"
                     /db_xref="GeneID:13388202"
     CDS             complement(768388..769878)
                     /locus_tag="LDBPK_362010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865316.1"
                     /db_xref="GeneID:13388202"
                     /db_xref="UniProtKB/TrEMBL:E9BTR0"
                     /translation="MQRTSVGYGAFDSLAQLRDDLRKSYEAAKEIEQRDTTLTKSETA
                     NTLKETSGLFALGMEKLISPDGSIMEVKDAIARAEDAEREVAALRAEKARLQSTGHGH
                     HSKLSATGSDADVEAFVAYAKELSELHDHLSLARAVFKAVLTKRLEDIRDDRLSQQDK
                     RFTDPKSWDAKKGALERMLQSLRTKTAQLQLSAKTYLDEDEALFLEVMNLATEAGDHV
                     RRGDAMREARDEKLKVFYAECAKLTGWCRQQLTNLEAMQEPDHVQEYCATLADNYPTM
                     SNNFAVLFNSVQEYVQANLIPVHKALLEAEEVWLYLQVSTLERLSKTLFEIHPKSPLD
                     VEVEKYASYPEHAAKFLQDVERYLAAQRSQQDELAELDSAHKECQEVLHTLSGEFAEL
                     PSEVHAFAQRAQALRLGYQCFREALLQRLTYISPAASTVVESKRRQEEFENCVRELKS
                     WAAEASHGESWRDIYSKIVEIKQMIKSEQASLEGKRERAMASAQSR"
     gene            complement(<771348..>771626)
                     /locus_tag="LDBPK_362020"
                     /db_xref="GeneID:13388203"
     mRNA            complement(<771348..>771626)
                     /locus_tag="LDBPK_362020"
                     /product="60S ribosomal protein L37a"
                     /transcript_id="XM_003865269.1"
                     /db_xref="GeneID:13388203"
     CDS             complement(771348..771626)
                     /locus_tag="LDBPK_362020"
                     /codon_start=1
                     /product="60S ribosomal protein L37a"
                     /protein_id="XP_003865317.1"
                     /db_xref="GeneID:13388203"
                     /db_xref="GOA:E9BFK4"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:E9BFK4"
                     /translation="MAKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGK
                     FAFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELAKI"
     gene            complement(<774084..>774986)
                     /locus_tag="LDBPK_362030"
                     /db_xref="GeneID:13388204"
     mRNA            complement(<774084..>774986)
                     /locus_tag="LDBPK_362030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865270.1"
                     /db_xref="GeneID:13388204"
     CDS             complement(774084..774986)
                     /locus_tag="LDBPK_362030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865318.1"
                     /db_xref="GeneID:13388204"
                     /db_xref="GOA:E9BTR2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9BTR2"
                     /translation="MTSTSPPAVDFSCAICFDTATEPVVTRCGHLFCWECLDHWLHSA
                     AGAPECPVCKGRVDERMAGDIIPLYGKGRQPAAKAGSGQGTVSAPATTTAAATAATES
                     AATVSDPAQEAFFSRPSAYSFAPARDARRSGQASSQQQQPEQQQHHPRPNANRAPPRP
                     RPQQRHQFQNVHINRGGMPLTMGSGIFFFGGGTGVLFSIIVVAIWTLYHYAPWREWVQ
                     ASARWYNRLRGHPEPANTSQAEHEASTDRPTQARTPPAATHLASAASSMEDPTDDVSP
                     PTIVRHLIISLFLVFILIQLLAYV"
     gene            complement(<778981..>780480)
                     /locus_tag="LDBPK_362040"
                     /db_xref="GeneID:13388205"
     mRNA            complement(<778981..>780480)
                     /locus_tag="LDBPK_362040"
                     /product="nucleoside transporter 1, putative"
                     /transcript_id="XM_003865271.1"
                     /db_xref="GeneID:13388205"
     CDS             complement(778981..780480)
                     /locus_tag="LDBPK_362040"
                     /codon_start=1
                     /product="nucleoside transporter 1, putative"
                     /protein_id="XP_003865319.1"
                     /db_xref="GeneID:13388205"
                     /db_xref="GOA:E9BTR3"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BTR3"
                     /translation="MTGQSAAVEGSNSALPWYRMGFHTLAEFNTYVTFVLLGMSIMMV
                     TSAVTSAPDFVTKYFIYATGDPDAVAETPLFWNNANTFYNAGTYAMQVVTEIASLTPF
                     MRSIPLGIRLFLGLGIPFVELVVIIAVPAATIPTQNGAIAVIMVVAMMGGLSKALCDS
                     CTNALVGPFPTKFMNGAQWGLTVIALFMSIIQIILQVSMGSTFQDVLTISRIYFGIGI
                     GIQVMAIAALVLLRYNPFAQKYIAEFRAAALRRRGHVEPEESQDSKEPATGDVAEAPK
                     AGEKEVTLDEMEEADEVRAVPSDAFVAKSGAVLQATGDADRMVDLDQTKNITSTEQML
                     RASVWSVFKRIYPMLLCAFTIFFTTLLVFPGVFFLVPARSGWYMTIIVTLFNAGDFVA
                     RVLLMIRVLRPSPKLVIVGTFGRLAVIPLIVLCVRGFIPGVALPYVLIFLFGLTNGYF
                     GTMSCIHCPRTPTLHYAGERSVAAMLAGISLMLGLCFGSNMSLAITLTY"
     gene            complement(<781511..>784555)
                     /locus_tag="LDBPK_362050"
                     /db_xref="GeneID:13388206"
     mRNA            complement(<781511..>784555)
                     /locus_tag="LDBPK_362050"
                     /product="mismatch repair protein MSH8, putative"
                     /transcript_id="XM_003865272.1"
                     /db_xref="GeneID:13388206"
     CDS             complement(781511..784555)
                     /locus_tag="LDBPK_362050"
                     /codon_start=1
                     /product="mismatch repair protein MSH8, putative"
                     /protein_id="XP_003865320.1"
                     /db_xref="GeneID:13388206"
                     /db_xref="GOA:E9BTR4"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR015536"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTR4"
                     /translation="MVLLDNQVDVNSVSFTYPFLEGIDPTAPPSTISIPHKYLDAMAN
                     MERQYWDIKSKHYNVVIFFKKGKFYELYDYDAVIANREFGLKMVLDTSNRGKMRLAGV
                     PEQSYNEWARLFVYRGYKVGRVEQMKETESEAQAAKMKVVPRELVEVLTPGTLKDPSM
                     LSDHREVFVLSLAPVCSDGELVIDAFAVDLSRRVAHWCTCGSGNKEAKTGCHAVSSEL
                     SIKRENGFYGSLKDSTLRALSALLQQLNPKEVIISSSDWVSKDAERRQAFKHICDEIT
                     KWTESEGFSVEHISSTALPSLSMSAMVTAEQVMASYFTFLCLASDIAIFSTATEYTAH
                     LSGVIGADSGTAASDTMLGGAASGKSSIMDYEHRFDKGLVLDAATVSNLEVLTNLHDG
                     SDKHSLNECLNRCSTNGGRRLFRSWLLRPSASSRVIAARQEAVRFLARYNLLHSLRDM
                     EVSEQAGEKRFRSNEGLSLFSSVVFVDFERFLSRLSDIKQNDSQNIAYVDPMVQYKKN
                     LGIILSSVQALSAMVGWGKQFFAQCREVACEQGTDIPALLGELLEEVTTAEASSKRIE
                     GLFDRQAAEESGLLIPSPGTSSAYDAATAKLRHVESKLHDVRRQLQEDVFRGAQAHFA
                     DLGKDLFLIEVAVADAPKMTPAGMVERARNAKSVKYVVSSIEALVETHKEATAMKAGA
                     LLTVLCSVASRICDEFPRLFSASRALSYIDCLLSLAQLHQAFPTVCYPRLCTAHERDV
                     AVVRGWDMIHPLLTAKNPVANNVSLDDVEGRVLLLTGPNMAGKSTLMRTVAINVLLAQ
                     LGGPVLATKMELSPVDRVFTRIGARDASHKGQSTLYVELSETADILHSASARSLCLVD
                     ELGRGTSTHDGMAIAHATLHALTTAKPAAPLTIFSTHYHALAIEQARTATTTPTGAHA
                     RAVQLGYMDFVLKFETAAAFADEEANDRSRSFAPGSCVSNVVFLYRLVRGICARSYGV
                     EVAVMAGIPNTLVQLAKAKSEAMSRETAFHEDVRAIENFIRV"
     gene            complement(<786147..>787238)
                     /locus_tag="LDBPK_362060"
                     /db_xref="GeneID:13388207"
     mRNA            complement(<786147..>787238)
                     /locus_tag="LDBPK_362060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865273.1"
                     /db_xref="GeneID:13388207"
     CDS             complement(786147..787238)
                     /locus_tag="LDBPK_362060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865321.1"
                     /db_xref="GeneID:13388207"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:E9BTR5"
                     /translation="MGSFQAIYIYIYICTYMYTYMLVYIFLPQQLLLRLCPHTGLPSM
                     GQSFSTPPPGSDGNECDDCNAKEEAKAYHMPPDLPSPEIVGVDDADKRMLVLTPKLAA
                     RLADALPPSCRCGAFSGVTRWYLLYSSYLHGKSFQRLVQRITSRGPTIIVIKAKDSPR
                     VLGAFCESDWLTVAQREKNAKSAAAASARATREGQKQRVTSAPEKQSNTFFGNVNCFV
                     FRAYADGTDDVSTEGEIYHSHSSMNSNFMYLFDTHPLEEKIGIGMGGQPGYYGWFIDR
                     WLENGASHGARCTTFQNPRLSSTESWVVESVEVYAVKKDIVEQLLITGSSRTSGVSCV
                     NDNPDSRACQMLLELNGTHEFNRRDRTEC"
     gene            <788323..>789066
                     /locus_tag="LDBPK_362070"
                     /db_xref="GeneID:13388208"
     mRNA            <788323..>789066
                     /locus_tag="LDBPK_362070"
                     /product="phosphomannomutase, putative"
                     /transcript_id="XM_003865274.1"
                     /db_xref="GeneID:13388208"
     CDS             788323..789066
                     /locus_tag="LDBPK_362070"
                     /codon_start=1
                     /product="phosphomannomutase, putative"
                     /protein_id="XP_003865322.1"
                     /db_xref="GeneID:13388208"
                     /db_xref="GOA:E9BTR6"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BTR6"
                     /translation="MTSKVILLFDVDGTLTPPRNPETLDMKQTLAKVRAAGFKLGVVG
                     GSDFAKQKEQLGESILEDFDYVFSENGLLAYKDGKEFHRNSLLKALGNEKVVAFVKKC
                     LHLIADLDIPVQRGTFVEFRNGMFNVSPIGRNCSQQERDEFEQLDKERHIREKLIRNL
                     KEAFPDYPLAYSVGGQISFDVFPKGWDKTYCLQFVENDFQTIHFFGDKTSEGGNDYEI
                     YTDCRTIGHSVKTYKDTIAILESLLEESR"
     gene            <789679..>790572
                     /locus_tag="LDBPK_362080"
                     /db_xref="GeneID:13388209"
     mRNA            <789679..>790572
                     /locus_tag="LDBPK_362080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865275.1"
                     /db_xref="GeneID:13388209"
     CDS             789679..790572
                     /locus_tag="LDBPK_362080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865323.1"
                     /db_xref="GeneID:13388209"
                     /db_xref="GOA:E9BTR7"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:E9BTR7"
                     /translation="MDEHSSACSCAGIRFCAKCRDSSRVQQLFSGSVPLSSARTVIEK
                     QHNDERLSSCSFAIIGKSSLSFCIECASVFKSEVPIKSCADHQGAMATSITISGLAVL
                     QHALTEEDEAAVIRFLDDSHPFPPWKESQSGRRKQDYGPRRNFKKKKVKVAEIPSMPL
                     VFESVFAVISSMTETFTGKAYRIAEVSALEYMEGKMSNFDPHVDDTWLWGDRIAGLNL
                     NEACVVTFVNPEGVCCDVYLPRRAFFLMSGNCRYKWMHGIRHEHVRGRRISLTFRELS
                     DEILADTEASEMVLSAASNFV"
     gene            <790958..>792181
                     /locus_tag="LDBPK_362090"
                     /db_xref="GeneID:13388210"
     mRNA            <790958..>792181
                     /locus_tag="LDBPK_362090"
                     /product="serine/threonine protein phosphatase 2B
                     catalytic subunit A2, putative"
                     /transcript_id="XM_003865276.1"
                     /db_xref="GeneID:13388210"
     CDS             790958..792181
                     /locus_tag="LDBPK_362090"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase 2B
                     catalytic subunit A2, putative"
                     /protein_id="XP_003865324.1"
                     /db_xref="GeneID:13388210"
                     /db_xref="GOA:E9BTR8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BTR8"
                     /translation="MSRPNVKCSAVGSRNLNSTSVERNTLRSDGKLSLENIMLQFLCG
                     EQLRLEYAMEIVQQAALVLRTEPNTLSINDTVVVVGDIQGQYYDLVKILAACGSLDTT
                     KYLFLGNYIGNGGFNLECILFLLAAKVAHPHSIFLIRGSNESKFMADVLQLGKECQLK
                     YSSTLLPQILSAFNCLPLAAIIRKKFFCVHSGLSPDVSHVDDIALIHRFRHIPTRGAM
                     CDMVWSEPDWDTNNQLYNNVEEPSGETYVPRLGLFETRPLFITNKQRGLSYVFNFACA
                     KRFVSANNLLCIIRAHEVHELGFKLYRPHPNHLFPCIISLFSAPNYCSSFGNKGAVLV
                     VSKETICFKQFEPSPHPCVLQGRNAFSWSLPFLESNLMSIFLTLLSGSDYDPTIADRS
                     EKGSSNGEGGVTPLI"
     gene            <792781..>793080
                     /locus_tag="LDBPK_362100"
                     /db_xref="GeneID:13388211"
     mRNA            <792781..>793080
                     /locus_tag="LDBPK_362100"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865277.1"
                     /db_xref="GeneID:13388211"
     CDS             792781..793080
                     /locus_tag="LDBPK_362100"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865325.1"
                     /db_xref="GeneID:13388211"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="UniProtKB/TrEMBL:E9BTR9"
                     /translation="MTESAEALQRRINYAIENQMAPPETNYISELLAASLALDNSNEQ
                     LRLLDYRWQTYLDKQYVQSQHLDEFLEGLVQHLLKKKPDRPLEELLLYLECERRQ"
     gap             796798..796896
                     /estimated_length=99
     gene            <797532..>801371
                     /locus_tag="LDBPK_362110"
                     /db_xref="GeneID:13388212"
     mRNA            <797532..>801371
                     /locus_tag="LDBPK_362110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865278.1"
                     /db_xref="GeneID:13388212"
     CDS             797532..801371
                     /locus_tag="LDBPK_362110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865326.1"
                     /db_xref="GeneID:13388212"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BTS0"
                     /translation="MSGTSLDFLLSEILSPDNVQRAAAEKELERRGLEVPGFCFSLAR
                     HCRTLMNNQSSHAVALVALSVLKRSVTASDRAEELEQVVSSLLSDLTDITVLPGGSAA
                     AMRQWSSTVCTTVRRLAVLCASQTAAPAAGEATTGAITAQLLGAFDQYPNADASGLLP
                     VFSHVWLLRTMFEEPVPDVMHAWCAELILNCAPPLFEILCAGAAATLSMASSDCSAFA
                     ADSPEAYARCSLSTLIAQTLAALYEWQFASSGRKHFPAELKQHFLSAYPLLQSFMCTP
                     CARWLSVCVGATSSSTSALPFVQARAANFAAASLAALEYVSSVLQLGGWYKRCVSAQL
                     FQALLQSLEADAAYYGAALCVDGEEEAESLIASAGWTGWPHTGSGGGEQGDGASPHSW
                     TTVVRRRATQCWSLFRDAALLPFLKVGLVDVVGHQCGLQYYKLLLAYAVPSPVDVGAW
                     LHDPNTFLREEEEREDGVRWTTRNTVAQLYTDSIAALGPLFLHASLEDLHERLLARIP
                     DNDGRTCGDGQTSLAYDGTVMLTASQQQREAALFFMETVLKHRARQLRECGAVDFTPL
                     ATHLWSNDVASASAHPGLTARALMLITAIVRFTHSTLAASEPAASADAAAATNTEAAS
                     EGFMATVVADSIHALSLFTGTSKEPIAVPLSSCTPLVAVLLCRVLQSTLPYWSDVMLA
                     QHSAAWQVSLLALLSSEAGLTDDALYNTVEQLADLLKVARAAREKGTQSHYGRVSTAA
                     AAPPILDALPRTVMDCWRRHVSDPNLADAVLGLLRYVVRDGESGASLLLQELPWVNAV
                     LSGFVESTAELCAVPHFLRLLKCLFEHAPDEVANCAAAMMLDSLCQLLLCTEESAILG
                     ASSSCLAALLRRCLAVQSVQVRVVAATMEAAMAGGATADEGGLSGAVGTTARLADAPR
                     TVYPFATVIVAFVLRTLDGRRDEASLMDVGDALLTIMQKYTSFSEAELIRIIHATVRR
                     LSIVRTDTVAQQLLAPLATLMVLHPAALLRTLAQGGFLVETMSRWLPQVEHFSNLRAT
                     FVSCEGLLKMLSYLSQPSSSPMLTAEEVQQLAQQPVTCRWLLPEELTESKKGSRKASR
                     KGSKGVSAAATRRVILSSLTRGASVETSLPLYAGVLVGVGRGLLTLLAAPPAALCRAS
                     QAAGDTATPGNGIGAGVFPLDEDDDDSNGLFRGDSADGSDPEAEDTWEEDVDSSSDDE
                     TGGDARQSEAPDINAYSPETTDRQRLLRPMGEQMLPWMQTHGGEVASFFTLQEAQTLT
                     SFFTSCAASGGCGPSAA"
     gene            <802447..>803550
                     /locus_tag="LDBPK_362120"
                     /db_xref="GeneID:13388213"
     mRNA            <802447..>803550
                     /locus_tag="LDBPK_362120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865279.1"
                     /db_xref="GeneID:13388213"
     CDS             802447..803550
                     /locus_tag="LDBPK_362120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865327.1"
                     /db_xref="GeneID:13388213"
                     /db_xref="UniProtKB/TrEMBL:E9BTS1"
                     /translation="MRLHAGNRSPVIRPGARIGAHDGVAASVFAEVHLAAASLRSSAP
                     FRPAHGTDRQGLFRGRTVPTIVDAPHDTRSPLSLEIEGVQTGEEVVVDVPSVRQRSST
                     SSISNDAAQLQKLRRQLEQATAALKAAVNTNRRQKQEHQQQRAEWLVFSNESDARLLN
                     VQSNQASREQLLCSELSDAITHLLGELKAQALKKRAADQAHASDKAEWDAKQAVLLSE
                     LEAARAALATQFTAANSGDTHKEEADQLRAELEALRRSAGDQQRSLEEKLMQTQSTLQ
                     AKQSELNRYLQERDQHNYLVAQCRLFIQQVCQPGFSVVKGPSLEPVETQRPEPTGFVL
                     VPLAVLLHGYALLTEGDRQALIEHYDGKAKSLK"
     gene            <804147..>805847
                     /locus_tag="LDBPK_362130"
                     /db_xref="GeneID:13388214"
     mRNA            <804147..>805847
                     /locus_tag="LDBPK_362130"
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /transcript_id="XM_003865280.1"
                     /db_xref="GeneID:13388214"
     CDS             804147..805847
                     /locus_tag="LDBPK_362130"
                     /codon_start=1
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /protein_id="XP_003865328.1"
                     /db_xref="GeneID:13388214"
                     /db_xref="GOA:E9BTS2"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9BTS2"
                     /translation="MLRSAVCLAGKDVRFGEEARRSMQKGVTRAVAAVATTLGPKGRN
                     VIIEQAYGAPKITKDGVTVAKAIEFKDRFENMGAQLVRQVCNQTNDLAGDGTTTSAVL
                     VDSIFGEGLKCIAQGTNPIDMKRGMDVAVDYVQTSLLKQSRPIKGSEDIVRVATISAN
                     GDEEIGKMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMKIERGFLSPYFVTDAKAQ
                     KAELEDLYVLVSKKKISTIQTLLPALNHVAQQGRPLLIIADDVESEALTTLIFNKLQG
                     KLKVCCVKAPGFGDTKEGMLEDIAVFTGAKVVGDENTGVELDAKNFDPSILGSVKKVT
                     VTKDDTVMLNGGGDAAAVQERQQLLRDRIEQEAVEYNREKLQERLAKLSGGVAVIKVG
                     GATELEVSEKKDRVVDAVCSTRAAVQEGIVAGGGTALLRASKELEKLLTSEHLSRDQR
                     TGVTIVRNAIRLPAMKIAANAGKEGAVIVEKVLEASEESVGYDAQNDRYVNMFEAGII
                     DPTRVVRVAISDATSVASLMMTAEAAIVEAPKESKKDKNGKKTAAAEAEDDEELFGSY
                     "
     gene            <808282..>809970
                     /locus_tag="LDBPK_362140"
                     /db_xref="GeneID:13388215"
     mRNA            <808282..>809970
                     /locus_tag="LDBPK_362140"
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /transcript_id="XM_003865281.1"
                     /db_xref="GeneID:13388215"
     CDS             808282..809970
                     /locus_tag="LDBPK_362140"
                     /codon_start=1
                     /product="chaperonin HSP60, mitochondrial precursor"
                     /protein_id="XP_003865329.1"
                     /db_xref="GeneID:13388215"
                     /db_xref="GOA:E9BTS3"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:E9BTS3"
                     /translation="MLRSAVCLAGKDVRFSDKARRSMQKGVTRAVAAVATTLGPKGRN
                     VIIEQAYGAPKITKDGVTVAKAIEFKDPFENMGAQLVRQVCNKTNDLAGDGTTTSAVL
                     VDSIFGEGLKCIAQGTNPIDMKRGMDRAVEVILKSVAKQSRPIKGSEDIVQVATISAN
                     GDEEIGKMIGQAMDKVGRDGVITAQDGKTMATELEVVEGMSVDRGYVSPYFVTDAKAQ
                     KAELEDALVLMSAKKIQSIHSLLPALNHVVRSGRPLLIIADDVESEALTTLIFNKLQG
                     KLKVCCVKAPGFGDNKTAMLQDMSVFTGAQLVGDEGTGLELDAENFDPSILGSVKKVT
                     VTKDDTVMLNGGGDAAAVKERVELLRELIKNETSDYNRDKLKERLAKLSGGVAVIKVG
                     GGSEVEVNEKKDRIEDALCSTRAAVQEGIVAGGGTALLRASKELEALANDSSLTRDQR
                     TGVTIVRNAIRLPAMKIAANAGKEGAVIVEKVLEASEESVGYDAQNDRYVNMFEAGII
                     DPTRVVRVAISDATSVASLMMTAEAAIVELPKDDSAAAPMGDMGGMGGMGGMGF"
     gene            <813894..>815951
                     /locus_tag="LDBPK_362150"
                     /db_xref="GeneID:13388216"
     mRNA            <813894..>815951
                     /locus_tag="LDBPK_362150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865282.1"
                     /db_xref="GeneID:13388216"
     CDS             813894..815951
                     /locus_tag="LDBPK_362150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865330.1"
                     /db_xref="GeneID:13388216"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BTS4"
                     /translation="MRNPTDIGTAAASQSPTDVLRPPTSVETMMLLTMPAASSRQSTS
                     SWLPTRLTSSYCVLSAAGLQEDFYTSCLSWGTNQMALALQEDLVLFHPSHPRQASSTA
                     RISTPPALREAGSNTGTGSSAAFSGPRRATAVAMTRFQETSCFLGMSNGAVELYEGRG
                     DGTLQRTVAFAMPPPPTGYLSSLVLGSDDCGGAASPASPTSRAARALCLLRSSVSSIS
                     CVGTSSRHPWLGSAATAARGLITVDARQVQPAIRFGTDAELCLDEGALRSSSVTASDS
                     SAASGGLSKLQRAASFLRRHDRLCSVSWNATGSLVATGSGSGIVKVWSLSAPQRPLHT
                     FLVDQDCSVKALCFHPGSPYVLLVGASAGAAGLRTYDLSGAEPALISTGATAAPVTQA
                     LYDPEGNYAVTGAGVPLSPVSSSLSQPQYPVLAAHTELGATGAGIGSGFHEHGAGWHR
                     SSSTRPSAASSNSAIGASGGATLLHDSWDEMEMPASPLSATLDTAAGLAGAFASESNG
                     SSAAAHSAPPNALVVWRCGTRRRENYLREALLQRSDRRRDSAGGRDDFARHGDDASDD
                     DSEDVAQEDCLARGGLRDSTVVADDGHSSDIGYPRSEWMPMYALPGHRARPLLICAPF
                     PQSPFAGCYASIAGGEDGTIRFWRFFETTSDATHWQHRRQAQQQSAATQEDMDLLATP
                     VLR"
     gene            <818114..>819457
                     /locus_tag="LDBPK_362160"
                     /db_xref="GeneID:13388217"
     mRNA            <818114..>819457
                     /locus_tag="LDBPK_362160"
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /transcript_id="XM_003865283.1"
                     /db_xref="GeneID:13388217"
     CDS             818114..819457
                     /locus_tag="LDBPK_362160"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /protein_id="XP_003865331.1"
                     /db_xref="GeneID:13388217"
                     /db_xref="GOA:E9BTS5"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="UniProtKB/TrEMBL:E9BTS5"
                     /translation="MKFMDVALAAEAVVIITVILTVPYTEIDWKAYMEEVEGFLAGEL
                     DYRNLKGGTGPLVYPGGFVWVYSALYYLTKKGEAIELAQWIYAGVYLVTLTMILRLYT
                     RSGHTWQTMIPLFVSKRIRSLYVLRLFNDCWAMLFLFAAVSFIAGRPSGAAKRSRQWL
                     IGCLCYSIAVSIKMNVLLFAPGMLYVMLRTLPFWRVAWYLLVCAAWQVAAGLPFLAYD
                     HRAYLSKSFELDRVFLQRWSVNYQFLNSELFAKPEFGQALLAMTVATWVLLWRTRWAA
                     RTYLTDAEVHVSHPAISDTRRQNTLLRRGAADGDKTMDNEAQEQAVYASTLLTFFEAN
                     LVGVIFARSIHYQFYTWFFYTVPFVLAYTTFPRVLRLVSFALIRQGFESFPPTPKTSM
                     MLQGGFALMLFAILFMGREARPAATREETHPARDNEPKLPQTQGTAGATGEKKIR"
     gene            <822404..>825148
                     /locus_tag="LDBPK_362170"
                     /db_xref="GeneID:13388218"
     mRNA            <822404..>825148
                     /locus_tag="LDBPK_362170"
                     /product="serine/threonine protein phosphatase, putative"
                     /transcript_id="XM_003865284.1"
                     /db_xref="GeneID:13388218"
     CDS             822404..825148
                     /locus_tag="LDBPK_362170"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase, putative"
                     /protein_id="XP_003865332.1"
                     /db_xref="GeneID:13388218"
                     /db_xref="GOA:E9BTS6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BTS6"
                     /translation="MPSFFLFGRKKDKKKKARDGTRDEGDAATPSLTARENSNDSKES
                     ATKHGKGSTTSHDAAGGSTPPSLDTPPADASGPATETSPPLPPSRKQQSYSESALQEL
                     PPPPLSSSPATNSPGLRASAVHLTLQHSTLDDAPVSTPHSVDLFPCEMSEVTIPQLTE
                     VFQVFRTFLDNCTSTEVKQESVSKLRKILPEIAAVDTTVSDETIKAQNFHPTFSIEPI
                     LSHLLAQPAPLRARLCLAIYRFCGELCEELEGDLLCQETGLFSGLQCMNPNLRPAADG
                     DYGSSEDPHQTSPFGGSFAENGTAKIERCPEIDLPKIYKSLLHKEDYLPSAEELNEIF
                     LRVQELLRVEPNVVMVAMPAVLVGDLHGQIRDLLENVLTLGGPLVSNEALALASPKSH
                     AAKSKAPTSQKRGSVAVAPPTSKKSGKAAGAAKTFSGALKGDESRPTRPPNYLFLGDY
                     VDRGPSSLCVIALLFTAKLLSPNTVFLLRGNHECPNTNRFYGFLDECHRRYPIVNHKV
                     TTLHMCTRSASEENTDDAAANRSGSGSSSPGASSTCEGDSGALSKINTNSSVEPTAAE
                     LGGHLGRDCDSSPDDMGWDMKDHPLWLVANDALCSLPLCAALYEEVEEGDDGATLPPA
                     TAAAAPNIEDMLAADGTENPGTASKAKKPTTAKAVKKSTRRSIGNASFAEPFKSPNLA
                     AGKSSTFTDSNARATSSKTASTSGEPSPLSPPSASASFAKPKKMRQVVRVCAMHGGLS
                     PFIDDSFDGIIAINRFRNIEHGALADLTWSDPSSSAAADGATASDSRANASQPPLSKF
                     QSICVFNGAPIGFTGNPRGTGHIFGEDATINFINTNHLYFIVRAHQCVQEGFQWNHKD
                     RLLTVFSAPNYCGMRNKGAVVLLDKNGAPTLKQYTYKEVEEKPHAKTTGAPQPPRLFS
                     "
     gene            <826204..>827724
                     /locus_tag="LDBPK_362180"
                     /db_xref="GeneID:13388219"
     mRNA            <826204..>827724
                     /locus_tag="LDBPK_362180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865285.1"
                     /db_xref="GeneID:13388219"
     CDS             826204..827724
                     /locus_tag="LDBPK_362180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865333.1"
                     /db_xref="GeneID:13388219"
                     /db_xref="InterPro:IPR002763"
                     /db_xref="UniProtKB/TrEMBL:E9BTS7"
                     /translation="MLGAQSAPSFLPASALSSSAPQCPPPQQLIERRPHDTLVQHSPY
                     GPSRNTTYGWGNPFRPPMTATVPSHPCIHIGISSLNGVPTVGQSDRSMRSLLTQYRKK
                     FNCLEHCYPYHKVGDEGTWKTWADMVRNSNAADGGRIHSLKTVSAPPLHTVEGAAAAD
                     VASAGATPLCPLTVNANRFLYTIKANNLLTHVKQLQMDDADVLAHVQVFFQERCPLLE
                     PFLGPVLVQLPPSFGYSPENVQRLTRLHQLLSQEEVLLLETRSVSPKAFSSSGTSSTT
                     APSSSAPRRQRRLRVAVEFRSRSWYRDETFALLRSFRWALVVAHHHDDPTYSQVVDTG
                     AGFLYVRLHGPLGRNVGDYGPLAMRLWAEKMVQYLRSERSPAEGSPTSALPDETTREV
                     FIFLNNSDSNVGGTTSSVVDATCLAEQMRNLLQCKSSRPPPAETAAASPSPRVSADPQ
                     LVMACVEAKTPMAVPEDDCRASCAQHVQDEADTPPPKRQCTAQRSSGTREDEVVID"
     gene            <829124..>830116
                     /locus_tag="LDBPK_362190"
                     /db_xref="GeneID:13388220"
     mRNA            <829124..>830116
                     /locus_tag="LDBPK_362190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865286.1"
                     /db_xref="GeneID:13388220"
     CDS             829124..830116
                     /locus_tag="LDBPK_362190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865334.1"
                     /db_xref="GeneID:13388220"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BTS8"
                     /translation="MTEKPAKEPPLPRDLKAQFDVLAGTRWDSVGDDADAAEHLSQLR
                     HDWKTLGNACYGKGYFLAAIRCYSRLLEVPGGDTAQIRSNRSAAYLQSPMLVGPSLAL
                     KDAEKAVELEPKWFKAHLRVGDAHRKRGHFAEAEAAYREALALQPECATALAGLRALQ
                     VESADLPAAAATFPRGHAERAPYHNASPSSKPISSRTTAHAAAAAQAKEEELQLTQEQ
                     LVHKWKADISTREGRTGCRPRQASLSQADRQQGAAVKQALLARFRAKLESNGEFSATL
                     RDRCEEAMLRGEGVNYRDADKLRNTYSHATNGIGLGISSDAYKEYTGRVDHRMW"
     gene            <834105..>837974
                     /locus_tag="LDBPK_362200"
                     /db_xref="GeneID:13388221"
     mRNA            <834105..>837974
                     /locus_tag="LDBPK_362200"
                     /product="streptococcal hemagglutinin-like protein"
                     /transcript_id="XM_003865287.1"
                     /db_xref="GeneID:13388221"
     CDS             834105..837974
                     /locus_tag="LDBPK_362200"
                     /codon_start=1
                     /product="streptococcal hemagglutinin-like protein"
                     /protein_id="XP_003865335.1"
                     /db_xref="GeneID:13388221"
                     /db_xref="UniProtKB/TrEMBL:E9BTS9"
                     /translation="MRITAATATAPVGAPGAKIRKGKAKTIRAVAAAGAVWRPQSQLI
                     FTSNATSVKATPNGELGASTTAGAISTNDSINGYTVTSSALAIKTAGTGVGGSCGVAS
                     VLPIPTAPSSGSAQARPLSSSGRAGLESQILRNDTLEAVRRSGAEGFPPSREKGVVSC
                     TLLAAEKRRRVADAAATSELSTDDRNAFTPAEVPLWVAGGAPLDASKAADTGGGASAA
                     SFEGAMGNSPFVSSSSSASSDTGCAQRAKALHTDQRPSATHRCDKGAFEKRPQLLLSL
                     AQDNRGFLNPGYSCSSSVSSSEDRGAGSGRAGSDGSAGSARRQGTPSAAPFSRAAPSE
                     QRGKACGGAPPPASTTLLGCGRNRATLAVFPLTAAEEQSARQAYDTYRAQQEKASYHR
                     NHASATKHCSQRSASVPPSALSTSTPVGKRELLRLLRGLYHRAQAMMACTTKTAAPAS
                     APPQRKAVSPTITVSAADVLHEFPSTKYLLNAAEACFGSRRFRTLMAAVVADSDALAP
                     IVVRNNDGGAPAVPTASRLRLSSSSQGLTVEEALSFFRHLKHEMASDVARQRERRQAE
                     PSAMPEAASGDKGRNRPAKAAPSQPLLDLQGSQKRRSISAPSCQAASQMCRLPSAQAG
                     RRSGRPPPTPVARMAARRATSASFLPSSTPPSPSPQLSSSPSRPGIPGAVALAGPQKP
                     TGRRKGPRRKVALPRPSPHLLGNNSCAPDAAYRDDFIHTYVQRKAFAEIAGGQGCHHS
                     TTVTLGQLIKVLHWFELALNPSVLERLCGVQAQPARESPDIFIDFNTFVKIINSGLRC
                     QRYSGGSGSSSAPASASADNDDDPQSNAFVPVLPPEAPARASPVTLPIPGLTATDGAS
                     LSTGSGCAPCSKAASSTISVRDSGGSNRSLLVLAPVSAAAHCRLSSLSSMSTSTASSP
                     ASGGSMHRPFVDTDDAYPLVAHDSAIAALCRSIRQRLRRELRRSVSGGSNAMLRPRDN
                     QGNRNGTGDGAAQKEGNDPQYSPSSRTAPASSRSWRSLSLASSAASPMPRENLSAAGL
                     VGESESAPARRDGEEFSVSPHLSKWLSDTKRSTPLSRQRLREQPSPSPLVVHALPPPS
                     HPYTPTPTPRAPRAQPVRRGEGAIASQWFRTAQRWRGHGHRLAAPPPARPATAQRQAL
                     SAAVARRCRRHQGSMHLITSLSPYSDSGHGARRPASHCWSRIATLSTLSQSRRSSSLH
                     SCDTQPVLHSLHLSEPDLSAAFLSQTLPAQTASRHQKRNRPASAYTRLTAAPTHDACT
                     AHVLHPPLSPTIRSSPLPYRRRLFQAR"
     gene            <842130..>844946
                     /locus_tag="LDBPK_362210"
                     /db_xref="GeneID:13388222"
     mRNA            <842130..>844946
                     /locus_tag="LDBPK_362210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865288.1"
                     /db_xref="GeneID:13388222"
     CDS             842130..844946
                     /locus_tag="LDBPK_362210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865336.1"
                     /db_xref="GeneID:13388222"
                     /db_xref="InterPro:IPR024224"
                     /db_xref="UniProtKB/TrEMBL:E9BTT0"
                     /translation="MSIRFDLDIGPKIEFVSPPDAITEEGKVKLLRCAFPDCNPDCGY
                     NFIFYFTMPDCTTAAVQSFSQTVAPPTTGNTVPELYGAAFYRQKHDPNVPRCYVQQVL
                     VLLSHLPYYNVHEIILRVVAPRFCQCCPLSPDTGKVPVSSLLIPVPEAYFEFDQSYSA
                     EHYTQEDVLSDAMAELAQWPSPHPQARYTVTLLQQALIFITPAHSQRQSSRATRSSCA
                     SMRSAMSVDTRVEFMEVTRGSPRHRGSALGSDFLPLFRLLGEQLHHLTYVWELLIRHE
                     PLFILSNTPCMASAAAFGIASLVLPIEFSGTLRSYFTVQNEDFPRLSRMGKVLSFPRN
                     EGLIVAGTNPFLLRSFSGWPSLMVVMDSNTSITVNGSIASPPPSAVAGAISPPPQASP
                     LHSQRSGACTAASLASSLLRSALPGEPSAETSPRPPWNGAHARTASGQEPLSVAMCSI
                     NSTTSLGSGSTSAHQQNGLRAPVTVVPSSFSSFNGNGDVFADVASRKPIFSSASSDTA
                     DLPATYNVESSTETSPSTSSPSHDSGRRVEAAQQAQRTEDGSLAGEHASTSALGESPA
                     QLGSGISNRAERFSHGQGHARPDSSDATLATAAHLAPAPITMPSPVDFSVTLFTTDHY
                     KTTVESVRAAEHRRRGGANQDNSRKNLQQGLHNYFDSSVHFLLNHEEQTQMLLKRLQM
                     VSLLDADAQRTSVSLSLTHWHGNPRTASSPTTSTKSPPFASPTPPLSSANTNSASGHR
                     VDPAAATNGITSCSHFSVADDMVRKFFTSLTSEFLTPVTAWFQRVTAPYTAFHLCDRA
                     LCDALLTPSSFLDDFAQRHRETAPSMWTQRHSYKTYKVVYERFAHGCLFKAYVLQLVD
                     GSLRQQMEDFQVEDWVTRVPSDAERIDLLINLFNTVQRELNETLDPDVLFVTSATSVL
                     ASMAVVLQQPHREQFMLKIGELKL"
     gene            <845854..>846969
                     /locus_tag="LDBPK_362220"
                     /db_xref="GeneID:13388223"
     mRNA            <845854..>846969
                     /locus_tag="LDBPK_362220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865289.1"
                     /db_xref="GeneID:13388223"
     CDS             845854..846969
                     /locus_tag="LDBPK_362220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865337.1"
                     /db_xref="GeneID:13388223"
                     /db_xref="GOA:E9BTT1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:E9BTT1"
                     /translation="MLSEEERATLLKYYSTVKLNETQLDQLAQAYWAATREERGEIAK
                     VYAHTFVDPTFVQRLIFFHDYHMPLTAAGADLSSPAGAAAGTSSSFAGQQSGSESGNS
                     PLMASPTSSFMAGSQTTAASHAPRRTHAQRLLRSTIQEHFPKLTGPGPYALQFGCVRS
                     EKEREEVIELYSSQFLHPDPPELHRIVTLPSSFSTRTRKRISGSYSWYLRCLATQELV
                     CAVTVTVHQQETIRFAEMPLFATGVGYKKNGFGRLLNAALLAWCAEVGLEFIMISADV
                     QAIPFWRHLGYRAMTRGEKNRIDFFYQHDCCKFKGAETMIGYCNVDRGNGTLSGGARR
                     RASHSGGSAEVLHMSVRQVLAQLPRFAVEGPAKLPTE"
     gene            <848540..>849400
                     /locus_tag="LDBPK_362230"
                     /db_xref="GeneID:13388224"
     mRNA            <848540..>849400
                     /locus_tag="LDBPK_362230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865290.1"
                     /db_xref="GeneID:13388224"
     CDS             848540..849400
                     /locus_tag="LDBPK_362230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865338.1"
                     /db_xref="GeneID:13388224"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR015399"
                     /db_xref="UniProtKB/TrEMBL:E9BTT2"
                     /translation="MNAMTDTEVVQYVLQNKSNYYKVLMVGADATEAQIKVAYKKMAL
                     KCHPDKNKHKQAADAFKLVGTAHTTLSDATKRSIYDRHGAEGVQRHESGGARRSANGA
                     GVYRHRPAGQRDFFEEFFFGNGYHANGHGVHPGAGGARYQAEVNINPNALLFVPIVVF
                     LLVAMLLSSSYTDVDASNPLFGGGLRGAGMAGASFSFTASQNEGFVVQRTTSLYGLRV
                     PYYTTPRMSEMMDRRKEVYLSMEQKVLETWRDSLGRRCEAESLKYRSRGRNEVPPVCG
                     DYQHFRRALG"
     gene            <852821..>855145
                     /locus_tag="LDBPK_362240"
                     /db_xref="GeneID:13388225"
     mRNA            <852821..>855145
                     /locus_tag="LDBPK_362240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865291.1"
                     /db_xref="GeneID:13388225"
     CDS             852821..855145
                     /locus_tag="LDBPK_362240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865339.1"
                     /db_xref="GeneID:13388225"
                     /db_xref="UniProtKB/TrEMBL:E9BTT3"
                     /translation="MPLSPLIRPMSPLQTQCAPSLPEPYSLADVVLQPFSGEASSTPA
                     AAWDQDTSFGAATGDIAPGSRRSSPAAPLSGVDAASVPPMAMWTPALPPLLPHTLAPT
                     FHSMVGDALSVEMLRESYAAQLQKGCQHRSAVEGLRCTSDGAAARARSCRGSDAGAAK
                     VFSANDAVHLGHSRRAPLPSLALFSPIHPYASGPTARTSVAPKTSAEEPSSAATSLSL
                     LHSAATTAMAAARPSYGAALLRKHPPAQPTGCREGCRSHLPAQKQVQRSSSQSLFERR
                     AHDRWEVVSPTSPLSSCGGASTAAESGETAPSKPNTAVPFTASATCYRSTAASDCTGR
                     SRAISIAAPPVAGRGGEAAAANTPAGGGARVSNPGVVSALGPAKVEAFVAPPCHAPGS
                     ACGSGEVRDTFFDPPHGLSRKALQTIQPGPATEPARQPAAQKQGKTARGTAPTTRSSG
                     GAASGPAAGSAASLAAESHLPRYVYPALEECRRLLHEIRIVSPLMRRCLTPPRPLESS
                     AGGGSGAATAAAASSTFSSARAPSRNIPAPPHSSAFPSLAAAATAAAPPKPATLAPKP
                     EARRLYHWDAATAAEDLSFMRGPFQQSSERFATSVDCQLRRLKALGTRLYGKTHDTST
                     SQAEVHAPARGRWSSPSPAPLASPWDSAVPRFDDDQCDREDNSVEESPPERLRRLLWE
                     TEAALPSLLEHEAEPSLSATRAAVLLAPFPSTIRYARDSRNDYSHGADDGAATGRAAG
                     VFTPPMESLLPFLSVSGSLTPARPAMLSSLSYGE"
     gene            <857863..>861150
                     /locus_tag="LDBPK_362250"
                     /db_xref="GeneID:13388226"
     mRNA            <857863..>861150
                     /locus_tag="LDBPK_362250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865292.1"
                     /db_xref="GeneID:13388226"
     CDS             857863..861150
                     /locus_tag="LDBPK_362250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865340.1"
                     /db_xref="GeneID:13388226"
                     /db_xref="UniProtKB/TrEMBL:E9BTT4"
                     /translation="MLEMEKRLQRHGHHAGAATTGANSDGCVASHRSTPSLRRSEGEN
                     PKRAGSDRIESQRARSSSSFSATHDATADAADAASVKSAHEEDWLARRRCKQAGVCDA
                     ESFDARRGGCALGGGAPARASAAYTFFSSQLRAPEDRRGRIYELAKALRGDGSHAVFR
                     GPGGGLLASPPADEQSRDSVEGAAALRIPCAAGSTSVSLGDAVAGSADMAMFSSQRTP
                     APPVQGEGFAPHHRELTAAGLQVYYSRCSLSSGEKESRRCPRLSGPTLLGSSVVEGVP
                     SAATAEGVSTAVAAAAALAFDSSRTSSCTPFTSHRQRPPPRMLCPPTPSPSPSPSRST
                     VMDAVLAAVANAEEGKESDASVMEQSFFSEMVPGAEPQLQPQASNANALPGQSSLEAC
                     TVSLGLEAANTMPLEPTTAAANSATSSPWQTRLWSSLPSPTVPAGTAVPAAAFVVATT
                     AVADVDSDAGVSVIGSSSSCRKRAVEGNDGADTGLQGESANREGALTEPRPAADTSVS
                     VGDAGGPLPLSPRCASSEPSKPRLHGGHTFASSAYRADSAPQHAGAVTANSASCLGCE
                     QATSCAASHRSISPPSAAVTAAVPLMQHDGAVEDSPILPICATSFPHGGQSTGRMSLP
                     SSRRDGCCGALSSWSTSSAACEGTGADNTVDVANDATDDVVQGHALTIRQSANTRKSP
                     STAVAEGEKHPQVPMKLLPSSAGSPSPIRPSTGCASDKERLHHELPMLHLCPGGGGEV
                     GDGQQDDADSNDEYDEAHLCCEDWASSPAEPAAAAATCQTRPSDTLGGLHVDGNDDNN
                     DGDDGGEDTAGQTWAEEALRRAEAECAVLRLELTFATERAVAAEANAQVRERECAELH
                     ALVSRMQAQLAAAQTRADAEVQVAACTASLDDIAASAFSSPNSPNLLGTTPLSMRKGT
                     ALVEGTVWRRRHDIVAQELATLKVSMAEQLAVLDRLGMQPPFSEELVCAAERRLRHVK
                     VAHVPDTAMKASQPDATISETPHTLTRSTCVDSAASVDLSAGGASVTATAKKIQVRNG
                     NKIAALLSQRKQNRHREKPAAAADAMATGATDSATTPSTSAPPAKRDGSQDRRSTLDA
                     KENHYVV"
     gene            <862351..>864066
                     /locus_tag="LDBPK_362260"
                     /db_xref="GeneID:13388227"
     mRNA            <862351..>864066
                     /locus_tag="LDBPK_362260"
                     /product="DEAD box RNA helicase, putative"
                     /transcript_id="XM_003865293.1"
                     /db_xref="GeneID:13388227"
     CDS             862351..864066
                     /locus_tag="LDBPK_362260"
                     /codon_start=1
                     /product="DEAD box RNA helicase, putative"
                     /protein_id="XP_003865341.1"
                     /db_xref="GeneID:13388227"
                     /db_xref="GOA:E9BTT5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTT5"
                     /translation="MAERNYSPFSGFSTTSRGGGGAHRKGSSEGMGSKLAPVNWSAKS
                     LVPGKWKVVDASAIRKAASVKDDHSASKVKHLSDVEAEEWRQANSITVSDSDQCPNPI
                     TEFDMLTAVPQYLKAKLLEQGFKAPTPIQAQSWSIVLSGRDLVGVAKTGSGKTLAFIV
                     PALAHIALQEPLKVGDGPMVIVLAPTRELAQQIEQEAIKVLPQSIRCGCIYGGAPKGP
                     QLGLLRQGVHILVATPGRLIDFMEIKRVNLLRVTYLVLDEADRMLDMGFEPQVRAICG
                     QIRPDRQTLMFSATWPRDIQNLAASFQKNWVRINVGSMELLANKDVTQHFILTSEAAK
                     LDELKRLMERHRNQRVLIFCKTKKTADYLEFQLKRNGVDCMAIHGDKEQRQREFILER
                     FRKDPRLCVVATDVAARGLDIKELETVVNYDFPMQIDDYVHRIGRTGRAGAKGASFTM
                     ITKHETQLNASTVFQLVELVERAGQEVPGWLREWAEQGGGYHIPKRNRNMMGSFGRSG
                     PRMRMPGDSPAAGAGSSGGHFGLTPHAKGSPAFGMPDSAIQNKKFDYSSDDDDSARPA
                     KRARQ"
     gap             865892..866004
                     /estimated_length=113
     gene            <867374..>868444
                     /locus_tag="LDBPK_362270"
                     /db_xref="GeneID:13388228"
     mRNA            <867374..>868444
                     /locus_tag="LDBPK_362270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865294.1"
                     /db_xref="GeneID:13388228"
     CDS             867374..868444
                     /locus_tag="LDBPK_362270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865342.1"
                     /db_xref="GeneID:13388228"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BTT6"
                     /translation="MLPASLSPFPHASPIAVAHTRTPIMGSLFLLIDIDNTLYEYSET
                     GFHHEMHDRIFAFAQQKVGLTAEQAERLSRKYWLNYGLSLYGYVKEYNVDAKEYSDFV
                     HQCSYDKLHYNKPLIDMLLSMQYAPEDARGHDEPRSTSIDHLYYFTNANHSHARSVLD
                     AQGLRPIFTRPRPVGLPVKESHPVGEQAGAEDQVEWLGFSYEDQWRLTHPEIANKPMR
                     RAYEAIYKVIEDQVAEDAALVATTTTAGSESAFASSSALRNSGSAEEVKNKRAHLRPE
                     NFVMVDDSLMNIDAPLALGWSAVWYAHDMQELPTDAKDNASAPLYAAAVASGRLQVIR
                     NILELRAAVERIREANSRSTSS"
     gene            <869498..>870304
                     /locus_tag="LDBPK_362280"
                     /db_xref="GeneID:13388229"
     mRNA            <869498..>870304
                     /locus_tag="LDBPK_362280"
                     /product="COP-coated vesicle membrane protein erv25
                     precursor, putative"
                     /transcript_id="XM_003865295.1"
                     /db_xref="GeneID:13388229"
     CDS             869498..870304
                     /locus_tag="LDBPK_362280"
                     /codon_start=1
                     /product="COP-coated vesicle membrane protein erv25
                     precursor, putative"
                     /protein_id="XP_003865343.1"
                     /db_xref="GeneID:13388229"
                     /db_xref="GOA:E9BTT7"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:E9BTT7"
                     /translation="MMSSSNGGARAHWSRRGIPQLLLLLVGFAVALQAATPAQALTYH
                     FVDSKPLCFSEIIENVQTSQITGVYDWKPSAHSPASQVRLRLSAKDGTGNVYYDKEMM
                     EGEHSFAVQLNPNVLSGEQLICFTASSNFVASEEKPVKVSIELDQAPKNEFNADKVVV
                     ETIQKRRQIDGLDVYTYQEAGGELKDILQPRAYLETIDRELSAMERLLDQLVTNLGTS
                     VMRESRMRETSESTFTRVWVCALLLIGIISGVLWMQFRFLKSTLRKKKLL"
     gap             872486..872584
                     /estimated_length=99
     gene            <873042..>873431
                     /locus_tag="LDBPK_362290"
                     /db_xref="GeneID:13388230"
     mRNA            <873042..>873431
                     /locus_tag="LDBPK_362290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865296.1"
                     /db_xref="GeneID:13388230"
     CDS             873042..873431
                     /locus_tag="LDBPK_362290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865344.1"
                     /db_xref="GeneID:13388230"
                     /db_xref="GOA:E9BTT8"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:E9BTT8"
                     /translation="MADEEDYDLEVNKKEVDKIERPERLIEVLQHDTNQTLTEEMVEH
                     AQTVLDSMPVEHTYKDVAAKLKRRLDGAYGGTWHVIVGKHFGANVTNDDDTLINMKIN
                     GVYFLAMRSGPPERPQESAENEAVTEE"
     gene            <874604..>876907
                     /locus_tag="LDBPK_362300"
                     /db_xref="GeneID:13388231"
     mRNA            <874604..>876907
                     /locus_tag="LDBPK_362300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865297.1"
                     /db_xref="GeneID:13388231"
     CDS             874604..876907
                     /locus_tag="LDBPK_362300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865345.1"
                     /db_xref="GeneID:13388231"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BTT9"
                     /translation="MPAPKSKLKLFGKNRREIRSATTTYDEHGNWVGTPHQDKMRLVG
                     NKMFDNYYDTLQQLGRVVARTVYPTSTDACVSSSSSSCVAAQGASAGVAASLWVREME
                     LFRTPLLTTFWINDTDPLADHVRAYMESLDPSLVEPISWYPIAGMGWRILADKAEFRK
                     RPEMQPLRQYLIRQTALGTISRQEEVSMIPPFLLDIQPTDVCLDMCASPGSKTAQMLV
                     ALGRHKVVPFDSDASPFPFQYDSDGLVIANELDTKRANMLVHQVKRLRLLFPFALFTN
                     HDARYFPEMSLQPQPGDADKTTAAGTQVLRFDKILCDVVCSGDGTLRKAPHIFKLWSP
                     KEAINLQKLQIEIALRACHLLRVGGRLVYSTCSLNPVENEAVVAQIVYRTRGAMRLVD
                     ARALLPQLVCAPGMTRWTVTDAKGRVFPAPEGNMHEALFPPHTPGGYSSAAVDALDLS
                     LCMRLFPTHCKGGGFFVAVLDKVSEYRLKRLEELKAEEKGASSENTAEAATERQTIIG
                     STAPPKREKKEVHAVSSGGAEATADAGADALEAKLTTVHEPVKPKSLPPQFVGAPAEI
                     QRAITDFYEIPQFPMQLLFVRTAQGERELRLTPGSVCSIVSRMAAQVLRHKTDNVLIV
                     SAGLRVIAFECLDKGWRIASESAVLFAKLMRRSSRLVRVPVSLIQDMVVNGGKLKEKL
                     LDSVEDTQLRSRLERLPIGAFLLEIEAPKALGGVFYSAALRARSRIQLLVDHEDLEGV
                     QLRLGEDPVEPAEVPKAENEDDARERK"
     gene            <878592..>880163
                     /locus_tag="LDBPK_362310"
                     /db_xref="GeneID:13388232"
     mRNA            <878592..>880163
                     /locus_tag="LDBPK_362310"
                     /product="protein-tyrosine phosphatase 1-like protein"
                     /transcript_id="XM_003865298.1"
                     /db_xref="GeneID:13388232"
     CDS             878592..880163
                     /locus_tag="LDBPK_362310"
                     /codon_start=1
                     /product="protein-tyrosine phosphatase 1-like protein"
                     /protein_id="XP_003865346.1"
                     /db_xref="GeneID:13388232"
                     /db_xref="GOA:E9BTU0"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:E9BTU0"
                     /translation="MSHDVSCVSRPSLLSNSSSRSTSEPPDASLLSAAATAAATPPPS
                     DTQASGVDVAGSAEYTCGNYDLEGSTSTVDALIGASCSKRERNPEFNMYKLPIEEQFN
                     LIEEEFAAIEASTMNPRLYDFTTSNANPTKNRYINVLANEETIFPPTRLTSAPPATGG
                     STLSTSRSPPSMAAAPSPMKSLTSRAQKVWGAAGQRLFGTRRGGTLPKDLEGNEKFTT
                     DCVAKKCPQWYINANVVDTSVEPVFVASQAPVQECIDDFLAVIYSCEVTLVLMLTEME
                     EAGFVKADRYWPEDSAPVDRTESFGSMCVYKDEQDPYTYDATHELVRRPFYIRPSAAS
                     QARAHKIVMYQYVGWPDRGVPDSTESFEELLKIIQDYAMVPAAQRMPVARPESAAHSS
                     IATNSGGDGSTNNTASDDGAGKLTPPVFVHCSAGIGRTGTLIGAYTAVKLTEAGLLTN
                     TSIRRIVTDMRKARFGMVQRVEQYMFLYMIVLQHIGVDTRKFSARMQPRADMYNMRWM
                     ETRQKALLGARAAKR"
     gene            <882722..>884482
                     /locus_tag="LDBPK_362320"
                     /db_xref="GeneID:13388233"
     mRNA            <882722..>884482
                     /locus_tag="LDBPK_362320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865299.1"
                     /db_xref="GeneID:13388233"
     CDS             882722..884482
                     /locus_tag="LDBPK_362320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865347.1"
                     /db_xref="GeneID:13388233"
                     /db_xref="UniProtKB/TrEMBL:E9BTU1"
                     /translation="MSNGVGAGLPRAPVRGEGLGEGSATRPLAAWRGLLPRPGVGDAS
                     TAPQPQHPLGLASLHQHAFSRLNRATTASDEEADQATFNRETEDEDAVADDETGEEDG
                     GGGRRSVVQSDPLRVVVDFAEVRRAAARSKTAAAAAASSDGALQQAEEAEAMLTDAQK
                     GSESHRHAKQDNASRCSLEAERDARDVASARAFLEKRAWADVHRRATQAATTPAPPSE
                     LLLDLLQHLPTTPGRAIYDRSSCPPTAAASGFDEDFHKCVQQLMTQIVLQRDGRIGDA
                     KLPSVSLADAAAAQQDSASLRHRSRMQRKGAKQKQKEGEVEQLVEAVERGIADDVRDV
                     VAYARFLMQERLHQEQRKVSERLSSPSKTAVEESEGNFCPDGDMRAPEQQQQLAELRA
                     VVEKKLSLMRAAAESTDKGGESESATLRTKRAQSTRGSEDDANGIPGATDAALQDSKA
                     VFAAAHRRFMDVVRSAAASRREKVEAAQAAEQRLEATVAAWRKSYDKLLTRELSRHCA
                     GKRPDKQSRTEALLQAMQPQQEKHQKRQHHRPPTGLWEMTKGMHKKERKHLSKLVKAA
                     ANVLPLPPFQYPPAPPHFSP"
     gene            <885086..>887017
                     /locus_tag="LDBPK_362330"
                     /db_xref="GeneID:13388234"
     mRNA            <885086..>887017
                     /locus_tag="LDBPK_362330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865300.1"
                     /db_xref="GeneID:13388234"
     CDS             885086..887017
                     /locus_tag="LDBPK_362330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865348.1"
                     /db_xref="GeneID:13388234"
                     /db_xref="UniProtKB/TrEMBL:E9BTU2"
                     /translation="MEALFYDHAVTSTATRQADLRQALQAFLTDAASRSAVQLIALFV
                     RIPVPSIVAVAAHTASGSRTSSRTSSSREGGSVAARHAATGKAASAASPSPPAPSRRS
                     RNAARLAWCAWEADRRLRQAAEDASEMNKWLAHDDFSASRKAGAGITRSSFRDAFVVA
                     VAFLAPHTRDDLVVYESWQRCAEMCAESSAAGVASGSASRTTRMLSPLRHARLVALSL
                     GAPSLLLSWAERPTRCHLDSLLLPHQSLLVDLSWWLATASGSAGAVSDAAAGSRVSNS
                     VLRDIFISDVQRSLKLPKGDSRCAVWISYATLLASLHPQVMGSGDGADGDGVSMDMRV
                     ARSASRRKRGRNTLCGEVSGVDEQAFMMTYARVRQLLSSLNASQAGAVGRTQFLRVVL
                     SYGGPSSALRRQLVHTCSRTEHGVTAVDAALLRTRSLVDVHALFGVLAGRDTGNVYSE
                     AAAFVRTARRRASAGQTSQQRHQRIAIQSARVEVTSSPSCAPPGTEHEVVDRGAGNLC
                     HNAFVERGARALARKLRLWERKRLGKRGKRGVHVRPRDTAAKRPMKRGHAEASGADSE
                     RVLAHAVERASRAAASPKTGSKRRAEPLACVDGRASASATRALLPPQKQRRTDAATVS
                     PTLTTETALRWSEDVAGSG"
     gene            <887931..>889466
                     /locus_tag="LDBPK_362340"
                     /db_xref="GeneID:13388235"
     mRNA            <887931..>889466
                     /locus_tag="LDBPK_362340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865301.1"
                     /db_xref="GeneID:13388235"
     CDS             887931..889466
                     /locus_tag="LDBPK_362340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865349.1"
                     /db_xref="GeneID:13388235"
                     /db_xref="GOA:E9BTU3"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:E9BTU3"
                     /translation="MSKAFGGGMNNGTLGKGPVPTDAGIPIRSSGVDAYGNGAHTQYP
                     QAELHYSGVGGPPADGIPLYPEAASNPAQAPRLSRFRIQGFKDVWATFVFAIFVIFSI
                     AWSIVQLTTYHFDTDPHSQSPFSGANGPRLGYVAIACLASAGASVISSLVMLALMQRI
                     PVQMIYVANIMTILLFFASAVMAFLRVHVVVGILMIICGVFQAIWLFLVRHRIPFAAA
                     LLRTSARLISTYKLTVVLNLMLCTVSFGYIALWGYGVAAPVDRFYKDQGNGGYIFVIA
                     VLVFTMLWVSQVTPNVMHVTTSGLVATWYFAGSDNMPRHPTLASFKRATTTSFGSICF
                     GSLVVAIIQFIRWLVESSGSDYENGFVHCLLECILRCIERIVEYFNRYAFVHVAIYGC
                     SYIEGAKRTFALCKQCFFAAYFNDCLVSPTLNMFTLAVSLVFAFIAGVLSRSWPIGVL
                     AFVVAVIVHSLFFVPVDSAVTTVFVCFAECPEALRESDLQLYATIHAADANGTHNNAP
                     PPL"
     gene            <891368..>892495
                     /locus_tag="LDBPK_362350"
                     /db_xref="GeneID:13388236"
     mRNA            <891368..>892495
                     /locus_tag="LDBPK_362350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865302.1"
                     /db_xref="GeneID:13388236"
     CDS             891368..892495
                     /locus_tag="LDBPK_362350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865350.1"
                     /db_xref="GeneID:13388236"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:E9BTU4"
                     /translation="MFRGRTFLVSLAASPLTVAELTQNGGRVVYDLDDKTPVTCAIIA
                     SDNQPGTPARCSRGSGPSKELPKSVESRVRSSRLTVVYEHWVHECLRENRLLLPCRDY
                     PDTIAYDPYLFAGVHFTTTQLPLQLKANIIALMQFYGATYHNHLLDTTNLLVYSHMRL
                     SPAAPRHAATAPLAPRLLAAGGCGAEAPPSTNEAEAANTSPSQQLSTERSGDNPTDAA
                     QPSLTKLAVARQRGLACVTPQWVQLCLNTGELKPASSALAATPLAQTPPPPSTNSSST
                     IRADAPVPIVTAAGDLRHNEEEVDRWVGEVLRSTSPLALPHSGGATTGVCAAPLPGSS
                     LCTVPGRQEEAAEVREALRLAAQLSLSGASASRTRKRRRAH"
     gene            <894246..>895925
                     /locus_tag="LDBPK_362360"
                     /db_xref="GeneID:13388237"
     mRNA            <894246..>895925
                     /locus_tag="LDBPK_362360"
                     /product="vacuolar protein sorting-associated protein
                     45-like protein"
                     /transcript_id="XM_003865303.1"
                     /db_xref="GeneID:13388237"
     CDS             894246..895925
                     /locus_tag="LDBPK_362360"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     45-like protein"
                     /protein_id="XP_003865351.1"
                     /db_xref="GeneID:13388237"
                     /db_xref="GOA:E9BTU5"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:E9BTU5"
                     /translation="MNRILPCDTNMKVLLVDDGALPMIATAFSQTELLKHGVYLVESL
                     NSAARQRNLMKMLRCYILLRPSLASVEAACVELRMAKYRSYHLFFCGATSAEMLDRLA
                     NADNDSLVEEVQEVFCDFNAVNKDAFVLETPPPQSLVSSFMSASQVRRLAEGLASLMV
                     AQRRRPRIRYQKNSPFVQRLGAELVNVLKSDPGLYDYPARDTVLLLLDRNDDPLTPLL
                     TPWTYQAMLHEHIGLRSNTLKLPADVQGAEEEGYVFSEHDDAFFANNMFNNWGDLCNN
                     VKKYVDQCKDALNLDRPTATLEELKAFMQKIPQTKSLTGSVTKHTTVTTYLSGVIKRR
                     NLLEISLLEQDMIASSDQSNHWARLQSFASRPSTSQEDLTRLCLIYHLRYEKPGGPSQ
                     VAPYLDRVNSNYALLLCKLRQYYGLHRNTDRLFAATGVVAKIVKTFVDVGNIYTQHEP
                     VLKRTLQQLYSGQLDTASYPYLEQPTSSSGGGGVANAEHKPMEVTVYMCGGYTFEEAA
                     LVHGINARTAYKPADAASFAAGGSSIKASIGGEAVLNTHSFLSLLDQLSPS"
     gap             896244..896342
                     /estimated_length=99
     gap             897178..897306
                     /estimated_length=129
     gene            <898817..>906628
                     /locus_tag="LDBPK_362370"
                     /db_xref="GeneID:13388238"
     mRNA            <898817..>906628
                     /locus_tag="LDBPK_362370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865304.1"
                     /db_xref="GeneID:13388238"
     CDS             898817..906628
                     /locus_tag="LDBPK_362370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865352.1"
                     /db_xref="GeneID:13388238"
                     /db_xref="GOA:E9BTU6"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:E9BTU6"
                     /translation="MISKVDPMVLPSACSDDEPRSHGPHPDSPPVTSARCSAPLLPSG
                     AAYRATPSTLVAAPGTQVSVLNLVSALPLLLSLDRSHYTATLGNAQGGVLDTLTAPAA
                     RGDGRLGPLSWTTITTDAATAAVRAVLYARGTPSWQAKRRRLRRLALDSFFRSTVSAR
                     ISVRRERGAKGGDGVHEAVVRLLHHTRAVMSDISPTQAHLVDLFAAQIMCGAQSAGAA
                     VEGSPHAAAGKAIDETTDAEGGQSLDASHATTAMMRERSKPEFERRGIMKSGVSPSIS
                     VTASPRHAQGEITSTPASATVAEQLLYIILRTSIAANTPRRPLAMHGDDTPALLADGL
                     HTSPPQGTDGATAVGGLTRKKPRLDNFDCISPATLSSENGQSIYRYSSDAGSANPATA
                     LPYEPYCWLAPSTVALVECSQALRRHQRWTCDLDPVIEATVAGEGSRTHSSHLFRGAG
                     TRSAAVVSLLDSMRNSWAPLPGMADSDDAAVLTALVRDSGLPFAPASISAALDMAHEA
                     GPASHSRGFQWGQTMMGGEDPAVEALFADGRARRIDSRRGEADGIPGSEGATQTRQRE
                     ADAAATALPACRIPFVSCLPLYDEVVYAQVHLALHWCTAGHADPFCLTHIDNTAGSNL
                     PALRVRDEFYARPLPTNGGAGTAAAATAISGLASLLEWGCYYGTLLRRLHRLCDVADN
                     VALRGTLGSYGRCAMSTLRLLLCLLQRQIGELGHQAGGPHRLSFAELLTAHQRLQRAV
                     EQVEVLAAFFGVPAVAAVPEAWDPVDVLEERCSSALLISRLYECFTARHADALGRHGS
                     AATHYHELQQERLAELLSSLGGEDSEELPLQANTPGGGADQQRQKMRAALAAVESGTA
                     PPSVRISPLDTGDNYGAWEQHRKDLLSYSIDVIGLLLRSTLRPLNAMLDRWLKAGELA
                     DPYDEFFVVPSHGQTHSGFTLEPSPQRLPVFLSVAAATDLLHAGVSLRVLRVASTHVV
                     LSAQKDARQLEAMAEINEAAAEDYVGELLDTQTLRRAIEQFIEQLVHGAPTADAVHDM
                     RHSGTGANDEVEVTDAAPMPLPPRVDLLSAYGAINWWKEHYQACTRVLLEVVKEAANP
                     AEGGDEDGSTEAAPDPSLWLHADEEEGLRSAEEASAAENEHVGGATASETHTGHAELS
                     LSCATAAPAARDDHHRDRSPHVKAAFPSKESTSEASSYITVFINSDDDEDRGAHSGMG
                     RATGGRQGADSASIASSSPRSSTTTTTSVLGLRHIAGSRFSTGTTVSSTASSRGTMAL
                     YGAITEELRQVSLLEQQTEADLGQCRQALRAEFDAQLWRRRRDNRLSDWKAQRLALRL
                     RRVRAMEGIVEELRDVYMIRAVGHTEIQGSASRSLEEVTPSHQSRSEKEETEQHGAGQ
                     EPSVAGPTMTEMRVVVPLRQLPPPRVAPPVILYAVPDDEDGVDGVTGGRRGSRLFPGR
                     SRRTSFAANTTIMELPATGARDTPQSCGRQRRSLSASILRTSNWPRTSGSPSLSACTA
                     RRVSAAAAGAGGVTFIDPLSTGASVQHSEGVGAGPGIIRQLRDVATAALPTFGVMEKR
                     SPVEPAQSAVATFTVPSVSTPPPMPPSKSSHKRCEQVEAAMLREHADMAAAVAADEAH
                     AAAVRRDELGYAHPDALFRVADINDDDFLLMRTGLKGYARREAEAAALAELAERQAQL
                     AAYTVDEPGYLRQLAAAAAAAVTNPCSGSPKGSTTLPNSGLSAQRRSRVSIKTERDGA
                     ARDDRADEGVDAGGGAAHVGGSIQLPSELDPAWQQDDPQRGSREARATIARTASMAKS
                     FTDELWSWTATEAHRWYFDDLVPLHHALTGAEVDRALIVDVALTCDEAEALQRCSGYY
                     RSLGQYTASFLTHKALQLTLLPPYGSLYRLTTQFLDVCLLQRAPIAVRLMDLWMTLVD
                     AALEMMAEAEEASMVQRIISGETRLSALAALADTRQGLNVTVALSSLNSAFQHEWATC
                     VTNGESTVKLEWRFMSSGGEGHERLSSAAEALGSDAGFTEGDDTAEEGVRNVSSVSRL
                     PHQPTPLSQGSAEKASKKSFPIHSFLASLSLTAASPWCSGAWLLPDHTLHCTGAIFRT
                     LLFWKSAERIVLHTWRAGMDSGLSSVFFFCTTVRQVLLSSLQETVWLRLEELTAAYRE
                     SLQFEAGVLYTYRSLESFTIDNATFLRECEFYTLCGPQFQCRVCPVLQAMVDAVEEAE
                     RALRFAQVSTRVARRQYMATFRSMVGSGSSSDSGSDSDGGTDSDCCRQARGRPVASAP
                     RHVFTLSRWSRRARKRQSAGKAQAGGSVAWASPWHLQPLEDALARHSEELSPPEATSG
                     RLTDVDAPDTESEVDVDSAGTPRRRAEKGRKGPAVKAKRSPSSAVSSAVAARFTTPVL
                     DKSLLALLSTAGGEEETHREGDSASTAAPRKKRRRGGSQPAGARQPTTATAAPMATTL
                     RASATAQRSQTPKCSRSAEVSVRRSPAPAEVSSSAVAGAAKTATPAMKRPRRGRRQQK
                     RMPSAERKERRCKLRAIAERKIKEEVDHQRRLVRDMISRQLRRFAWLTQSLRNALSEV
                     MVEEDVKGMEDESIAATATATSDGASLKSIKDLHKAQRQHMNRNAYISTILRKLDALI
                     EVMATQV"
     gene            <907745..>908851
                     /locus_tag="LDBPK_362380"
                     /db_xref="GeneID:13388239"
     mRNA            <907745..>908851
                     /locus_tag="LDBPK_362380"
                     /product="developmentally regulated GTP-binding protein 1,
                     putative"
                     /transcript_id="XM_003865305.1"
                     /db_xref="GeneID:13388239"
     CDS             907745..908851
                     /locus_tag="LDBPK_362380"
                     /codon_start=1
                     /product="developmentally regulated GTP-binding protein 1,
                     putative"
                     /protein_id="XP_003865353.1"
                     /db_xref="GeneID:13388239"
                     /db_xref="GOA:E9BTU7"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTU7"
                     /translation="MSSLQKISDIEAELARTQKNKATMAHICALKARLAQLKRELIAS
                     ESKKGGGKGEGFDVQKTGDARIGFIGFPSVGKSTLLSKMTSTHSEVAAYEFTTLTCVP
                     GVVNYRGAKLQMLDLPGIIEGAKDGKGRGRQVIAVARTCSLILIVLDIAKPLQHKLII
                     ERELDGFGIRLNKSPPDIVIRKKDRGGISISSTCPLTHIDQETIKIILGEYRMANADV
                     TFRGDYTADEFIDAIEGNRAYIPAIYVLNKIDQISIEELDIVARIPHNCPISAHHEWN
                     LDGLLECIWDHLNFIRVYTKPKGQVPDYDAPVILKKSPQPSVESFCNRIHRQLIRNYK
                     YAWVWGSSVKHQPQRVGKDHPLDDEDVVQVVKKV"
     gene            <911477..>912466
                     /locus_tag="LDBPK_362390"
                     /db_xref="GeneID:13388240"
     mRNA            <911477..>912466
                     /locus_tag="LDBPK_362390"
                     /product="guanylate kinase-like protein"
                     /transcript_id="XM_003865306.1"
                     /db_xref="GeneID:13388240"
     CDS             911477..912466
                     /locus_tag="LDBPK_362390"
                     /codon_start=1
                     /product="guanylate kinase-like protein"
                     /protein_id="XP_003865354.1"
                     /db_xref="GeneID:13388240"
                     /db_xref="GOA:E9BTU8"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTU8"
                     /translation="MSVAPKAPMPAISSVAAASAAHKTAQQAVGPLKGTVALRRLVDM
                     LLFVGPSGSGKSTVIRRLQRDWPTLFEFSVSHTTRCPRRGEVHGQHYYFVTMEEFQQL
                     VDAGHMIEYSRLCMPETSSSTPPLSKPVGNLYGTSKKALHTVLARNRVVLMDTDLLGA
                     INIRRYCSREVVSTRPVTVSQAQRSMAQRDDDAAPAAQTLLTLSMPRHASVSLENEHA
                     ADPTTANPSKDSMLPSSPFYAAPVVTRTLRCMIIFIAPPSMQVLEQRLRERKTETEAS
                     IQLRMKVNRQWMQWAKENQSFFDHYIVNDNLDLCYAKVREIVRAEVLMVDSTL"
     gene            <913815..>915200
                     /locus_tag="LDBPK_362400"
                     /db_xref="GeneID:13388241"
     mRNA            <913815..>915200
                     /locus_tag="LDBPK_362400"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865307.1"
                     /db_xref="GeneID:13388241"
     CDS             913815..915200
                     /locus_tag="LDBPK_362400"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865355.1"
                     /db_xref="GeneID:13388241"
                     /db_xref="UniProtKB/TrEMBL:E9BTU9"
                     /translation="MAEAKVVKDLAEVCARGEETYSVWTTAKALVQRRYLSAKAQGTF
                     EDCGKLLVSLTQVLRTYLRIDLAQELLRDMLFQVMERFSAKQAAGATAAIVKDGGAPH
                     SSFDLAAANFLQHVFDTLLSATTRTYTLMGPMPLVVEWNRDADSGGVDAVVAQSKHAA
                     SWAEDVVLEFAARAADFLSQRLQSADVLSRWAQNLFVSYEQLLALRLALPSSPPSTPQ
                     DGKAASTAAPSPSVPVPTLAAQLLRMSIFSRASRTGKESSDSPSAATTPLTAAVHWLT
                     HFAREPNAVNHLFAQYVYFDILGRGQQRSSTTNTAPGNSGAPAKMPLERVNAALEERC
                     ALTRREAIYMARAAVEAYWQAFPLVLKQTSSASSRQLSSCVEESGKEDANVDPQYVHL
                     YRWTWFLDSLTLTFAYSGSASAGANEDAAAQQRERQKHVCAQLLETYADVAAELPGLK
                     WKELIAAYIGP"
     gene            <916283..>917770
                     /locus_tag="LDBPK_362410"
                     /db_xref="GeneID:13388242"
     mRNA            <916283..>917770
                     /locus_tag="LDBPK_362410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865308.1"
                     /db_xref="GeneID:13388242"
     CDS             916283..917770
                     /locus_tag="LDBPK_362410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865356.1"
                     /db_xref="GeneID:13388242"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BTV0"
                     /translation="MQTIGGRVPDVAPLSEMGSSGNGLGTELGATVASPHRGSSASAA
                     STAANAQQKLVQELQAIRERRNWLIHLLYVRQEYSNCLQVIEAQLRETGGTCEYALYV
                     KGLLKRLEGSLSESLELLQTAVIISPENAATRTQLGRALHLLGRHEEAIQAFQEAASI
                     RVVKGLGADWEIEYYIGLCHLHRRHYRRAMDAFLQSITIQRHDCAYLQLGKAALLAHD
                     YATALQVYEEAVTLSPTNPDLLAVLGHLYLQQGNPCAAFDYLGRCLTICPTHIDALVA
                     ASSIIQDSGDYDVALSKYRIVVAQQPDSSQVWNNIGACFIGKKMTYAAVACLRKSVFL
                     CPLDWIGHYNLGVAFLMIGRYCSALQCLNAAVHLHADHAPAFMLLGICLGEMKDLPNA
                     CRAYEHALAMQDDFLVYLNYAVTLYKGRSVQEAYTKFRVFRSVWDQLTPEQRREQSSL
                     IPGVIRQLEDLLEPPPEPPMSTSDPVPEESAAAALATAPNPESLP"
     gene            <920388..>921818
                     /locus_tag="LDBPK_362420"
                     /db_xref="GeneID:13388243"
     mRNA            <920388..>921818
                     /locus_tag="LDBPK_362420"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003865309.1"
                     /db_xref="GeneID:13388243"
     CDS             920388..921818
                     /locus_tag="LDBPK_362420"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003865357.1"
                     /db_xref="GeneID:13388243"
                     /db_xref="GOA:E9BTV1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BTV1"
                     /translation="MRMPSVFTAPSTYMADLEVGAATSYHAHSEAATAGESDTCKPAA
                     TTASTRPPLAPHAADADAHNAVELSISSTAVAPAYQLRGELGRGQYGCVYLVEECVRH
                     HLLAVKATYDPIQVAAVRERQRRQERQQQKPSKGSGGCAREAAFSPYAQHEEGHAVVP
                     FPPLLPHFSNEVMCLRECHSPFIVRLEGADKGENGEDLLLMEYVDCGDLRREIRRRCA
                     AGTPFTETEAVFVFLQLCMAVDHLHQLNILHHDLKPENVMLSSTGIIKLGDFGFAKKY
                     REPVSQRVASTGCGTPYYLSPEALRGDRYSLKSEMWALGVILYELLALTGPFAAATRA
                     ELRAKVHSSDYAKLPATYSNELRSVCYQLLTLDPDQRPSTRDLFQDNEYLREKLNALR
                     RISECSVNMSTEEKGSMFHSISAALRRKPPSAKGPATASFNLGWGGSCKISSHGHGSA
                     RPEAAPKPRVERPVEMTPVARTRSVC"
     gene            <933927..>935375
                     /locus_tag="LDBPK_362430"
                     /db_xref="GeneID:13388244"
     mRNA            <933927..>935375
                     /locus_tag="LDBPK_362430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865310.1"
                     /db_xref="GeneID:13388244"
     CDS             933927..935375
                     /locus_tag="LDBPK_362430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865358.1"
                     /db_xref="GeneID:13388244"
                     /db_xref="UniProtKB/TrEMBL:E9BTV2"
                     /translation="MEEGAPANATASLPPSYESVLVFLTTLAQWLKHARERLTCRDEV
                     GRHAIAVEVLTRHRERAYERLAESVWRHTAVAGDISTSLFPSASVELAAWVLLRLLVL
                     LLTWWLLMRLVRATTLPRLRARQIAVHPDVHLSTSIGNAQAVEAFIHPDAAQRGINAT
                     LLLTVSACVSVACLLILCLLTMHVWVDVVLLRLLQHWTAPLRQAQAWVASHWLWPSNS
                     PQPGSLRAPATPVEQYATSFISVVSGLNSSLFSKLAWLRRVTQQVKLMYLWGMVGGTM
                     LGVALWLLGYSSRLLRTYNTSLPYFEENDPLLCWLGQQEAAAAQQRTNAAFAALLESQ
                     HRQERVMERLASSLAPATPRQRQRYLQVTEEGVESHCFVDDAALAAATSDATEDERCN
                     GETAAGGTDAVIIGKGCSGGGDPGKLRVESGPSPDKALAAAFEEAAAAASATRDEGAA
                     EASCGTTPQAGEKEGAATTASRMAKEGESPRS"
     gene            <936345..>937322
                     /locus_tag="LDBPK_362440"
                     /db_xref="GeneID:13388245"
     mRNA            <936345..>937322
                     /locus_tag="LDBPK_362440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865311.1"
                     /db_xref="GeneID:13388245"
     CDS             936345..937322
                     /locus_tag="LDBPK_362440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865359.1"
                     /db_xref="GeneID:13388245"
                     /db_xref="GOA:E9BTV3"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:E9BTV3"
                     /translation="MNRIPAAARNAPMYATAMSQFAVCRQPWNEYISLLTKDDAQPFH
                     TTPQEKPAYRGRKRGREGWLFGQQVQLHYHRFPDEQLFTNLTRWRMGDTVGDVAIQQF
                     RNAQPFDIEDKDPQGFQRPAPEVYMKLNYKNPATISRFLTRTGHMYPQDIMPLNPEAV
                     VKLRVAKAQAIRIGLYPRFGNPFWFRSQRFRPKAYQENYDPTTYSTKHTMEHFAYNWV
                     QTDRIRQYFKGLEELHQSRRATASSGGGGVTSEHKQQSQLYAVDNLSIEMHRNAPSYR
                     ADVERSIKNPTVPGLMSTKGMKKKFHNLYSSTSTKRMGFSNPTLGIKKV"
     gene            <938536..>939771
                     /locus_tag="LDBPK_362450"
                     /db_xref="GeneID:13388246"
     mRNA            <938536..>939771
                     /locus_tag="LDBPK_362450"
                     /product="glucokinase"
                     /transcript_id="XM_003865312.1"
                     /db_xref="GeneID:13388246"
     CDS             938536..939771
                     /locus_tag="LDBPK_362450"
                     /codon_start=1
                     /product="glucokinase"
                     /protein_id="XP_003865360.1"
                     /db_xref="GeneID:13388246"
                     /db_xref="GOA:E9BTV4"
                     /db_xref="InterPro:IPR003836"
                     /db_xref="UniProtKB/TrEMBL:E9BTV4"
                     /translation="MSLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFAQ
                     AAQHDRSGLHIIYVRFRVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVS
                     VPGPVTNGQLAGPFNNLKGTARLADYPVELFPKGRSALLNDLEAGSYGVLALSNAGML
                     SDYFKVMWKGTQWDALSEGKPVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLA
                     LECGCLSMSWCANEDSKYVQALAGYMASKARAKGLDSTVAPIWEAATNGSGLEFNYAY
                     EKEGQKASVPLKSAPEVAKLAKAGSDPAAVAAMDRLYKNLMGLTAETTMQFLPLTCVL
                     MGDSIVSNSFYFDNPENVKRLQARINEHTMERQLKFLSRTTFLRQVRSVNINLLGCLG
                     FGSQLSDPADQLAPNKSNL"
     gene            <941682..>942869
                     /locus_tag="LDBPK_362460"
                     /db_xref="GeneID:13388247"
     mRNA            <941682..>942869
                     /locus_tag="LDBPK_362460"
                     /product="endonuclease V, putative"
                     /transcript_id="XM_003865313.1"
                     /db_xref="GeneID:13388247"
     CDS             941682..942869
                     /locus_tag="LDBPK_362460"
                     /codon_start=1
                     /product="endonuclease V, putative"
                     /protein_id="XP_003865361.1"
                     /db_xref="GeneID:13388247"
                     /db_xref="GOA:E9BTV5"
                     /db_xref="InterPro:IPR007581"
                     /db_xref="UniProtKB/TrEMBL:E9BTV5"
                     /translation="MGEKPQQQQQRPESKDAADALGRSAEAHTPKAPSSAAAPQPSEE
                     KTRAWEAEQLRVGLLADVPRTEYYYCRHLSNHSSSTVQLHAPRNEGAAPDGAFVHQRF
                     ALPNFEASLLARPQTGATGNSAAHDAGSTICVPSSFSSPWEALWCQLRFDEARQSAAA
                     VAQPLPTLTLVGGVDISFIPDSDDGVACLAILRYPSMEQVKTYMHRCTLREPYMTGFL
                     AFREIQPVCDLFDSVRVELLATQTMPQLLIVDGNGVQHPRRCGLATHLGVALDIPTIG
                     CSKKMLQVDGLTREAVEAALETLGEAASSSPSLPRLLPLLGTSSPTQLYGYVVHRHLN
                     SVKKCIYVSPGHCIGFAVATALVMTMLRHRIPEPIRAADLGSRAYISDALASAATNNS
                     HPT"
     gene            <943396..>944631
                     /locus_tag="LDBPK_362470"
                     /db_xref="GeneID:13388248"
     mRNA            <943396..>944631
                     /locus_tag="LDBPK_362470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865314.1"
                     /db_xref="GeneID:13388248"
     CDS             943396..944631
                     /locus_tag="LDBPK_362470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865362.1"
                     /db_xref="GeneID:13388248"
                     /db_xref="GOA:E9BTV6"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BTV6"
                     /translation="MILLAFICGALWAIWSVASFLMYRPRQISGATVVVTGACSEMGR
                     RLCMQLYARGARVIAWDYSKIKLQELQADVLKATKEAESLDIAGLPGGGRAAGSFHSG
                     AFVVMAVDVSSRLQVQRAAKELDGPLDMIVYAAHTYPSKRLCDRADDSAERLVQTNLL
                     SPLMVVRQLLPLLLSASNSSSNAGGLPKAAQRRGDYAQVVTLVSAAANYTLSADNPEY
                     AASQWGMVGMHYSMREWIAQQRCEYMNSSGSGAPSETKTTAAAGSRTRRPAREVRTTL
                     LCLNEIQYGVPTVMSSLLSSSPGMPTTVRAVSPTTPSSSAASPESEGGGSIGSRGWST
                     STYRDSYTQHLQKRNAELDKAAACCVNAICRGQERYCYTSAWATAVVYPLLMACPVPW
                     AIRLLRWIQHTPAAAAAEN"
     gene            <946565..>947560
                     /locus_tag="LDBPK_362480"
                     /db_xref="GeneID:13388249"
     mRNA            <946565..>947560
                     /locus_tag="LDBPK_362480"
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     cytosolic"
                     /transcript_id="XM_003865315.1"
                     /db_xref="GeneID:13388249"
     CDS             946565..947560
                     /locus_tag="LDBPK_362480"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase,
                     cytosolic"
                     /protein_id="XP_003865363.1"
                     /db_xref="GeneID:13388249"
                     /db_xref="GOA:E9BTV7"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:E9BTV7"
                     /translation="MVKVGINGFGRIGRVVFRVAQTRPDIEIVGINDLLDAEYMAYSL
                     KYDSTHGRFNGTVQVKDGALVVNGKTIRVTSERDPANLKWGEIGVEVVVESTGLFLTH
                     ETAHKHIEAGAKRVVMTGPPKDDTPMFVMGVNHTTYNGQPIISNASCTTNCLAPLAKV
                     VNEKYGIAEGLMTTVHATTATQKTVDGPSLKDWRGGRGASQNIIPSSTGAAKAVGKVY
                     PALNGKLTGMAFRVPTPNVSVVDLTVRLEKPATYKDICAAIKAAAEGEMKGILGYTDD
                     EVVSSDFNGVALTSVFDAKAGISLNDHFVKLVSWYDNETGYSHKVLDLVLYTSAR"
     gene            948866..948888
                     /locus_tag="LDBPK_36snoRNA1"
                     /db_xref="GeneID:13388250"
     ncRNA           948866..948888
                     /ncRNA_class="snoRNA"
                     /locus_tag="LDBPK_36snoRNA1"
                     /product="uncharacterized ncRNA"
                     /transcript_id="XR_002966745.1"
                     /db_xref="GeneID:13388250"
     gene            <950873..>952219
                     /locus_tag="LDBPK_362490"
                     /db_xref="GeneID:13386702"
     mRNA            <950873..>952219
                     /locus_tag="LDBPK_362490"
                     /product="tyrosine aminotransferase"
                     /transcript_id="XM_003865316.1"
                     /db_xref="GeneID:13386702"
     CDS             950873..952219
                     /locus_tag="LDBPK_362490"
                     /codon_start=1
                     /product="tyrosine aminotransferase"
                     /protein_id="XP_003865364.1"
                     /db_xref="GeneID:13386702"
                     /db_xref="GOA:E9BTV8"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005958"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR021178"
                     /db_xref="UniProtKB/TrEMBL:E9BTV8"
                     /translation="MTIDTQAAPAAQTLKAGNATGSLTEERREVEQQRAAENTSFRRI
                     ASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPTVDGNLKTPDIVTEAMVDVVR
                     SGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVIITSGVSQAIVLALTA
                     LCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAF
                     VIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTNV
                     PRLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIAR
                     TLLKCPAECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFQDLK
                     SDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERHKK"
     gap             956810..957691
                     /estimated_length=882
     gap             958572..958670
                     /estimated_length=99
     gene            <964955..>967819
                     /locus_tag="LDBPK_362500"
                     /db_xref="GeneID:13388251"
     mRNA            <964955..>967819
                     /locus_tag="LDBPK_362500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865317.1"
                     /db_xref="GeneID:13388251"
     CDS             964955..967819
                     /locus_tag="LDBPK_362500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865365.1"
                     /db_xref="GeneID:13388251"
                     /db_xref="UniProtKB/TrEMBL:E9BTV9"
                     /translation="MFSLNIKTAASPSSAAPAPAPEVNAGEAPWATIDVDEADSFEST
                     PSTNSSGGQGGRHRYQHAAQPSHSPQSPETPIKFDHGAYPHCPIFIPSKGRSDLDRST
                     MAVLVRDLVPFVLVVEREEADAYRAMLDRLVGQYFGFAGMTFAANVDDGIEGATKTGA
                     EVVVSSSTTPADLWAFPCACCCGSTDVAGSPSSPTTPGLSEDALRALALRLSAAFHHG
                     YVFEPSASAAAGDHHGAVESNVSPPVSISPTAPSAASGSARRPSAAFVLRNVDEVRAL
                     FVIEVLPETNRGVSYVRNYILQVLVPRLMVACGVDRSGNVEELRLCGTGEHNTLTSAA
                     LRMAALEPDVYSALEWKSETESYLDARRASTTTNVVTTSTGSAAGTRDGVVSASVGAL
                     NAPTGQILAPAFSSSSAPRSSKPSSAAAATRGTPRLLHGLFGFYWVLDDDIYGFYQSH
                     GSSTKNERISTRAMMREVDMRLRQLRHNADVASPSPPSVPPSCFQTPPTHSSGSAAAS
                     PYVLSHPQQQQNFVFTCKEDALQNNFISGGKGRLPTLQNYNLYYTTACFSLEYNRFAL
                     DTAPDTLSVNSYNNIACLFNYALLHNPPQMRYFPPGVPHVRRAEDALVGYLDHSMLWY
                     RFAVREDYDFTLQLIARGLHTLRFRSIAFDVPQMMKVRGGMTDYYRNCHEEIRQQNDR
                     FVLQWPAVAQHWVKGKEGNRRDDIRVRWDLLSPARAKHPGAFLYLSTPLPQLQPQRLS
                     DDSTGGNGGVVSSSDSAATATAVEGAETETRKRLRPPSPTAPTAESSLAPAGRRPCVQ
                     AAATSAPAMSSTAARDWKGGYVVERWRDISREEARQHAGLVALSNDDIHIGRTVAVIP
                     PFFDQKPSVVRATVIERAVEPTDSHSSSGRSGNASAAEAGDAQQSLTPRVIWTAVAQD
                     VRGMPFLHVDTCFEVPAEGIEKAAASIDQFFAKMEGEPGP"
     gap             969043..970369
                     /estimated_length=1327
     gap             973054..973152
                     /estimated_length=99
     gene            <973313..>974374
                     /locus_tag="LDBPK_362510"
                     /old_locus_tag="LDBPK_362520"
                     /db_xref="GeneID:13388252"
     mRNA            <973313..>974374
                     /locus_tag="LDBPK_362510"
                     /old_locus_tag="LDBPK_362520"
                     /product="sterol 24-c-methyltransferase, putative"
                     /transcript_id="XM_024473496.1"
                     /db_xref="GeneID:13388252"
     mRNA            <973313..>974374
                     /locus_tag="LDBPK_362510"
                     /old_locus_tag="LDBPK_362520"
                     /product="sterol 24-c-methyltransferase, putative"
                     /transcript_id="XM_003865318.1"
                     /db_xref="GeneID:13388252"
     CDS             973313..974374
                     /locus_tag="LDBPK_362510"
                     /old_locus_tag="LDBPK_362520"
                     /codon_start=1
                     /product="sterol 24-c-methyltransferase, putative"
                     /protein_id="XP_024329265.1"
                     /db_xref="GeneID:13388252"
                     /db_xref="GOA:E9BTW0"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BTW0"
                     /translation="MSAGGRETAPTNLIRRRNKDETNGDVSAAADRFRDRFEKATLEE
                     RKAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARGGFME
                     GDHIVDVGCGVGGPARNMVRLTRCNVIGVNNNDYQISRARRHDALAGMSSKIDYVKTD
                     FCNMSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYNPND
                     EYHRTIKHRIELGDGLPEMETCKQVIEYMKQAGFVVEEAIDVISQFESSPIKSIPWYQ
                     PLVGDYSSLQGLRSTPIGRILTNVMCRVLEFVRLAPKGTYKATEVLEEAAESLVVGGQ
                     LGIFTPSFYIRARKPSKQA"
     CDS             973313..974374
                     /locus_tag="LDBPK_362510"
                     /old_locus_tag="LDBPK_362520"
                     /codon_start=1
                     /product="sterol 24-c-methyltransferase, putative"
                     /protein_id="XP_003865366.1"
                     /db_xref="GeneID:13388252"
                     /db_xref="GOA:E9BTW0"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BTW0"
                     /translation="MSAGGRETAPTNLIRRRNKDETNGDVSAAADRFRDRFEKATLEE
                     RKAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARGGFME
                     GDHIVDVGCGVGGPARNMVRLTRCNVIGVNNNDYQISRARRHDALAGMSSKIDYVKTD
                     FCNMSLADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTDKYNPND
                     EYHRTIKHRIELGDGLPEMETCKQVIEYMKQAGFVVEEAIDVISQFESSPIKSIPWYQ
                     PLVGDYSSLQGLRSTPIGRILTNVMCRVLEFVRLAPKGTYKATEVLEEAAESLVVGGQ
                     LGIFTPSFYIRARKPSKQA"
     gap             974878..974976
                     /estimated_length=99
     gene            <977226..>978242
                     /locus_tag="LDBPK_362530"
                     /db_xref="GeneID:13388254"
     mRNA            <977226..>978242
                     /locus_tag="LDBPK_362530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865320.1"
                     /db_xref="GeneID:13388254"
     CDS             977226..978242
                     /locus_tag="LDBPK_362530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865368.1"
                     /db_xref="GeneID:13388254"
                     /db_xref="GOA:E9BTW2"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BTW2"
                     /translation="MLSGSEHHLVAVAFQSMDPNNTGMVALSEVKKRYFAHAHPRVKE
                     GSMAPSAARDTLDYHFGVCAADHEGSITFDEFLAYHEKVADEAYDEHVGDVAAFTEKT
                     IMGLWRLGDVLLPTGVRPAFPVTQAPTGFYAVTLMTLVWVERRQMDASPASAQQSSSS
                     GGAAHDDLFVLRGIKDVVRPIFTRGDLPDELQGYFAYPEELSGMAIDYVAPRLSIQRW
                     YDFTWEYSEGKYCGVEGIISTRVDLESLPAGLRQFVCEHATAVSRGTTWMQTRLMMNP
                     MYKKTSSAYGCGVSEECRKIHHWKVKTFEGKQYGNQYQGLCGKYFSKLGAPLKSGAAT
                     GMNI"
     gene            <982998..>988769
                     /locus_tag="LDBPK_362540"
                     /db_xref="GeneID:13388255"
     mRNA            <982998..>988769
                     /locus_tag="LDBPK_362540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865321.1"
                     /db_xref="GeneID:13388255"
     CDS             982998..988769
                     /locus_tag="LDBPK_362540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865369.1"
                     /db_xref="GeneID:13388255"
                     /db_xref="GOA:E9BTW3"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:E9BTW3"
                     /translation="MTVSLHTLIKEWEVVNAELYRASLESHQRYSFPENNHGRSDNSD
                     CSAEGGSPSPPPLSSTTTYARVYSLLSRVRHIAEDARYNSFRIIQHLLWVTIVAWANQ
                     MANASGDLIRLPSGLQQYYEPSPRCSTRRDGINDGAAGKTVPSASTPVQRTSFPCALL
                     PPLEFWDPSVLEEMAGASSPEPQVVRDASLHRAPSLPEVWSNAVQHIFALWCATPIAG
                     SCAGAAQPCTAQSACGTASPGTLEYAHAWVIVAQHYHRFKSLLSLFFLRYDVVLEDAE
                     ELLQRRGRQQLHEQQDRRLSGLHDEEVQRAGAHVARPSSPPLRRRGGTSLVSSLSISP
                     EGAASAAGAGNSMSRSSAPAALSTDREATRNTDKQARLSACLPSSLPSTSNLLGHLMR
                     AIVNENLAKIHEVTGEILLFLLLPRVHRARLRNQVTTPASGTGNPGQRSHCAPPQDNT
                     ATGEADTGKEASLALATMRQLSGVSNGHSDVQDDDDDRVVWSSPPSPLLSYTAASFGH
                     GNGDAPAPAPRAGTLTTGPRVRGRAQQEEYVARNVFKLLLLVEHCRVHVLQRWLVENG
                     KRVAFFYGSQLAANLLDNAAGQQAAFAHHPASCDPSVAAIATTRTLAGANRVLRETLQ
                     AYVRLRAKLLFLNAGTTHFLDALTPWGRTRMLESLNAFLCGFCGVVLPSSFPSDGGAP
                     DKSTIESSKEPPSQAASSPLDGRDEPVLFSSTSAAVSDFVQRWGVPLWVAMCDDTQQR
                     MEALKHVEQKRAKRPKHCTPLPENERLCVMPPAKYQQQRRAMEGWSDGDMGEKDHWRG
                     GPCNTGTSSAPVTSSFTTAAVSAVDDDRAEKPDTRDRHSVASAELEDAVSRTTSIAWP
                     PRSPTVANEGEDGSGGSGIHPHGGAEEADRAFTRRRGRGLDLKRVLHQQQQRRARLGS
                     VKLPQRGVTASRVGAPLASSEDGGGDVVESLYTGETVSAGDDGSVSAAAVGAGNGGGN
                     VGRLRDNNGAAATEERQRDGEDLTISAGSHAKRFSRSAQLHQVATLPDEGFPCLLYLM
                     PRRSRFAMLDKAAAAVQQQLFTRFSANVQAYLTDYLMECETAAAAAAADQHAASASQK
                     KKREKAAQVTAMGGHAGTGTAATSSIAVVTPFPKPVLARMVFLLEMTYAALQGRDRAA
                     SESRDNHTEANHATVNGGSRRPLMETGLTATGQELGAAILEQCNGEFDTVVSTTLSAP
                     TSPALLAIAAVRKGFQGFLISMEKRAVLALVQALYGLVQQGAAQQPPAAQLDAVDTIL
                     NMASLLNSKDMFVLLLKGYLAPQVMMCRSQSEFLVESQVVGRMAYRLGAAVAAPCITL
                     LRDLQLAMFDPRSMMRSPSRSGARADLAEDRELNATYGSLSGEGRRGDGGNFGGASSR
                     DMATECAQLAATRDAETLGDIRPLQHGAFGLIHRVRVLCQAWWQSHTAVLLSSRRLRQ
                     LWEQHQLLDERIVDAVLSVEWQYDGHSEPFRGYGQHVRPRERESSNPLPPPSCSSGGG
                     GPKSLRSSLSDAPQGSHWRHGDGGQNSGPLAAGTQLRTVTAAAVVRGFSSALGNAVRR
                     TGRQAGDFGYDDSDNESEDYREAYGGLLTLSTLQQYRSAYAPSNSPYRGSNLSSVGSP
                     GAVGGPGASGEHQGTSDGGQSTTVDDHASTAVPADGQLERRRLRWPLGNGQLAFYIFS
                     RGAASACRGVSQAVQIVGPPLTLLVCQLLDRASEQPYTFDALHKALPVQAPKPLLAHI
                     LHELVKADVVVRSVAAGTRQLTYQLRDDTREVRQRKVIVDVRAAARQQWVTQTMTMTA
                     ADAADDGEDDGSERGGARGPASPGNPTEATTSFPTSSLKPARQGCLDAPAKAKAAPSA
                     SVDEPSSPTYSADSAHKIKVCIVRIMKVERVLPHRELVERVALALEGQFVVTPSQFKR
                     CVTHLIEKEFLQRGEQGEYVFVS"
     gene            <989343..>991901
                     /locus_tag="LDBPK_362550"
                     /db_xref="GeneID:13388256"
     mRNA            <989343..>991901
                     /locus_tag="LDBPK_362550"
                     /product="dipeptidyl-peptidase 8-like serine peptidase,
                     putative"
                     /transcript_id="XM_003865322.1"
                     /db_xref="GeneID:13388256"
     CDS             989343..991901
                     /locus_tag="LDBPK_362550"
                     /codon_start=1
                     /product="dipeptidyl-peptidase 8-like serine peptidase,
                     putative"
                     /protein_id="XP_003865370.1"
                     /db_xref="GeneID:13388256"
                     /db_xref="GOA:E9BTW4"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BTW4"
                     /translation="MPPTALKSYMVELSRYMDAFTSASGKPQHLTIVGDRVYWTQGKQ
                     QELYSAPVGLEVAEAVRVIASEEQEVGEEEQLTKEEEMLRERTRSQTTGIKNFHVRWS
                     DGAIFYTSGVEVYVYYQNGPRAGKTPLKLFDYMSEEDKTHFKAMGSKPNLFVQAIKSF
                     DESHPSTHTVMTFVNNNNVYKATLTESPASEEAPLAVAVEQITHIGDDLHQCGVADYI
                     IQEEFSRYTGHYATDRYIVFSYIDSSHMRSVALLSSLGSPEVPEAEPACQTYATETEE
                     MPYSRVGDPNARTTLVVYDIATKQMRLLPDVAIRKAAPWTEYILRFGFKDAETLYVSV
                     VSRAQEDYAVMSCPIAALPTIAKEEDLRSLYSDTGGPVTANIIGDAAAPGLHVEWKQR
                     IDFAWVECQPGVPVHYGKVYDVLCRHAAETETAHYHLYARPAGDGNPEAWKPLTAGAW
                     NVCAGTQHVCEDRVYFLANAEGRLKRTLYSVPLSLESAPRIADALTRLTPLDEHVYSY
                     CVKGDHLYYVSSTAAAPAKLYASCVSAPQKRAEVTVPSWIATTPGTDPATTADPTHYF
                     GGLPVVTPQIVTVTSRRGVPLSAAVFVSPSAPKDAPGPLALLIYGGPHAQLVFENDYE
                     TRCKAPVQVLLQHGISVAVVDNQMSNANGLRDLSICKKNFGNFETHDYVDVTQYLCST
                     PASESGCPANFRFDAKRVAIFGWSYGGYAALLAMCQAADVFRIGFAGAPVGDWKLYDT
                     GYTERYMGTLYREDSSAESGASRNRNEAYMTSTISHYAGGFPEECNRLYIAHGLLDEN
                     VHFGHSCHVVKALIDNAKPYSMLVYPGERHGLRQNRQSRLHHDALLVKTLEEQL"
     gap             992409..992507
                     /estimated_length=99
     gap             993949..995456
                     /estimated_length=1508
     gap             996194..996292
                     /estimated_length=99
     gap             997118..997216
                     /estimated_length=99
     gap             998487..998585
                     /estimated_length=99
     gap             999497..999978
                     /estimated_length=482
     gene            <1001186..>1001905
                     /locus_tag="LDBPK_362560"
                     /db_xref="GeneID:13388257"
     mRNA            <1001186..>1001905
                     /locus_tag="LDBPK_362560"
                     /product="caltractin, putative"
                     /transcript_id="XM_003865323.1"
                     /db_xref="GeneID:13388257"
     CDS             1001186..1001905
                     /locus_tag="LDBPK_362560"
                     /codon_start=1
                     /product="caltractin, putative"
                     /protein_id="XP_003865371.1"
                     /db_xref="GeneID:13388257"
                     /db_xref="GOA:E9BTW5"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9BTW5"
                     /translation="MQDAGRALYTVTGQRVARSELLKLIAFAQNAVAKQQQELQNRQD
                     QVSSQQRSVMTSAGSKNSQDATTVADNDATRFAISTRSSSRTGESMSNFSVRESSPAT
                     QQATPSTVAASAAAFPASPSAAASVSQIRFVSPHSHLLDSSEGIDLDVFEQIVLRKLK
                     HRSYEEELAYTFALLEDKSYPGFITKESVRRIAAETGEPLTEAEIAEMFDPLVTGVST
                     AAVDLSTFTDLQLKARKAEDS"
     gene            <1002929..>1003696
                     /locus_tag="LDBPK_362570"
                     /db_xref="GeneID:13388258"
     mRNA            <1002929..>1003696
                     /locus_tag="LDBPK_362570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865324.1"
                     /db_xref="GeneID:13388258"
     CDS             1002929..1003696
                     /locus_tag="LDBPK_362570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865372.1"
                     /db_xref="GeneID:13388258"
                     /db_xref="GOA:E9BTW6"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:E9BTW6"
                     /translation="MGKPSDPAPPNRRCAECERSFGITVWKHICDVCHRTVCDDCAPR
                     STESVDAKGEKAMLRVCKTCGTTGHRLGSAAGGNCATDGAQGTGTARPDPHSEAERER
                     RARIIEERNKAQKNRGRPQRAGGEDGSRAAVASARPAPPAPATSSPTSAPPRASASPP
                     AALPPPPANSGSQERLVNPALEAAMRRQQQQQAHSRAAASSPAANMSPEKMRLLCEIE
                     ALLAKHLEDPPFGLRAADEAKLHGYLQFLKKKYHLSE"
     gene            <1005024..>1006379
                     /locus_tag="LDBPK_362580"
                     /db_xref="GeneID:13388259"
     mRNA            <1005024..>1006379
                     /locus_tag="LDBPK_362580"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865325.1"
                     /db_xref="GeneID:13388259"
     CDS             1005024..1006379
                     /locus_tag="LDBPK_362580"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865373.1"
                     /db_xref="GeneID:13388259"
                     /db_xref="UniProtKB/TrEMBL:E9BTW7"
                     /translation="MQDWQIAVLVVVIVVFVALATPLIFLIYRFGSNRRRYSSKRTNT
                     TTSRYADSSCCAKHNIVDAGDAFGQLFRGDPRIHPSTHLLYFLDFQGELHWIDFNKKP
                     AAKIDTESALQQYIFENFHPMVEEGNRVVPLPPEMLALSYINDHQSLVVLDLNRLLAR
                     DAEFGARMRHTAERPLLLSRLVADVADGAVFTALSRYGYTVGDASVPSVTQTGMQCPA
                     LVAASPPQQRHQRIDVDLSTSRANPIAAAPAVSASMPDTHVPPPTVRPPVAPHLSPPS
                     NFSSPYACDASGMAPAPVIHPCDTHHITTSTPVSITAASYTVLNANGSRTELDAISTA
                     RIEGARLRWDRRQSLVVPFMSGVLSGYQCVIDPVTEEATLSTESAARAANVNGVESIV
                     CRRADALYYTVERVNSTQWLPFDEAFYLPAGRWCVRARATLYCDNSSKTIAKVFTVTV
                     I"
     gene            <1008276..>1010396
                     /locus_tag="LDBPK_362590"
                     /db_xref="GeneID:13388260"
     mRNA            <1008276..>1010396
                     /locus_tag="LDBPK_362590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865326.1"
                     /db_xref="GeneID:13388260"
     CDS             1008276..1010396
                     /locus_tag="LDBPK_362590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865374.1"
                     /db_xref="GeneID:13388260"
                     /db_xref="UniProtKB/TrEMBL:E9BTW8"
                     /translation="MLQGILGSVSSTGIREAENVLRQSWPSLLKLKDEAQTRFCADAE
                     SFLKAQLTNRPAPSDTLAIFTTVYVTAVHAIHSGLAAPVRWTKAQDSPFRPSMPVERV
                     LPSRREAARVVASVCERLLLANAKVAGAYFSKLLRETAMGVPLLALVLRAYGEAAVGV
                     LSAHSEDPPYLQSCIHHLVLATYKFTVAMSDDALTIAHPILLHVARVSGRTQDAMQLL
                     CRPIYSVSPMLTGIGLSDYVAYHAEAALLLAALEQYESAMYALTPVSQLSPTRGMPEG
                     EKGSRGGAGEGDLPPWLNELEYEEADVRDAIPRSGGCAADASRAPVTGADSALPAQQS
                     VVLYPWYRTECVGETRKYAGSTDAKDRKAEVKAVVWRGILVPSVIEREMDRRAVTWAK
                     RLGIVLLAAAFGGGSPRGVMALTASAGRRIVDNEEASSIWTGMASAIAGHVCFPHPLF
                     RLLTETTPVSLRSFVHFVTTDKTASARAYADLLVAIARRDANNAHQCLGNPANVSLFT
                     ADLTVDVVRATVLRELPRHILLDVARMYAHVPMQMLLDRSQPIHTAAKAKGATPANER
                     AEDEERPLDAATVDSRHALVQLLVKMCSTGDLASSHVCVTAAPAADAAAKERATFYPV
                     EEVARQLSRGTASFCVSTASVKWTLPSSAARLQRCAQVVQFHIHQYPSVNLGTSLVPM
                     LAQLQELQRVVDADAEEICDMGIV"
     gene            <1011890..>1013227
                     /locus_tag="LDBPK_362600"
                     /db_xref="GeneID:13388261"
     mRNA            <1011890..>1013227
                     /locus_tag="LDBPK_362600"
                     /product="acid phosphatase, putative"
                     /transcript_id="XM_003865327.1"
                     /db_xref="GeneID:13388261"
     CDS             1011890..1013227
                     /locus_tag="LDBPK_362600"
                     /codon_start=1
                     /product="acid phosphatase, putative"
                     /protein_id="XP_003865375.1"
                     /db_xref="GeneID:13388261"
                     /db_xref="GOA:E9BTW9"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9BTW9"
                     /translation="MNLARLVSAFGLHSARRNKPSTATETSDPVHPRVNINWTQQSLN
                     SNITKAERKEILKSKLVLTKLVVLNRHGHRAPNAPFWKMCPNDIKSKKRYDVSAEDLT
                     GLGMEEEYNFGQYVRNNYHAFIGDKFNRMLHYFRAVGEPRILQSAMAVAQGIFPDGFG
                     PGGYLPSRPQFVPIFSDMDTHEYLLDDVPCFRRAENDSHRWIDKRYQNFIDDPNTGRV
                     LKMIKEVCGEYIGPAEGYAYIKTVADGLTFNSDIGLKVAKGRLTPEMLFSIRNVSLQL
                     LMQRLYDTDEQQTYMAVDLPRNILQTLNHTHVGDTPEQLNDFTDTRQESTFYFMHREA
                     LYAFAQFFGFQYNVAGLPPGELPVASSIIMEKLVPHRDQYSHNASRIYVRITLWTPYN
                     GIYTIPISTCRIPELCELKELRYIHDIRVSRTGTWEQLCNYAPQEIDHTTDIR"
     gene            <1015570..>1016346
                     /locus_tag="LDBPK_362610"
                     /db_xref="GeneID:13388262"
     mRNA            <1015570..>1016346
                     /locus_tag="LDBPK_362610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865328.1"
                     /db_xref="GeneID:13388262"
     CDS             1015570..1016346
                     /locus_tag="LDBPK_362610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865376.1"
                     /db_xref="GeneID:13388262"
                     /db_xref="UniProtKB/TrEMBL:E9BTX0"
                     /translation="MDPSKRICLKNLPEGCTKREIAELVRNRTGTPIHSIDLGLDADG
                     KTRRYAHFSCEGAKHVLEVLSAGVSLRDSTIYAHPAKAHYSFRYAEARRKREREEAEE
                     KERLEAFWAATRQRFLDRTNGGELPKSKTPKDFYASKRRYARIAAEIAQTSRNAHAAA
                     GDAAYAEHPRGAAHATPSFSGADCGANSAPRAASKNHATSGGGDANAAKKCASRLTAA
                     KSKAPAAAPPPPPPPEPTKEERKLSGLQAKLAALKEKLKK"
     gene            <1018564..>1020045
                     /locus_tag="LDBPK_362620"
                     /db_xref="GeneID:13388263"
     mRNA            <1018564..>1020045
                     /locus_tag="LDBPK_362620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865329.1"
                     /db_xref="GeneID:13388263"
     CDS             1018564..1020045
                     /locus_tag="LDBPK_362620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865377.1"
                     /db_xref="GeneID:13388263"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:E9BTX1"
                     /translation="MPIAAMLTKDADCEKSQQQKLEEDIKSPCTPSFHCISDEDPKSD
                     RATNYSCAKPLDWSPQTPETPPVSVAELRVTAVADTSVTETTSESVTHRNELRANEGE
                     SSASGTVEKPFDGVAAAGGAAPAAVPQKAQERGSSEPLKPKRSYGTSDAVSSSSCHVD
                     ALGDLAGSVRQHHPTSTPTLGTSGSNGGGDATKHAVAAGHVDGSLPPPLSGVFFPSTA
                     CDAVTTASLVTLISSYCDVVTLVQLMRVNRSAHLLATSDAVWKPLLVSMNLPPLLAAY
                     ERDKDYYDFFVEDVITTRALHGHYTFQAANAASGSRESVSTTSGSRSAVMNRDYVSRD
                     EDSLQDDIFNIASLQLLISAASLGQSNHLIGRVQLLLTYKNESMEVLQGSCRFSVHRR
                     CFSLCCSAFGTVKRGPVFTVAVATVTKPWANEGFQHFSEHKNGIRLVMTPVLWEGQSP
                     GSQITENDILVVSRPKPAPSLITSTTGSAAANSSLDAPTASRG"
     gene            <1021450..>1023405
                     /locus_tag="LDBPK_362630"
                     /db_xref="GeneID:13388264"
     mRNA            <1021450..>1023405
                     /locus_tag="LDBPK_362630"
                     /product="chromatin assembly factor 1 subunit b-like
                     protein"
                     /transcript_id="XM_003865330.1"
                     /db_xref="GeneID:13388264"
     CDS             1021450..1023405
                     /locus_tag="LDBPK_362630"
                     /codon_start=1
                     /product="chromatin assembly factor 1 subunit b-like
                     protein"
                     /protein_id="XP_003865378.1"
                     /db_xref="GeneID:13388264"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BTX2"
                     /translation="MSSHNTAKEEARTGAHVEGAGLDGEACCAPHQPLRVRTIEILWH
                     FNERNEEAELLGLQSSVTEGITSVDYNPRCHRIVTTGGDGNIRLWEVRVKAVDAWLEN
                     NANDMLACCRHLCRMRTSWMPLTARWSPQGEMIASAHCDGKVCLWWRDPAGGSAAAAA
                     SSDEGSCGSGLQGTSGDSDGDVEEWKAYRHLTGHISDIYDICFSADSRYLLSGAGDGS
                     IVIHDLEGSTMPALQLTNLHAKFCRGVAWDPWTRFLHTFGSGPSLLCFTHVPKSEGQH
                     RRMHLAGQRKCQGDYIGESCALSYRRLCWSPDGLLLAVPYGKLTRAGQQQAPSTANLL
                     AFIEAKEKAEATLRATKDHPQDTSLPTHITEASGGKKRHGAPVTAIADAGDDALDGML
                     HCVYVYTRGAPDKIACRLGVRGFSEVRGVLWAPCFFEPLPADEVLEGCSQQPTALSTT
                     ATAEAPLSQLAALEAARQRRGAWGPAEYRMAIAVWTSDAVIVYTTDSSSRHSDFTDLH
                     MRSITDVAWSHDASHLYTASLDGYISVIAFGDSLTAAHRLPYFSASPAVRSLCGLLER
                     IERVGVSVEAGRSTGAFSAGAARGYRKAGGDAPAGAAAAAVTKTSVAVVRKKRKVEKT
                     SGDPAAPSVMAKKAVDMQQLEALISDI"
     gene            <1024091..>1026793
                     /locus_tag="LDBPK_362640"
                     /db_xref="GeneID:13388265"
     mRNA            <1024091..>1026793
                     /locus_tag="LDBPK_362640"
                     /product="nucleoporin interacting component (NUP93),
                     putative"
                     /transcript_id="XM_003865331.1"
                     /db_xref="GeneID:13388265"
     CDS             1024091..1026793
                     /locus_tag="LDBPK_362640"
                     /codon_start=1
                     /product="nucleoporin interacting component (NUP93),
                     putative"
                     /protein_id="XP_003865379.1"
                     /db_xref="GeneID:13388265"
                     /db_xref="GOA:E9BTX3"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:E9BTX3"
                     /translation="MFSSTSNIAPRRLGSAGPGGDDASALRVMPSAGDPADEVRVSLA
                     SLTARAQRLVSERDAEQLLRNGFGLFEASRKAAEEARHQANKCQSTSEGYAPATHASV
                     ELFMTQHLGFDAQAQQRLLRQLQRRHAQLGVDLGPIDTLPGAEASGFTGIADVDAVVA
                     ELKNDILLDVQHAVHRRQTSIVRDQVDTLFKAAWHPFYVRVADDYETLSMGANELAAG
                     KAGASGRLRSMGTAAPSANALGGVGSDASSSLVDILNSGSSLAMELSRRVAAFAAIVE
                     EYAPAQWITHFTAYVTETSLDGANDLTVLWASIVQIIEPMQRRGSEADILSYVASSRR
                     VMERKSLSRLLERVLRMDPMRFEEVENMSASHLMDVIARSCGVTNHWMHTFVAMRVGR
                     YDVAQLAMDAIGIQSVRDAMAKMAATPPAERNAMPPASDLQPVYAEAKTKEDPYRQAV
                     LMVLLAGRTGESPAAVLRTILSLAQRVTDSLEDALWLRLSCIRGVDKSAQVTPVQSLR
                     TLQRAVLDDMQDLVSITQGNACRLASFLIHALLPSTGLRLLLENNITHVDGFHMALCF
                     SAQNLLQGRLHSALEAPIDIARHMSRYCSVVLLGVDRRLPATVFAGTAIFAYFHKSGL
                     TEAFVECCLKDVICARLLGSRNAVGGQDALLLRAGAGALSEELLKALMQVAEAASARS
                     EVAKATHVLLAVAFLASQLCRPELQQRALRRAVQMMSPALAQVLHLPSRSSVVSDVLS
                     QAAQLQQAVNAVPHHLNEEAINAQDYQTFALLCRMADVYAFNVSGNFSDAVDAFLQLP
                     FVPPPNTAVTGGVDAYVEAYCNAPGSVQLGASAALRIAISAAGKLLQYYARSSTGGGA
                     DVDEKRLRLLHRMQTVLEWARQCCALTSVAYPAVAEEFERVYMC"
     gene            <1027832..>1028884
                     /locus_tag="LDBPK_362650"
                     /db_xref="GeneID:13388266"
     mRNA            <1027832..>1028884
                     /locus_tag="LDBPK_362650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865332.1"
                     /db_xref="GeneID:13388266"
     CDS             1027832..1028884
                     /locus_tag="LDBPK_362650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865380.1"
                     /db_xref="GeneID:13388266"
                     /db_xref="UniProtKB/TrEMBL:E9BTX4"
                     /translation="MPRDTDLERLTAFAKDYAQLYARFANHFAIPERATIDGFAELFD
                     ASHIEYLHYCGGTTLERPFFPAITSELLMLSSAYLSIPEAVAPRGARTFGLLLSFFIY
                     STQPARQQPKAPASVTTEGVSLPPVQTTASLVESTLPRSGGPRAARIAMMADSLTSSS
                     TQQPQSCSAAEGTAATAPPSPPVPSSLRLPMQPVPVSVSCMRLLLSRLFIDAGSGVMS
                     GQSCAEAPPLRTAAAAAPASASPAQLSHTEAKVVLALRRATGWHIEPYLQQGKHFSAL
                     LSAHQACAVPLVQHVTPLPRSLFAATLTARSMLNASAAPEEIGGSDSLFRDPDFVRLR
                     QGYEAARRRLLLGERR"
     gene            <1029982..>1031778
                     /locus_tag="LDBPK_362660"
                     /db_xref="GeneID:13388267"
     mRNA            <1029982..>1031778
                     /locus_tag="LDBPK_362660"
                     /product="DEAD/DEAH box helicase, putative"
                     /transcript_id="XM_003865333.1"
                     /db_xref="GeneID:13388267"
     CDS             1029982..1031778
                     /locus_tag="LDBPK_362660"
                     /codon_start=1
                     /product="DEAD/DEAH box helicase, putative"
                     /protein_id="XP_003865381.1"
                     /db_xref="GeneID:13388267"
                     /db_xref="GOA:E9BTX5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTX5"
                     /translation="MPADLPRGAPRSFEDLLELSPSILRTQLQKLIERKRYRALTPVQ
                     AAVIPLMLEYRDVLCIAPTATGKTLCYVYATLMHLLLKDINDRPAAAAAAAATAGDEG
                     NEGGGVSLNRRQVETFLQEKIDKGEVCPYCELSLSEVRVCPMTGFPHPSAFELETDLA
                     LRSKERRAMRLEELQSSVAEPRVLVLVPNGQLASQVSAVFRSLHCDYRIHCMVRASSA
                     EEQRKYLQALEGGVDVLVASPETILPALYRHKLSLRKVQTVVMDEVDDIVSVNHFEPM
                     KIILGALPKGVRRPQRLLFGASLPPVAYEMIKKKMLLPSHRFVLVDLKAPAELSRAAP
                     SSLASSLSSSSPDKPNAGDAGDLPVAALSTTVTGGFLTARTNLRHLVFMVGRAEKVQK
                     LAWLYETGKLNPDQRTLIFCNSRHNVAYVCDKMKELVSQVNFTTLTSHASSSAREGVL
                     KMFRTGVSTSLICTDLLSRGIDFQGVVYVVHYDMPTDMETWTHRCGRCGRGGSLQGRG
                     YIYTFFQPENIKLAKPLVGYLRQHQQLVPPRLREYAKQSFIDVFNNSLFHHPTRPRRK
                     DDPQNSTPVLGRGMRRFPDYKQGTIHKHFRPH"
     gene            <1032590..>1033798
                     /locus_tag="LDBPK_362670"
                     /db_xref="GeneID:13388268"
     mRNA            <1032590..>1033798
                     /locus_tag="LDBPK_362670"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865334.1"
                     /db_xref="GeneID:13388268"
     CDS             1032590..1033798
                     /locus_tag="LDBPK_362670"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865382.1"
                     /db_xref="GeneID:13388268"
                     /db_xref="GOA:E9BTX6"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:E9BTX6"
                     /translation="MELTKKRVKIPPIHKLRPGWSAVALHTVIYLLRHDFVTAIVATF
                     VVQPLYHRLILQSTYLQRLSDPALFTLVFAVLCHCVPWAFFNGIFLFFDSLHPQYGIE
                     GLRNNALLAPLGRRMAVYKLPRKPQQLPSAALIFSTMLHTAFNHYLVIPVVLYAYLVH
                     TNSCALRAPPPETVIVGFTPEDVVNYMSGRNLKQIPISLVTITSHFLIANVINEMGFY
                     IVHSILHSSPTLYRLFHKKHHMYTGTISIAAEYATPLEEILANAIPTTAYFAFMFFHY
                     TREEASKSSFVTSARAWPLFITWMWARLWETYEVHSGYCFSDTWLGKLGLLHGHRARF
                     HDFHHTHNVCNYGSGLFMDALLNTMDPYLIYRYPDKHPRTTTLREEDLKEPRDLEAGS
                     EAMDEVRACS"
     gene            <1036251..>1037372
                     /locus_tag="LDBPK_362680"
                     /db_xref="GeneID:13388269"
     mRNA            <1036251..>1037372
                     /locus_tag="LDBPK_362680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865335.1"
                     /db_xref="GeneID:13388269"
     CDS             1036251..1037372
                     /locus_tag="LDBPK_362680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865383.1"
                     /db_xref="GeneID:13388269"
                     /db_xref="UniProtKB/TrEMBL:E9BTX7"
                     /translation="MSCEPNSPVVDTTTAAAAPKLMTLKEAIDRDGVPATSSSKQRRL
                     MDIHVTAYPGLVNQHMLPKHNTAVNDFSSIDPLQYRKAHTVRNNNTASYSEKEENVLD
                     MLTTNQCANRMTRLGMQLREERAKNPKGMPSISSLAPRGYRSRFLSPSFDERSTYRWD
                     YCQWEPDGFHDTVRRELLAAYRDDWTEDEKADVDISMKIPYLTMAVSSDRLKDKATIY
                     RKDFMEDATQADYRSLSYKTNLEDLGISYAYSAYSIDDPRRKVLFDASVAALKTPHSV
                     LEKTYSPRNSFLEKSLSTKQQPSAREELDRLRTMRREALRLSAAKRSAAESNDDGKTT
                     KTVVIPGIKGSGYRRAPKGNDSYVCLSRDHFCYQQVDNF"
     gene            <1038464..>1041253
                     /locus_tag="LDBPK_362690"
                     /db_xref="GeneID:13388270"
     mRNA            <1038464..>1041253
                     /locus_tag="LDBPK_362690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865336.1"
                     /db_xref="GeneID:13388270"
     CDS             1038464..1041253
                     /locus_tag="LDBPK_362690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865384.1"
                     /db_xref="GeneID:13388270"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BTX8"
                     /translation="MSSAEMLLDAASLTPSLSQLLAVDSVSSVLAYLVQGAIIDDPDA
                     RLQALSEVLAHVSTSPKSDSAVSANGVGADGTSPSSATYTRVHGARWKWADVVMRGVT
                     DPWSRIRSLAAPVMADLLDAEVELVLQRHDSSFSTYLRSSSSTPRSSSVARTTPRSAK
                     KDWKDELTATESSLLESVSAPLEYVWHRWRGMSLWYEQDGIVRMLAKLYSRSGTPSGD
                     ALRTDEAGLRCLLFNVIFPALRNPQLPVRESAALLLGILADRRSSTSLSPAITSFVVD
                     HVCRTIMQVPTPARRHSPETLVSVEDTRVLEGNLLALNKLVDADAIRVEDADVMPLLL
                     RLSNYPASSVRQYVAQILRPPSLCVFTYLMQRLCEHQNCMPQHAEGDGDSSSSVPGGG
                     ENDDSDGLSWQRLETLMMALQQHLLYLHTTSATMQDLFHVSSDTKGILTPVVFATSLS
                     VVFQATHSPRFEVARMGLQLFPLLLQLSLRFCPPVALPRVCEACCGSDGCVQAELNRI
                     AACGAVETLAKAQTYVATFVVPVMWWFLTIRRLVAEVREKMTPSPTTGAPGETRAQVE
                     DLVRPYATLEQILFASQAHLSGKASSSAALPRHTATCALLPLVTYFATVMDPEEWHRC
                     VNELLAPSWWAGLLADPARQEQARVGPDFVRAVHRRGTSDEVRRVVELVPTLTAALAD
                     APTHQQCLLVAMIRVAVVAHTARTVVVEEHALSFLYHEAYAAPALVEGGDAVSLGHVW
                     LKHFMPTQEAIPAAALWGESSQSRDGSIVLVESNSTVFQAIEKRCYQELYQSPQTEPV
                     VLRELRSLMMSLSHPSMSVPSGEHVYWYAAALAAVFGRLEKVCPQWRETDTAATAAAT
                     AVFSGCEDDNECWDDWDDEEDGAAQGIYAAEEVRNARAVVLVLRERAAAWMEARDMAA
                     AEHRFRPEFAVLTAL"
     gene            1042463..1042534
                     /locus_tag="LDBPK_36tRNA1"
                     /db_xref="GeneID:13388271"
     tRNA            1042463..1042534
                     /locus_tag="LDBPK_36tRNA1"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:13388271"
     gene            1042732..1042847
                     /locus_tag="LDBPK_36snRNA1"
                     /db_xref="GeneID:13386705"
     ncRNA           1042732..1042847
                     /ncRNA_class="snRNA"
                     /locus_tag="LDBPK_36snRNA1"
                     /product="term=term=small nuclear RNA, U4 snRNA"
                     /transcript_id="XR_002966743.1"
                     /db_xref="GeneID:13386705"
     gap             1043748..1043846
                     /estimated_length=99
     gap             1044873..1044971
                     /estimated_length=99
     gene            complement(<1045967..>1047511)
                     /locus_tag="LDBPK_362700"
                     /db_xref="GeneID:13386703"
     mRNA            complement(<1045967..>1047511)
                     /locus_tag="LDBPK_362700"
                     /product="membrane-bound acid phosphatase precursor"
                     /transcript_id="XM_003865337.1"
                     /db_xref="GeneID:13386703"
     CDS             complement(1045967..1047511)
                     /locus_tag="LDBPK_362700"
                     /codon_start=1
                     /product="membrane-bound acid phosphatase precursor"
                     /protein_id="XP_003865385.1"
                     /db_xref="GeneID:13386703"
                     /db_xref="GOA:E9BTX9"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9BTX9"
                     /translation="MRRGIAFLYRCVVVVAVVVSAAVVLAAPMYKVELVQVVHRHGAR
                     SPLVDDNHTLICGTEFPCGFLNYEGQAMLVKLGEYLRHRYTEDRSVVSKPYFPYSWYN
                     LSISYTRSTDVLRTLQSANGLLRGLFPNNSNFFPAIHTVGFEEDVLLHSMMVPMIRAR
                     FNYAKEELRAVCDQMLDRLMPFDQLQAVAAEVHSQGFCANYTLRSRCAERLCDIGRAY
                     EPTGRLERLPLLSRHLDDVCAVTAMSSHFCFAYNASNPVHQKQGAPFYHLARLLVSNM
                     LAHQQRETAPPYKLYEYSAHDTTISPLAVSFGDSSLEAMLPPFGTAFIIELLSLTDAP
                     AASSRFYVRLLRGHSGVRPESNFTFALSHFDMRCKDATGNTYIATDNICPFTDFERFI
                     NSTAPTSPMGTCYLDPGLLFRMDCPVDAVGDNRSLSKDCLFYRKHCSNYSCGTGYYLD
                     AIDYGCHRIPANNSTTVSSPMSSGGIAALSIALFIVGGVASIGGMEVWKRYKKLKSKQ
                     SEVLIV"
     gene            complement(<1050298..>1053273)
                     /locus_tag="LDBPK_362710"
                     /db_xref="GeneID:13388272"
     mRNA            complement(<1050298..>1053273)
                     /locus_tag="LDBPK_362710"
                     /product="related to multifunctional cyclin-dependent
                     kinase pho85-like protein"
                     /transcript_id="XM_003865338.1"
                     /db_xref="GeneID:13388272"
     CDS             complement(1050298..1053273)
                     /locus_tag="LDBPK_362710"
                     /codon_start=1
                     /product="related to multifunctional cyclin-dependent
                     kinase pho85-like protein"
                     /protein_id="XP_003865386.1"
                     /db_xref="GeneID:13388272"
                     /db_xref="GOA:E9BTY0"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:E9BTY0"
                     /translation="MPLMNVCIYGLSSQMLEAFFARERARSAQPLVASASSELRFGLV
                     GAGESMGAWGLKWPVALECCQCQRIPCLRVPYLSPLPHPCEDGQESCVEHYVAQVRLT
                     SQEMDGLRNQQSAAEPLSMPCRLVILEDAFFRAPRTPESSICATPGTVIAGVDQRYSQ
                     PSSLCITPFEHEEGALTEGSGEVLQWLAVLDVRRHHDASVTVDSNPLGRSGRDDAATA
                     SVCFGSTGEQFALLYNLPALPPRPTPPVPVTVSSGMAFPASEADADASVGSASDSIPP
                     FCECDPDGGVCATVGNPGPLLSLTFYANDPTQPFDQAAWQSELTSHQSEVMRRRMRET
                     PDGVLSTTVCQVTDVRPIPVEGSCWCRSNLPIPALLEQQLNEMRMKRSSAAAASNGGR
                     DSYRASSPAMSSTSSVCTMNSSHSGRHHTHVESSRRSARGGATQPSAGFLAKGWCVRP
                     LQTIKPVLPQTGYVDSTGRAPLVAARTQHVWTCLLNLRELDEFAIEVTVKVPYIAGDT
                     ELSLQGNTVLFSGMLRSSTSGTVLLPVYCPAPEGAPAGVTSLWMKLYVQYLLVFPLEG
                     CGQHGPLEIVRSSETFAWLTVPTLIGHRGLGKTYARSPSASGGAPFVIKCSENTIPSF
                     QAAHARKCKMIEFDVMLSKDRVPVVIHDPLIELMALKREGVRACPGKAEYTPVRAAVH
                     KLNYTRLRDLHVQCCKSVDRVFPTKDLLIHHWDSLLSWARNCQPKALRGSSSSSQNGV
                     CCGSSARTVESSLMGVEDFPNGVPSLREVLEQTPPSLHFNIEVKYPFQPLIDSNLFLQ
                     SDAFEVNGFVDAILRVVFEFADNGRKITFSSFDPNVCLALALKQSRYDVLFLSDTKEM
                     RDLKDYRSFYVEGAIQFASAQHLAGVSVNAGTLLSPEDEAVLPNIPEAPLHGSAERGP
                     VTAELFHADDPQHAPPTVPSSFGAYGRAMVAEMHHRRLKVWTWGDMNSYLYFAYAQAA
                     KMQVDGVIGDRMPVFSSTS"
     gene            complement(<1056397..>1058112)
                     /locus_tag="LDBPK_362720"
                     /db_xref="GeneID:13388273"
     mRNA            complement(<1056397..>1058112)
                     /locus_tag="LDBPK_362720"
                     /product="membrane-bound acid phosphatase 2, putative"
                     /transcript_id="XM_003865339.1"
                     /db_xref="GeneID:13388273"
     CDS             complement(1056397..1058112)
                     /locus_tag="LDBPK_362720"
                     /codon_start=1
                     /product="membrane-bound acid phosphatase 2, putative"
                     /protein_id="XP_003865387.1"
                     /db_xref="GeneID:13388273"
                     /db_xref="GOA:E9BTY1"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9BTY1"
                     /translation="MACFARLGWTAALAAVLIACAISIAHAQSTIARDGAADAADILK
                     VLQVNVLHRHGARSGLPRENTTEICTESPCGYLSWAGIEMLLKVGGFLRTRYNTDPSV
                     VSSPMFESPNYDLDVAYSRSTDVLRTLQSAEAFLRGFFPNMSSLYAAIHTMPESTDVL
                     LNSNTQPWLKFFYSNNKALLRAVCNPLTDELFPDWTEITKIGAEIYQEGYCSDYETRS
                     DCVRTLFDIGAAKKAIGELNQYPLLEANFEKLKRVTTVLFDYEYHYNHSDPLMFKQGG
                     RGQPFVQQMVKNMEGVIEGSNTYKLMHYSAHDTSLGPVWGTLGDRTPDGMMPPFAQVL
                     VAELLQNPSTGAHYVRILRGNPGQSPDTKFEFGWDSKWQMQCIDALGTAYKAEGNICP
                     FADFKRFVKWSEPADARGYCYLDQVSIDIADCPLEPVAYGTPPTALVPSTCRFYRSAC
                     PQFACGIGETLNSVSMQCVCSKDSCLGGKANEESSGDAAVDADKKPTLRDSNGLSGGA
                     VAGVSLATFCAGAIIAVAATAAICMCKRRRQHQLYVRMSSTMEVGNQPNDEREGAAKE
                     FKEGI"
     gene            complement(<1059453..>1061612)
                     /locus_tag="LDBPK_362730"
                     /db_xref="GeneID:13388274"
     mRNA            complement(<1059453..>1061612)
                     /locus_tag="LDBPK_362730"
                     /product="cyclin-e binding protein 1-like protein"
                     /transcript_id="XM_003865340.1"
                     /db_xref="GeneID:13388274"
     CDS             complement(1059453..1061612)
                     /locus_tag="LDBPK_362730"
                     /codon_start=1
                     /product="cyclin-e binding protein 1-like protein"
                     /protein_id="XP_003865388.1"
                     /db_xref="GeneID:13388274"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:E9BTY2"
                     /translation="MFAVVPTAAAAPTEAALHSLADSAKPVADALRPFLEASPSATAS
                     LMPLYTIKKVASCKAVYSALLRSDGVLLLLSHPAADGAASSAHVSVLESGGEAVVDVA
                     AGESHIVYCTVSGAVYSCGYDNTYGQLGDGSVWSSNDAADSLADEQNVGGVRELVLSA
                     PRRIAGFGEGALTDGAHRGHLSNEDTGTPLSSLKDYRVAIDLAPLSSSLSSCTRSLTA
                     AAKSTSTGDSAASWRHVPPPADRHIKQVACGAHHTLMLTRSGRCVYACGTGAHGQLGG
                     SRPVLVQSTFRAIKLLFGVDMAQVAAGDAHSFVLLRNGLLYAFGDNTCGQLGLGHTKC
                     VSRPTTVPLTKKEEYEASMPQDHAAATTKGHRHLDAKAYATLRAPYASTESTYYPLRV
                     PRLQDNGKPHAITGDDNRDSGAAFTTVIKYDAHSHELDASNSSFRVVRVYCCVSWTLL
                     ETTNPGVWLSCGVPLTRGVNRADVATTAARIDGCGVLGRPLLRNKAEAYVFQPVNWAA
                     TLFSMRQNVDAATDALAAPPTWVGNEQQVFSADPSHGAGEGTSDALQLPGVQIHHRTP
                     CSISGEGDSSSCTPVVTTAPAAGHCNTPDSRISSDTVPRFSHPNKGIENAILRVSDTL
                     VSAYPTSLLVAFSSANAGDVGRDGAVTSMLIQSGSPAVVALEVRPDSSSVHEVWGSPT
                     HASMGGPLTAESSGTSVLQVNSTHGAVIPLTSYVLVI"
     gene            complement(<1063138..>1064760)
                     /locus_tag="LDBPK_362740"
                     /db_xref="GeneID:13388275"
     mRNA            complement(<1063138..>1064760)
                     /locus_tag="LDBPK_362740"
                     /product="folylpolyglutamate synthetase"
                     /transcript_id="XM_003865341.1"
                     /db_xref="GeneID:13388275"
     CDS             complement(1063138..1064760)
                     /locus_tag="LDBPK_362740"
                     /codon_start=1
                     /product="folylpolyglutamate synthetase"
                     /protein_id="XP_003865389.1"
                     /db_xref="GeneID:13388275"
                     /db_xref="GOA:E9BTY3"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="UniProtKB/TrEMBL:E9BTY3"
                     /translation="MSVSTLHPGVLAAGSAGRPSPPPPPPPPPQHARPRVVVHNVGED
                     GCAGEGATSAAAGVPKRRHRSFKDAMEVVERMTGRRPNRCPDGFETTKRFIDRLGFAP
                     ILERIRFVHVAGTKGKGTTSAYTAALLQAYGFKVGLFTSPHLTDLRERTVIDGRLLDE
                     NTYAQYFFEFLDKYEALQYSDSQLDRDIASPSRANFFRFIFLLSLYIFEQEGVEVAVM
                     EVGIGGRIDSTNTIPSEVSIITSLGYDHMEILGNTIQEIASEKAGIMKSGVVCFAAPQ
                     TDHPETRLVLEKHARKVGAPLVLLDQNVLPIRSWPKLAIGGVHAIEDSKLALMAARCV
                     ASIPPILPLDEVEKSVLQSMTYAGRSQIATVDDGANITFYLDGAHTVESISSATQWFL
                     DVSAANTRDPAPRRVLVFYTSRDPKRVLKAFMPYVSHFCKVVIAQVANPRMTSHSADP
                     GDVEGKISELRERMVTTTQHWRNMYREVTCLPCARPFSALEDILDLVVPAASDNEDAS
                     KPAQVFVCGSFFLVGDIVKLLKVYEAGGRRPE"
     gap             1065994..1066092
                     /estimated_length=99
     gap             1067140..1067238
                     /estimated_length=99
     gap             1068157..1072534
                     /estimated_length=4378
     gene            complement(<1073689..>1078896)
                     /locus_tag="LDBPK_362750"
                     /db_xref="GeneID:13388276"
     mRNA            complement(<1073689..>1078896)
                     /locus_tag="LDBPK_362750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865342.1"
                     /db_xref="GeneID:13388276"
     CDS             complement(1073689..1078896)
                     /locus_tag="LDBPK_362750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865390.1"
                     /db_xref="GeneID:13388276"
                     /db_xref="GOA:E9BTY4"
                     /db_xref="InterPro:IPR014883"
                     /db_xref="UniProtKB/TrEMBL:E9BTY4"
                     /translation="MSADADASPTDPFLNSRSTEASRSRADNDGAMVVEVVDDCQTAS
                     SSSAAPAAPFATRVRPSTIVARGESPQEAMTHLANNAAASTSAAAIMHHSRKRERPAV
                     ALASAGSSTSTTAAPPLAQRRRIAGQRKSGATPSSSRRAGGAARTIVDRGQHSTKDRS
                     DEDELAEGAGGEYCSDNEEGYAPDDGVEGDAEERALVSASIALMAGQGALTAPSAASA
                     TPHLWLVTDAFHVCLWYVLRYAGRALSAEDLWACRALLSLTAVDATEEEDGGERATAP
                     FAAAQARSANMHFDDWAWSGSEESELLLRLLLRHAHGFTARHLELRYGDWLHVQPALN
                     ALTQRRFLWWATKQASLDSAGGGAETVCLHSAEEDASTDLTETPLLPADELARTEMAS
                     SPLVEHYDGARVARLLLSCCEEGRPQHRHATAVSKSASSFSSVETVIRVAQAVRATEL
                     RTFLTTLRHCSKARALMDERARGGDATITTRAIAFTTASTLGTSGNALCKDGSSGGGV
                     MAEPTPVLRLKSSGWTDDVACARPGQISHNSLYDVIPGRKRDMIRYLVERRYSVWVPT
                     STVNGSPAASATTDTPTTDTMIPSHGPPLTAPHALSSAPLITRPSPRGAVRCTSAFAS
                     APDRSPFRRCFPTVSVESDAVAQCWDRVIGSVYVPHSGLRQHLTWITELFHVLTSNNG
                     AGMVSGQGAKAVMATMTVATPPTLLMVRPQLLLLLQTLRAARHQARPSLTEPSPSTAA
                     HPDPKAFKESVPHALLPQWCSPPPVVKATKVALPRVCGQLYRDISSGGRAANKTESRS
                     RPDASAEPSDNDSSLMDTIVHTSRSFRDFGAAEDGTVTQVWPTPPHVCLFSSPATLQE
                     YRRALSTQRELYCVTEGAVTAAQRHRGKSSAFVSHMYDTVMAAVRAGVAAVKQHPHHA
                     RTAASASLVSGKVTHFGSMHPPAPPVVSEAAPLSKHFTQSVTASLESLVYHQGCHAEH
                     LLIFTPLYRWFACLELLFPLLQSARRYDDANACLHHLLYEPIFVLHHMPVSGARCHIS
                     PITYEFRYKPHKRGKWVARLAQNLSHQKRYAEAFAVLEEAQAGYRELASHTADDARSV
                     PATGSDGGGHVTNDKWLPCDAMSNSTAAALCNVLAGNHSPASESALPIKVQRRSRMLR
                     VLWPAAASATFATDDNNSSPPAAEGLSPASLALLHAAWEYVRDRYCRRQDRLTLERLL
                     AVTHRKVRQWTPPAAYLEFATRRLVDVAMRHIGGVRDKLDRMLWREPSGQAPGRPSTS
                     AGGAAEAAKSTTPSGALHPQRRPALPVELLVLQRYLSRWNGASRTTAAAANAATDPKP
                     RRRKGTLTANSAKAETEGRDNAGGAKVTSVWCGVHCEGQWIACLARALLWDCYWAFPS
                     VSPPFASFPVSAGDHESDQPPLQTCSTHEVLWLSAFQDGPLDLTTPIQFLWRRRALIE
                     ARLAQLERCTREELIAYVGARIKVEGNTAEGVGPSNLKARRRDAGAEAPRKEAHVVQR
                     ADEDKGYDRDEERARRRRSRDEYGCGPHRHSYTAKMEEEFRGSNEEDSVQIASSLPAT
                     PLLSTGSETSSLVLGRVVQERNAEAQRVESVKDSADASLSSRVSTLAVPEAWKVPVGP
                     LPLLDILRAIPLEPLWRLLRCLYLSPVTEGVPLAFSGFPDLVFWRTGGSGGGECSNAA
                     LQPSVGGDSAVLRTSFCLMEVKGPSDFLSTKQIAVNDLLHRCGFEVCVVRVDEVYDDG
                     QRVSTKRIR"
     gene            complement(<1080120..>1090496)
                     /locus_tag="LDBPK_362760"
                     /db_xref="GeneID:13388277"
     mRNA            complement(<1080120..>1090496)
                     /locus_tag="LDBPK_362760"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003865343.1"
                     /db_xref="GeneID:13388277"
     CDS             complement(1080120..1090496)
                     /locus_tag="LDBPK_362760"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003865391.1"
                     /db_xref="GeneID:13388277"
                     /db_xref="GOA:E9BTY5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BTY5"
                     /translation="MTLNQFKSWPSKYPKSALEDTAPVRLRANSSTAASASPATAPAT
                     STMPTSVLYSVLLRASVSRNAVSKNPAERSPHSHTVYDIDSTVREAVRAEVERLFPYR
                     GAFAEPPGGADVDRATPAQRFFGLAPKAEEGERSGCRSACVARVNVYRHISEPDTHNP
                     RAPVPSTTTAVAATETPSSSAARQTSTSVLQRLSGGPRVVIKSLKRKKTLAVMGATRV
                     PAPSMPESAEAPKQLFAPLLAENSIGVGGVMRDQEASSCTSPSAVADNSHRFTVVSAT
                     ELPDMQRHLERLFDDFAAAVEQCRAALDQQQLQSSSPAAWQTTKKKRGVASEEPSVSL
                     LGEEASASQHPQQPPHCTNSNHRPGNSTVLSTDVFPRHNSHHPVSDFLSPDRIPDEWR
                     HDHGTVATANGSCCTSYAQSASGESVRMADGSVPETTPSLEAEDFSTGIVMIAHTIAE
                     HLHAILHPNITLAALEEEAAALRGQGHGGSSGAGGPAALNAVMATCRRSHTGAEGEDR
                     KPMSPASFSSPSPLPDLRSSEGLQSPSGASSAPLGPRALRQLVHSLFWSRITAFLSSV
                     SLKTPGKDCPMWLSTAAVEQREACSYVQLPFWIWLYAACGLATDVIRAQQEAQRDFTI
                     PGQATGPRKTLTSSSATASAPPPPSLSQLLPTVETLARQLQRRQYERVDSTAGTLLTA
                     NTFLSFTGVQMTDKAVMKRLFPLQSGVIASDALGFATLSPHSAQCITHEASVATESSS
                     GSLTTGAFDSAAVPTLISINTSSDRLISAEHTMSAFAGAGPNAIDRSSSSVEGAPISP
                     SRRGQAATSVVLGDAGNTAAYATEEAPQVHSGSYSCPSTVELYLQWLESADAARLAAC
                     SSRSEAERFPDRADTEADAAGEAAASSPTSRPYRPGTIACMQPHVSSYAEDGQASNGD
                     GNIARGNSSSGKDRSSSDSSFSYATVQRPSEPFRVAAVMPSAGLAPCLGRVEKELHQA
                     RSAVQFARKVGTLYATQDMKTLLQLLPAVAREEPVSPNANLVSARADGGAVESFGGAF
                     PPRGGTDSTGTPAAPATPAEGVHSQYTWTGTPTTSNPMTGSLPPLVTPPQVAADRMPG
                     NHALFFRRANASSTPPALFPSVTSPSLEKRLLMEHLDSCAAAIVSNSYELFVDSARAL
                     EVSFSLAVVLLSHVMGEAVPKGEVASVVQAAAVASSSDSSQSAISTKAGAVTTTMVVL
                     KRLPAKVAAAALSEKSKGRVTTKTAAAPPPPRPLSMDLAKVFGFGRSRLWWQHLSAYV
                     RETLISVALRALQRKDVAMTQELLQCITLDMTIAHHYDQVRRHHPVPKPARVKGGGDT
                     KKVSGSTLKKSRSAFKAGGRKVTHLSAPPHESSASFVNVWLSSFAHLADTTTHLLHGD
                     HNAPSSLKGAVWHLAGLAHYFLLTRARGYDMYGGQSHLCSTTLFGHGSGNSAGVGVRT
                     SSVTSSAALQSFITSQLVEPAGKVLGVVVSFMESVCQALSADIESGGAAERHFREGVM
                     FVDNSSDDESLFMCPAADDSVRLGSAAESTSLYSDGGGGDYDMASNRLETSGLQTCWM
                     ELAIHYFFEIVDVLLDAALHLPEKPLYLYQLTVSAFNTAAPSIDFADTLSAAVLAGGA
                     GSPLLWGLGDLSSSVVATAPQVVADSPLDRVQEFLSTYTSMVLQSAVNYFTVDSRHAH
                     SRVATARETPLNTSAAADGTSEDDWPRTFWERLLTSVAAPANPSALGEVILTARQPLT
                     SASTPTSWPAANPAVSPEVSASSSYTRSTMWWPDVRFHRYSHLIRIVEHAQLVSLYLN
                     SCAGSNPAQTAPLTSYLEVSRAPRDSAPSLQVSAVTSLLNTSTGPCAQLLSIPYACPP
                     SAVDTSSSSIIPGSARTTSHERCWFHCTGSPADQSPPRFPAGAHRRVPADRAMREVCG
                     GLWIRVELLRLLRLAAAPLDAETFVSFTKTASKVATQTRDRAMQTHYTAIASMKAGAE
                     SVLPKTYASTYVRLLFLRYVQAFYADVHALSASGPATGPDHTTSERVDGTSNATPLTR
                     SVDQRAALATHADLSSHGDATPYRTLGPPQMRSQVSTLQHLSQRLWTHYCHELLWALR
                     ELCWSCAEAHETAANLSVASVFGRLLQMISGRGELEGDDVIDDYDDEPAEKFPDEPHL
                     DLKDVGMSFITSERALEPYSTAEGVRMEGFVDFEVSSSNSSVTVVPGMSEGRKRLPGQ
                     PPNSGSSDDFERRLEPSRSARRSPVSKASVEVEQQVMVGISDQTSVFDFKERRRLGSN
                     DHFISGGTQATVRSTTPLAASSTPVPTPPRTPVTAPPVVQKLSFTGLKPPLYFTSSGD
                     TAAAQENDFYKEQSKQPQMAKEPMVHFLSTTGMSVVDAASHQSQDDDNGECDVKYEAR
                     SDALESASKHTLPKSTSHEPRESYSTANANADSATRRDAPKPPALTIPKLSLGALSPP
                     LYFTSTGDTAVFAERPISPSLARPPAQAFPTLNSLTAAAPAVVGAAHVDPAVRGAPLK
                     GAAEAANASTLTPPPVPVLHTSTPTTVDGFALPKLSFGSLGPPMYFTSTGDTGGFIEA
                     ENQKPHAVAGATTSAQIPSDTIHLQFGLTAQGMASRGTANTATATAAAITASNCPTAA
                     TAAAHFHGSHSSDESHLRPVFSFADFAPTGGKVSRSGNASDEVGSYAGCVDEQDSKER
                     RRCDSGLSLNSLPMPESSPLSMLTGQRRRKRVPRTSRPVLTPIVAPAVTMELILCICS
                     IILQQDSGMIQYAYTVSSLTQKRVLPDMSSSSQRRWHAGSGTAAAASGSTFTQKSDAA
                     QTDRWRYTPQHSPSSFHVIQAMHNYLKDSRNSLVIDLLEEWVLDEYAEMERARMEQFE
                     SAYAPSMQQECSPQPPHPSYSHSESGGNIGNSVHHHSLHQPQAGGTGGGRSGKPSAAM
                     LAGRYVLLRLLLPRAITPLITQQNERRIGAGGYGSVTSGFVQRPGTGGDTQLPPGWGQ
                     RGFRWRPAKTRGSTAASGSGAGVGGTTPQSLHMGRSVTTTAERIAPGVLDGLRAPWRT
                     ATQRIAQAVCKCEVAIKHIPLNVQGSESGNLPLCHAEVLCMYRLRGHPHIVPLLSFDN
                     TKDEYILVLPHYTQGSLRLWRQKHYPLGCAVLTLSPGMKDSCKSGPMPTAAPATTSST
                     PTPAAAPSTSLFTTCARCLLQVLKGVAFMHDHRIRHGDIKCDNVLITATAASAARGEM
                     DPPMLPSSVCLCDFGSCDTCDDDDIQNLKHDIMAGEARFLAGRWGVGRGTEAIQPPEL
                     MSAKRRYALLRRIATAVAPAAAATPATSSLLTLSERVERGSHAASFAGPSAEYLPLRS
                     RGGELMESTGPQMTELLRRAELSVDIWACGCLLYEMLTGRMLFGEARLGRLLVLAAVD
                     DGEDQDPETAASKTSTAAGPLPGAPRSLQKATVPTTSSVGADTGSSFTPSVSKKALDD
                     WERRDLEAAVGKRVVDFMSTLLDLDPLQRPSAHEALQHWKTIMVEAGLEI"
     gene            complement(<1094167..>1095822)
                     /locus_tag="LDBPK_362770"
                     /db_xref="GeneID:13388278"
     mRNA            complement(<1094167..>1095822)
                     /locus_tag="LDBPK_362770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865344.1"
                     /db_xref="GeneID:13388278"
     CDS             complement(1094167..1095822)
                     /locus_tag="LDBPK_362770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865392.1"
                     /db_xref="GeneID:13388278"
                     /db_xref="UniProtKB/TrEMBL:E9BTY6"
                     /translation="MEHQYFFIEATWLEAAAAGICSRNGIILKDAIAKAEKGIPVQIK
                     NDSAPTMHSLIQTTHASLEQACERYLHQNARNLRLTRASKPTPAVEALNEAERASCRE
                     LVVRIAITGALTQYQRCTRKCILQDSSSFSPSSSHPAVSASKTVQGNGVTEKQLERSL
                     QTTLLKGLLYAFESFQECHSMNRDHYPPRVDSNTPGTVGWDTLVLLYLVHRIPQVARH
                     ASGSAIDDCIGQVIRTWRKLLVALQSVDAQEAPEHSRRRGALSLVNGLLIILFQRYNT
                     HQCAVLLGAVEHAENVAESSKEPARSILHPSRHMVSEVVTYHYYQGRMRLYERKLDEA
                     HRILRIAYTLLPPAGFGNEPQRLNKERVRFFLSVAGVANGRRIPAEILRADEDLLPRL
                     FGSLTAAIERGDPVRFSGALDSNASTFHRRGVYLILQQAKILCYLMVVARVHAAMAAL
                     SDVDNSRITIPTLLAAYTYITSEEPQSGKPSAESKKRSRDDEAVPPVSEACMAESVMD
                     EDRMALWIAKLIARGYVRGYYSHEHKTLVLSKKVPFPLLQEEV"
     gene            complement(<1096620..>1097642)
                     /locus_tag="LDBPK_362780"
                     /db_xref="GeneID:13388279"
     mRNA            complement(<1096620..>1097642)
                     /locus_tag="LDBPK_362780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865345.1"
                     /db_xref="GeneID:13388279"
     CDS             complement(1096620..1097642)
                     /locus_tag="LDBPK_362780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865393.1"
                     /db_xref="GeneID:13388279"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BTY7"
                     /translation="MSANCAGSAATPDAKRARVEADVITEGDRAPVFPLPPTDAAAYE
                     REHVHNVYRAIADHFSSTRYKAWPQVGAFLEGLPPFSLVADVGCGNGKYFSAAQRLAL
                     TASSHPMSTSGASLEMKSRQQAEAQPLPPLVSFAPAHRYVVGLDYSEELLRSTQRQLV
                     DPNMHHAQRRRRLSGKRAKNEAEAVVKPVSAEELPRTDTVRSDALRCPLRSGVFDAAI
                     SIAVIHHYASRERRRLAVRELLRLVRPQGGRVLIYVWAREQRGHTKRLVDPETGDGLV
                     RWERNQKCDGAQQVFHRYYHFFSEGELEQLCKDAASDDGTGSIPVAISKSYYDKENWC
                     VMLERC"
     gene            complement(<1102403..>1103794)
                     /locus_tag="LDBPK_362790"
                     /db_xref="GeneID:13388280"
     mRNA            complement(<1102403..>1103794)
                     /locus_tag="LDBPK_362790"
                     /product="dihydrolipoamide acetyltransferase precursor,
                     putative"
                     /transcript_id="XM_003865346.1"
                     /db_xref="GeneID:13388280"
     CDS             complement(1102403..1103794)
                     /locus_tag="LDBPK_362790"
                     /codon_start=1
                     /product="dihydrolipoamide acetyltransferase precursor,
                     putative"
                     /protein_id="XP_003865394.1"
                     /db_xref="GeneID:13388280"
                     /db_xref="GOA:E9BTY8"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:E9BTY8"
                     /translation="MLRRRAVSKLATPAALRFLTITPIPMPALSPTMEKGKITEWCKQ
                     PGDVIRPGDTFCNVETDKAIVSYDNATEEGFFARVITSAGEETAVGQTVCLIVDEKEG
                     VHSDEVKNWKPEAEEAPAAAAEEAPAAPAAATPVAAAPVAVSGDRVKASPYARKMAAE
                     KNVSLSGIKGTGGGVGRITSKDVAAAVASGTASSAAEVAAPAKTAAAAALAAPAKPAA
                     AKGTPPANPNFIDIPVTTMRSVIAKRLHQSKNLEIPHYYLFDDCRVDNMLALIKQLNA
                     KGNGEYKITVNDYIVKAVARANILVPEVNSSWQGDFIRQYATVDVSVAVATPTGLITP
                     IIRNAQAKGLVEISKETKALAKKARDGTLQPSEFQGGTCSVSNLGATGIPGFTAIINP
                     PQAMILAVGSAKPRAEIVKSEETGEFEMTGRVENVVNFSASFDHRIVDGALGAKWFQH
                     FHDAMENPLSLLL"
     gene            complement(<1104730..>1105830)
                     /locus_tag="LDBPK_362800"
                     /db_xref="GeneID:13388281"
     mRNA            complement(<1104730..>1105830)
                     /locus_tag="LDBPK_362800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865347.1"
                     /db_xref="GeneID:13388281"
     CDS             complement(1104730..1105830)
                     /locus_tag="LDBPK_362800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865395.1"
                     /db_xref="GeneID:13388281"
                     /db_xref="InterPro:IPR024654"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BTY9"
                     /translation="MPVGAAALCEYYGYLPRLVRHTGLLPSTRTSVTSSMAPTVLHSS
                     LYEVDPSPPVRSGEVELPSTYSLHKPLVYDIAELPPKPVSSLRLVIISDTHERHREMS
                     VPNGDVLVHCGDIQEGLNFVRDVKAMLTDFSAWFTDSALHPHPVKLIIAGNHDKAIAA
                     MSTEDVRRLFEPAVYLCEDSVVVEPVGVRFYGSPRSISNSRWSPNTAFQDKKAWKPFM
                     FASARQDDGPGAVSTASRCSSEQPLRARFEGATPGGSVDVLVVHQSPDIPRAHHSVEE
                     QPICTYTQQVAPRRVLLCGHLHGAHGMHRLPVPELVRKSFRVATRGGGGQPEGVARLD
                     EIPFLPCINAAMMVGRFGQNVLLPPSVVDLEL"
     gene            complement(<1106590..>1109607)
                     /locus_tag="LDBPK_362810"
                     /db_xref="GeneID:13388282"
     mRNA            complement(<1106590..>1109607)
                     /locus_tag="LDBPK_362810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865348.1"
                     /db_xref="GeneID:13388282"
     CDS             complement(1106590..1109607)
                     /locus_tag="LDBPK_362810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865396.1"
                     /db_xref="GeneID:13388282"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ0"
                     /translation="MSLGDAINLLREVYASTNNDHRKGCTLQLLQWEKALQAADAVRI
                     GIELLKTSNEGVAVQAYGAVLLRHALHARVLQPAQLPLMDLLSWYCNEPTLGPLLRAD
                     LMELLIECVIYSDDAVIGQVLGSLCTGIESQPRRMLLLSEMTVALVDPDFDRVPRESI
                     GKLKRSVTKQGSQLLNAATMSLYTYYVTSGGEQSTALAPDLEPCVEAAFKVIGTLAPQ
                     LPFSAWQENNLAATMEVLLRWVPAQRPVLTCATSLLRCYSAGDVSKAAILRVLLSIVL
                     RKIPALVASGDIAALDEILNLALELPKDFVQLEGVLLVQSIMSVFSVPSILFGQEAVQ
                     LMERMGEETFRHVDAIEIYNGLRLLLPKNLCHPVQGTNPEGQELSREQFGFEQLFEEV
                     FADFRRGASKILTQLARMYPERTNQYLLSLLGDLPDPRGTPGDPRTRSRFVRQSSLTF
                     VCWEATQFMMEYLSAAFEYSTVSVNACVSTLLAHEPSDAVLRPVYFNMISYFWKVRDG
                     DVMNVWEGTINILLNCINDESSRYTDDIDVSAARRRAHTLLVQMCVEHSRRFLPRTPS
                     LIKQLEPMLMRANGMERSLLYEALIALTAVLPAHESDAYLQTIVNPLVNMLATSPALK
                     DQNAFNNIMCAGTPDDKDARGVLQGCLNTIAAVFRRCQMTPYVIEKATQLFPLIGQLL
                     LSIHSMQPSDLPPEYRSILEQEPGERDLFLPGKTRKSDAHLVNTVRGARATLMNIRIA
                     LYQVFGELSPILPAERFGEVITALTTSAQIPTHVTRSLTEKCLLPIGKEHPTLLIYIF
                     QLLHRFFAQRKEQVRRQRTAEANARNTRDDVVESKQWLYYAKDVTKFIRSHVLDSHLW
                     KRDKALFLATAEVAMSIFESGADNRTAQSFLISIVNLTTDTAVLPEVEAALSEVRVVV
                     YSRLVSYVTLTPDGELTPCERENVAYAISEPYVRLFPNLTPSLTMAGISQEQQETLNA
                     HLLIVGNFAGQRRKVKEFLINIAKADAGASGRV"
     gene            complement(<1110448..>1111419)
                     /locus_tag="LDBPK_362820"
                     /db_xref="GeneID:13388283"
     mRNA            complement(<1110448..>1111419)
                     /locus_tag="LDBPK_362820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865349.1"
                     /db_xref="GeneID:13388283"
     CDS             complement(1110448..1111419)
                     /locus_tag="LDBPK_362820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865397.1"
                     /db_xref="GeneID:13388283"
                     /db_xref="InterPro:IPR001646"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ1"
                     /translation="MRGATSCLLFFCFLLSHHHLSTLPNKVAALLYERRDCAAMSRRV
                     NAEALGQILEALFLLRSSRLAETSTAGSASSVSSGYSTPEPGSTSEAAVDCARHLLRD
                     CVLNAVEIEPTQPDPSSLPVVEADSSMTTKKSPFSLSSAAAWRPRREIGAVLEGRDLH
                     RIDLSGTRLCASFNRSDLSEAVLLGTYFAHCTFNLCDLRKANMAGAQFHSCTFLSTDA
                     SAATARRAHFSHCMFHRADLSDWDAAGATFFQCSFTLSDLSRWSLDGQTTVVGPTDWG
                     RCRRLDWVMKPGSSVRKCCVFGDANATSALSLAPAEKSSCHPSQRHH"
     gene            complement(<1111998..>1113017)
                     /locus_tag="LDBPK_362830"
                     /db_xref="GeneID:13388284"
     mRNA            complement(<1111998..>1113017)
                     /locus_tag="LDBPK_362830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865350.1"
                     /db_xref="GeneID:13388284"
     CDS             complement(1111998..1113017)
                     /locus_tag="LDBPK_362830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865398.1"
                     /db_xref="GeneID:13388284"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ2"
                     /translation="MPLVKAETDASFVAEVAENVGGACARMNDHISVMIEEYLRRRTQ
                     QVRDDAKQELDAVREHLERRIADAEAAKAAEEERHHKKKAQVLQAAVELQQMHANLHL
                     ERLFHTWRRCADVRRERRRLAEEAHAHIGRLNLFHAYMQWRLFAAALRHKRLEAKEVH
                     KRDCREQELLGQIEGYQRQLEEERAKDASLNEKLKEAFVRGMCALNREAVHVLHGSEE
                     NQDADVEAIAEILSRESHSRHRSVTPGYMDSSTLSNLHGHGVCPVHHIDAKGSFYHPC
                     FSPGYCEYDRHSGSRAPVSSAVPPSASGPFVVRADPKSARSIDSSPPVPFRHLSKSST
                     TRWRM"
     gene            complement(<1113937..>1118250)
                     /locus_tag="LDBPK_362840"
                     /db_xref="GeneID:13388285"
     mRNA            complement(<1113937..>1118250)
                     /locus_tag="LDBPK_362840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865351.1"
                     /db_xref="GeneID:13388285"
     CDS             complement(1113937..1118250)
                     /locus_tag="LDBPK_362840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865399.1"
                     /db_xref="GeneID:13388285"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ3"
                     /translation="MMGQARSGRSARYFSLSCKRCVGYPTQWSAVRHQSQSSLGRSRD
                     RQRGQPNADPNTGSQMSVAESPDLTQHIRFGLNNLEHVKLPDMPDEARRRSDIDKERE
                     MRAKFGEYGPGERLTKSSPQMRRDMLEEQQDVDGLPWEVRWRKSLIPTSEEVIQDIRD
                     RFDLFVQDPIEREQEWYLHWKDRSFKIQKDRMIWPQGYTDYLDHYDENGRRRVLPTDQ
                     RWSDSSWKHLADTRYKDRMWLIEGEERKAVHQSLQTDRTLLKEEEQRQSEMGDVYHGI
                     LSGVVDLDPDQTYQALSGTADPLEVAKTKIKLQAYGAHQALTAGKRELNPAQIDPISG
                     FPKADMEPLPTGITVEQGAAIATQANIQYEMLEQGAEATRLAGYDPAVAMMKAHHNTS
                     KQYGDRPMLRAQVEANIRKIKELEAERPPLEAGKTAGALTDGEMMEKIESPLLEETAK
                     GQPAVSQTQIKASVTTTESDSGAVGASTPAGFIQVAERPKNAEPDVPNELFRVPQSRE
                     LNEMPKWYRETLVETEPMIRQYGMVHDPLEEKQPEKEYYVPPPLRDDERVTLDDAPSG
                     PSAFDEVKMHKLKSLPELVVGYKPLPLFREVSKNDSLEAAAEAKEKKLVGKDGKPMKR
                     SERQRLERQERLRKSKLSYDSDILLPNLPWETDSIVDPYRGVDAVDAVEFNKEDLEKT
                     WRAYRDAFQQALTEFGNLTQVASEDKCEKMLYDTMERFREGRVGDHPEVPKEQDEVFR
                     LVFEAHTKHFLADFYKFKGNRTTEANVVKAEADEILRRASAKSKLLGRNFMNFVQEMT
                     SLELETIRKNPVQRYAVMVRDRKYEPISQPFMKWIKNELGEFMITEFHSAEQLETHKE
                     FLHRHLNDACIRCPSRVEGISDASRDAAVEAFYQWCRGALAFYTGKKFHSMFLDFADS
                     RFRSRAEELYEDSIELFSNYAKAGKDIVQIPVPDSDPPYEYDEKEFLDGENALFAEIS
                     GHLDKAEALWHSGSSKRWYPMTDETEYMWFNERRGRLTLAMDISDRCLENVNKKTHPS
                     IHPFPERARVFLEGAPLTQETAEHLWLRYMGDLYWEHSEFMQRQGRFQTSRSYRDKCL
                     NLYHLAVRTARERLPASWKAPLLTEAKYMLRVYKPGDDVLQHLQDVGTVVDKLFAQGE
                     PRHWVEPFSELPYRLAVVHANLPAYGEAITKEVHRRLKWQPSNELLMKDMEKRARGGA
                     VTPELVPYYNTLNAVAETVFRRKILKWRSKEYEGSDPFLFWTHMYFAFRVHPKDRDEV
                     QRMWDMYEPAYVYIYTQCALASRVRGHRLINDALRRLCQILLSGDQSQKLVLMEELTK
                     VREKMAHLIDRRELDRTINALEAHLENPAQQAYTYGTALLYKEAVLHEKITRNPLLRT
                     QMAAKEYTELRKMQEELRVNGVTLDPQQAAKMQEKEGGLDDTHLDAQPSLTTKEMFAE
                     K"
     gene            complement(<1119319..>1121034)
                     /locus_tag="LDBPK_362850"
                     /db_xref="GeneID:13388286"
     mRNA            complement(<1119319..>1121034)
                     /locus_tag="LDBPK_362850"
                     /product="mitochondrial ATP-dependent zinc
                     metallopeptidase, putative"
                     /transcript_id="XM_003865352.1"
                     /db_xref="GeneID:13388286"
     CDS             complement(1119319..1121034)
                     /locus_tag="LDBPK_362850"
                     /codon_start=1
                     /product="mitochondrial ATP-dependent zinc
                     metallopeptidase, putative"
                     /protein_id="XP_003865400.1"
                     /db_xref="GeneID:13388286"
                     /db_xref="GOA:E9BTZ4"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ4"
                     /translation="MSYGQPQQQPLPSDLGTKERPIVVVSAPQKASWATRFWMFLLFG
                     IALSCFISLVEEFNDRFQEGQPANKSGFARSGISGLFGSVDVKPVNLDNLEVTFDSIR
                     GCDEAKKELEEIVEFLKDPEKFYNLGGRLPKGALLTGPPGCGKTMLAKAIAKEAGVSF
                     FYATGSEFDEMFVGVGARRVRELFAAAKANSPALIFIDEVDALGGRRSRSDHSTSRMT
                     LNQLLAEMDGFDSDEAVIVLAATNTPETLDKALTRPGRLDTTITVDPPDMKGRAEVVQ
                     VYLDKIKTDSTVNAMDIARGTTGFTGAELSNLVNLAAIRAAVLNKAKVTSEEIEYAKD
                     RVMMGAESKKIVPEEERRVTAFHEGGHALSAILLKDEGADPVHKATIVPRGNGIMGLV
                     QQQPDRDKYSQSKRQCLARLKVCVAGRVGEEILLGPDDITTGAGSDFQQATNMARHMV
                     RQFGFSDAMGFVDYGTPDTAEGAYISDETKLKIEKEVHRLVEQAYIETKELLLSHRAE
                     LESIANNLLKYETLSGKDLEKIIKGEAIPERPPRLSQAAESKAAPPRGGNSDQANGRR
                     TVPIS"
     gene            complement(<1121668..>1124484)
                     /locus_tag="LDBPK_362860"
                     /db_xref="GeneID:13388287"
     mRNA            complement(<1121668..>1124484)
                     /locus_tag="LDBPK_362860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865353.1"
                     /db_xref="GeneID:13388287"
     CDS             complement(1121668..1124484)
                     /locus_tag="LDBPK_362860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865401.1"
                     /db_xref="GeneID:13388287"
                     /db_xref="GOA:E9BTZ5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ5"
                     /translation="MYTPTEGDLVSVIQLLHNNGVEVSNSKAAYAQLKQYESNPAFCI
                     LLSTVFGADTNPVADMVLPVSWAQYRQLAGITLKNNLASARHALGEGAVKEAARFALK
                     SLTNPPDTRIARTSAQVVVKVTALTSLEWWVGSGVGDLPSILLNDLLPGGELKTLAAL
                     YCLQYLVEDVPKQIGESSEHVILRVSQLAASQNDPMTIRKAAFRMCFNIYEQASLLDW
                     NVDTLSPLQMGLSKASHSLSSVCTSLLECSCGEDSAFVILVLRTCSFLLDYFDFFGQM
                     SPNEMQRYTNWWITNSAQIICSRQNSISGNQELVAAAIDLISTTVDLYDRNGGETAVA
                     FLVSGVPQLIFSLAPALVRYALLSSEEVANIMDTDDYRVRDSTAVSFEVKGGTKDISE
                     DDMLDDDAAAMTLRSSALKLVDVLSTFSSDATYQAFIGPIQQLWSSSEWREREAGIVL
                     VGTIANGCAHELRAVLDSLVDQFLQFISNQSEHVCVVSIAMWSLSRISETVLNSSPRT
                     MDTIIPLLASRLQSTSKRIQITSVSALNVIYGVLENYGSTAVVMPHLPLLLESACACL
                     PVYSTTNLSLLVDFLNKLISLLNDQTTAERLSSVLQVERANRASLFEQSYTAMYIREE
                     PNVLLDKDIFSLDRAMIAFISVYPSSEVAVANLSTWNGVLADIKNRNVTDDADLVFNT
                     LLICSAYTNSVSTTILEEWLRSTSWALPVSAAHFLTTSRIHEVKVAGITILCGLLHAV
                     GSGALPAGLHDTLMRWATSEVSEAEDPQFKEHLVRLIGQATACYPGQLSTVATEALKS
                     ANAALRSDVFGDSSYYFSAMAFDLCGALGAVPSYAALFRIDTMSQLMAQAENTVDKSE
                     ATIHLFQALVQLPADVFSGVFSSAIKIVYSWQQAAVNYPGTKEAIQSFLFHAGKTCPG
                     IFQSILEGLPAAFRNMLVSFYQLQ"
     gene            complement(<1131147..>1131605)
                     /locus_tag="LDBPK_362870"
                     /db_xref="GeneID:13388288"
     mRNA            complement(<1131147..>1131605)
                     /locus_tag="LDBPK_362870"
                     /product="D-tyrosyl-tRNA deacylase, putative"
                     /transcript_id="XM_003865354.1"
                     /db_xref="GeneID:13388288"
     CDS             complement(1131147..1131605)
                     /locus_tag="LDBPK_362870"
                     /codon_start=1
                     /product="D-tyrosyl-tRNA deacylase, putative"
                     /protein_id="XP_003865402.1"
                     /db_xref="GeneID:13388288"
                     /db_xref="GOA:E9BTZ6"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ6"
                     /translation="MKAVIQRVLSGSVTSEGEVVGSIQKGLAVLVGIARDDTADDIEY
                     ILRKILGVRVWSNEDGSKMWCRNVKEIDGEVLLISQFTLMHVMKGNKPDFHNAMPPED
                     ALKVFNTLRDKLRCEYAPQKIATGNFQHYMNIHLSNDGPVTLILDSKKRS"
     gene            complement(<1132137..>1135196)
                     /locus_tag="LDBPK_362880"
                     /db_xref="GeneID:13388289"
     mRNA            complement(<1132137..>1135196)
                     /locus_tag="LDBPK_362880"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865355.1"
                     /db_xref="GeneID:13388289"
     CDS             complement(1132137..1135196)
                     /locus_tag="LDBPK_362880"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865403.1"
                     /db_xref="GeneID:13388289"
                     /db_xref="GOA:E9BTZ7"
                     /db_xref="InterPro:IPR016182"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ7"
                     /translation="MDASGIAASWTDLLAQSPSSPGSSSRVALSEVAALCLAVEAPKC
                     YAVYRPSNSGSGVQRYTSPAPALATPQHFLQLLARLREALGASAEAARIAEVLVDLLN
                     KPPHPHEPGPWDLTQNEVLTVKATAIQHVMDSMQGGSDALAWLTRLLRLTDTCAGEGE
                     VTESEVPLLSTALSERYGLHGGSPIRRVHCGDADGEWLLTCSPVVLAAIAAAMLRSTT
                     KGMKAHALELLEAAALTRLSRTSLSSGKAVAGSYYRSDMQRGAPKALFDETVAVRCAE
                     AAAVQGDAETVTRLIFLLYRARGALGFATLAEHRQRRRSGRGNEGTWRRTSSGLLPRT
                     SSWFSARWWCRDDGAMAKRPAFVEEDAADMRFELAVVRLLKSAMQALLYHPQRMSDSV
                     VYTVEEALSLWDGLSGAITWPGIAAIGAELLRYFADQHARLSVAADAGDGCAASDDVH
                     VRRAALRVYGHLCRAAPVRQRTAAQRDELNHFTSLMLRIFSTELAVIGSAGMLVPVVA
                     STTAAERILRLFANLSGPRAQEVALPYALAASLVIFAAAATQKGYSVPPSLLAPLAAY
                     FSETQSLHYYCVAATSAEVPAHVAVSGSLVLLHLLLWSSVPEGEWARGDGELWPLLQR
                     MQKVKENGLGADTVAAAPATAAAYRVTAWLRVSGDQQRSLLWLLLLSAKQRDTPWCRA
                     VVNAFSSPASSTVVNYAVSSVYAQLPQAELKSVVELLYACGNNDNPAQASQTLDRVVS
                     ASLQLPIRALTLETLEAQLQRFSAGRQATSVLVLGAASIRALAERCATTSKKDADDEL
                     TVEVFLRVLQPLLFGPTAALPLRFTVVVLTPASLVELQRMYTGADDAPRHASAFVRAL
                     HDALVSRATPSAYQVRAASSWPLLPSLALALRKQKELQSVDGLREATAAARHLEHTLP
                     KESRPLVCLWVEREALFDTPHALSAKAEVLRHYGVREVSTHRAHVEKAKRDIFSLVRS
                     GAAGTVHPTGAQVTGEAALTEAKAARRTRHHSLLSAVAERSRRQRSA"
     gene            complement(<1137241..>1137717)
                     /locus_tag="LDBPK_362890"
                     /db_xref="GeneID:13388290"
     mRNA            complement(<1137241..>1137717)
                     /locus_tag="LDBPK_362890"
                     /product="acetyltransferase-like protein"
                     /transcript_id="XM_003865356.1"
                     /db_xref="GeneID:13388290"
     CDS             complement(1137241..1137717)
                     /locus_tag="LDBPK_362890"
                     /codon_start=1
                     /product="acetyltransferase-like protein"
                     /protein_id="XP_003865404.1"
                     /db_xref="GeneID:13388290"
                     /db_xref="GOA:E9BTZ8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ8"
                     /translation="MPAPVVTVRRAEREDTQRMYDLIMELAIYERAPECVVVSKAEME
                     EEGFGERPLWSAFVAEQQETNDVKPRVIGMALYYYRYSTWRGRMLYLEDFVVTESHRG
                     IGAGKVLFERVLQQAKEEGCHGMVWQALDWNAPAIDFYKKYDAEIDPGWVNCMLKF"
     gene            complement(<1141506..>1143329)
                     /locus_tag="LDBPK_362900"
                     /db_xref="GeneID:13388291"
     mRNA            complement(<1141506..>1143329)
                     /locus_tag="LDBPK_362900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865357.1"
                     /db_xref="GeneID:13388291"
     CDS             complement(1141506..1143329)
                     /locus_tag="LDBPK_362900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865405.1"
                     /db_xref="GeneID:13388291"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9BTZ9"
                     /translation="MFDSFKHTFSQTKYVSHREACGLHVIDEVKRFRALVCVLFCSIC
                     VSLVFAFDLFSEEFQSRFHLSDGDLSTISTVGVVFCYFVIPYGVLYDHIGPLPLLVIA
                     GMMGFIGCLGLGLVFDGKIKGNTVTISIFYAFMNTCSGLFDAASIVTLVELFPRNRGP
                     VIGLAKVMTGLGSSVISSINRGFFSNNISGFIYLIMVLTVVVALMAMLLIALPPYFVN
                     WWRARNKTEEQIAALTSLKGIYAKKFVPLRRIAYGYVIVACLVIFFAITAPILAYTKV
                     SRGGKAVVGGITVVLCMSFWVMALPIPWLGGVSEPAEQQSSTFDDTEGSKPNVLTSVE
                     PLETSNKPLSTSPVSDDDAARKQSLVGVEAVIEDGPQDPRYGGTIWETLMRPDIWLIL
                     IAFVCQGVLGTIVTYNGSTIYVARTGRPRTAELGSLYTALLGVGSAVGRISMGLFEAY
                     VQHQDPKNRKVLVTIALPVAPIIATIAGILILVLPGDALLLPYILVYFEEGVFNGVRA
                     LIFPCIFADHHGILYNMSFFTNVIGVIGFNRFLFGLTVDKEREKMGHTVEQGCTSHAC
                     VQTPIIVVTCTAAFAVVLATMVHLRYVRFVKQCRKALKAAS"
     gene            complement(<1147506..>1149746)
                     /locus_tag="LDBPK_362910"
                     /db_xref="GeneID:13388292"
     mRNA            complement(<1147506..>1149746)
                     /locus_tag="LDBPK_362910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865358.1"
                     /db_xref="GeneID:13388292"
     CDS             complement(1147506..1149746)
                     /locus_tag="LDBPK_362910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865406.1"
                     /db_xref="GeneID:13388292"
                     /db_xref="UniProtKB/TrEMBL:E9BU00"
                     /translation="MSARRASSQHRDRPQSSSRRRYYEDEDYMQPRDERTSHPTLHWH
                     HSSPQQKPHRPSSASKQRKGLSHVSRELHQYLKDDHAPEDGVPPLRRQSTQPPRRRSS
                     PTCHYNGGNGGERVCHRRAVALTSPRRRSTPHRRRSSSRHAASVYPALRTAPVAVGDG
                     KRASPRRSARTSTDGTPRRSRRQHEPSHVGYDSVARSPRQRHRRSSASPHRSHTSKES
                     PIHPERRAPSSSRKSRHASTEPHARSPQGSVRCHRHSHTTSSTAPAPATEAAHRHDAL
                     RYRSSRQAEVAAKREATPHRSRRHSRAKAGGSAEKEARSPRRHTSVHRSRSSRPESRH
                     HSKRRHRHHRTSTPNSVDEGSRHPRHTSLFRPLAEDPYTAPPPLTGSTYIRSAADSHT
                     TGRPRSGSHIEVISVHSACQVPANGWSHSCSNTAHSPRRPYDNGPPVVIPSPRGQQIM
                     QRIDSTRHWLQNMKDEVKKVRERELQQVEDVARSRATRHSARKEYLDSTSPAGSACRH
                     RTSSTGSRRHTRGETHAAVQVTSRQDAGEAIPPTASSERSHRASEQVSPPTREKRHRS
                     SQWHLRRPTAPAAAPRAPAPDPDLFRALMDSVSSSREEGIDYPILSFMSFLDGNTFDS
                     TASLCQYNVDLADSLSDQHLDILRAAVFDHDEEAFAELLYGDDVEAEIGGAAAALGHS
                     DDPTVQHELVVLQREAVRRFNDKCAKALQALLSAEGGLAEAVQVAASQLERQAYQADG
                     SLVIVP"
     gene            complement(<1151328..>1152929)
                     /locus_tag="LDBPK_362920"
                     /db_xref="GeneID:13388293"
     mRNA            complement(<1151328..>1152929)
                     /locus_tag="LDBPK_362920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865359.1"
                     /db_xref="GeneID:13388293"
     CDS             complement(1151328..1152929)
                     /locus_tag="LDBPK_362920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865407.1"
                     /db_xref="GeneID:13388293"
                     /db_xref="GOA:E9BU01"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="UniProtKB/TrEMBL:E9BU01"
                     /translation="MPVSVCRICDTPLLSPPSLPSVSSRHLLSVACLYLCRHTDMSTT
                     ATSHDCHRAPYHQQLQSHIEALLLLFLRDFCAEGASPTRNGYRASHLQAIAQTFYVLQ
                     IVRCSTAPRREQETPYSLLQTGDGTSRLDVCTERDLYYRNPPLFAPRGQRATHESIKR
                     LCGWLEVVARVPPHQQRGEGPVLTSLFRSPRCLLSRPWKGAQGAASLTPLYTRESLGI
                     TAAGKSLLAGAITLELCDPVELIDVSARGSAGITLTYSLATRMVGCREAGVWQAARDG
                     ISSSRPYRLVLIEKESVHHAVLQSMTKSGTPHTYSCILLCTKGYPCVAAREWLRRVHA
                     LRPALQLYIMVDGDPDGLGIALTVMGLLGSKGYPSPIASSQPKPTLSSFSPLSGATPA
                     SAETAKVKELLPLRFLGVCPSLVWSCNFQSEAPLSAGFLGGLASSQGIPLTMHDVQVL
                     KRVVSIVQGALASAPEASDSATSLRGCDTAIVRHTLQRVLKEAEWMQRARIKCELQFA
                     CGPIGPLTFMEQHVQRCDAELSEGF"
     gene            complement(<1153490..>1161601)
                     /locus_tag="LDBPK_362930"
                     /db_xref="GeneID:13388294"
     mRNA            complement(<1153490..>1161601)
                     /locus_tag="LDBPK_362930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865360.1"
                     /db_xref="GeneID:13388294"
     CDS             complement(1153490..1161601)
                     /locus_tag="LDBPK_362930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865408.1"
                     /db_xref="GeneID:13388294"
                     /db_xref="GOA:E9BU02"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="UniProtKB/TrEMBL:E9BU02"
                     /translation="MNSIFVLIRPHVWSPAVVDRVRTCLANVGACVDAEDTVSASTLL
                     STSTVERYFGSIHYWAASATDTVLRHPLSASDSATGEEEQPSFCAAEEDLKSLFYEFY
                     GELWDSALDDGRLRTAFDVMRADNVSAAELASRCTSAGDDAVLALPLGLTVTRILSSD
                     ERERAAPLHYVVNGAYPAVLEAFRRGSGDASGAAAPCWWCVASWPSQAAPEVSQDVTE
                     RMIRLPHMLAEAASTPHSIDVFTGALEALACRVCWMNVPLYDDPFARSLVQRGLPLPW
                     VAVLLRGPTLHEHGHFTDVFDMMAGKDEDDVAVALVALYDALCSPDSTAEGRNSVDDA
                     AALYDWKNGCVDMAAAASGPLAKDSIPSRTYAVALVHPHLWSRKELVHLLEQKLEQLE
                     VCVEAVREVSAEELEAKLDLHHGDVARYALDQEALRRFAVDESKAVAAEAMACFEKNW
                     GVPWVVAMQEGRIWSASLAEDLLGAELAAAVLKHCATNTHKTHQLSATLSVTELSRQE
                     LMTELNPACPVDAVSSASDSASLQGKRKEVVTPNRPFSLTSESYFVVNAAYAVYRRDV
                     LGTSTSACASERAGGLWQLSWRADPEQQSMAARCAAISEALCAAASVDPVSLGEGRNE
                     TLGAEHAASYGAAVTESVAAAYPLVQVSADCFGAMRARHLWWGIPYEDDVVSRDLVRS
                     QGQSWVTLHASFSASPAAETTAHEAVLALLPPVATTAEAIKLTLATLEESGVFIVEEA
                     DIFGYDAFDYVFSSSTALAVARQLAQKTGTGLWAMMSDDMQVTLRAAAAALADETAQP
                     LTPENLYGGAIVCEALHIPLGALEAGWRCTAPICVGDNFWLGYLATYEVWVVNGHVPL
                     LEHRYNAETARVHLLRVQWDASAVSWNEMREALVGQCSNGNEGETGSCGNSAAGSLTR
                     LLSRIADRSPANTTRLVGEPLHVFSRTAYHALVDVLRWPRIGSSGPLSSEVALEDWLV
                     RQPSVQRLLHRGASTLAGVVQYVRETLKTVLQPLLPSQDSSPSTPCWTARFAQSQRAV
                     QLHHGFIWLHPSSTTPAVRDAVPALLLAHRVRVRDSGAVPLQVALERELLDVLHDSFF
                     KNAYMRSAAEVPITDAEAQAFARHFNLGWMEAVQLGLMLNAKEAEEKYGTVHVMMWWE
                     SLAPEHQAKLSDSLFVGYMAEEGLYVMNAPYSYRRSRLHVGSHEVVWYAVEWNAADMS
                     WDDYLRDVIGAADPVAAAAGSLRQHFGAQWTRYSLAGQPDEIECVLHASNTPLAALAE
                     RCRWLAQSPRQDPYGCLLLQSGVHPSLLSTILTNPSVYCRDTSVITEAFHVLPQEDVH
                     ALVRQLRDFQCTRTVLMLQDRTRLVPPATALATPPPPDAPHPREAEEADDGPADLTIL
                     AQLRAYRHVAFTGAVDPFLQCGFATAHRQNPPSPSSPFTCSAVLYLDPTCVPVAERMP
                     SSYHTLRSLLEQQLRINGVRIVHERVVQCASAAEASVLYRCHHHREYRYGVAIPAIES
                     LASSMQWQIRFKERFGVSYRHTSVSLYNAAEMSRVMQVTEREVAALCRRSKSLYPHDT
                     AVVGEGCFIQRLQSGKPFYVMNGDVMEAEKEFVAAQAIVGVRVWLLTWDSARADMGYT
                     KLQHLIAELQAPTGVLRQWWASEGGEGDLSRASGLSTRGHDSPFLHVSESAVAAVRQR
                     QLWWRLPVWSDPTVAAWVNVAAGNETARSSTDVSTLDPRTVAWALQDPLISVAARDDD
                     GPAYLWDTVVGMDARHACARIRCCWAAAVADECNDETTRDTAVLTLAPQVATNSAVHH
                     LVRSVLLDNGLRIDAHGFIADHGEDIATLKRTVQYLYPEDWSYAIEEPQEIQLNADEE
                     ERAARTFGTSWKALLDGGRLLPASRATKRLGGMTAPQLQLFVKTAKNSLWVRPHLHVA
                     ELEEYGVYVINAHVPYLAHTIAGAITEYPLPYYLVSWSPSRWSWKECLAQVFGCAEPT
                     LAAPGSIRGRLYASWSSFGLHAAPEMAEGGGGGVCVSEGPLQSLLGRLHLQWPPLDYF
                     DSDPIGSVVLRQPEPSGATALLRAWLRNPVAMCDGIGTGVLSHLACWDTREVLHLVET
                     VTVTRKKASASETLLLPSALAKARNEVHEAEARRAAEAAREAAFQQRYDLPLLNTFSA
                     AAAAAAPPGVQTSDNTAESALLHRNVSTLLFFSHQLDTAQRALLRQHLQQHGVAVTAA
                     VKHEEEEQECTVALLDRLYATEAFFADCPNLAAVLSESGEVAVEDQARFSAVFGDEVP
                     WPELLARSALSQEAVHDADTSLVGSASEDLHQRRHIYSAADAMKIWHLTPHELWAEMR
                     QGVSMRLSEGLEVTRLCRMTPGCASDTNERAVATDPGAPWKGHYVVNGLYAAVRDSLQ
                     APAATRDTSGASHAPAPPSLTKWNVTWDAQSLSWHDLCQCVIGYADCTQAAPSSFNAL
                     LAESIVDARATHEEDKDEAPSPLSCVGVMAASGPLAAFAVRRYWCWNASHHDMYLPDP
                     FLRAVGVAGMDHDVVLKEGWLLNPVMAVAPSLRHLRVFDWTRGCDTPAVLDWMHSREQ
                     MLDHTPIETTEARGASPAPAEAPHDSEESASIVAVAQTVAAELRPPSPPPRMKSQLQM
                     AWVYDALLHASTHADYKLLWQHYRSLGAPAAAAAAAAAAAGEAASAHEMSNTISFALF
                     YRDFKYLDNFGVPCMSHELKKLFIDIETQRRGRMTYEEFAHAIALYHSL"
     gene            complement(<1162947..>1165574)
                     /locus_tag="LDBPK_362940"
                     /db_xref="GeneID:13388295"
     mRNA            complement(<1162947..>1165574)
                     /locus_tag="LDBPK_362940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865361.1"
                     /db_xref="GeneID:13388295"
     CDS             complement(1162947..1165574)
                     /locus_tag="LDBPK_362940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865409.1"
                     /db_xref="GeneID:13388295"
                     /db_xref="UniProtKB/TrEMBL:E9BU03"
                     /translation="MYSPYDAVYGHDATYIRRMTVEEYVQELKEEEADVRGVTPPLCA
                     AGPASEKTASATPTSSAPVRRTTRQYEQRRMALSSCNPNVVFFSKYPMYDRLGRELCV
                     AFQMQDMAVQQELRRLAKEDGRDSRRSGVRLSAELPMESDTTGGSRPMSVRASAATAE
                     GHELTQTEEVSRVVRPSHIDGDTLVDIDVSATSHYPSVSAICTSSCPASARPSDFSIF
                     RDSSGAAAARMSRGGPTKRHSCVPVRFVAEEEGILIHRSNGGGDSHRAASMPPAALPR
                     LPDDADGRRSQWRWRSEKRHRSRSSGGGGRHSRVRFINDDQSAEDIQREEQPPQQRVH
                     GALPLPPRLSTPPPMPLSEGDNTRVEETAVEDATRWTATSRASAAVRATKQLFRSITH
                     THTSTASRATATPSYRQPIASTAYGLSATAIAASKVGAAVEHNVQVCAAAMPPQLYSE
                     EVAADVETTPELQCGSVVRLGSAWYRLVHFHLVAEVYVAVRISAPAQTAGSPIKTDRS
                     PETGISVTVKETRAADSQAAPDQQPSGKELMVEAVTDTEPQQDRSVGAAAPELPMQPS
                     VGDRGDRIVVASTAAPAGPVAEAERNYVPCTDDAESCPLPTSTDNACVGEASSQEYFV
                     YRWRVTMLPRGGDEARRAALGLSLCAPAVHVHGIRYADGGGITVLSMPLGYRAVPMSG
                     LPLSLRSYTTLMRVVLKAFSTMVARRTVHGNLSALGELFLAWPIVPEQSSSLPRVEEK
                     KQRVEEGHANVGAQGATWQPFIMLFHWERWVDFSMFVDRNAGRTIPFDFEDGTAPSVI
                     TYGKDLLGSLQLFLEHPLAAELTSEQYILLQKLIVIASEPTQVANYLIQMKNLMLSLP
                     TDTEALHQSFDAAVMRHAR"
     gene            complement(<1166163..>1168100)
                     /locus_tag="LDBPK_362950"
                     /old_locus_tag="LDBPK_363010"
                     /db_xref="GeneID:13388296"
     mRNA            complement(<1166163..>1168100)
                     /locus_tag="LDBPK_362950"
                     /old_locus_tag="LDBPK_363010"
                     /product="40S ribosomal protein S24e"
                     /transcript_id="XM_024473497.1"
                     /db_xref="GeneID:13388296"
     mRNA            complement(<1166163..>1168100)
                     /locus_tag="LDBPK_362950"
                     /old_locus_tag="LDBPK_363010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865362.1"
                     /db_xref="GeneID:13388296"
     CDS             complement(1166163..1168100)
                     /locus_tag="LDBPK_362950"
                     /old_locus_tag="LDBPK_363010"
                     /codon_start=1
                     /product="40S ribosomal protein S24e"
                     /protein_id="XP_024329266.1"
                     /db_xref="GeneID:13388296"
                     /db_xref="GOA:E9BU04"
                     /db_xref="UniProtKB/TrEMBL:E9BU04"
                     /translation="MRPSLIQCFPHPFTRQWPATSNPVTCECRQLYALVSVCCCVPNT
                     HLLVLHESAHLNTNLITSMPKGPKYVDFAITPRTTPEDLCGFLVRAEMAATGPPFAAS
                     AGSGGVVGASTSEEVSASHASPGESLHEGFAPTAAPTSASQTRNQWSPLSRSTVAQRH
                     AVVVCLHGIADASAAVQSALMDLLMFEQVRNHHRAVRVPTLRIVAFCSSRNYAILLPE
                     PLRALFTLSTYVSTLASDSAVVLQTATATSSSIVNKRFMLEVMTASDGQSLLETVTLS
                     GTVTRYLRHLLLVVRGSFAAGMSPGALALRRIPRWMTILKALAILFMPDEELLRSRVQ
                     QTRSTLLQSYSRVTSSTTFERTMNCATHRTATPVSRSMSPETQAAHQQPRGLQSVGSD
                     ERRQADHTTAATVEGSENSKSGGGDSAEIKSFSHVVVSPSDIACVLHCFVGHLMTMPR
                     EMVPSEEILSATSTMMGNAAGSGSLVEAYGRMLNAHRYGKAGLSLQDPAMWDAVAASW
                     TLRNLHGIANPTTESVNGLDSSLISNGTYQNYSTTLRSLESVEATGEADPGLRRSHGT
                     RYGGNPEQDALAASSHAPHEQYFQTLNNRPFFSVAEAWRWAATNKFGILDVASTPMLN
                     YWEVREAMRATLLCRSAPAPG"
     CDS             complement(1166163..1168100)
                     /locus_tag="LDBPK_362950"
                     /old_locus_tag="LDBPK_363010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865410.1"
                     /db_xref="GeneID:13388296"
                     /db_xref="GOA:E9BU04"
                     /db_xref="UniProtKB/TrEMBL:E9BU04"
                     /translation="MRPSLIQCFPHPFTRQWPATSNPVTCECRQLYALVSVCCCVPNT
                     HLLVLHESAHLNTNLITSMPKGPKYVDFAITPRTTPEDLCGFLVRAEMAATGPPFAAS
                     AGSGGVVGASTSEEVSASHASPGESLHEGFAPTAAPTSASQTRNQWSPLSRSTVAQRH
                     AVVVCLHGIADASAAVQSALMDLLMFEQVRNHHRAVRVPTLRIVAFCSSRNYAILLPE
                     PLRALFTLSTYVSTLASDSAVVLQTATATSSSIVNKRFMLEVMTASDGQSLLETVTLS
                     GTVTRYLRHLLLVVRGSFAAGMSPGALALRRIPRWMTILKALAILFMPDEELLRSRVQ
                     QTRSTLLQSYSRVTSSTTFERTMNCATHRTATPVSRSMSPETQAAHQQPRGLQSVGSD
                     ERRQADHTTAATVEGSENSKSGGGDSAEIKSFSHVVVSPSDIACVLHCFVGHLMTMPR
                     EMVPSEEILSATSTMMGNAAGSGSLVEAYGRMLNAHRYGKAGLSLQDPAMWDAVAASW
                     TLRNLHGIANPTTESVNGLDSSLISNGTYQNYSTTLRSLESVEATGEADPGLRRSHGT
                     RYGGNPEQDALAASSHAPHEQYFQTLNNRPFFSVAEAWRWAATNKFGILDVASTPMLN
                     YWEVREAMRATLLCRSAPAPG"
     gap             1169058..1169156
                     /estimated_length=99
     gap             1169644..1169742
                     /estimated_length=99
     gene            complement(<1170312..>1172087)
                     /locus_tag="LDBPK_362960"
                     /db_xref="GeneID:13388297"
     mRNA            complement(<1170312..>1172087)
                     /locus_tag="LDBPK_362960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865364.1"
                     /db_xref="GeneID:13388297"
     CDS             complement(1170312..1172087)
                     /locus_tag="LDBPK_362960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865412.1"
                     /db_xref="GeneID:13388297"
                     /db_xref="UniProtKB/TrEMBL:E9BU06"
                     /translation="MFFIYPTPQYPRRALEFVFKSLYMFANTMHLMSLVVLISDFYTR
                     LSNSMPSYYTNRDLVISDAILLVMENCTYNGSIQLGNVRGTVEVTAGNIGYGLMTTAQ
                     YVTGLFVLEFLLLVNNLLVAFNYTKGNRHLRIFGVHVPLYHITVMMTQVYSIAIIVLV
                     WAFDGNRQLFQRALQHCAEQMRKTSYEQLLKSEFDGYTIFSTAVYWPFAATCVAELIY
                     VSAVILLCYFSNDEGIILFSEADAPWESRGFLCNTSKPLLKLHTAQRKAIIEDARNAI
                     KEGQKVRIVRSYQLITEEAFEALVQAMREQVARALKEKQFEQLKRTFGDNESQLDNMG
                     FAWRENLMASHLDEVNGGVGNGLGNSFEAAPADQFFNVPFEDYFTDNGGAVGRSEVLC
                     SVDPLSIQEGGFGDDDGAYGDGNNGFMLDPADGGGETIDAWSPQEGANMMSTVGEIYD
                     PPQPQQHTQHASRTKHRSRRRRRRGDHKEEDEDYQVEPDPRDPLQQQQRGYGKSDIDG
                     EDAYTSPSNYFDANDDMVYVANDMGGSGGDYGSGADPRGRLDGTNGNYPLSTRESRQR
                     QQSRGRQAGLEQEDGVADELSDELG"
     gene            complement(<1172959..>1176222)
                     /locus_tag="LDBPK_362970"
                     /db_xref="GeneID:13388298"
     mRNA            complement(<1172959..>1176222)
                     /locus_tag="LDBPK_362970"
                     /product="pre-mRNA splicing factor ATP-dependent RNA
                     helicase, putative"
                     /transcript_id="XM_003865365.1"
                     /db_xref="GeneID:13388298"
     CDS             complement(1172959..1176222)
                     /locus_tag="LDBPK_362970"
                     /codon_start=1
                     /product="pre-mRNA splicing factor ATP-dependent RNA
                     helicase, putative"
                     /protein_id="XP_003865413.1"
                     /db_xref="GeneID:13388298"
                     /db_xref="GOA:E9BU07"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU07"
                     /translation="MNVVDDTVAALGDDDAIAEQQNMSFLMKLQELYCKTVLYEQLEQ
                     MMGHPATQEESDGYLDDVEGLVKLYCSEREAAKKMVPQGEEADAAAQREEVTEQHILH
                     SLSVAINGEAEADEQPDIPVSSIQQLYHVLHDCLTTDTVETGLAVGSLLLADDAKRSA
                     EEAARLAYQQQQRHMHGGVDTASMNTSTAERKNAMKVSPEEMFRLAQHVRSGLADEAE
                     LLKLRSEDNEEEGGGAQDVELNDEEPRFLRNMGFSSMLHRRINYRAPLPSQQLRDART
                     PQHRQAILDRLAQRQQGDSSKLNSMEAVAQMQEKINMERRVIARKAQRTQQQFREYDF
                     GATMGGRDDRSVLDEDRYGRRGGALESEEYSAQPTLLHSELNALPEEGGFRPQDMPTK
                     LAPWMKHSFGRKPRFGLPETMQTIQEQRISLPIYAKKEALLNFVDAHRVTVLVGETGS
                     GKTTQIPQYLAEHGYADRGMIACTQPRRVAAETLAMRVAEEYGCRLGEEVGYTVRFRD
                     VTSSLTKIKYMTDGMLLREALLDDSFQRYSVIILDEAHERSISTDLLFAIVRQALRKN
                     EVLKVMVTSATLETEKFCAYFGASEPFRIEGRTFPVETYYLTDPTTDYVRAALQTVMM
                     IHLQEPPGDVLVFFTGQEEIELGGEQLFRWMEMLRRQVSTPLPDLMVLPLTATMPQEV
                     QSKVFEPTPPGCRKVVLATNVAETSITIANLYYVVDSGFCKQNIFDAKHGIDQLKVMP
                     VSQAQAKQRSGRAGRIGSGKCYRMYTEKQFTTDMVPETVPDIMRTSLFHVTLQLKAMG
                     LDLLNLELMDCPPKGAIVSALEKLRYLEALDDDGLLTPLGSRMAQLSIDPSQSKTLLT
                     AVDLGCSEPVLTIVSMLAVQKRGVFYRPRDQQDASDAARRQFMQPEGDQLTLMAVYDA
                     WVENGMSEDWSKHNFLKHRMLVEARDTRDQLKEMLARRNQHISHENDTNLDEVRKSIT
                     AGYFFNAARRVDSHTRSYVTLSDRREVYVHPSSVLIDDPPKYVLYDDLRMTKREYMTE
                     LLAIEPKWLVELAPAFYARPKEGRLTKEQAAERFTPILKSWETGSSWRISRLKKQRR"
     gene            complement(<1177848..>1181285)
                     /locus_tag="LDBPK_362980"
                     /db_xref="GeneID:13388299"
     mRNA            complement(<1177848..>1181285)
                     /locus_tag="LDBPK_362980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865366.1"
                     /db_xref="GeneID:13388299"
     CDS             complement(1177848..1181285)
                     /locus_tag="LDBPK_362980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865414.1"
                     /db_xref="GeneID:13388299"
                     /db_xref="UniProtKB/TrEMBL:E9BU08"
                     /translation="MGSAPSVQEHLQKWETALGELEQLCSVNRRLMDQDRIYGSGAAL
                     NDIHRATDDEATSDRGGARRPSSLVSFSPTATAVTPEAGMGVSAGSFHRLNRSGTSTA
                     VTAPLPESRTGFGFTAYSGAPGTSTVTTLNFVQGGATALPGNAANDVTNRSAGSASVG
                     QQQSKHTRQQVLEIRKARMSLFRSYEAENPDALTDLMQCSHFGAAAVALSYLLGGDAN
                     CKDRRRRVTLEDIFFATQSPLHMLHSGSPHLPIMTGIIREFLDVDNRFKGDYSLEAVH
                     LDVSPTMGQVELGPNEVGDRQTRMQLPEFQRLITQDCEEETQAIRIVNYDPYVLEQAM
                     LVDAFEDEDELNSPLATSVLGPNPHHMERQYSPRNEGAYAAVVDVRNAVQLMVTIAEG
                     VVNDSLHVKLKEVPVASLFKAMMTAKEGHRARGFIRVFKKELNPEFTTDEIKTFWTPE
                     LRSGKVLGTTQLGTNAVAISHHISPHIVGVAWAMHLLAGVRPGTHGYGNGLPVSDIIR
                     TMKLPAEVFVDGVLPLEQVYEYAAGYVQRSKRDVDVHLYPVLTKIFREDAVPTISVFD
                     LESILINVKDANADPECPEHVMVIMYNACVAHNVLYIVEEPQWCVLAGYDQEMQTAVL
                     IDAHPKTFSHTWSCPLDRLHKAMTGNGYLIFSKRSTNPVSRRVGAPATMAPTVESRLE
                     LVERQHELSSSWEGKTAFAVPKAFTFPSLPVMPTMVAMTCTRLGVPTTFDDVVQRLPF
                     EISALVIRNLTLEIMHVCLTQYLRVVGLQDEVQVKAYHGESNADGFLTLQLPQLEELI
                     QTSLDGNHVLLLHFDASRLLVNGASHPFGALGIVVGYDAGLGSVRVADANPNSFLREW
                     SAPLLEVFESVLDSDVTRKHRTRGVLLVSRAAVAEGAAGPVFAPPCSRPFRLELLPVL
                     NVFLVSPSPHFQGMSFAFSQLGYYYSPEEIFYEAYLKTMDDQRRRGSQAFAWRDVEVS
                     LSIINKKIDASFMAEGCRKFLESRNGHQSGTQETISVQVLEDIDVDEELDELLEKSTR
                     SSDTVLLLNYDVLRTHQLSNLGRSVATVKSYNKEKQLVELWDAEYAVFGLSFVVTKQQ
                     LIEMGDLENVGSSPYGFVQFKRVAAGAAPKKLGLMSAPSTLEEEAELEAAAAAAGVK"
     gene            complement(<1182163..>1182441)
                     /locus_tag="LDBPK_362990"
                     /db_xref="GeneID:13388300"
     mRNA            complement(<1182163..>1182441)
                     /locus_tag="LDBPK_362990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865367.1"
                     /db_xref="GeneID:13388300"
     CDS             complement(1182163..1182441)
                     /locus_tag="LDBPK_362990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865415.1"
                     /db_xref="GeneID:13388300"
                     /db_xref="UniProtKB/TrEMBL:E9BU09"
                     /translation="MSTVAELQAQLDALRARNAQEVEAAQATLAKLQQDLNYMQEDTE
                     ALEREEEELCKQFGKSRGTDTALSASQHTDIIAQGLCALVECDDSKCC"
     gene            complement(<1185690..>1186472)
                     /locus_tag="LDBPK_363000"
                     /db_xref="GeneID:13388301"
     mRNA            complement(<1185690..>1186472)
                     /locus_tag="LDBPK_363000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865368.1"
                     /db_xref="GeneID:13388301"
     CDS             complement(1185690..1186472)
                     /locus_tag="LDBPK_363000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865416.1"
                     /db_xref="GeneID:13388301"
                     /db_xref="UniProtKB/TrEMBL:E9BU10"
                     /translation="MFRMPAVKKPLSSHRPSEARKSIEDPAPSPYVPATPASVKSVTF
                     DWTQACPIYTIKGNSVWHKGGGELPYRPVIGDLAMRPNTGKYFFSYRINTDNSRVGFC
                     TSCVYVSDEDLQNIEFGKAVAMDSETSESLLDQNPAQPSFLQAIGAVPTLPSKRWEAY
                     MDLQTSKVFVNGVEKHSFWRLFVPISGGVASFVVDTDAGAVQMFMDRKYVGMMLDEQS
                     GLKGNTVYPCVGISGCDMANRSIQSGCMGAFVEPAHAFDCLY"
     gene            complement(<1187936..>1188349)
                     /locus_tag="LDBPK_363020"
                     /db_xref="GeneID:13388302"
     mRNA            complement(<1187936..>1188349)
                     /locus_tag="LDBPK_363020"
                     /product="40S ribosomal protein S24e"
                     /transcript_id="XM_003865369.1"
                     /db_xref="GeneID:13388302"
     CDS             complement(1187936..1188349)
                     /locus_tag="LDBPK_363020"
                     /codon_start=1
                     /product="40S ribosomal protein S24e"
                     /protein_id="XP_003865417.1"
                     /db_xref="GeneID:13388302"
                     /db_xref="GOA:E9BU11"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:E9BU11"
                     /translation="MVFQKKKAEVCIRTSQFKVNKLLNRKQFIVEVNHPHWCGTVPTQ
                     LIRKKLATLYKVPDASQVSLFGFKTKFGGGKTTGFGLIYDDLASLKRFEPNYRKTRMG
                     FGKARLPARKSVKERRNRNKKLRGKAKGKQVAKKK"
     gap             1188473..1189625
                     /estimated_length=1153
     gene            complement(<1190464..>1195617)
                     /locus_tag="LDBPK_363030"
                     /db_xref="GeneID:13388304"
     mRNA            complement(<1190464..>1195617)
                     /locus_tag="LDBPK_363030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865370.1"
                     /db_xref="GeneID:13388304"
     CDS             complement(1190464..1195617)
                     /locus_tag="LDBPK_363030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865418.1"
                     /db_xref="GeneID:13388304"
                     /db_xref="UniProtKB/TrEMBL:E9BU12"
                     /translation="MTEVSARKERREQRQRALGVDCVDRLTWKEWEPGKEYKRKILVK
                     NIDRASQTIQLSLPVNRKTFITPFPEPITLSSGVSHEIVISFRPTELVELHDAVTVTV
                     EGRGSFQVRLDCLTPYAKLTLPPSHDFGYCAVGSTAHAQVQLRNSGTAPVEFSWEVSA
                     PFCILPSHAVLDEGEIMHITLLFTPTEGCTMVAQAVCRLTGAEDVIAALKISGIGKYP
                     YICFQEPSAEERTLVVQMEAQQNSGSSSGKLIHVCNPSPVPVSVRIRRVDESLMCAFR
                     FVVEGKVAAEQDDPNGEGAFLVPRGAVQPVRIHYTPGSPGVIDFNTFQFDCAHGNSLQ
                     VELSGTTLGPRVTASISSLDYEAVDLEHMPAEKQRTRHLTLRNASATDAPFTWMNTLP
                     GAAFTVVPHSGVVGAQSSLQVAITFRPTHPILYYRRLYLLIEGAKDVVGVDVLGGAYT
                     SDLRPPTLALVDVEAARLRMERGLGLLTPEQLATVAAAATAAKDELMGSRHEKGQRGG
                     RRSSVPAATLEIWRRIEEDVRSPDVVMCGAKRKVRVPLSNLETADGSVSIDTPFGVDA
                     KPLYTFGGGGKSCSDLRGHLVTVMNASNATAVATWSLPALQACPYAVVPTQQVVPPNG
                     SAVFQLQCSSTVSNDLPAACTLECYVNYESMSAFYLAPDACVVPPQCFTVTCTSASIS
                     VFTSAKQKSQQQQQSTSSHISYARQVCLPACRVGGSSYQVIAFQNKAATPVRYEVTGV
                     MLKQVSAVVVPPNMKPVAPEKETSTAAVEARAAQQEAGEVGEAVFSVYPTAGVVPALG
                     RQLLVVKFSPRDTAQYAASARILWDANLMQSTASPAASAALLAAADITHLNLFGEVCL
                     PQLQWRQVGEDVTVPLSMITLPPSCVSGESQQRAWVRNPTGLPVEFRFDTSAELLGVL
                     RMEPEQGVVPGGARLPVTLFFSPQQPRVFDGFLQLYVQGGAEEAAAPGAAQLRYCQQL
                     RVLGEGAYGDVEVEPRIMDIGDAADTREQQAALTLYNSGYCDVQYDVRAMLVHAGKSG
                     AGAAVVPRLHNSRGVLPARTHTTVLVAAQPAPGLTEFLVYAIVSGLSTDVANVPNAST
                     AEEAERHPHCRWRLRAAHPAVQVVDVDLPGVARPLAWQQLSLNAINAQLATASAEPED
                     SINSAHASFQHYVSGLDPISMDLGVAHEGDSTVCVKVCLKNTGDCPAPFDVMLPTQHE
                     ANREHWCLENAELESLYYIIDRGLVTVAPQQGSIDVGQTVQLEVRYVHSEVGVHRLPM
                     VLRVGRGGRRVAVVLEGRTLPAEVRALNFHHQKVYELMPVALGDMEPPLQFITATNPF
                     DEPVEYSVDLKALQEHTREHYGFPVFQCVDPRGTVSPRGTVHIGFYFRPLEAREYRVS
                     VLLQTVQGEGYYVDLVGSGYHPRKVAATSVIQWIGHALMQVPAVPPTLAARAHTAFLS
                     DDVCKLGAVPYFTLCRRTCTLQLAADCPTAMRYTWHVDRPQRGDAQAVVRPSEGVVKP
                     GKEQTFKIVFYAGSTSQVLERLMTCAVVPCAAASNGEERQHSDSGSRPGRRIRAPPLP
                     RPNSSNDGGRSAASLSLLLQARVMPQDDYEALYGSEKLNTAFAPPLYNSHADPVSPTL
                     LPVASQTTTSPATTAEVCFVKGVMDELIRSLVAAPAVQSSFTALCAPRHVTYANMRVL
                     HAAKATNAKALSTAAAAALSRGNASSAVATEEVLEELLCSALAEAVAVV"
     gene            complement(<1197056..>1199107)
                     /locus_tag="LDBPK_363040"
                     /db_xref="GeneID:13388305"
     mRNA            complement(<1197056..>1199107)
                     /locus_tag="LDBPK_363040"
                     /product="ATP-binding cassette protein subfamily G, member
                     6, putative"
                     /transcript_id="XM_003865371.1"
                     /db_xref="GeneID:13388305"
     CDS             complement(1197056..1199107)
                     /locus_tag="LDBPK_363040"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily G, member
                     6, putative"
                     /protein_id="XP_003865419.1"
                     /db_xref="GeneID:13388305"
                     /db_xref="GOA:E9BU13"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU13"
                     /translation="MSSPAPPTDRADAGLLHHLSHSPPESPESSPPPPASSHRTAVLT
                     WEDVSYTVSGADEGESRTLVRHVSGYVKSGEMLAVLGPSGAGKTTLLDILAQRKMKSK
                     GDITGRIMLNGEPVEPAAFRLCSGYVQQEDIMHSYVTVEEVVRFSATLRTSPTISEEA
                     LESRVSQVLRQLGIYHVRHSCIGSALMRGISGGERKRCAVAAEMVTLPSLLFLDEPTT
                     GLDTFTALHLLTLLRSLSRSGVAVVFSIHQPRSRIYEVFDRVLLLNGVGEEAYFGPAA
                     DAVRFLAEIGLSSGCSSNPADYLIDAVSVLPVEEEAWLSEEAQQSAAVEAATYGNQLS
                     LPSPSVDSKERWERLPSAAPTQGRDIAAAFSSLRLADVMRQIDELQRSSRAATAALTA
                     TGSPVRAYHRRWTTQVRCIAMRCLRNRCRDPVATYVSVTSAIVFAFLTGTIYYQVGNS
                     QDSIRSRMGVLFFIMMISTFSSLGSLEMFLTDRAIYAREHRNGMYSTSAYYIGKFIQD
                     APIVVATNFVFNLIVYLLVGLQGTVAKFLIFDSVGALVTLNSYALCLLMSNLSKDYAT
                     GNILTSLLLVLYLLPTGGMLVSLNSIPLMWRWIKHVSFARFAFSVMVANEFDGLTFVC
                     DSVPSDIAPCITSGTAYAASQGMYAKDIRSHMLVVAFSMVVYLVLGYLVLRGWRSTEG
                     K"
     gene            complement(<1200329..>1203043)
                     /locus_tag="LDBPK_363050"
                     /db_xref="GeneID:13388306"
     mRNA            complement(<1200329..>1203043)
                     /locus_tag="LDBPK_363050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865372.1"
                     /db_xref="GeneID:13388306"
     CDS             complement(1200329..1203043)
                     /locus_tag="LDBPK_363050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865420.1"
                     /db_xref="GeneID:13388306"
                     /db_xref="GOA:E9BU14"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU14"
                     /translation="MYPFHYFLYPILPWRSTALSRIYRHKLAFRYGRRSKHAEDTIET
                     ASSMCTPTCAASECVAASIRWLDYASATLNPDRLPEHAVHLGELLALLRSAQSPPSTL
                     QDEWSAQVWAMAGEPYLVYLLRCLAHQSGLTQLSPHFVVPTTEIGNDDGVAVAAVTAG
                     NSANHPSRLFWERCVVVGVRVEPTTKNLLQTGWETQPCPHCVVREGAAADAHDGPSRR
                     QRLCVLPLLYGGTQCGECGHALPLVPTWTRALYLVLQRRDRSRAAAVAYGEEVHRHLW
                     LGVAIDALLYTSATEKQQQLLVVHAAAAPARAAPSATLSCAETTKGALHIFCQDEHVS
                     RLALKWGDGTAFYAAANLHDVARRVAPQLQGQAHIKELLLLVVLYIVYHASHPEAAGS
                     HRHPLHVLLVGPAKTGKSALLREVAQLIGLEAEVLEATVVRTGGSGGAAGGSSFSAAL
                     PMRRSAVLMAGSGMTASTLVLDQLPSTAAGAAAMAPLLEAMERGHGCGAAGGEGEGAA
                     AGGPDVHQLPSTIIAAAGEESAAAVQLAPYFSLIAAVAPTNSLDDTAIISQDVVAASR
                     ARSSHSRATSRSMSRATQLSASSPHHSQSGPSVSQSTSRRIDPSALSERLTHDDVRYF
                     VRRAAEPALLSSVVSHAACYDAFIGKLVDCAGLLEEAQPSVCHALPPPSACRGQHRIG
                     HPSAASDSLRAAPLAIDEHLRILCALSRARVLLERAELLRDAGWTAQMRDEVWALYHG
                     HLVAFADLIQRRSCGSGAMASRDPAEVLRMTSWQSSFFDACGGSTAAPAPAGYPPPSR
                     FSGDAAALGREWKGGMCAMSSREGRGLWHPQKTPSKKRCRLMFVDALRQRQRLSAPVE
                     GAVPPSEVEHLFGLLGGSSAFGDPLDVVISQMQEEGLLLRRPGGWRSL"
     gene            complement(<1204466..>1205506)
                     /locus_tag="LDBPK_363060"
                     /db_xref="GeneID:13388307"
     mRNA            complement(<1204466..>1205506)
                     /locus_tag="LDBPK_363060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865373.1"
                     /db_xref="GeneID:13388307"
     CDS             complement(1204466..1205506)
                     /locus_tag="LDBPK_363060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865421.1"
                     /db_xref="GeneID:13388307"
                     /db_xref="UniProtKB/TrEMBL:E9BU15"
                     /translation="MLSSAHSAAFARPTAALWTSARSFGAGPTRLLLGLEQVQDVPTS
                     TDRKPTGMHRGPGKRQTAPKEAAQYQFIKKWDLQMREAWDELEPFKGLPKPKAQFGNE
                     AAEVIWPYALLLENVIKVHPYTKSIYVYYSQRQSTPLGELAARVAKRVSQAYLIPITF
                     HNSHVYVEAEMLLEYSETPWIVVHCLDGTHKLIPVKPQAGQTVKEGAEEVLNGIVSAC
                     NEIGNAVKNPKEVMRLLSERPLQNQYVRVNYQWYGDTPEERMSHLVKWDYEPEEVVPQ
                     LRNRTQHVLDWMNYDGNLPTHNSVRVNIRREAARMRKPNVSAGPKTFFNSSGSRANAR
                     TARFNNSRSSQS"
     gene            complement(<1206461..>1206802)
                     /locus_tag="LDBPK_363070"
                     /db_xref="GeneID:13388308"
     mRNA            complement(<1206461..>1206802)
                     /locus_tag="LDBPK_363070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865374.1"
                     /db_xref="GeneID:13388308"
     CDS             complement(1206461..1206802)
                     /locus_tag="LDBPK_363070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865422.1"
                     /db_xref="GeneID:13388308"
                     /db_xref="InterPro:IPR005345"
                     /db_xref="UniProtKB/TrEMBL:E9BU16"
                     /translation="MLRHSKDLQMCRKTAGTALGYVCRLHEGRCVICDLQFSEIVDTM
                     REVHLCEDCSVLAAEGEEACIMCGSRRVTDVAYYCSYCVALEKDRDGCPRVLNQTRQQ
                     RLAALRAAVSQ"
     gene            complement(<1208224..>1209870)
                     /locus_tag="LDBPK_363080"
                     /db_xref="GeneID:13388309"
     mRNA            complement(<1208224..>1209870)
                     /locus_tag="LDBPK_363080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865375.1"
                     /db_xref="GeneID:13388309"
     CDS             complement(1208224..1209870)
                     /locus_tag="LDBPK_363080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865423.1"
                     /db_xref="GeneID:13388309"
                     /db_xref="GOA:E9BU17"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BU17"
                     /translation="MYATVPILTLGPYSLALVAGLLLYWNTSLIVSRVLTAFIVSMIA
                     MKVDLAFHLFFSCCHRVVSLLCRFRTFWSPNGSLDFLQTQSQFYSIADVVSLALLVGN
                     ALQFWTAALVTRIALSALATRTELSIRWWQSQSAAEHVLFVLGSLLCCTGCALQWAYY
                     TLLPTEERTQGGTGSLLMWYTSIVYIVEVGLRSACTLATSVMRMWGYRVLKSLASQVD
                     LIAVRALEDSGLNPFTEVHDLYMQYLYAVACAATAWYYTSSSTPMWMQCFMLVRLYFI
                     TLASGKLHHYRQVLDRFPSVAADPTKTCGICLDDFVDGESVKCLPCGHTFHGACVRSW
                     LIRAAVCPTCRQPAAQSRHQHFAAAHHERISRQPRVSLDMRVPAAGGGFTGSLQPLAP
                     RLPAAAPLARSSSRYMSRSGADALSQSPSLPVELRRLPHYEELQRVDAKRRSLALHRQ
                     QQLFSEGTRAAASPQERHKEETVGRVRESAAIDALLFTETPLLPAESTPLPPYHGTSG
                     RRKRQRPPPESTPGSGTSARNTASSGVAATEDLPSRRRME"
     gene            complement(<1210892..>1223431)
                     /locus_tag="LDBPK_363090"
                     /db_xref="GeneID:13388310"
     mRNA            complement(<1210892..>1223431)
                     /locus_tag="LDBPK_363090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865376.1"
                     /db_xref="GeneID:13388310"
     CDS             complement(1210892..1223431)
                     /locus_tag="LDBPK_363090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865424.1"
                     /db_xref="GeneID:13388310"
                     /db_xref="GOA:E9BU18"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012582"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:E9BU18"
                     /translation="MDEVINVISKCITQLNLFVDGPAAHLSGTAAPTTIETIRKCIAD
                     HAYLFTDHRINGQRMWELVCSATFTVGEPRTPTTAATATATLLSLFRRLTDSVAASAR
                     APEADILKHLVKLLRDAVKPPLVRGASPGQLRCLFQAAMRLLKLLLPLKKRADVQTEC
                     LHLLLALMQLSDLQEAHCAVVASGDEVAQVAKLCADICGAKHDVALRPQNASMQLLGC
                     LCEQPAYVHALSGQLAERILKCFLDVARNLAQRAEVNQTLGEGLLRGLAGVLGSFPLR
                     CEEDAPALTLINNIVLSALMLGETSTNYTFCLSALFLLRRRASDTLAPFTLLCAAEYS
                     VALRSLWMHRNKDVRRETHAAAAVFWSALSSQLQQRCSSEVADANTTRNTAASHKLHS
                     IVEFLLRSLDSSADREASYALEALYHLLPAVAALSGPQALQTMSTRLEERVGGLLITA
                     SAQRTEALFQQVPYLLATLGQLLTLLPSVSPRQQAVVRELLDWVLLLYPHPKFYNREK
                     TVPGIVLVIRALTHHPRAPHNTLPRLLSERTLELVGEAPGAAMMRLAGERISTEERLD
                     RMATLWTRLLTTREESGAEAEAESKQRLSAAFYRACTGFCERARLEVVIVKSNSEATL
                     ERILVDGVDGVQPSFPTHYSAFLSFVDFFVRLSEGLKGSGCVCRPPAEELTAWLEALV
                     RGASAALHVSGFYTLLHHTVVGVEGVCPHSLTHQRPYTDAPLASGNSDVTSDGHHENH
                     LCVSPLLHHFLSTECLRRVHVYSDELLYQCAMCVVVGAALVGSEDRGELAGSRARACD
                     DHRRLDAYVRAFKVVMTATPTSLQAESVAGSTNEVVCSFGSSPAILESNRQHALRVLE
                     KKACRSPRWAAAVLPALTSALRSAEVVAAVRAPVQMLAARHGVAIAAELQHHSNEATF
                     ALLCRGEPASNGRRDSMPRWLATMQPVTVPLVPVDSALHIGYLVPLVSRLSLHGKHPA
                     VRTAAAEVLYWCVVWAIGKKVNDWGSAVFPPLLSLASLARTSTGGSGGGGGSMVHQEL
                     HGLLMQAARWFGRSAGTPEEAELFVSVLLRGLGEREGMQRQVATEALFAYAIPPADEP
                     QTVTPHFRAVIGRLVRMECGVSEWSRLGAAHCLHVMMRRLCKVRVPGLVCTVQAVAQG
                     AVGCLRRCTEAPIWGVMETATCNEVQESLRWLGAYCHDIRQLENEEEQREADRFAADL
                     VHAARAVLPALARRHTVCAITLLQTLPAVTHTNASARQVLLLSQELICEQQQRLGPAA
                     VRSLDSTVGGCATLVALLQSGYGTETNKRAIAEAVTPVICTRADDCCVETELLRLLTV
                     VLQAIVEEARVATHESRCISPHIVRWLLELVDVVPEQTHATHFSLLLTPTVIAQAARV
                     MVAGAKVTVENCAGDVGEDATAGVPLRRCAPSSQLAPTARWCLELIELLMRVAGQRRR
                     GAQVIEDVLCAIRETSVFTVFTAASPARQLIDALSVGPSALVTGPVALAAALCQMEAP
                     CSSGTTTLWMRIADSMKISPKTVVAMLLGLLRNSAALNATGGEEVCEGLLVLMLSEPD
                     PALLRQHLRDLLASDAVQHNIFTSSSFAVNLEDGHGAVAVSPSSRSTSVLLSRAFDSV
                     MNRCWQQASAALPTDRLVSALPSLTTVAMSEDALRSSSEAVSLFSLVGDWLAELQRRS
                     LTSEHDKVLCRVCANLVAAEREMRQSTPTAAQDDGRGGARLAALLMLVQLIGPAIRTD
                     TTLSSALCDLVLFVSKPANMCSLLASVDATEHVVWGFHVLAATMTPRPARRSLAVFPV
                     DLRAVEMAFDFLNEVLNSALPLRWTELKTPREKTNVADVVRSGTALFAAVLPHKVQVL
                     EVIAPLLAQESMPQRDTIVRQVHGALQALSVCQQALQLDACRCASRLLRDPRTHPGIC
                     DALTEHVLLPLLQASAEAVRLRLFEEEVRNWVTEAGRAPALGCFYMQTAAFSCLALMH
                     RLCPLTELRGSISTAFTGRNPNTTGVELTLEVLKACRAAWQSPNTGGDDNSAEEADGD
                     VGDSARADAPRRYRQAAFRCLLATLSQTQQTEKVFCRCFFQERSVAGWNGLFLVKRPG
                     VAVTDLLDAVGEVQLWRDMDRCQVPELFAHLLRHFPSSSVTPGEPPEWVRHVVAVLRQ
                     PQLRLPVRMVFYEMICRHERFFGTFARCIFDGVADAVAAMAPSERAGKVIWELLALLT
                     RWHREGSSRALAVGSAASLKALARYAAVHLAWEHSFTACEGSRALDPTSHKRLAELLE
                     QFRRAQGAALASLSTSQPLTAAEMKMLLSHPAYERHAALEVIYLITNACGCLGCTGDS
                     REVVEVYDLLGAFLGASASPQLYHITARLVGLEHRLLSEAATREPSSAVRKLLRDALR
                     GTVCAILAVCKSDKKFLEVLEAMQEDRSGDLVYQLLSRTDLLRRYSIRKDSEKLLTLR
                     VLARAGTYVADNYDSIHVCLSGLLRGGQGEPLLGICTVVKNALPHMSMESVRHVLRDL
                     CCLDVLQAMESAEPARIAFYKMGLAALRRWTVVREDQEKQDGGGSVSADAEAFLVRRG
                     LRDASPAVQGAVLEYLDVHAQHVPDTMWGRLTCLFTAEDGASGDGHSGSGGWVRHVAL
                     LLLSLSKRSRDFANPTYFCPEALHSEGASPTLATSADTAAESSVAQRQPRSAPLFSEA
                     VQCGSPAEAATANAACPITAALAQIYAPPALVPQPPHQQQQPLSGARRPRATGAWRLG
                     AAPCAAATAVTRSWLRLESGDSEQENAVISAGVMASRQISATMQRNAAHGAALQAGRS
                     VMNAPSAAPSLESNTAGRLSEVRLTLQSLLVPLQVLCLHEDEVAARVLIDLISNAAVA
                     SPVTSESPHIVSLCSALTSLLPKFQSGVTTRQCELAKNPFTLFVALELLLHAQAAGWS
                     SLASLDCAALVRLTSDVQAYGGSVPTAFLPVVDGTAHVVEKLLSSLQPSAARGVPTRP
                     SLEFPALGWHAYHVAQRLRRHDDAACQAALQLFRATRRHEAPVIQLQGALDAMEVGGA
                     AYSMRVIAKLLEDEEKEAAAAVATVASPATHVSGGAFALFAAREEVLRHYRSRASRLL
                     LDWCGAASALQSATPVGAGGSGEVSVEGVRLRLRAQLQLMCDGAASAVTAEASTASRH
                     RTGFEWGACLMANGRWLDCQLHAETSVDHLLGSTASHYDSGGSSLVCGYLAANSLSQL
                     ADAAQVLRFVSTSAASSAGVALQTYLDTMPASVPLSGAYGSLFIDDVLLIRRLIIDYH
                     VQSTGDLLGSLQFTDNERHKLVAQIHELLGTWTVQQCSELLLLPEKTSAIETIASKAD
                     HATLSEPTRCALELLKKRSSLFRIAVTPREASGASREEALAAFQKATGKDVQQRAAAG
                     LLSPAAARQWAADVAQCEVEIFASIGSILSIPAGSAASVQKREIWVSTLKENLRDTIP
                     SHVALLNALEKLLPPVSRGDGTLADMGGDAKDAARASYITAATQSLWQLYANTFLWCA
                     QAVGDRSMQVGSGGHLPVSARVPRLLSLFALPRVAEAAAQAQWRGTWEALVMLPTLVW
                     LPWATLLVNALLQTEHAVLARILLRLCRERGQVLYYPINCAWRSLADLGKRRNAGRAV
                     DDDLTRELAELHKWHRSHRMALVAEFAAALDELVEPQHRLEVRLSEVESLVKQHEQCT
                     RGGGGAQAEYLMAALQLYERCKSDLMDPARWGRAQLYHRRAAQVLQELDRRNAFSAEV
                     LKSGEQFRSAKREALRQVAQTLSTLSTSASNSATRSQELRLYSERLQHALGRSATAAT
                     TTTTQLGYTSDAAEPILQPVQPTHLLHTPPDAAQQCCTLVGVADRVLVLKSKRLPKKV
                     DIYTSAGICTYMVKGGEDLRLDQRIQEVFTFANLCLLVSPRSRLSALTIRTYAVVPVS
                     PLVGLICWVPRTTPLQELMKEATPPDAHDAVARFCRARGKPQEILPLYKTAHITGIPE
                     QEYKDLVYCLRQSALVESLQSIATDHCSWLGARDAFLDTNAAASMASFVLGVGDRHAG
                     NLLVDLLNCELVAIGFGLAFGDATRKLPVLELMPFRHTPQLQRVQGVLGDDVTRCRMR
                     HVLHVLRAERQVVEGMVAALLMPDADAMGDEESRIAGHQLDVVRRKLNLEHPAGIILR
                     DVARNAYVTQDKDVWIGVKACLCERKRDENGEDADLTETALSTLHQEDVFVQRLLRIA
                     SDPRVLGRAYAGWQAYM"
     gene            complement(<1226981..>1228222)
                     /locus_tag="LDBPK_363100"
                     /db_xref="GeneID:13388311"
     mRNA            complement(<1226981..>1228222)
                     /locus_tag="LDBPK_363100"
                     /product="succinyl-CoA ligase [GDP-forming] beta-chain,
                     putative"
                     /transcript_id="XM_003865377.1"
                     /db_xref="GeneID:13388311"
     CDS             complement(1226981..1228222)
                     /locus_tag="LDBPK_363100"
                     /codon_start=1
                     /product="succinyl-CoA ligase [GDP-forming] beta-chain,
                     putative"
                     /protein_id="XP_003865425.1"
                     /db_xref="GeneID:13388311"
                     /db_xref="GOA:E9BU19"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:E9BU19"
                     /translation="MFRFGRLCTPKAAGVQRRFLNIHEYQSKQIIKDNGGRVEFGIAC
                     KTIEEVEAACAKIKTEKKVVKSQILAGGRGKGVFKDGFQGGVHVCDSAAAAVEAAKHM
                     LGNTLVTKQTGPKGQLVNTLYVTEAVAGIKRELYLSLILDRKSASPMFIGSAEGGMSI
                     EELAKTHPEKIKTMKVNVAEGVDHDAAVAYAKELGFAGETAERAAEQIKALYNIGKSK
                     DCTMVEINPFVELENGDVMEIDAKLSFDDNAAFRQRGIFALEDQTQIDSKEVLAKKHD
                     LNYIALDGNVGCLVNGAGLAMATMDTISLHGGSAANFLDAGGSASEAQIVAAFKIITG
                     DSNVKSILVNIFGGIMHCDVIAQGVVNASKALNTTIPIVVRLCGTNEQRGKEIIRNSG
                     LVIHPVEDFDSAARKAVELAK"
     gene            complement(<1228968..>1229366)
                     /locus_tag="LDBPK_363110"
                     /db_xref="GeneID:13388312"
     mRNA            complement(<1228968..>1229366)
                     /locus_tag="LDBPK_363110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865378.1"
                     /db_xref="GeneID:13388312"
     CDS             complement(1228968..1229366)
                     /locus_tag="LDBPK_363110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865426.1"
                     /db_xref="GeneID:13388312"
                     /db_xref="UniProtKB/TrEMBL:E9BU20"
                     /translation="MFVIQWYTAALILADVYELLQLRQANPKGLEHGTWWFDSKANAP
                     LAAALYGGLLVFLMLSRLFVLLEPLNRWLLMLNTIHEGIRLVLYSLLFTQHSGATQLN
                     TILLTFTLWNTLLYGRQYYIIMCMLREHSK"
     gene            complement(<1230174..>1230689)
                     /locus_tag="LDBPK_363120"
                     /db_xref="GeneID:13388313"
     mRNA            complement(<1230174..>1230689)
                     /locus_tag="LDBPK_363120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865379.1"
                     /db_xref="GeneID:13388313"
     CDS             complement(1230174..1230689)
                     /locus_tag="LDBPK_363120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865427.1"
                     /db_xref="GeneID:13388313"
                     /db_xref="UniProtKB/TrEMBL:E9BU21"
                     /translation="MWGLSITRVFQVYCAGAALFEVPGIVRLLSGDMPLPKAGAWVDD
                     KNYYTDNKPLVYVFVAILACLVVSRGMACALPKSRIIIVYLVVVHTFEAGLYLYCCSH
                     KEDAPDSEVCIMGMLMVVNISLFAARLVQLKVQHTRVEIADLKRRQEQLAIIRKKRAD
                     YAKNREEKKNK"
     gene            complement(<1234687..>1235397)
                     /locus_tag="LDBPK_363130"
                     /db_xref="GeneID:13388314"
     mRNA            complement(<1234687..>1235397)
                     /locus_tag="LDBPK_363130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865380.1"
                     /db_xref="GeneID:13388314"
     CDS             complement(1234687..1235397)
                     /locus_tag="LDBPK_363130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865428.1"
                     /db_xref="GeneID:13388314"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:E9BU22"
                     /translation="MDVSKRPREEFHKEQCLSFVKKLWAADTLAMFHYPVSATEVPGY
                     YDVVDTPMDLSTIRKNIEQGKYRTDTEVENDVVLMLSNALDFNEKGSQWHDLAKQLKK
                     RYLTLAQESGLSFDADQAFIPTKKVRDDESTLRKAEKKGGEKLEDVLQAMEKDKEIPL
                     EQLRAMYARRRTRGKADQQSSDYSSGRGSDDSDEEVSSDEEDTSDSGSGSGSYDTEEE
                     DEDSLDSESVSKDDDDDE"
     gene            complement(<1236224..>1237687)
                     /locus_tag="LDBPK_363140"
                     /db_xref="GeneID:13388315"
     mRNA            complement(<1236224..>1237687)
                     /locus_tag="LDBPK_363140"
                     /product="GTP-binding protein, putative"
                     /transcript_id="XM_003865381.1"
                     /db_xref="GeneID:13388315"
     CDS             complement(1236224..1237687)
                     /locus_tag="LDBPK_363140"
                     /codon_start=1
                     /product="GTP-binding protein, putative"
                     /protein_id="XP_003865429.1"
                     /db_xref="GeneID:13388315"
                     /db_xref="GOA:E9BU23"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU23"
                     /translation="MLRRRWGAHRAKHRFVDRVKVLLCSGAGGDGASIMAHEHGNEFA
                     GPGGGNGGNGGNVMLQCVKQHTDLSHIEDLGSQISAGAGFCGFSREAHGKRGQDLWLQ
                     LPLGTQVVDMDTNEVQYDMDEEGMQIVLLEGGQGGKGNAAFANKWHHSPIESTKGLPG
                     NTMLAQIELKTIADCGLIGYPNAGKSSLLSAISASKPTIAPYAFTTLRPYVGVLHDLY
                     GNVCRVADIPGLIEGAYENRGLGHQFLRHVERTKCLALVVDMCDTYVPDTGSRNSSEV
                     LQPWDVVELLLQELEYYLPGMSQRVIMTFANKMDIEKDSTGTDTQVKLSELKRRVSMP
                     VFPISAALGIHLGPQHEQTGLAPALQFMCREVFARQSHEREMQQFRFSHERAQLERAF
                     RAKHNGVFLPQVHALGAHGAEASQDLDDEAASRGGSLVDQQLDFLGNSGLGVEFDAYE
                     NSAARGQLHRYRDLTMKGKYWNLTRQDGEVMKGEKWS"
     gene            complement(<1238524..>1241388)
                     /locus_tag="LDBPK_363150"
                     /db_xref="GeneID:13388316"
     mRNA            complement(<1238524..>1241388)
                     /locus_tag="LDBPK_363150"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003865382.1"
                     /db_xref="GeneID:13388316"
     CDS             complement(1238524..1241388)
                     /locus_tag="LDBPK_363150"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003865430.1"
                     /db_xref="GeneID:13388316"
                     /db_xref="GOA:E9BU24"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU24"
                     /translation="MSDRREDEPVAKRTRREVDPAITFPYELDTFQKTSIDALEEGDS
                     VLVSAHTSAGKTTVALYAIAKALREKKRIIYTSPIKALSNQKFREFSEKFDSVGLMTG
                     DTTIKADADCLVMTTEILRSMLYRGTEMLREVGCVVFDEVHYMRDKSRGVVWEETISL
                     LPEGCQYVFLSATIPNAREFADWVENIHPTTKVHVIHTEYRPVPLQHYLYPAGADGIF
                     LIVDEKGKFRDDNFGKAIASMGAEGGANGVGAAGPGNGSSKDPRGNHKGSGGRSHGGF
                     SQSMMEIVKLVMDRNMYPVIVFSFAKAECERNALALSRLNFNNTEEDALVMEVFNNAM
                     ESLAEEDRKLPAIEHLQPLLKRGVGIHHSGLLPILKEVVEILFQAGLVKVLFSTETFS
                     MGLNMPARTVVFTSVKKFDGEKNRYLTGGEYIQMSGRAGRRGLDRVGVVITMVDEAVE
                     PDTLKQLTSGGADVLLSSFHLTYNMVLNLLRVEGVDPEFMMKRSFSQFQRLREKPALE
                     EKGAALRRSIEAINVTHESAFRQYTICEDMIAKKRNEVDHILRQPKFLKNWVQAGRFV
                     HIIRASDQRDFGWGICRSFAAKSTNPNFSDPSTFSIQAAVICMKADASNPSALTPCPV
                     SEYTSEKADLYTVTFDFSDVQCLSTLKTNLPESPDSERGRAEVVQILSKLQRQFGHDI
                     PVLTSAQMGAEDAQLSKLQTQLSNLQKQLEGNILAISPTPELQEEFEKYKRKADLEAQ
                     LEQVKGELAGMGKAVFSEELKQMMRVLRRLDYIDKDNIILRKARVACEITTTDENEIL
                     LTELLFKGVLNSMETEMIVALLSCLVNVHRTPDGFSLPQEFEQPLKDLNEIVTRIATV
                     SAESGLIQEDSSEEKVMPSLMEVIYLWAKGAKFVDLVSMTTAYEGDIVRTMRRLEEML
                     RQLASAARSPAIGSIELHEKFLKGIQLIKRDIVFASSLYL"
     gene            complement(<1241885..>1242343)
                     /locus_tag="LDBPK_363160"
                     /db_xref="GeneID:13388317"
     mRNA            complement(<1241885..>1242343)
                     /locus_tag="LDBPK_363160"
                     /product="glutathione peroxidase, putative"
                     /transcript_id="XM_003865383.1"
                     /db_xref="GeneID:13388317"
     CDS             complement(1241885..1242343)
                     /locus_tag="LDBPK_363160"
                     /codon_start=1
                     /product="glutathione peroxidase, putative"
                     /protein_id="XP_003865431.1"
                     /db_xref="GeneID:13388317"
                     /db_xref="GOA:E9BU25"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BU25"
                     /translation="MASIFTYSAVQNGKTVFLQKYSGYATLIVNVASRCSLASTNIEI
                     LNEVQQAYGSRRFTVLAFPCAQFANQEPLNNTEIAQWCKDLGLLFPVFDRVNVKGSSA
                     DPLFQMLRVQKGAPLWNYTKYLCDRSGVPRRKLKPGCSMDTLRQSIECVL"
     gene            complement(<1243188..>1243928)
                     /locus_tag="LDBPK_363170"
                     /db_xref="GeneID:13388318"
     mRNA            complement(<1243188..>1243928)
                     /locus_tag="LDBPK_363170"
                     /product="exosome complex exonuclease rrp41, putative"
                     /transcript_id="XM_003865384.1"
                     /db_xref="GeneID:13388318"
     CDS             complement(1243188..1243928)
                     /locus_tag="LDBPK_363170"
                     /codon_start=1
                     /product="exosome complex exonuclease rrp41, putative"
                     /protein_id="XP_003865432.1"
                     /db_xref="GeneID:13388318"
                     /db_xref="GOA:E9BU26"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:E9BU26"
                     /translation="MSRQKEYVSPAGLRLDGRRPLEARRMDIAFGTLSACDGSCDITL
                     GQSKVCACVFGPRESLHKQEAKHDKGLVTCEVAVAAFAGENRRNPQRRSKLSEDIGAA
                     VVQVARSVILLSQYPNSQIHIYIEVLQKDGNEKIACVNAACLALIDANVAMRDAVCCI
                     DAGILDEHMLIDLTNDELRSQCPVIAAAFTGHDTRNIIWLETASRLPPDSAARLLKCA
                     EEGATKLFETAMRKALEEHAKKILTLQS"
     gene            complement(<1245849..>1247165)
                     /locus_tag="LDBPK_363180"
                     /db_xref="GeneID:13388319"
     mRNA            complement(<1245849..>1247165)
                     /locus_tag="LDBPK_363180"
                     /product="clathrin coat assembly protein-like protein"
                     /transcript_id="XM_003865385.1"
                     /db_xref="GeneID:13388319"
     CDS             complement(1245849..1247165)
                     /locus_tag="LDBPK_363180"
                     /codon_start=1
                     /product="clathrin coat assembly protein-like protein"
                     /protein_id="XP_003865433.1"
                     /db_xref="GeneID:13388319"
                     /db_xref="GOA:E9BU27"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:E9BU27"
                     /translation="MLSVLMFLNSRGDVVLSRTFRAGNSVRSLAETFCSEIISTKQVD
                     RCPVNIVKRMCFIHLKLTELYVVMVSDSNVNCLMCLQYGARLLQHIQNDYEGLDEKRI
                     KENFVALQGIIDESMDFGYPILTDAEAMKEFITKDGVDAAVLKSTRESERIADRMTGE
                     TPWRVEGLAFRVNEVFVDVFEDVNLLLSQTGETLQSSVLGRVVMNNFLSGMPECQLNW
                     NAKVMSHGIDEAVESHGAGGTGEVVPLSSISFHNCVRLKASGEERRLTFVPPDGKFTL
                     MTYRSNVNVQPPMKVLSAKAREISKTRTEVEFTLRSDTSAGRAAKDVQVSVACPDNTA
                     TAEVKVGRGKANYDPVSHAIVWKLPEVKSGEEITFFAEIRQIAPTENTELLWTKPPIR
                     IAFQCVSLSLTGLRINELVVKEPTLMYTASKWIRYTVMAGDYQCRI"
     gene            complement(<1247637..>1248185)
                     /locus_tag="LDBPK_363190"
                     /db_xref="GeneID:13388320"
     mRNA            complement(<1247637..>1248185)
                     /locus_tag="LDBPK_363190"
                     /product="pre-mRNA branch site protein p14, putative"
                     /transcript_id="XM_003865386.1"
                     /db_xref="GeneID:13388320"
     CDS             complement(1247637..1248185)
                     /locus_tag="LDBPK_363190"
                     /codon_start=1
                     /product="pre-mRNA branch site protein p14, putative"
                     /protein_id="XP_003865434.1"
                     /db_xref="GeneID:13388320"
                     /db_xref="GOA:E9BU28"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BU28"
                     /translation="MRLARFRPLVCQRAHTRRSCMLCLFLCLTILLNQPPPPLLAFLY
                     SASVACSQASSRNASVRAAAMPDERILLVTGIPSKQCTSEYLYSLFGAYGGIQQIRIG
                     SSSITKGCAIVVYEQCEAANNAVGALNEYALSKDRVLRVSVYEEERDKKALERRKRKR
                     EMQAEYKKHIADVAHAADEPKE"
     gene            complement(<1248585..>1249013)
                     /locus_tag="LDBPK_363200"
                     /db_xref="GeneID:13388321"
     mRNA            complement(<1248585..>1249013)
                     /locus_tag="LDBPK_363200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865387.1"
                     /db_xref="GeneID:13388321"
     CDS             complement(1248585..1249013)
                     /locus_tag="LDBPK_363200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865435.1"
                     /db_xref="GeneID:13388321"
                     /db_xref="UniProtKB/TrEMBL:E9BU29"
                     /translation="MMRIKQKAFVGKKICIAWEVLYDGKGWRAQGKALEILRFYAFSS
                     EVYLMCRIRDADDKRQILNLVKAVDGIERHRVLFCTTEKGYEAFTRQIDPSLLITNNA
                     AQVAFLKRVIQTLVLVGGDGVVASNVACVPSVEAIAVDLE"
     gene            complement(<1249686..>1251806)
                     /locus_tag="LDBPK_363210"
                     /db_xref="GeneID:13388322"
     mRNA            complement(<1249686..>1251806)
                     /locus_tag="LDBPK_363210"
                     /product="cullin-like protein"
                     /transcript_id="XM_003865388.1"
                     /db_xref="GeneID:13388322"
     CDS             complement(1249686..1251806)
                     /locus_tag="LDBPK_363210"
                     /codon_start=1
                     /product="cullin-like protein"
                     /protein_id="XP_003865436.1"
                     /db_xref="GeneID:13388322"
                     /db_xref="GOA:E9BU30"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:E9BU30"
                     /translation="MSSLVSSRKRMAEYSTFSDKWSIIEETICCIFKKEVSKNSFQRI
                     HHSVFQLCQAHYGSLVLEQLEEQFFAQVSIIVNRIDGSSTYVADFLREWQDYNDSVSQ
                     ISNILLYFNKNYMYACHHSSIEHLGERIFCSSTLGNPEVSACLIASIKQLIHVPAAES
                     TIRDIGQELYTAEGSKYFARCMETPFVDAMVDKYVVQGEQQKQALTTSGYLQWVQNVV
                     CSESHKYADTFFYILLDKLTSALYSSLVLSDPSSVNEMLTGPTGLVQMLEEWDVASIS
                     TFVQVFCAMKREKDVTDVIAHVLKEKCEDIINDRDTSTFPFPGVQKMLQLIERAKALD
                     DLFPSEEGHSPSPFLRVIRNVLGNDTRFMETLSVYYDNGIRQGKDDIVSTVGNNVLTI
                     LQLTPDLEAFEVAFRSHLAVRLIYAKPHAVDMECLFIDRLFNIYGSSVVNRFQKMVED
                     IRSATAAQEKLIADMKTKKISPPLEFDVLVLTSGLWPQYTNIPLSIPQSMEACKRVFQ
                     DYYRRRHNGRKLVFQMSLGSIAFQLCHAGRAYHVSAHTHFVNSIMALNSDENLSVAVV
                     ARQGALSCDEVLTQFNTLCHVGLAERNGTEFRFNRNFYSSKPKVKVSAGVQKSAHDGG
                     GASTATRKGMDGARTMSLDATIVKLLKEHNSMDYQTLCGAIESALRDVCSPTRADVKL
                     RIDALIEKGLITRGESAHCYFYCS"
     gene            complement(<1252673..>1253377)
                     /locus_tag="LDBPK_363220"
                     /db_xref="GeneID:13388323"
     mRNA            complement(<1252673..>1253377)
                     /locus_tag="LDBPK_363220"
                     /product="fibrillarin"
                     /transcript_id="XM_003865389.1"
                     /db_xref="GeneID:13388323"
     CDS             complement(1252673..1253377)
                     /locus_tag="LDBPK_363220"
                     /codon_start=1
                     /product="fibrillarin"
                     /protein_id="XP_003865437.1"
                     /db_xref="GeneID:13388323"
                     /db_xref="GOA:E9BU31"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BU31"
                     /translation="MLHPGVFISKAKTDSLCTLNMVPGISVYGEKRIELGATQGGDDK
                     KEYRLWNPYRSKLASAIYAGVSSIHMGPGSKVLYLGGATGTTVSHVSDLVGPEGMVYA
                     VEFSHRVGRDLVEMSKRRPNIVPIIEDARYPMKYRMLVPMVDCIFMDVAQPDQARILA
                     LNAQAFLQNGGHYVISIKANCIDSTLEAPVVIASELNKLKKDKLKPLEQVSLEPFERD
                     HAVVVGVYRPVKKSKQ"
     gap             1254278..1254376
                     /estimated_length=99
     gene            complement(<1254625..>1255422)
                     /locus_tag="LDBPK_363230"
                     /db_xref="GeneID:13388324"
     mRNA            complement(<1254625..>1255422)
                     /locus_tag="LDBPK_363230"
                     /product="lipoate protein ligase, putative"
                     /transcript_id="XM_003865390.1"
                     /db_xref="GeneID:13388324"
     CDS             complement(1254625..1255422)
                     /locus_tag="LDBPK_363230"
                     /codon_start=1
                     /product="lipoate protein ligase, putative"
                     /protein_id="XP_003865438.1"
                     /db_xref="GeneID:13388324"
                     /db_xref="GOA:E9BU32"
                     /db_xref="InterPro:IPR000544"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR020605"
                     /db_xref="UniProtKB/TrEMBL:E9BU32"
                     /translation="MKAFFIGKREYRRVLSLQETIFNAKIARQVSVRRGESKLPLLPD
                     VVILVEHSTPVYTVGRRDTAHGLPPHCSIDVVKTRRGGGITYHGPGQLTMYPIVNIQL
                     LWKDCTAGKPRSPIEWFSWALEEAMIQTAAMYHIPTHRFKTGVWADQYKDIPAQKLGA
                     IGLQLGSWVSMHGASLNVASDLHFFDDIIMCELPDRRATSLSNEMQHRGITESPPLVQ
                     ATAPVLLQKFIESLHQPPSRAAPQLVDLSADADWHERVIDAAGILTP"
     gene            complement(<1255998..>1258472)
                     /locus_tag="LDBPK_363240"
                     /db_xref="GeneID:13388325"
     mRNA            complement(<1255998..>1258472)
                     /locus_tag="LDBPK_363240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865391.1"
                     /db_xref="GeneID:13388325"
     CDS             complement(1255998..1258472)
                     /locus_tag="LDBPK_363240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865439.1"
                     /db_xref="GeneID:13388325"
                     /db_xref="GOA:E9BU33"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BU33"
                     /translation="MQTQAHKDVVKNIATASQLEGELQLSEAQHGVAVLDVYNAEWGH
                     CKALSDTFRRLFTDAGDLVHLRFFSVECNAVLESLKDPDEMKPHHPQQKGMVFSKDTL
                     VSFWKEMLEKRQNHSKPFFAFYKEGRMRAQLEGIDTPKICRIVRDLCNQQNTVSEYVT
                     NADVLRFWESHFSLSENEVAASEFAHAVQAVLGASAAELSEADLADITAEVQSTSGAT
                     VSAADLQSFVGDSGRVKDAILAVVAKKRAMATATAAAPPPPPAEELQPTESEEKGADE
                     DPRASLQRPSSAESGEAVEEAAAGDEEAEVGGEEVDVDADAAQETLPAGEDTAEAASS
                     VHGAPSHNDEQKEELPKTVTDGADEEPVVEPPAVDAAEADEAGADTHELGEPAVANPV
                     EQQAMQQPEGNEADSAYEELPGQQAAADAESPTPSPSLPAEEHGESGVGEASGAPADE
                     ARTEDDTQALPGAAENDNQHEELQEDARPPSSAPQPPMDTMEPEDGDDEELGEAPSSA
                     PPADTVNTTGDQDESVVNQIFTNRWVTVTEEEMHVWNTVAALPLHYPQSTTMMADLTN
                     NTTPVHEALSTTADLPTLAEYLTAQGVPYSDINMMCIAADQKVASESLSYGKLSLLLI
                     SCDPEEGKGLVPHCETFLKELSDGTLLKHQQPLAFTALALSASVAYPDECFCYCVPET
                     AVAAFQELAVDDIFILNALTPLKTTVPQDGQFILRIIGLPKVIELATTDENEDTMVLS
                     QWYARLRVAEQGAGALTAHFVENVCDDEFQDFLSGYIERLIEDENRLDKKHGDEEKSA
                     EGDFNDEELDDGKSAEVATPEPEDVL"
     gene            complement(<1261966..>1262616)
                     /locus_tag="LDBPK_363250"
                     /db_xref="GeneID:13388326"
     mRNA            complement(<1261966..>1262616)
                     /locus_tag="LDBPK_363250"
                     /product="ATP synthase, putative"
                     /transcript_id="XM_003865392.1"
                     /db_xref="GeneID:13388326"
     CDS             complement(1261966..1262616)
                     /locus_tag="LDBPK_363250"
                     /codon_start=1
                     /product="ATP synthase, putative"
                     /protein_id="XP_003865440.1"
                     /db_xref="GeneID:13388326"
                     /db_xref="GOA:E9BU34"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:E9BU34"
                     /translation="MSEARQIQSMIDFIEREAQEKAEELEAAAQEEYDVEKMRLVEAE
                     KAKIRAMAEKKLKQVDVDRRVARANFSKVQRMRVMEERARTMEKLHEQTRQKIVAMVN
                     NPSQYKPMLVRLIHQSLMSIRTDAVVQCRKEDEAEVAREIPELERWYKEKTGATISIQ
                     TSKTYLNTAEAWGGVVVKSTDGRVVCNNTLSYRTKTCFDEQLPTVRFHLFNPEAPL"
     gene            complement(<1264223..>1265356)
                     /locus_tag="LDBPK_363260"
                     /db_xref="GeneID:13388327"
     mRNA            complement(<1264223..>1265356)
                     /locus_tag="LDBPK_363260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865393.1"
                     /db_xref="GeneID:13388327"
     CDS             complement(1264223..1265356)
                     /locus_tag="LDBPK_363260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865441.1"
                     /db_xref="GeneID:13388327"
                     /db_xref="UniProtKB/TrEMBL:E9BU35"
                     /translation="MTRVRVNREDCSVQVKGDLITFLYATVVKDPLVLAARNVTQLLR
                     SRKDDTAAKLVADGESYVLKFESLRDREGFIESIVRAQEAEQALSNDEWVASTICHAA
                     VDVGVLDKEELNAIMSAAGQRGVEQAFDALETLVDRETFQLLPITEQMENDVLRQTPV
                     LAAIFQQRVVDKETKKSFWEAVVRKYFCFSRTFLEEDIQRLEGARPAATAAPPPPLSG
                     SAATSSLSVINASSMCALPKGAATAMLDTDINEEDLLHLDENVEPLLHSFHGLFAAHR
                     HVPVGSASVLPVNGAVLPFPQETAESSPVYPPRFVGRRVLHQLPSETIEKAALETLRT
                     FWRSSVKQRRSILAKYTRSSKKGGGGFIQRICLEQADRAVQNT"
     gene            complement(<1266276..>1267982)
                     /locus_tag="LDBPK_363270"
                     /db_xref="GeneID:13388328"
     mRNA            complement(<1266276..>1267982)
                     /locus_tag="LDBPK_363270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865394.1"
                     /db_xref="GeneID:13388328"
     CDS             complement(1266276..1267982)
                     /locus_tag="LDBPK_363270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865442.1"
                     /db_xref="GeneID:13388328"
                     /db_xref="GOA:E9BU36"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9BU36"
                     /translation="MAGFGMAYSNAPQYSRGVLVGNWFEDIALREDQLKLYKAQRHAA
                     VEHPEKAATNAVARSMLASQLEEPTTVVAFKGDDVRIGHPYLLVNDKTQAVLALDLMT
                     GGGASSQSQQYTLSGSLAPGPQVRSTWTLLRCKDEHNHSYNRNSSDVLHYGQRVRIAN
                     ENVSAEGFLYVQSSLSSGLRSSEVQCTVAALNACADNVFVVSRAGTVRDDVHFGFPVK
                     VGDGVVLLHSLTNLPLACNGERVATSYGMEYAVTCGYTTDYCSRSRGAVVVKPENVFY
                     FSGGDGTDAVLMRPRTSSRHQSRASAMLTMTAGTGVMALMERIRQGALEIGGRIGFRS
                     LSIALGVACNEQRQRRFLDRNELRKAIARLGVLLSPIEMDVLMRHFDTTGNNVVCAQD
                     FLAELRGTMPLARMQAVIYAYQQLSIEGRGSVEFKDMHSLFRLNAATIPDVVNGVLQR
                     EEAVLDFESCWPGRVGCKVGTVTLDEFVEYYADVSPAEESDERFCKLLQQSWAIPVTS
                     AYLSGEPHRLLTVTYDDKPTETVRLPDSLVLDTQDRKAVKRLLIQRGLRGVKDFTVST
                     NM"
     gene            complement(<1269012..>1269812)
                     /locus_tag="LDBPK_363280"
                     /db_xref="GeneID:13388329"
     mRNA            complement(<1269012..>1269812)
                     /locus_tag="LDBPK_363280"
                     /product="cyclophilin-like protein"
                     /transcript_id="XM_003865395.1"
                     /db_xref="GeneID:13388329"
     CDS             complement(1269012..1269812)
                     /locus_tag="LDBPK_363280"
                     /codon_start=1
                     /product="cyclophilin-like protein"
                     /protein_id="XP_003865443.1"
                     /db_xref="GeneID:13388329"
                     /db_xref="GOA:E9BU37"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9BU37"
                     /translation="MHVGVLAPHSHPPASFRPIFEVRPPPSPTHSFHHPPTPIYLCTT
                     CTDAVDFYVRAVTSLLVEWTTAMFTRSTIRWAAGAGHAFMDIAIGSQPPHRVTFELFT
                     KKCPIASENFLKLCTGENVLPQVSSIDGIGEPSFRDQFLPQLTYRNTTVHRVCKGYLV
                     QGGDIVSGQGTGQLSIYGEFFDAPEEVKASKFDRMGLLGTAVSAPHLNGSQFFILTAD
                     KAPHLNGTCICFGRVVDGWAVVKAIEAIPLTAAGEPTERVVVVECGKL"
     gene            complement(<1270760..>1271509)
                     /locus_tag="LDBPK_363290"
                     /db_xref="GeneID:13388330"
     mRNA            complement(<1270760..>1271509)
                     /locus_tag="LDBPK_363290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865396.1"
                     /db_xref="GeneID:13388330"
     CDS             complement(1270760..1271509)
                     /locus_tag="LDBPK_363290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865444.1"
                     /db_xref="GeneID:13388330"
                     /db_xref="UniProtKB/TrEMBL:E9BU38"
                     /translation="MASVDTQWAIKSILQLGHHHLRHRVETTSSSSSCLVRPTSLSFR
                     SASEAVQVTAMPRLMRASCDPSYVLLLAKRPSGIAGVSLRPGNRVPWAGLPAAASSPV
                     SAPCSKKTRLLASYLQRRGFATIPPVATETHSSSSQFRPVQKSMPLLLHTSHLIGWKL
                     NDASPAFPVYAHTLAELQRLHSSDVAALKPQHCLIASEYCEWDNWREVLGEPGWDLFS
                     ADEDAVERLLQDGLALSTLEEEPGLYPVEVI"
     gene            complement(<1272453..>1273856)
                     /locus_tag="LDBPK_363300"
                     /db_xref="GeneID:13388331"
     mRNA            complement(<1272453..>1273856)
                     /locus_tag="LDBPK_363300"
                     /product="ADP-ribosylation factor GTPase activating
                     protein, putative"
                     /transcript_id="XM_003865397.1"
                     /db_xref="GeneID:13388331"
     CDS             complement(1272453..1273856)
                     /locus_tag="LDBPK_363300"
                     /codon_start=1
                     /product="ADP-ribosylation factor GTPase activating
                     protein, putative"
                     /protein_id="XP_003865445.1"
                     /db_xref="GeneID:13388331"
                     /db_xref="GOA:E9BU39"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:E9BU39"
                     /translation="MNIRQRKSERHKEVLRKLSQNGGNKSCFDCGMRGPLYVVSDFGI
                     LVCSGCSAVHRSFQHKVKGITMSEFTDDEIARFSVAGNDRALKVWLSTFHNQLPRSGD
                     VMALKDHVRVVFEERRFLNAQELSALQDSWEHAREQPSQAPPPLSVTRPAESSLASIP
                     EAPTAQPGPVSAPTNPARPPQEDAFDSLFSASVQSSSTPQPTAHAAAPPPPMTTLHAP
                     APPAPQQPATVTSIVADLFAGVPPPVVQPAGGYSAPHPQQQQQQQSMSYPTDGGMYNF
                     TQGPQSSMMAPTQLQSSQLPYQQQQQAQPTPYAASGPMVCAPCVGSQHASTFDFAAPS
                     APAANPYPYQQQQPQPFTWGQPAPAQLQQQQQHMIGFLGSSGSAAPYAAPAQPQSYNF
                     KSGAPGATAYPSANGAPAQAYQPSPFASNLPPPQEGWGASLSSNASSIPNHNRIVVLS
                     VTKQQNDGPQNPQPPWQ"
     gene            complement(<1274741..>1275748)
                     /locus_tag="LDBPK_363310"
                     /db_xref="GeneID:13388332"
     mRNA            complement(<1274741..>1275748)
                     /locus_tag="LDBPK_363310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865398.1"
                     /db_xref="GeneID:13388332"
     CDS             complement(1274741..1275748)
                     /locus_tag="LDBPK_363310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865446.1"
                     /db_xref="GeneID:13388332"
                     /db_xref="GOA:E9BU40"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR027684"
                     /db_xref="UniProtKB/TrEMBL:E9BU40"
                     /translation="MEAKFLKLRQEREEQRRQRSKETGAITLQRQQYEAEAELLEAEV
                     TQLLQEGNVTESQQRIDALRTLVQDTSNSISLTAHEMAKANVILARLQQRVDEKHSSA
                     APKKFKFSSRLKAKPTSDAEPATPSLSLTGISDTNEATATATVPVAGTVSSTNGFGNV
                     YGPSTGTDLFISHSRGVFINGCAECAIYCLPIAGSAFLSNCTNCRVYVACHQLRLKGC
                     TNLDLYAWCASTPIIEECDAMRFGPYRCWVGLLSSCTEDGKTYATHAEWVSRVGEIED
                     TARTEQNYVKVDDFQWVKKSASPHWRVLAREEEKASTTVFGPATLPSPSTAHSTDAAD
                     H"
     gene            complement(<1276478..>1277512)
                     /locus_tag="LDBPK_363320"
                     /db_xref="GeneID:13388333"
     mRNA            complement(<1276478..>1277512)
                     /locus_tag="LDBPK_363320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865399.1"
                     /db_xref="GeneID:13388333"
     CDS             complement(1276478..1277512)
                     /locus_tag="LDBPK_363320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865447.1"
                     /db_xref="GeneID:13388333"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU41"
                     /translation="MSSDDECPELISARVPVTVLTGFLGSGKTTLLHYILSADHNMRI
                     AVIVNEFEFGKTIEKGLTLKSSEKPDDEWLELSNGCMCCTAQTQTVKALESLMERRGT
                     FDLILVETSGLADPGPIAAMFWQDLALCGHLYLSGIVTLVDAVNICMYLHDEDVMQEA
                     ERQILMADKVVLNKCDIATEAQQKAALSAVREINPVATVIRSDHSRVPNVRDILFIDT
                     TRAATELVHLHEHHHSSISAVSLEFFEAERALAVSSCRDVHAIGSDLLYRCGEYGFEV
                     VRCKAAIWCCEDGQYSLLQLQSIGDLFDVTPMVGQSVPFGCTRALVLGKKLDEEKLRD
                     IFAKYLKATK"
     gene            complement(<1281354..>1285583)
                     /locus_tag="LDBPK_363330"
                     /db_xref="GeneID:13388334"
     mRNA            complement(<1281354..>1285583)
                     /locus_tag="LDBPK_363330"
                     /product="receptor-type adenylate cyclase a-like protein"
                     /transcript_id="XM_003865400.1"
                     /db_xref="GeneID:13388334"
     CDS             complement(1281354..1285583)
                     /locus_tag="LDBPK_363330"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase a-like protein"
                     /protein_id="XP_003865448.1"
                     /db_xref="GeneID:13388334"
                     /db_xref="GOA:E9BU42"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9BU42"
                     /translation="MWQSPQLVINRCKGISTHPSVTPVLLLLLLVLCAPVSAQGGSLR
                     DSFDVQCFLLQTTESSTAALNAVDVTAQKASITCAREILSIPLAWAPTDGSGSTLNVY
                     MSTLSDTLLSSVVAASSFTSCTLVTSISEGVLDTRGMSKNVYFTNADPATEMLALMSY
                     VMINGAPPKIGFVYTKTAEGKTSAGAAVYQEFLRRMGELAYTGTLVTYEATQDYDSAK
                     FAAFSKNFESGISVVFFFLPAGSSTDSMFVELIKSSGEVQVLMPSWLIRTATSQYLAA
                     TSPKVPARNIIVSSTNPHPQDNNFKKSMDQFKKDYGNTKPALASSSVDGIEAVAGWIT
                     ARATVATLQHHTLWTESPTQKLYFDRLLEQRVYTIGGNIVLGAYSSSCNVGGRMVLLY
                     SLRAMNDGEPSAYYGLTSIPGASLMLKPWECHAVDVALNISKMVRAAYVKYHSVGENA
                     NYMTTQMDNMIPAAMASAIFTKATIGPLDNLADTTWKAALDKSPTIAVFGAASAGVDK
                     SPVEKVLVEPVFLQPTLYQNASNVVYLTATNEQQLGAVATWVAKSAVAPDVYAVLRNS
                     GASATAMQSTLQRITTRAGVTVKSVKTLGAGDKLSPSDLPKSGLVLLTGIMQSDIGTL
                     QKHMQSNTDTRVILLFDEVTQWYREIEKVFAARPSSGERLLFVTNLPPWTPKKRDISR
                     LSADFLAATIGPGYHSPASMRGFLAVRALSMLSYNAANPSISALLDALYTQQVLQMND
                     LTLGPFKRTGCACSPRSNQVECAGVLNGGAGGIYIWSYSDMKGETNGPIAGPYVVNLF
                     GYVDAHFEDSSSSGDARSSSSEDARSSSSKSTIIASVAVCVVVIAAVAAAAIICVLCT
                     RDSRDNRNAPRDENEPVTLIFTDIESSTALWATAPQAMSSAVALHHKLIRQLVTKYKC
                     YEVKTIGDSFMIACKQSFAAVQLARNIQVELHQADWGSTAIDDAYELIGKRSGGTDPG
                     ECGLRPWSGLRVRAGVHRGLAEVRFDDVTKGYDYYGNVVNTAARTESVSCGGQVICTS
                     SVVEALTEEEQGTVQFVALGPHQLRGVAEPIEMYELRTVPGRVFPSKESDIGANPLAS
                     LAAGADADGAPNAEEGNPMLMQEDAFTEVAAGVEPVAEVLDVYFSVYTNHQKIKLLQK
                     TCKYFCLPSPPRRMFASNEAYLNSLMLTVATRTSAVIDFRHRKLESETLRSAAENQAN
                     APAIESVAHQDAAAELRRHSSVFFSGVDSPVAGESKLRRSVMIDLPGASLPRHGNSDG
                     TMMLVMDNGELLTLCSSAGPSCTEKPLEVSEATKVYKNGAPSVSGDEVSPCFEGGNGL
                     LFRIIDKATKRWAFYNDTTDFVMHVYFSVGRTSAVKWGPGVAGKVTQAEETGRYEGEL
                     IVPPLATEVLMTGRVNGYTMRYCAMPSGNGE"
     gene            complement(<1288953..>1290653)
                     /locus_tag="LDBPK_363340"
                     /db_xref="GeneID:13388335"
     mRNA            complement(<1288953..>1290653)
                     /locus_tag="LDBPK_363340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865401.1"
                     /db_xref="GeneID:13388335"
     CDS             complement(1288953..1290653)
                     /locus_tag="LDBPK_363340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865449.1"
                     /db_xref="GeneID:13388335"
                     /db_xref="GOA:E9BU43"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:E9BU43"
                     /translation="MPPAPPPALLPIEEPPIGTQPAAHLASGTTSQNTSSNPTGGTVV
                     CDNCKTRGHLRRNCPKIKCNLCKRLGHYRRDCPQDASKRVRSVEGAPHEEVNLDEEYR
                     WSVCRHCGSSRHIQANCPVRYQALECYQCHQLGHMMTTCPQTRCYNCGTFGHSSQICH
                     SKPHCFHCSHSGHRSSECPMRSKGRVCYQCNEPGHEAANCPQGQLCRMCHRPGHFVAH
                     CPEVVCNLCHVKGHTAGVCDNVHCDNCGRNHETVHCHQPYMAPVTHDRVSEERSASLP
                     SEHDSGSAEQSNNSATPRDSDDGASNRGGEPRPRAAVSCAPVVPPYIPLDGPKRDGRV
                     AIVVDGSYFERCVAVRRNRSDPAYYRHITDALLYTIDYIGDIFQREPFAFWFDTDTAA
                     FTEFVEMSMPLAHRENAFREASMRKRYLTDEMNSGRSLPNVVAKLVGGMKRQRGFTED
                     GPGHVWVQTGVDVATATCVIELFQDHRQFQQVVLLCGDADIYPAVQYCNTLRRSSHQH
                     ADSNPVRVCGTSDSMSKMYGQQQDLTDFLPRLLLDRPSHTEGGRTIEFPTSKVFMSVH
                     "
     gene            complement(<1291880..>1294723)
                     /locus_tag="LDBPK_363350"
                     /db_xref="GeneID:13388336"
     mRNA            complement(<1291880..>1294723)
                     /locus_tag="LDBPK_363350"
                     /product="DNA topoisomerase III, putative"
                     /transcript_id="XM_003865402.1"
                     /db_xref="GeneID:13388336"
     CDS             complement(1291880..1294723)
                     /locus_tag="LDBPK_363350"
                     /codon_start=1
                     /product="DNA topoisomerase III, putative"
                     /protein_id="XP_003865450.1"
                     /db_xref="GeneID:13388336"
                     /db_xref="GOA:E9BU44"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013498"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013825"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="InterPro:IPR023406"
                     /db_xref="UniProtKB/TrEMBL:E9BU44"
                     /translation="MPTWLNVAEKPSVAKEMAQSLSGGNCRTVPSQSRFNPVYEFKFE
                     GKTMLVTSVAGHLMEDQFPPNTKNWSTYPFQGLFLAPITKYVRADLEPVKKNLEALAG
                     RADTLVLWLDCDREGENICFEVMQVVQSKRPQVQVKRAHFSALTARDLLNAVHNLKLP
                     DKRLSDAVEARQEMDLRIGAAFTRYQTVKFRHLFAAIPGVLSFGPCQFPTLGFVVRRY
                     WQQQGFVPEDFFTLQLQHGDTKFHSSRGSMYDQVAATLIYEDMLQAAAAEGHKGRITN
                     VQQRPSHRRPPVPLATVVMQKLAATHLRIPSERCMTLAESLYQEGLISYPRTETDSYT
                     FQESELLELVRVQIANADVAEYVAAMLADIATRVRPPLRGGHDDKAHPPIHPTKAWNA
                     TQDERGRLYNLIVRHFLASLSPDAVAATTQVSAEFGGELFSTGGTTILQRGWLDIFPY
                     ERWNNTCIPNYQIGDTFQPTAVPLKKGCTSAPPHLTETHLISLMDSNGIGTDATIAQH
                     IKTVLDREYVKREGQSLVPTTLGIALASAYESLGLASLLQPQLRAQMELAMGDIANGA
                     ATKEQVVTAAVQLYEEIFSRLMANTNAFYEELKRYLQPAVETDACAVQATVVKANFIP
                     CGTCGRLMDLVERAGERDREVWSVRCHACNKMYRVPNGRLNTLEPVSPPHTCPLCGFL
                     ALRVANREKQTSYHVCPHCFGSPPKAWSVTAYGSAGAAAPLPDVEAAAEFRCFQCTAD
                     CPLAKGLEAIGITTCIACRQHELRLRSGANGFFLSCRGYPSCHLRVSLPAAASVKPSP
                     SQRCPACSAVLLTFDFSGRQGVPGLDMLDTICVRCDARIKDYIAVKGMPTGGANSSAV
                     PSSAASVASTASRTYTLPSVKPSARRSVRGGGQRGGSGGDAAAANTSSGGVDPVCGCG
                     APAKQLVSRKEASRGKRFLTCANRQCSFFQWLD"
     gene            complement(<1298311..>1299087)
                     /locus_tag="LDBPK_363360"
                     /db_xref="GeneID:13388337"
     mRNA            complement(<1298311..>1299087)
                     /locus_tag="LDBPK_363360"
                     /product="14-3-3 protein-like protein"
                     /transcript_id="XM_003865403.1"
                     /db_xref="GeneID:13388337"
     CDS             complement(1298311..1299087)
                     /locus_tag="LDBPK_363360"
                     /codon_start=1
                     /product="14-3-3 protein-like protein"
                     /protein_id="XP_003865451.1"
                     /db_xref="GeneID:13388337"
                     /db_xref="GOA:E9BU45"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:E9BU45"
                     /translation="MTETIKWKNVTIQDEVVPKPSDIKLPDDLAELIYMAKLAEEAER
                     FDEMLLCIRKYVRLNSELDTEERNLLSVAYKNVITPRRNAWRVITSIESRENAKENSA
                     TLPFVVNMRRELEAELSPLCDDLLSLLDTYLIPAAQGGEAKVFYLKMKGDYHRYYAEI
                     DSGDGQRQAALNAYQKATDVANSSLAPTHPIRLGLALNFSVFYYEIMKEHEKGFQLAR
                     QAYDEAVTELETLDDEAYHESNTIVRLLRENLNLWTDDQL"
     gene            complement(<1299808..>1301460)
                     /locus_tag="LDBPK_363370"
                     /db_xref="GeneID:13388338"
     mRNA            complement(<1299808..>1301460)
                     /locus_tag="LDBPK_363370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865404.1"
                     /db_xref="GeneID:13388338"
     CDS             complement(1299808..1301460)
                     /locus_tag="LDBPK_363370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865452.1"
                     /db_xref="GeneID:13388338"
                     /db_xref="UniProtKB/TrEMBL:E9BU46"
                     /translation="MASYAELLQTCAEFQENFSALTGKYNALSLELKNTKAVCERKQR
                     QLDEAAAREEQQRKELLELKKEVDDAAGFRQRYHAAAVATEHLKSQLACAHQSAIDAS
                     LEHDQEVQQLKQQLEDMIKRVETATDGQRLREAQRQTLELEERCATMHAQLLEDRERH
                     SQQLLTAHNALREQQSRNLELEQRCRAMEADVAEMRAAVRRSTELQNEAALLKERYST
                     AATVAQHQVEELRAEAEEARRRLAQLKADHEAQLAQVTQDAAEAREELHERVASLTAD
                     LATAQSNLAEERSLCRKMQASAEEQVMQARNASVVEASALRRAQAALKEENTRLQWRL
                     EKMDGELREGQQALQALQSRHDSLAAKLQQSQSQLDTAAQQEAWLTCERQNIADQLAV
                     ARQQLDALSKALMNHEEVALQAQQLTIRLASATEEAQSHRRAALMCESQLRDVEEASA
                     LKVRELRRELKTYKKQCTNEAARADRLRRKLMAALVEKEAELYRVSRATGRALTLEGE
                     PAIIPTSGTVLHDSAYSDVIGMLRNQSQQAEELHTRLVQLAR"
     gene            complement(<1303094..>1304704)
                     /locus_tag="LDBPK_363380"
                     /db_xref="GeneID:13388339"
     mRNA            complement(<1303094..>1304704)
                     /locus_tag="LDBPK_363380"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_003865405.1"
                     /db_xref="GeneID:13388339"
     CDS             complement(1303094..1304704)
                     /locus_tag="LDBPK_363380"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_003865453.1"
                     /db_xref="GeneID:13388339"
                     /db_xref="GOA:E9BU47"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR012132"
                     /db_xref="UniProtKB/TrEMBL:E9BU47"
                     /translation="MNKAYDIIVIGSGAAGCAAARACALHHPAASIALIEQGSRTAVP
                     WVMRVPLMQPYIASVRKARPFLQTLSCVAEANLAGRSLPFTLGRGLGGSWLCNDMKYM
                     RGTRKDYERWADASWTYDTLLPVFKSLEANSRGGSRDHGEDGPLRVTDAQRSNIDSGM
                     NVRFFEACEAAGVPATNDFNTGQVDGFSAMQSYIDGGARVQAFDALIEGTQPRAPNLD
                     LLDETCAERIHCRAGRVCDVEVSHRGDKRLLEARHVVVCAGTLRSPLLLQHSGIGAKG
                     SVLDAPAVGQNLITTSAADLVFRIRNSSNVYSKSISWRNSSYLYRQWREYKENGTGVF
                     SAFVEGAAYVRSQPQQDAPDLSILFFRTPQMGMTHWPMDGFTMRVTHHYPSSRGEVLY
                     DGSKGTTFIRSGMLSTREDVLAMDEGVQWVGLLTTRDGTLQSVNHVDEKGRHVSPFWS
                     YGAALHHPRDGLITQRSTAAFLAEHVKSGGDLYGTCAMGTVVDSQLRVNGIAGLFVAD
                     SSVVPLPTVASSSTLGSAIGARVASFIH"
     gene            complement(<1305355..>1306278)
                     /locus_tag="LDBPK_363390"
                     /db_xref="GeneID:13388340"
     mRNA            complement(<1305355..>1306278)
                     /locus_tag="LDBPK_363390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865406.1"
                     /db_xref="GeneID:13388340"
     CDS             complement(1305355..1306278)
                     /locus_tag="LDBPK_363390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865454.1"
                     /db_xref="GeneID:13388340"
                     /db_xref="UniProtKB/TrEMBL:E9BU48"
                     /translation="MDSLYFIGKAQFHQLATHIALYHEDMSAGYKHLSTDAVMAVGLK
                     PHKFTYWNVPMMSGYLGKTVPLDIHGGYVMIDEEKVMPMATSYGMLRYALLTSAVRAK
                     EGGRWRYDFMTMNSTLAIGTAAGFGLLSFGRQRIRWMRRHPIGSVVASFVACLTTTVI
                     ARQGIKALGIGVVQAQNSHKRALTCLHCVDCLEDVNTYTLKQIEELKAQQIPQQAGMP
                     PPPEEYVRRFKKGVEMQCRLLETDMEEVRLIRKWAGASLCDVHQHLRDDPMGYKEPHG
                     LVLLASDRARAAERPPLAAMPDDMEIRPAKN"
     gene            complement(<1307357..>1309918)
                     /locus_tag="LDBPK_363400"
                     /db_xref="GeneID:13388341"
     mRNA            complement(<1307357..>1309918)
                     /locus_tag="LDBPK_363400"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865407.1"
                     /db_xref="GeneID:13388341"
     CDS             complement(1307357..1309918)
                     /locus_tag="LDBPK_363400"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865455.1"
                     /db_xref="GeneID:13388341"
                     /db_xref="UniProtKB/TrEMBL:E9BU49"
                     /translation="MDDVQSGPLERDNEQIAAAVKATNGAGVRRRRMGEVYPIMKNTI
                     YSDEECEVVVVLTSWDCGMRFIRYISGLFQYFLRNPKAMGFIFTTVIILLFFKYAQQV
                     VVKAVNAAVRAHPGLEPTDTIRSAVTSFTEELRALERAAQTIGWAYMRDSVEGCDIGS
                     AVGTTFSSLVRNFQLSFMANMKTYVVYALPAAASTAFTSRHWGQIGCASNETNSSICF
                     YVSKDSTVRQWDTVSNTGDGGPLGRRAYIEQCMPDLLSVATTATKGSALAASGVWTRA
                     YMACNIVPQKTVRTISYLLPIAFNAEGYATAMAGIDVSLELLMEIVNATATPNIELVI
                     VDNRYNASKGGQFVYDSFDESIFWPTPYGVLDAPVGRIRDLAESVWSEHGGTLALNGS
                     FYRNGLIYQSLTMMSHWTLIASSPLALSVAEVAASLGVIVKESKGVATVASGLYHDCE
                     TAANKQQNSVTVEAFGEIEQAFGTQLHSLYTSYTLAGTTKSRSSSASVESESSHNSNA
                     VGGSVIHVLPYSSAWAQSSAVSSAAKATLATPAASTSRGGNGVEMLVLQATTERLPVD
                     IPDVNASWRTSSSGSAAEDERVWGVCGCTYTSVASKTCFFTDSNQTEILFEGSVFNAS
                     AKDKIETSQLSASLRGLFTSQYIDGTTTTTGFWTKPYLRSSASGNASVVVSYVHPSEH
                     SSNGYVTRACIIDINAAWMAYTLKENQHNGTTALYLIDRRGAGTFLASSTAVQATDAV
                     YAALKTPDSEFNRIASAVYSAAGNTWERSLSLHIGTTLVNYQVVEGQWGIVEVIPGDV
                     ALQRYLPTPAVTSATDALRLLPPGETVQLFLYIGSILFFFFLNLLILGCSHLGRQ"
     gene            complement(<1311541..>1313088)
                     /locus_tag="LDBPK_363410"
                     /db_xref="GeneID:13388342"
     mRNA            complement(<1311541..>1313088)
                     /locus_tag="LDBPK_363410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865408.1"
                     /db_xref="GeneID:13388342"
     CDS             complement(1311541..1313088)
                     /locus_tag="LDBPK_363410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865456.1"
                     /db_xref="GeneID:13388342"
                     /db_xref="InterPro:IPR013176"
                     /db_xref="UniProtKB/TrEMBL:E9BU50"
                     /translation="MTLTTSSDVGAPLISLAVYCPLLCADKEEHGADNILFYFPSDTH
                     LNLQMNQVGFCIAISSLAPRFGVHCSRRQTIRKQRSSVCLMSPAENLWVSAHVRGGNE
                     AALTTHHLLQLSCTLFELLYSADTMLQLTLPNMEKGRKEGPHTGTGSSNPSTPTTDKA
                     GSSDTAARSALRSFFARCATFISSVLAAQCMARDGETGRMGRSGAAMSAQDWAHHLSA
                     EASFGLPLRFVSDRELPSLQLGRVEEVVRHILWQPVCGCTAGPDGDAPSSLGRDSVHC
                     CVFNLPSLHVVMADSRLPRVVVQSLKYYLVLYAPIACTSFQCHVPPGGLCEAAVWLDG
                     NVVAVLVDMHEDETASVCGRAVSPSLMEHARVISSEVRQLLSKPAAGATSVEAKDAYW
                     LSMRDVPAHQLYYKLTLKPPIAASSGLVAHWRLRGTVVEGTPFRQVVPGLVEYVRALV
                     YSTKLCLPSSTSTSVLEHWTRWNSFWVYLRFAGATVTAIAWQHQQHAMSIRQLAYEVQ
                     RLLLVAP"
     gene            complement(<1313834..>1314418)
                     /locus_tag="LDBPK_363420"
                     /db_xref="GeneID:13388343"
     mRNA            complement(<1313834..>1314418)
                     /locus_tag="LDBPK_363420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865409.1"
                     /db_xref="GeneID:13388343"
     CDS             complement(1313834..1314418)
                     /locus_tag="LDBPK_363420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865457.1"
                     /db_xref="GeneID:13388343"
                     /db_xref="UniProtKB/TrEMBL:E9BU51"
                     /translation="MLRSTGVSLYYRATAELDRLRGMLRGRARLERKVGLKRITFLMR
                     TQTRYRVEHKAHWERAIVRKNVDSAAHEHGSGWQHLRNDLARQNLMLLPRTQQQLAQY
                     EPLAFRAVMELCASRVAPPPPPMTAQVPEEAYATRPEDPKVAHPAARRQLKECIEHML
                     CTGRSEVLQREGPRTTQAWMDAWKEYDLGSAAQK"
     gene            complement(<1315320..>1315709)
                     /locus_tag="LDBPK_363430"
                     /db_xref="GeneID:13388344"
     mRNA            complement(<1315320..>1315709)
                     /locus_tag="LDBPK_363430"
                     /product="60S ribosomal protein L22, putative"
                     /transcript_id="XM_003865410.1"
                     /db_xref="GeneID:13388344"
     CDS             complement(1315320..1315709)
                     /locus_tag="LDBPK_363430"
                     /codon_start=1
                     /product="60S ribosomal protein L22, putative"
                     /protein_id="XP_003865458.1"
                     /db_xref="GeneID:13388344"
                     /db_xref="GOA:E9BU52"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:E9BU52"
                     /translation="MVAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVL
                     GNFEQFFQDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKKD
                     LRDWIRILATGKGTYQLKYFNIQDQEE"
     gene            complement(<1317559..>1321071)
                     /locus_tag="LDBPK_363440"
                     /db_xref="GeneID:13388345"
     mRNA            complement(<1317559..>1321071)
                     /locus_tag="LDBPK_363440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865411.1"
                     /db_xref="GeneID:13388345"
     CDS             complement(1317559..1321071)
                     /locus_tag="LDBPK_363440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865459.1"
                     /db_xref="GeneID:13388345"
                     /db_xref="GOA:E9BU53"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:E9BU53"
                     /translation="MLRRRVCAAPSLAVGPTGSSSLSLTPSPADSQQRRSLKTLDVRE
                     YRPLGTPIEFRFYQRYANHPNRQSGVQFLTHYNTHQRFRVNKDFIDYMHWGKEQGQAR
                     LPHRHQRVAFDFDDALQPTRAEGDVSAWFAGQDPTMGSHPDISTSFDPNKKLFSHPEH
                     WNKMFSKRRPGEGDIKLNVIPSNSLLGPMVTQTDTQEMAYFKTETCGPTHGRVPGINA
                     PFKGEMDRKMMQAMSRPLNRSRTLTGNNGRFSNTIFINDPKRHQTLSATLAKELNREV
                     DRATNGLYSKLTVLTSAQSGLTDFFCGGTDLQSIGFDLNLAQLLRKEAEALTKSSVSG
                     SKKVEAKVQELIRDAERYEERADSVLRENAAVIWRAYTSPRALMTLVNGKCRGTGCGL
                     ALAAKYAGLQDASEFIVDGPNVGLTPYSGMTRLLARPETSLKYPGLAEFVMLTGASLF
                     AGDALRLGWSDLFTSLPDMPYHIKDWFDSTEHMHNDAVAWQLGHLLERCFQMKDRWHT
                     SAMERCAMTPIRARWVEDAFADQSSIEEILKTLSAMEKLPLTDRHNTYDPSYATPYTL
                     ASVAEGVEKLSASRLRYTLSPWDATPPEEAVEVRQAAEIFTSYVLERRGKVNIVAHRD
                     RHKAQAWQKQREREYVAYSNMKSAPHRRHVYARLEGCEGTLVDFDFTVDPAGDAAAAV
                     AEKGAGVDDNSELVHTASVDRLKRAVLQAMGMPADRDIDLCWYLPTLDTCPIRNDEEL
                     IDVLHSDPGFEDSSAQLRYPPIYFLVKRNTLHLSEWAYAVKHQLLLQSPYALKATLQL
                     LQEVRGDGSAEAVRSLADTLATEYRYATRLLKRPDFYQVGQHVDKSPEEWDIVKEERV
                     RYVHKEHLPSRPLPDYEVVFERNVQLDGHTFQLRPRWSPRTVQEVTAESLAPLATPLD
                     FEKDGAVEFNVVVYASKADRLAGMIEDAGGLEVVAHLGEVDKEGNAKVPPLHGDAHVP
                     TNVSFYEMARHPWEDTPSSWRRDGFTAGSKEYFDQQYKKAEKAVYDEAGRGQRNYWPS
                     KAAVDGVTGEESNALLEERFFAKLRDAERGVESWARQLRKKAVEGKLDNKTEIATQQE
                     KIYDDDYYRWFIQPGHNPNPSGLLRGRKGADSGSSSVDKDLEVFLNQLLSGAAERGAD
                     GTAGDEGEALILPEEDADEAADST"
     gene            complement(<1322006..>1322836)
                     /locus_tag="LDBPK_363450"
                     /db_xref="GeneID:13388346"
     mRNA            complement(<1322006..>1322836)
                     /locus_tag="LDBPK_363450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865412.1"
                     /db_xref="GeneID:13388346"
     CDS             complement(1322006..1322836)
                     /locus_tag="LDBPK_363450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865460.1"
                     /db_xref="GeneID:13388346"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="UniProtKB/TrEMBL:E9BU54"
                     /translation="MVSYLEGQVTRDGRKRAPRHLFGTNYRKPFPWIRVGLGLAAMAA
                     AAGMVYRRMSYVSPQEQFVRKIKIRPYGVMGTQMTLQGSLRQEGPRPDDTMVITDPCD
                     LMHIFTSAAGATGTSGAIYKWVGLTKAFPNDVVMAMSKVGDAKHHQYGLKDSEAGEKH
                     VIHVSAPDFREGIWSEREAAIELSRAYRNVLHEYVVSECDTLRMVPLSDGLQAGPLYN
                     QLPAITHSALLMGFEQLHLFDKEYVLRDDKNIELCVFMNREWDMFNNAFENLPVGPTG
                     "
     gene            complement(<1325119..>1327566)
                     /locus_tag="LDBPK_363460"
                     /db_xref="GeneID:13388347"
     mRNA            complement(<1325119..>1327566)
                     /locus_tag="LDBPK_363460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865413.1"
                     /db_xref="GeneID:13388347"
     CDS             complement(1325119..1327566)
                     /locus_tag="LDBPK_363460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865461.1"
                     /db_xref="GeneID:13388347"
                     /db_xref="UniProtKB/TrEMBL:E9BU55"
                     /translation="MSRAREVSQKLTCYGGITLPNIPRIAPDEKSRQKYLSEYEKYEP
                     ELRRHHLGDAETTNTIGLKDVPPDFDRTMPSLLDPTAAEVEYERAREGRKAQVLRKGH
                     RGASARVAQAAGTVNPAPAARKSISPQPSQTALADEEPQQKGTPSPSSPSSAAGTPTT
                     AATAASAASEEAARLTPVEADGTRTWDAVVIEVAPAHVPRPPSERSHPKSATATTPMS
                     QPRARTAPSLKPQQDATRLGTRTGTSPAASARAARPKSRPRAQPERATTPATAPTTPR
                     RLRTPFAAHEPPTAESTARVLRVLLDPPQQYASSLHLDLSSFDLGWLRNGQAAPRHLT
                     TIAKHFNDNGASPQLRINSPRSVIAFLENGASPKDWDPRSSAASASAAALGGATQDMA
                     AVQVEVHEHRRAYVQAQRDALRRTLQDSYSVLCARVPFNELVGWYRRLCEADMLADAA
                     LEEQQHSLATAVRQLQERQRQVFETNKIRMMRQMQQAKELQERQEASVQRKLQAEAEA
                     GELRRQKALEEQERRRLQQARLEAHRAERQRREEAYKQQLQARLNRAETCNAERMAAR
                     ERQLQAMQQRREAQEAERLRRLERSTAVLEEKFAAKEQKRREKAAKLEQLRAAREARL
                     AEERRALAEKQQRAAYLREEAKRRSEEAEEAARREALQRQQHAEERLREFQSRRHEEA
                     AQRAVAAAAHHERCNEIRSQALAKEELFKATVEDKHRQSEEHHRERQSRQLTEFMWRR
                     EANWEEEEAKTYAVLQLQRIAEFNKLHTVVDLLEKRKAANAVVRHRELICEKVMRARD
                     ELRAGRDILKQEIEKSS"
     gene            complement(<1328967..>1330190)
                     /locus_tag="LDBPK_363470"
                     /db_xref="GeneID:13388348"
     mRNA            complement(<1328967..>1330190)
                     /locus_tag="LDBPK_363470"
                     /product="actin-like protein, putative"
                     /transcript_id="XM_003865414.1"
                     /db_xref="GeneID:13388348"
     CDS             complement(1328967..1330190)
                     /locus_tag="LDBPK_363470"
                     /codon_start=1
                     /product="actin-like protein, putative"
                     /protein_id="XP_003865462.1"
                     /db_xref="GeneID:13388348"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:E9BU56"
                     /translation="MTGVSASIQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTR
                     RPRPTLLQHPFDIATGDAAYNDGGLLSLTYPVRAGHVYDYDALEKLLFYALVEEARVT
                     PDASPFLFLEPADQSRLARERLCELLFESFNIPLAGLLTNTAATLYSSGRTRGLALDS
                     GAGRTCVAAVEEGYTLAHSVRSSSIAGEALTDELFAALRAGGYPLSTAADRDVVEAAK
                     EALCRVSADAKDEEARQVGTHSHPDPADGFILPDQERIFLLEHAYKVPEALFDSTYLT
                     YTTAMSAERPTTPTGYSQSNPIVKKTLSGWVGMLCDAAAAAPRILEQVLYENVVLGGG
                     STLFPGTEQRVQREIADIAPKGVRATCVAFPERGAAAWMGASIWGCSSVFPDTCLAKA
                     TYDEQGSSVVHLYTQ"
     gene            complement(<1331448..>1331912)
                     /locus_tag="LDBPK_363480"
                     /db_xref="GeneID:13388349"
     mRNA            complement(<1331448..>1331912)
                     /locus_tag="LDBPK_363480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865415.1"
                     /db_xref="GeneID:13388349"
     CDS             complement(1331448..1331912)
                     /locus_tag="LDBPK_363480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865463.1"
                     /db_xref="GeneID:13388349"
                     /db_xref="UniProtKB/TrEMBL:E9BU57"
                     /translation="MLRRSADRYMKPFLHAFSPGARASEKGMLYRNSYMNAHAQVASI
                     QSTHRTRRERTIFLLLLLPDQVFMCIIVFATGCVAVAVLFRQQPFSTNLNKDRWLSGG
                     MNPHEQYERNATMSQIFEMHKEAIDNTRAELTRPQVFSAPSGYHSPSGVYAP"
     gene            complement(<1333206..>1334432)
                     /locus_tag="LDBPK_363490"
                     /db_xref="GeneID:13388350"
     mRNA            complement(<1333206..>1334432)
                     /locus_tag="LDBPK_363490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865416.1"
                     /db_xref="GeneID:13388350"
     CDS             complement(1333206..1334432)
                     /locus_tag="LDBPK_363490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865464.1"
                     /db_xref="GeneID:13388350"
                     /db_xref="UniProtKB/TrEMBL:E9BU58"
                     /translation="MSTYANSQARLNRVAPQLRPAGVHGDWTEATTAELLSSYNPNGI
                     ITPDHIRSFHHRGCDVGEQRRHWGLAKDAPVDPNMRHGVKGKETGGADACLRPEMYAD
                     KMTALLDAQRESQYLSYRRKPLGHAPVPRDPVPVPFGGFGITQKKGDSTQSVLAGYRS
                     VGVLHPAGEQLTRNYDWERAGIDPTQHRFGKPSARSDGTTAAALFNDSATQLRSKLAK
                     DYETTVAKELGKSKSYGLDDPAEWDEEKRGSVTKFGATGTAASYFQTEQPTVRELLSS
                     WAQTASGSRTDKAASGKSGQQGLTGFAEAAVAAKADASAAAPVASGPSLTGPLKDEVR
                     AHQLLYPCHYVSLGVESKYFAGGRPLEDIRRLCHKCGFGMSDADIDAVFAIVAKGGST
                     CSIEEFKNAARARGYM"
     gene            complement(<1335683..>1343284)
                     /locus_tag="LDBPK_363500"
                     /db_xref="GeneID:13388351"
     mRNA            complement(<1335683..>1343284)
                     /locus_tag="LDBPK_363500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003865417.1"
                     /db_xref="GeneID:13388351"
     CDS             complement(1335683..1343284)
                     /locus_tag="LDBPK_363500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003865465.1"
                     /db_xref="GeneID:13388351"
                     /db_xref="GOA:E9BU59"
                     /db_xref="InterPro:IPR027272"
                     /db_xref="UniProtKB/TrEMBL:E9BU59"
                     /translation="MSSSHEFITMDGGPAPISRRRVATLHVLFFALATISAVSLRAPM
                     WLIGGLVYCSKHRSALIGQHLFPLRLWQVLLASLVASTVCSLVANLVTTLQYNTAWVQ
                     KAVWRTLYPLWALLGVQQWDAADYVNTIVWPLATAVVLGAYLSILKRTLAGRVLSRND
                     ATRTVQDRPVPSSFLPRWAGAALAAHRPAAGPLLSLFSWAAAWTAEPSLVGLCLEGFT
                     FVFAAAFLYVEHRIRKPPGRAVQSGKGAQRHIPHAFGTAVAVVLVCVCVTQNGAFFFF
                     TNAHGDWCRLLGMGPAALDTVAGLRYAMQMVGMAGVFLGAAFMCHGTESSESALPDSG
                     ADAAVPASGEATRLLAARDQPVLVTPVPDAFSPSTSARGERLPNRHRRAPQVVAIACI
                     TALLAYAVYYPSLVSTAVWLLHLCCCAGGLVQSPMAPPSPHRIAIACALAVLCCTILV
                     QYVFQALAGNPRTAAWGQWSPARPAYPDDGRAVGAQVVAEHLIALLFGVYVSIAGVDG
                     TGGGGNSAHEGAEPAAPSRSSLVNRVGFSTEANAHFTDSVQVTWLRAQLSDAAADRKQ
                     MRYLFQVAVGRSPRTIELNAICAAAAQQSGASSPVASRGGLTVEEVAQLLVSGPFYTY
                     AVIFCMFVLGTSGVSMDLLHATCLVVSLCVSVIGGNAMLYRRVRSVPPVCVAVVVGVQ
                     LCYGVFAAGDEKQRQQQQQRQLVPTGTQPSFLKATLCNYVGLTSLTWEDCAPYLCAQL
                     VLMWCSRYTPKWLTNWTHIAQCLAFRCSWARFIRTVHQVAGVVALAWIALLLPRSASV
                     TGLILLLFTVALLQHLRLHRLAYVWRRFFVVGYCGVVLMCMLTAEFEPVQPRLWQLLR
                     TLGCPPGSEGRCAQDIGLPADSAMWLTPLSIPWWLIIVLATATARPHPLPSSLPSSLA
                     AAPATGIPEASTPWFWRALVWWPKVLSNVLSIAILAGMVHTALQRPSILAALYLVGPG
                     LGVFPCWTFGVAAVHAALQCVYQLWFSPGWLDAQTRLGVSAAQLLGLWRPSSAMGSAA
                     NLPSTLVVAAAPLLVGAAQFLQLQCALLARWRERNTVATCSGQGRMWCRLQRTCATHL
                     YVLLLWVLLYLTQKIALGWGVGVLITVVWISAEVRSCGVLQRRRWLFGACGSATAVLM
                     ALAYLLHWLHTVFPWWSALATYPYLFGGSTNEDKMMAELQSVCCAAAAACAVLRVSSG
                     APRDKESEHLLRHSHSPSFLDWLRRHSRQLRENREDISASLSEMPPDEIRYFFRDVAG
                     VFHCDEEAAEGADTSPLSTGPAPPSKGGVVVSVARRVPLVACGSVAVGSATASPPCVL
                     RAALLLAGLCLAARHPRLHWSFWRWWRLTVALYALLPLIALVAACPCVRDAIPKLPLW
                     MGLLIGWSVDASHVDGNALVFSHRHVMLFLCLWLQSCVYNCPQSGTALLRQQGEERLL
                     SETRHAALQRQLLSHMANATEKVVRVDREVCSYLDALRAGDDVVFTCQVCSRRSPDYV
                     EEDGDEHDSDAERVRVSMPSPPSMTPVLEAEEVNEVLDDAGELPRPLLTFPAADSRSN
                     APTLSSDQAQPPLSRCWRQRCARWLRRICDKLAACTYHPSEYRLSAVAADSSTSTLWL
                     LSQYALRAAVQVVLRHTPFALLGCSVVNSLLTGCLWELIGLCYVVQVALAYHPHPPRL
                     VYKALGVYVGAGVLLKEAASMWTIFGNTNSSLITALSWILLPLKGQDRSSSNSNQVWA
                     NVPYSRGPLRYGTLWMDLVTIGVIVLHDRVCIIHGVHVERDQQQSMERDRSDVTAMLE
                     GPASSAGGASLSTSVTAATTVSPSASFLLLTPISHGTSIISAFRALVADYSQNLLTVP
                     GVGEDWYISYTSVDSLALLIVAVYYSRIAGNNNGTLQDNVQNNLLPGPMALLICVSVL
                     QLVMDRMLYVQRSMRLKAIANGVCAISYTLFYWWWRNAVTVSEHATGNVYFALKVVAL
                     VLSVTQVCRGFPVHRRRHIFTTHLGSLLSYSFTVYRSLPFLWELRTLVDWTVLRTSLS
                     LQEYLTVEDIYVYVYQCRDRYLEKHRNNEKLGDAVAPLSKWAFGVSRLALVLLALLGP
                     LLYYSTYNPSTVANSATQLNFQLSFFGAYDFFATTVRDNVTTPEGWWTWIERTRPTLG
                     SYGFMAEGKTVQLMEFTSCSSSLWMASPQAVRQVLAGLRAVASNASSAYVLQTLEVSR
                     SVSSTDAAAAASLVNRWPIPWDTAQDLVAILERETSGTRGAAVEDSENSSSSSSSSSS
                     IVVGSASLPFFYSPFVFNRASRIDGLPTSLRFPHRNQHNCTLELNHNTDVALNSLVRY
                     WCLHCAPLFPEGNIPSENSSSAAEWRCLTTGEGCDDFNYEDATGGSGSRTVRASLAAQ
                     MNSRVAAKQVPMYMVIISGTVVMGISLLKGIGIVALYTTFVLALGRLLRSVLTNQTST
                     LLYSNMANPAALQNMVRCMEMAREYGDLRLEHTIYLELVDLLRSAERLFRVTGPLRCM
                     YGDAGHEDLFGLGQVRRRNIRRNPSVEAHDGEAGEGHGDSGVPAAVPHPAQGG"
     gene            complement(<1344460..>1345047)
                     /locus_tag="LDBPK_363510"
                     /db_xref="GeneID:13388352"
     mRNA            complement(<1344460..>1345047)
                     /locus_tag="LDBPK_363510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865418.1"
                     /db_xref="GeneID:13388352"
     CDS             complement(1344460..1345047)
                     /locus_tag="LDBPK_363510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865466.1"
                     /db_xref="GeneID:13388352"
                     /db_xref="UniProtKB/TrEMBL:E9BU60"
                     /translation="MLRLTQAVLRVQSHQKKRAQHPNAGTRYGRVYNRGFVRYGFGGF
                     GMSVYSPKKDRTFKVMPVPPPPPATTTVEQRDDFADNRGLSATTRTLSPTFRMFALED
                     GGVFVSHPSHAQIMRWNQRVHTEEGKAANSTVMDEYVNSRIQAIIADNTIENTSLSQW
                     RKAHMWNVIKSHGKLQRRWGTPDFVTGARSTLYNN"
     gene            complement(<1346786..>1347457)
                     /locus_tag="LDBPK_363520"
                     /db_xref="GeneID:13388353"
     mRNA            complement(<1346786..>1347457)
                     /locus_tag="LDBPK_363520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865419.1"
                     /db_xref="GeneID:13388353"
     CDS             complement(1346786..1347457)
                     /locus_tag="LDBPK_363520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865467.1"
                     /db_xref="GeneID:13388353"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:E9BU61"
                     /translation="MASQPGDALGKIDYWVQYIDCALKHPRPLPAGKHAHRQSLETIP
                     EVAELYHCIYKLYNEEESSVWFREPVNALAQEIFTYYDVVKSPMSLRHILDNIVKGDT
                     YSTALQVMEDVELIWKNCITFNGANSLLATEAGKCRSALDRIRRAYQDDQRITVEEAE
                     RLFRVISSMQEQQLIDNIAEYLRRDDPTSIDETGAVNFDMLKRKHFRNLERIVDNYSK
                     SRTRS"
     gene            complement(<1348543..>1348851)
                     /locus_tag="LDBPK_363530"
                     /db_xref="GeneID:13388354"
     mRNA            complement(<1348543..>1348851)
                     /locus_tag="LDBPK_363530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865420.1"
                     /db_xref="GeneID:13388354"
     CDS             complement(1348543..1348851)
                     /locus_tag="LDBPK_363530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865468.1"
                     /db_xref="GeneID:13388354"
                     /db_xref="UniProtKB/TrEMBL:E9BU62"
                     /translation="MGLKRLAKATKITSKHMLLLNRREPYKPVTSDRVMIENRRRLED
                     FEAKNAEGIVFVPDTALPPWQKSIATNLKQQATQMNFRGFRVRVADKQDEPGFPTHFR
                     "
     gene            complement(<1349916..>1350323)
                     /locus_tag="LDBPK_363540"
                     /db_xref="GeneID:13388355"
     mRNA            complement(<1349916..>1350323)
                     /locus_tag="LDBPK_363540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865421.1"
                     /db_xref="GeneID:13388355"
     CDS             complement(1349916..1350323)
                     /locus_tag="LDBPK_363540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865469.1"
                     /db_xref="GeneID:13388355"
                     /db_xref="UniProtKB/TrEMBL:E9BU63"
                     /translation="MFRRSSSVMRRAVSAFLKEPGQAKTFQETLAACKAENRDLASML
                     SSDFLLLQSKLFKYRIARLGEETRYVMKHPLGCLPSADMVLVHFVAVPLVFFAAVCIG
                     RGSSRPLVQPPTAKMEVAAAAAATADAAEEEQK"
     gene            complement(<1351242..>1351454)
                     /locus_tag="LDBPK_363550"
                     /db_xref="GeneID:13388356"
     mRNA            complement(<1351242..>1351454)
                     /locus_tag="LDBPK_363550"
                     /product="ribosomal protein L29, putative"
                     /transcript_id="XM_003865422.1"
                     /db_xref="GeneID:13388356"
     CDS             complement(1351242..1351454)
                     /locus_tag="LDBPK_363550"
                     /codon_start=1
                     /product="ribosomal protein L29, putative"
                     /protein_id="XP_003865470.1"
                     /db_xref="GeneID:13388356"
                     /db_xref="GOA:E9BU64"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:E9BU64"
                     /translation="MAKSKNHTNHNQSSKNHRNGIKGPMPLHLHNSKRGSWLPALVNA
                     RRVRKHNQKAALKKRRERIAAFAAKN"
     gene            complement(<1352549..>1352761)
                     /locus_tag="LDBPK_363560"
                     /db_xref="GeneID:13388357"
     mRNA            complement(<1352549..>1352761)
                     /locus_tag="LDBPK_363560"
                     /product="ribosomal protein L29, putative"
                     /transcript_id="XM_003865423.1"
                     /db_xref="GeneID:13388357"
     CDS             complement(1352549..1352761)
                     /locus_tag="LDBPK_363560"
                     /codon_start=1
                     /product="ribosomal protein L29, putative"
                     /protein_id="XP_003865471.1"
                     /db_xref="GeneID:13388357"
                     /db_xref="GOA:E9BU64"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:E9BU64"
                     /translation="MAKSKNHTNHNQSSKNHRNGIKGPMPLHLHNSKRGSWLPALVNA
                     RRVRKHNQKAALKKRRERIAAFAAKN"
     gene            complement(<1353569..>1354489)
                     /locus_tag="LDBPK_363570"
                     /db_xref="GeneID:13388358"
     mRNA            complement(<1353569..>1354489)
                     /locus_tag="LDBPK_363570"
                     /product="short chain dehydrogenase-like protein"
                     /transcript_id="XM_003865424.1"
                     /db_xref="GeneID:13388358"
     CDS             complement(1353569..1354489)
                     /locus_tag="LDBPK_363570"
                     /codon_start=1
                     /product="short chain dehydrogenase-like protein"
                     /protein_id="XP_003865472.1"
                     /db_xref="GeneID:13388358"
                     /db_xref="GOA:E9BU66"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:E9BU66"
                     /translation="MSRVAFAALLSLAVALLSRHVYRRVNRQRLQAGAVALITGGGSG
                     LGMELAKIFAVSHCEIVLVGRNEAALKTAAQVCREAGAPRVEYIQADISKVEGTDRVR
                     SEYARLYKDTARSLAPPLKYLVLNAGAGAIAPFTAEPAFEQMCHAMMSINYFANVRLL
                     QAFLPQLTQNHSSSSPSRIVVMSSLAGVLPSILRSAYTASKHAIQGFMNALRGETAVR
                     ITLCCPGYVDTDFHSRVLTNDGKPLRGNQRRGVSPAVCARQCMDGVLCDDAEIVMTTG
                     GKLAYRLRPFLTGIIDVLVKRKSLQSLEHH"
     gene            complement(<1355250..>1356335)
                     /locus_tag="LDBPK_363580"
                     /db_xref="GeneID:13388359"
     mRNA            complement(<1355250..>1356335)
                     /locus_tag="LDBPK_363580"
                     /product="vacuolar protein sorting-associated protein-like
                     protein"
                     /transcript_id="XM_003865425.1"
                     /db_xref="GeneID:13388359"
     CDS             complement(1355250..1356335)
                     /locus_tag="LDBPK_363580"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein-like
                     protein"
                     /protein_id="XP_003865473.1"
                     /db_xref="GeneID:13388359"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:E9BU67"
                     /translation="MLRDELPPEKGQQSFSLLSRILRSIDGCKLEIVLDDKTEEDKIK
                     VVDIYDKVSERFPLYSWKEPVKGRVVVTPTGSSYSHQGVVVELIGVASTFREVESRVV
                     FLRQERQFEPDTLNQPTPFEFIFSAPKEHESYHGIYARVRYFVQATVKQRIKSPSVKA
                     EVWVHRVDAALSESQPDASAHMNYFRETCFGPESIAMNVGVDNVLHIEFRYDKKIFHL
                     AERVLGKVEYKVADMDIAYGEVGLVRKEFLAPGQTGETMESETLQKFEVMDGTPIVEE
                     VVPIRLYLKSVPRLTPSYMNVENLFSVRYFLNLVLVNQEGKRYFKQQEIQLYRRTGQE
                     RPPTSFNSGLPVKHASGDVDTKGGWSA"
     gene            complement(<1357643..>1360021)
                     /locus_tag="LDBPK_363590"
                     /db_xref="GeneID:13388360"
     mRNA            complement(<1357643..>1360021)
                     /locus_tag="LDBPK_363590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865426.1"
                     /db_xref="GeneID:13388360"
     CDS             complement(1357643..1360021)
                     /locus_tag="LDBPK_363590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865474.1"
                     /db_xref="GeneID:13388360"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:E9BU68"
                     /translation="MPGKASGGVVAITPTDWEAQYERDFNAQKSSGSIIFSEEERRKN
                     RELCSRLRDILPFDDAYKVSDCDLMYRFLIGKHWNVASTEKGMREYARLRKSDDLNNI
                     IGEQLHPTICSVLSPMYKDEPCPIYGLDKEGLPVLWLSPDANKLMAAMKDFTSEQLLR
                     FQLRSMEVSRYVCLQRRVDRCTYVIDLGGITMSSVSKATLALLKGVMNLLQVAYPEIM
                     RRLLIFNTGWAVSAAWKVLRPLVDMRVQDKIKFESGPPTLAVLEQYIAADQVHPSFGG
                     TGSANVLGPIIDAEVRRIRRGVEGRVSPDPAAAAASVVHRPSLESRQSTTLLSRDALT
                     LYSVESTTPLSTACPSPNCNPSLACGGHAEERERVVIGMPSAVTAWLVKTSTASGPLN
                     VLDMSLSVASSSGEYACCRKQASPTPAADDATKRSYRGVASPPSRDPSADGTAAPSRE
                     PVPIHATTSIEPTTQQQTELPIVAISLTYGADGSISGYCGRQCVGCFQQGLLYAPATD
                     DDDSAFPRRFPSLLPLSQSSVVGGCAGRSVGVPAGELLAEAGHPLHNFLIVCDAQRRA
                     RYLVRESRLRKRLTVYNVVGEAEVHTGKNNRHYVEGERAKLGVVVPHSNATSCGGKED
                     WMLYGEDVTKRSSRNPTLPLQQLFSKTKRAVLTAKKSRSSDSLDKSQNGRWAASIFAA
                     LHFRVYSPAKRKPKSISFMASGSASVPPPSLPDQSGKSCDAVTDDSTQLLAECKGQTV
                     RFYKLSTKNSLPDLFALAVAITQSWSNEMDSCKGKAAASKETHYSSDDDVMP"
     gene            complement(<1362887..>1363540)
                     /locus_tag="LDBPK_363600"
                     /db_xref="GeneID:13388361"
     mRNA            complement(<1362887..>1363540)
                     /locus_tag="LDBPK_363600"
                     /product="SNF7-like protein"
                     /transcript_id="XM_003865427.1"
                     /db_xref="GeneID:13388361"
     CDS             complement(1362887..1363540)
                     /locus_tag="LDBPK_363600"
                     /codon_start=1
                     /product="SNF7-like protein"
                     /protein_id="XP_003865475.1"
                     /db_xref="GeneID:13388361"
                     /db_xref="GOA:E9BU69"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:E9BU69"
                     /translation="MPAFGNMFHRTTPEEEVRKWTRSLRSEQRKIELQITKIRREEAK
                     VKLSMKQAAKQNDQVVMRMLAKEMIRSRKAVNRMYASKAQMNSVSMQLQNQVSQMKMS
                     GSLKKSSEIMKEMNSLVKVKEIQQSMMAMSKEMARAGLIEEIINDTIDEALDDDISDT
                     ELEDEVNKVVMDVVQGQMDGARVGASRIPAQQQQQEEAAEEEEEDELMEKFNALRNS"
     gene            complement(<1364626..>1365483)
                     /locus_tag="LDBPK_363610"
                     /db_xref="GeneID:13388362"
     mRNA            complement(<1364626..>1365483)
                     /locus_tag="LDBPK_363610"
                     /product="glycosyl transferase-like protein"
                     /transcript_id="XM_003865428.1"
                     /db_xref="GeneID:13388362"
     CDS             complement(1364626..1365483)
                     /locus_tag="LDBPK_363610"
                     /codon_start=1
                     /product="glycosyl transferase-like protein"
                     /protein_id="XP_003865476.1"
                     /db_xref="GeneID:13388362"
                     /db_xref="GOA:E9BU70"
                     /db_xref="InterPro:IPR002654"
                     /db_xref="UniProtKB/TrEMBL:E9BU70"
                     /translation="MRTSPLWRLQMNSRPFSLERIFAINLDRRPDRWAAVQAVCARAG
                     LPAERTERVPAVEGSRLDVNAAHRCGFVSALGLRRLKEPPEHHIWGMDLNKAALGCAL
                     SHIHLWARIAALGTVSNFSAETPAAALPKQCFLVLEDDSTLTDSDDSGSGSPAASPSL
                     PFLDQLQRRMNSVPPDWELVYVSGLDTARQCPHMQVAKGVARVPQYHRTTNAYLVTPQ
                     GARRLLATCVPLTFQLDTAMTMNVGYPPGVVGVAGAQTLPHVLDPVCYTLQPPLMQQA
                     AQLGTDIQH"
     gene            complement(<1366492..>1367094)
                     /locus_tag="LDBPK_363620"
                     /db_xref="GeneID:13388363"
     mRNA            complement(<1366492..>1367094)
                     /locus_tag="LDBPK_363620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865429.1"
                     /db_xref="GeneID:13388363"
     CDS             complement(1366492..1367094)
                     /locus_tag="LDBPK_363620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865477.1"
                     /db_xref="GeneID:13388363"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR012577"
                     /db_xref="UniProtKB/TrEMBL:E9BU71"
                     /translation="MLRLCGRHLGGVKSASHVYELRTYVVAPEKYDSFHQLSMKYMPQ
                     RPRIGICQGCWTVQLGGVNQYIQIWRYENLKHRYDCRKQLEQDHEWLRTYVKPADDMM
                     ISKSNTLLRLVYREGNASTQSYKYLMQVSPHKEVELSGPSAILAATFQVIVGEEEGKY
                     IHLVKGHKLDDVIPVTPTLGCSSKIMGPVRWSSTMNCLWR"
     gene            complement(<1369424..>1372462)
                     /locus_tag="LDBPK_363630"
                     /db_xref="GeneID:13388364"
     mRNA            complement(<1369424..>1372462)
                     /locus_tag="LDBPK_363630"
                     /product="2-oxoglutarate dehydrogenase E1 component,
                     putative"
                     /transcript_id="XM_003865430.1"
                     /db_xref="GeneID:13388364"
     CDS             complement(1369424..1372462)
                     /locus_tag="LDBPK_363630"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase E1 component,
                     putative"
                     /protein_id="XP_003865478.1"
                     /db_xref="GeneID:13388364"
                     /db_xref="GOA:E9BU72"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:E9BU72"
                     /translation="MMRRLVPVRGVVSCVSAVAPTSAFPRASHAALITGRRHAAEVVP
                     ERQLLFDNDSFLSGSSAMYMDELYQQWKKDPASVDASWAELFSRSDLGNYDHALLDTP
                     ICVLPTESSDEAVVKQSLADCGRLIRMIHTFEDRGHLMAQTDPLNYMDTDVTERTPSR
                     RYKEMVRLDLAYFGFSDKDLDRVVRVGFQNQMGGVYDTSSPPMTIRQLHELLTERYCG
                     RIGFELVHLTDGDAKRFVRSQIELKDSSSALHRPMSREERLRIWDTVASAVFFEDFFK
                     RKYSTQKRFGCDGAETMVAGLRALLEKSSEFGVQTINLGMAHRGRLNVLCHVIGKPFE
                     VILKEFVGVTGQELHPFQIQSDVKYHLGYRGQLKLNSGKVMQTEMLCNPSHLEAVNPF
                     VQGYTRAMQVSLGEKGREKVLPIEIHGDAAFAGQGVAFETMCISEVGEQDTGGTVHLV
                     CNNQIGFTTDPKSSRSSAYCTDLGRVYNCPILHVNGDYPEEVIRVFEFAAEYRARFHK
                     SVVIDLVCYRRFGHNENDDPSITQPLMYERVRAMPDVFRRYTDALITQGIVTPQQSTQ
                     KAIDEKARYGSYQEAAAQVNYAEYLKKSIPDKWKCMKYSDELGNVTQHPTAITQETVN
                     KVLKALKTYPEGFQLHPKLKAVLDRRNETIETGEGIEWGTAEALAFGSLLLEGHQVRV
                     TGEDVERGTFAQRHAVIHDQSQERTYVPLAHISDMQGRMIINNSPLSEYGMLGYAAGY
                     SLYDPTSLVIWEAQYGDFANGATIVFDQFLSAGESKWNQQQSCIVTLPHGYDGKGAEH
                     SSGRLERFLQMSSEDVTTPAYSKEERAHRINWEIAYPSTPAQYFHLLRRHQKRNFRKA
                     LVIFFSKKYLRAPNVSTLEEFTNGEFQSVIPDLSVPASQARRLVMCTGQIYHYLNKYR
                     ETKGVKDVALVRVEELSPFPVAEVQQLLAEYEKAELMWAQEEPKNMGSWAHVEPRIEE
                     YTKGERELRYAGRSITAAPSTGYKSKHDKEQEIICEMVFH"
     gene            complement(<1373987..>1374616)
                     /locus_tag="LDBPK_363640"
                     /db_xref="GeneID:13388365"
     mRNA            complement(<1373987..>1374616)
                     /locus_tag="LDBPK_363640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865431.1"
                     /db_xref="GeneID:13388365"
     CDS             complement(1373987..1374616)
                     /locus_tag="LDBPK_363640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865479.1"
                     /db_xref="GeneID:13388365"
                     /db_xref="InterPro:IPR026714"
                     /db_xref="InterPro:IPR028124"
                     /db_xref="UniProtKB/TrEMBL:E9BU73"
                     /translation="MTSFKDCLREVREAATEHLEGCRGGDTEKALQHIPREEALTTIS
                     LVAIRLLEQELQKRGACDDASQNELHSKLKACRKALKSHSARSAAGDEGTSDKKRRRT
                     EDSTEEPTSSSSSRGTATADRSGTSKLIELGQYASSDAFDENEQKRMKFARLMGGAKV
                     AAQEKGGAGGHSRHNTFAASNAELKRMNANLESQFEFAMSHKGKKGLGA"
     gene            complement(<1375522..>1376541)
                     /locus_tag="LDBPK_363650"
                     /db_xref="GeneID:13388366"
     mRNA            complement(<1375522..>1376541)
                     /locus_tag="LDBPK_363650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865432.1"
                     /db_xref="GeneID:13388366"
     CDS             complement(1375522..1376541)
                     /locus_tag="LDBPK_363650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865480.1"
                     /db_xref="GeneID:13388366"
                     /db_xref="InterPro:IPR021298"
                     /db_xref="UniProtKB/TrEMBL:E9BU74"
                     /translation="MVLVVVKGTNYPDEFTVERALTDALSSSEETPRGAADVNSPPHA
                     CSSLPSTSTIVPGIAHILNKRHHVRLMLMSAQELATLWPQHQHRSDGTASTEARETQE
                     PEEVLGRYQALIDGLYARLRDAKTPVLADEFDKAEHELRALTATLYSSLCTHADGPEA
                     AVQQLYTKHEDPDLDEDTRLVVYHCRALLDPEWKANERVKEDDAALWFCGKPMNATLA
                     KYCGRNEKSKVIVKVAPRKGPAPSCEPRMRYEDQRALYRALCQRREAYKQLEDSELRD
                     RVVQQSRSTRRLLLGAAAAFGSRTEGAPTVTPLASGTSSPAMLRTDGLRPIFPRKEER
                     ELPIS"
     gene            complement(<1377312..>1379774)
                     /locus_tag="LDBPK_363660"
                     /db_xref="GeneID:13388367"
     mRNA            complement(<1377312..>1379774)
                     /locus_tag="LDBPK_363660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865433.1"
                     /db_xref="GeneID:13388367"
     CDS             complement(1377312..1379774)
                     /locus_tag="LDBPK_363660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865481.1"
                     /db_xref="GeneID:13388367"
                     /db_xref="UniProtKB/TrEMBL:E9BU75"
                     /translation="MADPFLDVGNPLELEVTRLTQENRELRQENARLRARISLTATPS
                     ETASNAVSERSTLRRADDTAAVPVGTSPGAKPIDKPGGALSHRFTRAAETSSPKQHKQ
                     QAVSTARIEEAVQRVKKELRGEVEKYQKAAETKASQMEQLKQQFELFVTTTCEREAAY
                     ELVYMQVFRELEEQRALARIAQAQLEEQRLEAVEMRTSLQAAAAAAAAPSKCSTLVSL
                     SPSPPSKSEDVAVASSSSAARPVKRCRTGKTATHADDGYKSNATEAQTTQEEVVEVQQ
                     EVAMTAPNATPEPRQLRIVQGGAALRADSKTSRLKRPRASSAMSVSSATRSTRTRQSA
                     AAVAQLHMPASPVFAAASVSAADISVGVAVTSSSGTAATAFPAAASASSPARRTASDA
                     LGDLWTLLARHTEATHGFLPLWQHLARLRGSDRLAALRVMIPLLLHLLGPADATIPLV
                     LPAPLSASVAAPPTSITVLATAIRLLEVQLESEAQQQRGAAVSRADATAQHCSALFNS
                     LFYRICVATLRRWQTAEAGADAVDNWATALIHLYGFQPALSKLVQYTNSTIAYERTHL
                     AHSWVTYTAQAIFAQCLTSSSTSSAEVAVARWRELCDSIGWSPHSLPLERLEAAAARC
                     VARTRVGLGSFTAACAEEALLSLRLVVLYRGFDHMERIAALLEMPGVLPMVITKEIYA
                     ELVSLAVMDRAPFRTTDAIQHALRLLREYVQEVSPERCTSAEHFVSVPRLSHLLAALA
                     LLRVESTNTAATARSTETDSAFCEAVQEGRQTALRWLQAQKVALNMVRQSAALARDRQ
                     LLLRDTVLGQRLLRDASETVHS"
     gene            complement(<1380743..>1381312)
                     /locus_tag="LDBPK_363670"
                     /db_xref="GeneID:13388368"
     mRNA            complement(<1380743..>1381312)
                     /locus_tag="LDBPK_363670"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865434.1"
                     /db_xref="GeneID:13388368"
     CDS             complement(1380743..1381312)
                     /locus_tag="LDBPK_363670"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865482.1"
                     /db_xref="GeneID:13388368"
                     /db_xref="UniProtKB/TrEMBL:E9BU76"
                     /translation="MLSSSSSSTGAAAAAAAKPSAGPLSVALATVTVNEDPNIEVLLA
                     SKRIQKLTRATDALIARDFVLREEAAILDDLEAYIISLESEVRKAEFQTEELRSRSSL
                     LRPGKRCAIAGENAELSALWNEYGSDMGHLVKRHSLRLAVLEKALATVSTRNPESPVT
                     KPLPPPPVTKTSKAMPAMRDMSQRQKAHS"
     gene            complement(<1382463..>1383242)
                     /locus_tag="LDBPK_363680"
                     /db_xref="GeneID:13388369"
     mRNA            complement(<1382463..>1383242)
                     /locus_tag="LDBPK_363680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865435.1"
                     /db_xref="GeneID:13388369"
     CDS             complement(1382463..1383242)
                     /locus_tag="LDBPK_363680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865483.1"
                     /db_xref="GeneID:13388369"
                     /db_xref="UniProtKB/TrEMBL:E9BU77"
                     /translation="MTAAGDAHSGDSHAHDDHRGHHGVATAPYEKIKVPSMASEDYLD
                     NLPAFDTKKPMPKPRSAVERFTRVLQMQFGQDPDMPTLGYNTERKYHSLLDYLASPIT
                     PLRPRTYVDSHTRPNPCPEEYWWASWRWPRTKYVNAKVPPPVDGKYTDYYHYLAFKNW
                     LERERDVYVAHANLVHEMTSRCLVKEGQYNAAKNCRHLYHKGFAMSRMEELNQAMLYM
                     AMTGNAAIRETPYPENFVEEKRKIYDDWLYRTRMRKPGDAA"
     gene            complement(<1387408..>1388523)
                     /locus_tag="LDBPK_363700"
                     /db_xref="GeneID:13388370"
     mRNA            complement(<1387408..>1388523)
                     /locus_tag="LDBPK_363700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865436.1"
                     /db_xref="GeneID:13388370"
     CDS             complement(1387408..1388523)
                     /locus_tag="LDBPK_363700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865484.1"
                     /db_xref="GeneID:13388370"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR023114"
                     /db_xref="InterPro:IPR024559"
                     /db_xref="UniProtKB/TrEMBL:E9BU78"
                     /translation="MSTNQPIVKPFIYLRIPSEDAKPVEELHFNGHNEAELRHTLTRC
                     FRQSLLSDDQKKDMARHLADKASESAKKHAVKGDGDANAAGSGAEPPADVEQQQAAMI
                     DQYLEQASYEIIPVTMPMRSTQYIGTSLYIDDSGAFKDLPLNYRASKLAQREIRGDAF
                     LLSNHDDPALDEWGRVDCPLQRYEELYANPPQIAYDPSNQAQMTQAAMLRETETKKIS
                     LEDYEKAQKAKEDGNRLFAASDLPAAVQAYSMTVDLTDGRRDLLPNEEAATQLRLSAL
                     LNRCLCFTRLKKFPEAVKDAQAAAYLDPKSLKAYYRLTHALCGAQEYEAAAQACEKYA
                     QLGGAEEDVTAMRTAVAAGEAEAKKVQKQIFSKMFRS"
     gene            complement(<1389755..>1393249)
                     /locus_tag="LDBPK_363710"
                     /db_xref="GeneID:13388371"
     mRNA            complement(<1389755..>1393249)
                     /locus_tag="LDBPK_363710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865437.1"
                     /db_xref="GeneID:13388371"
     CDS             complement(1389755..1393249)
                     /locus_tag="LDBPK_363710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865485.1"
                     /db_xref="GeneID:13388371"
                     /db_xref="UniProtKB/TrEMBL:E9BU79"
                     /translation="MQLQSRAPEHFSAPFFASPSSSVACESGCSLDALERLVHFTGAG
                     ADACLYAVHPAQAEGADSAVLTPTAEGLRYWLNPSVRARPTTATCEITNLGPPFFAST
                     STSMLRISATPLFVDGRCFPTRCVVSLATSAQRLDGVSLRPVVVTEWNLTASGAAGVC
                     TTTVPLRTLYHLAVLISSFVPATGVEEVRLYLHLRFMGCSDGSDTHRIAAVRLRYEQL
                     GTAAEVLPQLLQRRQRAAARVMLPPSPYDVKDHSEGRVTRAGAPLEEVEVGVTAGSST
                     ATSSGGKDMGDDVGKGRLAGAKERRTPTSPPPSTRMRSDGGEDAAGEAQQQLLRSPPQ
                     RSATRPRAERSLSADRSSSSWIEAAGPTEGRDGPKLVCVDRVLRIPPPPPKSAAAAGS
                     APSLLSGPWPPRKVRTIVLAPSISPSLCSSSAGTSPRGSPLPLPSPPPTTNADSSAKA
                     HSNTSLAGTACCREAESCDREGFDDAVDALMPLTQQNVQGRFLECTKSDERTSYPVSA
                     AGTSSQRCRCHESSSVPRHIPSAEAREVPQTVAENRPDPHPHPFAPQQLYAHSDPAVL
                     WAATSLLGTLPWTLASQHQSRTSTPAASVASSRAPSCDGSAQAMPTDSAKGAPCWQMR
                     QPAPSKSFLDPGSCAHRRDTQQPQQKSWKRTPLGALDRNTNSHRPERTTVAAKADSAA
                     MTQTYSTESTTAFPRHWRRDESAHVSPQLHPPHPFATASLSPSHPEPFSRPSIPPPAT
                     TYAPLQRPTSAFVPRLLLRSRQRSNETRAASFTQRGGGAITTNSSRSIGSSAATTGTA
                     ASAPPPSQNRGLWSKAAAPGGASSSLDARPRRSATADVHERRRLSTAAFPMSSSAVLS
                     VMPSSWLRGNATVAPEAPTESAAEVKSQSSTASQRSFRSSTAPPSSRRPQYVSSPAGA
                     ADMECMEDTVSVASGSSAPLPPSPLPPPESCALFHSPAPTHSSLSSSPSSSSSRSRAA
                     PALPLQEAHDGSRNRNRPRHRSVAQSGGGHGSNNPSTFRQCVVQTFAVWKHHASRRGV
                     GRRWLRIERLPPSPSTSAAVRFRITLDKVHPPILARASMLLGRSSSSSGNNSVHAANP
                     SCEVCIRRTDKVEVWCGLRAYHSGVIHHSKVHRAECCLVIRCNAQLVMAVELESTEAV
                     DTVRRLLSDRQLTSQANR"
     gene            complement(<1394227..>1395405)
                     /locus_tag="LDBPK_363720"
                     /db_xref="GeneID:13388372"
     mRNA            complement(<1394227..>1395405)
                     /locus_tag="LDBPK_363720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865438.1"
                     /db_xref="GeneID:13388372"
     CDS             complement(1394227..1395405)
                     /locus_tag="LDBPK_363720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865486.1"
                     /db_xref="GeneID:13388372"
                     /db_xref="GOA:E9BU80"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:E9BU80"
                     /translation="MRNKEATDYYRALPQNELSKEDMWRRINEASADRAEATGTAIGS
                     AEVDYIKLEDELRDFDLFHYRIGEMAYPDQAMRRDYYALWNLAMSLNKARWSMLEVHS
                     QRGMKTTGAGMKLIFWKESVGAIMEKRKMCTGQFTDSHPVLRPFAAAVERNPHMTKAF
                     VRGFTDARLRVIQQPGNVQQLFDHFDKFYGYFFNSLLEVTHIKDEATEHLMTHVGRAT
                     GLTNHCVMFWKKYARLGFTMLPADLCADNHVNLGLLKNIPLASRDRAVRKVLFDVMCI
                     VKDEMLHAQKCAKDVPPKTWPIVMECLYANYYLGFLQRRDFNVSAMFADHNIENAGFT
                     WYRLKKRWEWERYQSIERLVDEAAPLPYINTSFAHRGSHYKMASGVGSGAPQAQRKRS
                     "
     gene            complement(<1399778..>1401595)
                     /locus_tag="LDBPK_363730"
                     /db_xref="GeneID:13388373"
     mRNA            complement(<1399778..>1401595)
                     /locus_tag="LDBPK_363730"
                     /product="signal recognition particle receptor like
                     protein, putative"
                     /transcript_id="XM_003865439.1"
                     /db_xref="GeneID:13388373"
     CDS             complement(1399778..1401595)
                     /locus_tag="LDBPK_363730"
                     /codon_start=1
                     /product="signal recognition particle receptor like
                     protein, putative"
                     /protein_id="XP_003865487.1"
                     /db_xref="GeneID:13388373"
                     /db_xref="GOA:E9BU81"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007222"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BU81"
                     /translation="MIDTLSIVSDSGVVLWQCTTHETGRRVMVNKLIQEVLLEDRAGL
                     AQYSVDNYQLRWVLENDARFFVVAVYPKFFKPHYMHVFLRDIATTFAKKYGKQTAQQD
                     FFSSIQGSSNQVPAENLMEFSAEYAALLAKFNASEEAASRHGVEGEDRDEAACSGSSG
                     AAGEASDSGSAQEDSAGVGVYGDNPQQPAAQNAGKVIVTKDGRRLTIGGGPGKGNASG
                     ASEAAASSGAVKKRGKKPTRWDNPGAVHDPMVEKQLHEKKATEEELQAQASIQRETYI
                     KRLPNGGIAPVKEREWEGQSRGRLATWLRSYVGTREVDAEDLKKIIPDLREKLIAKNV
                     AVEVAEHVCKSVEASLAGKRLGTFDSLYKTVEDAMMASLRRILQPKCEVNLLRDVAAA
                     KAAGKPYSIVLCGVNGVGKSTSLAKITYWLQQNGNSVLLAAGDTFRHGAVEQLGVHGR
                     CLGAPVFQLGYGTDPSAVAAAAMAQASKQHIDVVMIDTAGRMQDHESRMRALAKLIHD
                     NQPDLVLFVGEALVGNNGIDQLRKFNQCLVDFAPVGSRSRGIDGIVLTKFDTIDDKVG
                     AALSMVYELGQPIVFVGVGQTYQDLKVIEPEVVVSALMK"
     gene            complement(<1402394..>1403797)
                     /locus_tag="LDBPK_363740"
                     /db_xref="GeneID:13388374"
     mRNA            complement(<1402394..>1403797)
                     /locus_tag="LDBPK_363740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865440.1"
                     /db_xref="GeneID:13388374"
     CDS             complement(1402394..1403797)
                     /locus_tag="LDBPK_363740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865488.1"
                     /db_xref="GeneID:13388374"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:E9BU82"
                     /translation="MHFSQYPLRLTDLERQKLQLIVAALKVSEYTDDVDDFMRPYGKE
                     GRMEAAMREFIDIVVGLAIASDAIPRSVKNSFLAGEVKVATVVPLLEDLFEIMRRHKR
                     LNPFSHRGEFGKLMMMLQDVQKRSIQRALEIQSTLVIPVRTVEAALSSIHCETLADDE
                     AVRTDYLKRTGTEKQAGMQSLIERYSKGDGHKKEIIAHCLRSIDDVHSFIQSNTRPLR
                     TLRRWLSRDFEPLSSDNAYSISIRHGRSGACFTHSHATHCQYVTESLLLWENVQKNIL
                     NLWEAAEDDMLVEGQGQYVVANTGQGFHRMCSAPRSYGVMSRLVRDTEQRMGGWVGIK
                     VIHLGDRDVPNPLVFIDKYTVIPRLVKPVVQTLHALRYVFHEEDEEEEGQPQVVHEYD
                     NYPGLRNLLRSKYHSYGELMMMILSDFFKHAFDGSGDDGGSCIDGRLTSAWNWCHQLH
                     KKKYYDAFVLTGFAGFD"
     gene            complement(<1406194..>1407195)
                     /locus_tag="LDBPK_363750"
                     /db_xref="GeneID:13388375"
     mRNA            complement(<1406194..>1407195)
                     /locus_tag="LDBPK_363750"
                     /product="cysteine synthase"
                     /transcript_id="XM_003865441.1"
                     /db_xref="GeneID:13388375"
     CDS             complement(1406194..1407195)
                     /locus_tag="LDBPK_363750"
                     /codon_start=1
                     /product="cysteine synthase"
                     /protein_id="XP_003865489.1"
                     /db_xref="GeneID:13388375"
                     /db_xref="GOA:E9BU83"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005856"
                     /db_xref="InterPro:IPR005859"
                     /db_xref="UniProtKB/TrEMBL:E9BU83"
                     /translation="MAAPFDKSKNVAQSIDQLIGQTPALYLNKLNNTKAKVVLKMECE
                     NPMASVKDRLGFAIYDKAEKEGKLIPGKSIVVESSSGNTGVSLAHLGAIRGYKVIITM
                     PESMSLERRCLLRIFGAEVILTPAALGMKGAVAMAKKIVAANPNAVLADQFATKYNAL
                     IHEETTGPEIWEQTNHNVDCFIAGVGTGGTLTGVARALKKMGSHARIVAVEPTESPVL
                     SGGKPGPHKIQGIGPGFVPDVLDRSLIDEVLCVAGDDAIETALKLTRSDGVFCGFSGG
                     ANVYAALKIAERPEMEGKTIVTVIPSFGERYLSTTLYRSVRDEVSSLPVVDASELQD"
     gene            complement(<1409234..>1409482)
                     /locus_tag="LDBPK_363760"
                     /db_xref="GeneID:13388376"
     mRNA            complement(<1409234..>1409482)
                     /locus_tag="LDBPK_363760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865442.1"
                     /db_xref="GeneID:13388376"
     CDS             complement(1409234..1409482)
                     /locus_tag="LDBPK_363760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865490.1"
                     /db_xref="GeneID:13388376"
                     /db_xref="UniProtKB/TrEMBL:E9BU84"
                     /translation="MLFAHATPPPHTLKAATHFFFSCCRRRPPSPSSKKEKTKLHRAH
                     PSSLSHRHTYTHKERASRNEHREDVWNVLCNECSSAAA"
     gene            complement(<1411641..>1413254)
                     /locus_tag="LDBPK_363770"
                     /db_xref="GeneID:13388377"
     mRNA            complement(<1411641..>1413254)
                     /locus_tag="LDBPK_363770"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865443.1"
                     /db_xref="GeneID:13388377"
     CDS             complement(1411641..1413254)
                     /locus_tag="LDBPK_363770"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865491.1"
                     /db_xref="GeneID:13388377"
                     /db_xref="UniProtKB/TrEMBL:E9BU85"
                     /translation="MECADTVLLIASYLTKKELMALSGVSHLCRKIVSDSFISYEEKK
                     YLVWPCLRDDYVELAPPSQILALGVLEKEQRLLVLVRSGTDTSNIDEMECYLYTQLVD
                     DDGYVAEHQRELPACFAFPSSLVHFSGNRYLLCKTREGDLHVFDCLIETMIEVPVGTD
                     GFYASPDGDHFLLDYNRHVFFCTASVHIACWLEMTPVDLKRHEGTYNAASNLPPSALV
                     ATHLRAQIVPLSDPFSSCGNSTSGSAPAHVDTTHPAPPLHFYLGTSSAAWRTFWMGSS
                     SALCANEDGVSLLKINNYPEMVAERLTSLSSSCSDFVDRSCGDVYGTPCEDSDEYAVM
                     NCREVRLHTVSYWPMRCSTTEVRAIDLNSIVPSLATIKSVRIAVSRVTYLIYMQHQDL
                     DRVLLLSSDLTLTRWISIGRPSCYVLWRQQVSLVTASLSDGAGDNYHPLVEAVEGGLG
                     CVYTFGVRLPEGSSTGAADPFVTAVDGGAGPAGAGRFLMLPQSFTGVEALSWMAFGVV
                     SSSLLWTVSALCYNGWWLHLQLLIRGKVA"
     gene            complement(<1415132..>1415443)
                     /locus_tag="LDBPK_363780"
                     /db_xref="GeneID:13388378"
     mRNA            complement(<1415132..>1415443)
                     /locus_tag="LDBPK_363780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865444.1"
                     /db_xref="GeneID:13388378"
     CDS             complement(1415132..1415443)
                     /locus_tag="LDBPK_363780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865492.1"
                     /db_xref="GeneID:13388378"
                     /db_xref="GOA:E9BU86"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:E9BU86"
                     /translation="MQQSLIPGHNNNRHLTYDEVENNIGGLPVTDNRIQDLFDSLDVD
                     HSGTVSVEVVKRFYMGLEHYGVDLSDKELDEMVRKYAATHDESLSYEEFACFVLSLAQ
                     W"
     gene            complement(<1417990..>1418880)
                     /locus_tag="LDBPK_363790"
                     /db_xref="GeneID:13388379"
     mRNA            complement(<1417990..>1418880)
                     /locus_tag="LDBPK_363790"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865445.1"
                     /db_xref="GeneID:13388379"
     CDS             complement(1417990..1418880)
                     /locus_tag="LDBPK_363790"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865493.1"
                     /db_xref="GeneID:13388379"
                     /db_xref="UniProtKB/TrEMBL:E9BU87"
                     /translation="MHRVFLVRSSDAMATTTSTDSDVDCNHGVWDAATLTCDCDAGWS
                     TDWLNQDVLGGNYVYCNSQASTPPPSNSSATTTSFLADKSTLIIIVALAVVLAALCGI
                     VVFYCYRKKRRRAKEEAKGAEIVAAANEEARRQEALQLQQMQVQVQEEAALQQQLWAA
                     QLEAQRRNQALLNHLVSMSTMPAASNSQLSASSRHHRRHWHEMLPRHQGEVAYACDAD
                     YEGGNSLAETFDGWGSQEPFVQCPSSYRRGAPLSATDGYNNYPDILPSYYTATTTEAP
                     RREVNSPPPYAQLAFRHPPF"
     gene            complement(<1419370..>1419735)
                     /locus_tag="LDBPK_363800"
                     /db_xref="GeneID:13388380"
     mRNA            complement(<1419370..>1419735)
                     /locus_tag="LDBPK_363800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865446.1"
                     /db_xref="GeneID:13388380"
     CDS             complement(1419370..1419735)
                     /locus_tag="LDBPK_363800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865494.1"
                     /db_xref="GeneID:13388380"
                     /db_xref="UniProtKB/TrEMBL:E9BU88"
                     /translation="MALVISDEATREAERILACSNSFEVLELSPSNCTKEMVLEQYEA
                     KVSLFKGLFRNKLAMQAKAKLGNAKVRLADAQLREKEAAALKGLQSDAHKNYAELQAL
                     EVRTRVLEMRAATVQGEAA"
     gene            complement(<1420234..>1421415)
                     /locus_tag="LDBPK_363810"
                     /db_xref="GeneID:13388381"
     mRNA            complement(<1420234..>1421415)
                     /locus_tag="LDBPK_363810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865447.1"
                     /db_xref="GeneID:13388381"
     CDS             complement(1420234..1421415)
                     /locus_tag="LDBPK_363810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865495.1"
                     /db_xref="GeneID:13388381"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BU89"
                     /translation="MQEIIDTVNRYTLRSAAFRDKPTPGLAARQFLCSLLLHRKLDSI
                     RLSSIALYMFSTEALIAVSRDGIQTISCEGNTLWPICSIPNGLTSEISGVAVTPEGTL
                     VCSSNGICYLEGGNLRVTEDCASSSYAQNVLCISCTPDGKYIATGGGTATVTVWTSDL
                     KPLHHFAGHTDWVRFVKFARGRSPALQLFSTGDDGVICQWDVLAGSLISRVDYSLGES
                     IQLFEVSYYSGLIAISSGTSLIALYCPRSDNTTRALGEDVLRLQPMALITGAHDYTPT
                     AGKFTDDSQWLASASEDETIALTYVLDPQTCFVCKEFVTRRRCFSFMNIFNSICILAA
                     PPASSVIIIAACSSDGTVVQWVVDPRTNRATYTKKLQLHLGSFLGMDLIPGDDLNHLL
                     W"
     gene            complement(<1421885..>1422481)
                     /locus_tag="LDBPK_363820"
                     /db_xref="GeneID:13388382"
     mRNA            complement(<1421885..>1422481)
                     /locus_tag="LDBPK_363820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865448.1"
                     /db_xref="GeneID:13388382"
     CDS             complement(1421885..1422481)
                     /locus_tag="LDBPK_363820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865496.1"
                     /db_xref="GeneID:13388382"
                     /db_xref="UniProtKB/TrEMBL:E9BU90"
                     /translation="MLWCTGPRRAVFHNAPSVYPFTKPFHDTPYDQDRGRFDKAKSIL
                     RENKWPAWMDHGADGTGFGIGLNRTHPLSKLRGNLRRNPSEIPRVLNMMIQGVWHKSG
                     NKLYFRGGKPPNPSTHPYLTGEPCPVYGWKVTDPGVIREFNLPQLEKNKTRYKPYVAL
                     QERKIMGMQAPMKEHSAVPTSAESTDSKPLMKRLFFWK"
     gene            complement(<1423379..>1425136)
                     /locus_tag="LDBPK_363830"
                     /db_xref="GeneID:13388383"
     mRNA            complement(<1423379..>1425136)
                     /locus_tag="LDBPK_363830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865449.1"
                     /db_xref="GeneID:13388383"
     CDS             complement(1423379..1425136)
                     /locus_tag="LDBPK_363830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865497.1"
                     /db_xref="GeneID:13388383"
                     /db_xref="InterPro:IPR011677"
                     /db_xref="UniProtKB/TrEMBL:E9BU91"
                     /translation="MLQGLLCVLLLTTSAFAYPIVVVPVDWANVPNSTPDARNLNSPY
                     LGECVCDVTRGICDSFCCCDEDCDASARAAFFYCLPEKYSSPYLDYCYPKDRATSLKR
                     INGKDATYIEKKSQGYNAVCVIRTNHPSELYRYFRVPTDVRQPLLPTAPIEPVTVSQP
                     YAAGDPLTTAKYVVISGSPSYRRVAPFQLPTTMSDGSCSALARNVGFLDSIKGTSCTL
                     NGAQICLLFPVAKYQNLFLQSTLGYNSSAPEFVPVTLNLHDASGALLDTLGPTVVPTP
                     STYATISDGKTCNNAVVDLHAHFSYSSNESGKLIEAALNVTLSSVGLMQYVALSFEAA
                     FTGENATVPSNIFAATPGYLSGDKIRSGTLVTHGGKSAILERESGFAVPAGGRLCGSN
                     QWRRASFLHSIISSGCLILMNESDLQDICSVGTGHLLAALINVTVDGEPTILDQIGVT
                     NDALANDTTSWIPITGLSNALTSSSGTYNAYTRQCSNITVGLHYQFVVARAGAEYNPQ
                     DIIVGAFASPIVGTFQIWNETNFDGNALSYQQFTFKVTFSRYDSNSQATIMRRIVAPP
                     ILPPLDDSIFYPFHRSPPV"
     gene            complement(<1425447..>1426115)
                     /locus_tag="LDBPK_363840"
                     /db_xref="GeneID:13388384"
     mRNA            complement(<1425447..>1426115)
                     /locus_tag="LDBPK_363840"
                     /product="nudix hydrolase-like protein"
                     /transcript_id="XM_003865450.1"
                     /db_xref="GeneID:13388384"
     CDS             complement(1425447..1426115)
                     /locus_tag="LDBPK_363840"
                     /codon_start=1
                     /product="nudix hydrolase-like protein"
                     /protein_id="XP_003865498.1"
                     /db_xref="GeneID:13388384"
                     /db_xref="GOA:E9BU92"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:E9BU92"
                     /translation="MKHTYLRTGLEVVSGLKFTRLCSLSYTASDDGAQPGNKWEMVQR
                     TTRSTPVSAFQRSPAPIPVDAVEICAVVRRSSERFIVVVAQYRPPVDSVCLEFPAGLV
                     DDNENASQAAIREMHEETGFVVDEAGIVSISPPLSTEPGLTDSCCVLVRLDVDGERAE
                     NQKPKQHLDDGEDIEVLMIPISQPKNALSALSDVVERYAEKGQRAIVDAKLYTFMEAL
                     AWSV"
     gene            <1426941..>1427963
                     /locus_tag="LDBPK_363850"
                     /db_xref="GeneID:13388385"
     mRNA            <1426941..>1427963
                     /locus_tag="LDBPK_363850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865451.1"
                     /db_xref="GeneID:13388385"
     CDS             1426941..1427963
                     /locus_tag="LDBPK_363850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865499.1"
                     /db_xref="GeneID:13388385"
                     /db_xref="UniProtKB/TrEMBL:E9BU93"
                     /translation="MITWATLSFSFCFSTHHQKLSRNLVCVMKATSGRAPLLRMLDDC
                     RVLSCQRRWHLIKDDRKQNEELKRVEFAPTFERDQIVKGVESGTYAGSSTTGDEPMEP
                     LSRGLMNTMEETPYRVSWYDFQTVSPAKRFTYWVYRRLRDLPPEWQEYYRSMVYQEIS
                     ASRYVNQTWDCFMMVVDGYRKAKWVLRKYGVKVDESLIPRPYNNFWEETTHEERVWAH
                     RRSHQMKELQALQRDDDEAVFGASMMNRNEVSYTSIKNLQTGMQGGTPLHAHDLPAPK
                     ESELRMSRQDEEMSSALMSSIEDDKLWNPVLRSRLHTQRQRAEAELYGFEDEDDDGTA
                     AEIQRK"
     gene            <1428329..>1428796
                     /locus_tag="LDBPK_363860"
                     /db_xref="GeneID:13388386"
     mRNA            <1428329..>1428796
                     /locus_tag="LDBPK_363860"
                     /product="calmodulin, putative"
                     /transcript_id="XM_003865452.1"
                     /db_xref="GeneID:13388386"
     CDS             1428329..1428796
                     /locus_tag="LDBPK_363860"
                     /codon_start=1
                     /product="calmodulin, putative"
                     /protein_id="XP_003865500.1"
                     /db_xref="GeneID:13388386"
                     /db_xref="GOA:E9BU94"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BU94"
                     /translation="MADLLSLQQITELKEAFSAFDVDCDGSITVDDLEQVFSSIGHKV
                     SKKKLQSILCEADLDSNGVIDFPEFLTLVAAKLNDPEEKELEMRRAFRMYDLGNTGFI
                     TVPNLRFAMGRLGCFLTPEQAFDMISEVDADGDGKLSFDDFRRVMTEGWGATP"
     gene            <1429372..>1432305
                     /locus_tag="LDBPK_363870"
                     /db_xref="GeneID:13388387"
     mRNA            <1429372..>1432305
                     /locus_tag="LDBPK_363870"
                     /product="mitogen activated kinase-like protein"
                     /transcript_id="XM_003865453.1"
                     /db_xref="GeneID:13388387"
     CDS             1429372..1432305
                     /locus_tag="LDBPK_363870"
                     /codon_start=1
                     /product="mitogen activated kinase-like protein"
                     /protein_id="XP_003865501.1"
                     /db_xref="GeneID:13388387"
                     /db_xref="GOA:E9BU95"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BU95"
                     /translation="MSGASVRIPIEKYDIHDVFFSLSVLRKLPEYTRELEEGSSETLY
                     RIIHSSICAARWYYRRYSRYGEFVHLLNTYAECIAVKSSNSALRVAELLAARTSQLHT
                     PQLWQRLPLPIAASLLFAVICCSATVILIGIGEDCCRKADVAALILSCVSVLCLCALF
                     PLIYASLRRRGYKGQERLVDRMVRMACDNAQSQNSFYNPLSDRIELTERVIVEDADAF
                     LVEADIAHRNRRAIAMLLTEATEDEGSAVLRSRGLPPAMIGLNAIYRHTIIIMTDFDG
                     KVVMWSDGAATCFGFSARDVEGNNIISLLYGERSVELYATMTEAAEKNLDLSEKVLNV
                     AHMGLGTVSISATVVVSREAKSNQPVGFTLIGSVRSDELSQTQAVLHSFFVAELSQLS
                     VKDSQFRQIVDCLRWKNLRDLSALARDWRSAHIRQLLSEVIKGRQLYVSVEVDPKVTE
                     LPPILCDTVGITAVLNRAFELFCEKIRVRVEQKRTTSAVYQLIVVYRHDMSGLNRNTL
                     IDITRSANDLGGIVVDSPGTLKLLLPFMVKDEAIQALRPQGAAAQKPIGHDPLIVLLL
                     EKNAVHRRNISASIWSCGHSLRLVENVRKALQAIEGSTDLGCAIIDVDVKGSDRVIEA
                     LLAKHIYIIEASEALDGGAKRGDALLKKPISNEALRKELEKATYKCEEAKRAGEELLK
                     RREVFGKVRNSPWTQGRLLGRGGHAAVYEATSTLTGGKMAVKIIRVSGNFEERIDEFM
                     NEIGILCKLTHPNIIHYFYCERTETTLNLFMAMADQGTVADLIKRCPRLPENHVATIT
                     KQLLQAVNYLHECGIIHRDIKPGNMLISQGQLKLSDFGTATTNVREGTVGTISYMAPE
                     VVDGKPSGKESDIWSIGCVVCECLQIKRSGDGLLGYGAPEEYPSDVSAQAIDFIKACM
                     QRNPSERATTGTLLLHDFIVHLDQEVSQLAEVLPEAAPNEEGAKTPKARSSFSDSTVI
                     SWSFD"
     gene            <1433026..>1436253
                     /locus_tag="LDBPK_363880"
                     /db_xref="GeneID:13388388"
     mRNA            <1433026..>1436253
                     /locus_tag="LDBPK_363880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865454.1"
                     /db_xref="GeneID:13388388"
     CDS             1433026..1436253
                     /locus_tag="LDBPK_363880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865502.1"
                     /db_xref="GeneID:13388388"
                     /db_xref="UniProtKB/TrEMBL:E9BU96"
                     /translation="MVAGQSGSTQGCSPSLSTSLQEAFLRYDPKECRRSANGPAVEEV
                     RPMLANRYFNMDHLALWKPSLLTSLGETCRRAVYVNEYHALLCSRRLVLVNSKGRYIV
                     FPPFCDTLNDAYVERVSKTCTLVLAAVASGVHVALVRDSDIRKADTLQSVFCPTASAV
                     ACIHHVGKNFYGLCCENCSVEGLAITLDNAHSLHPELHAKVLPSRHGWVQAACDYLSP
                     KRYVHSLFDRHRGYLLMLSSRNVSLWMYSDVTHLQLECSAALPREAVVAIVPPLQDEY
                     GEAQVAVLITSSGGRVPVHLCTTAGKRGNSWSLSVGELRGLPSGVTNTVVSLACACGS
                     SLLLADQLTSSLLLVTRCEPFCEAPDSSTTHVVTQHFLGKPICGVGVEKSVRDGDSFL
                     TFVVYCGDSTIVRLGRMPRGQLLQRQFAASVTSGIDALSKLEPQAQVVLLLDAVLSGL
                     PISYLSQSLEPLLHPWAATVCGVRLSDGARGIIHHAMRGLSELSRLCLSFHYWRLTEE
                     LAQSRSRLEKSCAILAEVLNRGGWLDCPTRQRLEWDDDVLVRADGKLTDISAVDAQAE
                     VLQLLLSSVKHATTIAWLYDLVLQTGTTYRFPGRLEDLLWKSDPVAVQVSLCMDLLAK
                     HDKDITDKLLQKEHVLPQRCRLAATLLSLVLDRAFEPVMAYTRRHILDIVQYDLLSYT
                     TDLLESSFPTSQPRIRLLVYRYPHDHSVSSDMLSMVEAISSTGDLYNTLVTILGDAAC
                     DSELSSVLLDWMECHTLADHRILTFAKVVVDMGLCVDPAHTLTGRFFSSVKQQANGNA
                     QQAALRFAELARSNLSVPLDGRLLAIEHAITAVPSDDNRLIQFLLLLQQQLASLIAEH
                     LAVGKDLVFARGTVEADLRALREHYVNENSLFELAGRYKVLGGCSIQLDLLKIHSDSP
                     ELLIANALTGVLTFLKAVGLSAPQAVQRVLREYLGTFQAPLPLFPFVEFLAFDGQSPA
                     LAVDELEKVGVPLPTIFDTFMSLLDGHRNPLFQIGDTVLALGQLVPKISPAVQHICAA
                     HLLECSRSMLAGEQRAIALTEEDVHIIKQIGDDMRKLSQRSQTAF"
     gene            <1437632..>1438216
                     /locus_tag="LDBPK_363890"
                     /db_xref="GeneID:13388389"
     mRNA            <1437632..>1438216
                     /locus_tag="LDBPK_363890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865455.1"
                     /db_xref="GeneID:13388389"
     CDS             1437632..1438216
                     /locus_tag="LDBPK_363890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865503.1"
                     /db_xref="GeneID:13388389"
                     /db_xref="UniProtKB/TrEMBL:E9BU97"
                     /translation="MLRLCLALRSASVQRKPHLFRIDLTSKHTPGHLYLADRAVKSTA
                     ADPCFVCLDNAMACQTVDSNAAVVLRSCMTKGRELFQYGRMRFQGMSAALVFRHNHLV
                     FQGIGDASVQALEMSLQHKDIFALLGGISQHENIPEWARAVEKAIAEGDVEYVAEEML
                     LQLRCSTEGCTSVVAKISKFSAGLPEPPSYSHAM"
     gene            <1446006..>1447364
                     /locus_tag="LDBPK_363900"
                     /db_xref="GeneID:13388390"
     mRNA            <1446006..>1447364
                     /locus_tag="LDBPK_363900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865456.1"
                     /db_xref="GeneID:13388390"
     CDS             1446006..1447364
                     /locus_tag="LDBPK_363900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865504.1"
                     /db_xref="GeneID:13388390"
                     /db_xref="UniProtKB/TrEMBL:E9BU98"
                     /translation="MPPKKRSSRRLTLNAGEEYTLIGDGAVQITLQSGLLDVAGVMLD
                     TNRPYTFYLHTDRQAITLFTLEGAACMLSSDNRVDTHRGVARAGKLVQMTRRTILSAK
                     RTKVLVIGRPRSGKTLAAHTLCNLLMRYGNDKKSVFLMDLNAESNCLFAPGCVSCIQV
                     SESPLWPGLTASPKLLPLSLYTGAAVRPSASNVNSLLHYYDQLHETVMGYIQELSGAA
                     AVAAQQQSPSPYAPSLSETHSHVVVDAPAPLADLQEGVWYKKLIEVLRPSHVVIVSSR
                     EDGEERWSTFLQEDVQRVLPDCEFLFTDPVAHPCERSSSRELLREYFTGTPFYSLGCS
                     KVVVPLKSLTFVEEASEGLAPGSADGVLMRVVHPDASFQALVCALSHAELLEEAPLAP
                     IAGLVTIVYVDEKNEEVAMLIPAAEEPLLRRLIIVPQSRYRDTLRMSSAQVATMEEYV
                     AV"
     gene            <1448387..>1450270
                     /locus_tag="LDBPK_363910"
                     /db_xref="GeneID:13388391"
     mRNA            <1448387..>1450270
                     /locus_tag="LDBPK_363910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865457.1"
                     /db_xref="GeneID:13388391"
     CDS             1448387..1450270
                     /locus_tag="LDBPK_363910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865505.1"
                     /db_xref="GeneID:13388391"
                     /db_xref="InterPro:IPR007523"
                     /db_xref="UniProtKB/TrEMBL:E9BU99"
                     /translation="MRASVRVRDTHKIGWRMRAKRAVERAIHKYVPDPRDNPLTELPM
                     NSEAYSKTHQQQEGSVRIGIRPGQSIEDYMAERDRKWLDQQRLIFEQRVKDDHLPTTK
                     NGLPFVGAGSREHYMDVDSANKLVHTPEPKDYEIDEEMVLLRRQLQVENEAEYRKFVA
                     EAKRSDIAAQETCKRRLPHPSDPNYDPFKLTPGYRPQDSTALAQWLKRQRESGKSASG
                     LSLQTKEGQERFYNEEKMATQYNANPFANRIETPRGMSTMRITAYSPDSVFINDREVI
                     GSCIVTEKGYYHWNVGSFEEVNERTLAVLLHMYPVPDVVFLGTGRNLHFIDEDLRIAF
                     QKRGTVIHCLTTPQACGHFGVQLSVSRRSALAIINPIPTNGYGVECFGDFVENDMFSL
                     SDTQLGISPMRQFSPSLFRQNKVAEKYRATQGTGIGPQYHQLSDGRLVRPGTSHTKLL
                     PMLEPGETVDWEKLPSYYHWYPKEELHDYIENTTWREIKGRPTGEPLEKRLRKAISGG
                     TFEKDEAPAPDLMPWNSATIPITKFPHERNDEEIIVVDPKTGRIIGMERETYERWKRM
                     MEERRAGLPESDPVEYDQERYVTNKDGVVFDLSKMKYRPIFEGRWNPRRQQSTGRTNP
                     IMT"
     gene            <1451363..>1451908
                     /locus_tag="LDBPK_363920"
                     /db_xref="GeneID:13388392"
     mRNA            <1451363..>1451908
                     /locus_tag="LDBPK_363920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865458.1"
                     /db_xref="GeneID:13388392"
     CDS             1451363..1451908
                     /locus_tag="LDBPK_363920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865506.1"
                     /db_xref="GeneID:13388392"
                     /db_xref="GOA:E9BUA0"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:E9BUA0"
                     /translation="MLVIEGTNGPLFRVAESAAAIAYLSTHYPQCKKRGSGWHLSVEE
                     VSLLQSQLRRADGVHFASADTKEQFEVLRKRYARDCAVYAALTTDHGYRLRHGSQFGA
                     NYIGYQDVGTHGECLLFTGPLAELERVRAVRIARSVGKRAMLVTVQEGDSGCSSTVTV
                     TDLMADSLADLRRPHKSCRKA"
     gap             1452846..1454038
                     /estimated_length=1193
     gene            <1454460..>1454966
                     /locus_tag="LDBPK_363930"
                     /db_xref="GeneID:13388393"
     mRNA            <1454460..>1454966
                     /locus_tag="LDBPK_363930"
                     /product="60S ribosomal protein L34, putative"
                     /transcript_id="XM_003865459.1"
                     /db_xref="GeneID:13388393"
     CDS             1454460..1454966
                     /locus_tag="LDBPK_363930"
                     /codon_start=1
                     /product="60S ribosomal protein L34, putative"
                     /protein_id="XP_003865507.1"
                     /db_xref="GeneID:13388393"
                     /db_xref="GOA:E9BUA1"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="UniProtKB/TrEMBL:E9BUA1"
                     /translation="MSCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIH
                     TPWVLGHKRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQR
                     IVKQALKEHSKMKLSHKRTANKKKSKQSKKEAIAKKISTKTVSKKKAPAKKATTTRQP
                     VGSKLVKK"
     gap             1455328..1455456
                     /estimated_length=129
     gene            <1456117..>1456377
                     /locus_tag="LDBPK_363940"
                     /db_xref="GeneID:13388394"
     mRNA            <1456117..>1456377
                     /locus_tag="LDBPK_363940"
                     /product="40S ribosomal protein S27-1, putative"
                     /transcript_id="XM_003865460.1"
                     /db_xref="GeneID:13388394"
     CDS             1456117..1456377
                     /locus_tag="LDBPK_363940"
                     /codon_start=1
                     /product="40S ribosomal protein S27-1, putative"
                     /protein_id="XP_003865508.1"
                     /db_xref="GeneID:13388394"
                     /db_xref="GOA:E9BUA2"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:E9BUA2"
                     /translation="MGFFDADLSYPTVRTERMKHKRRRLVQGPNSYFMDVSCPRCRQV
                     TVVYSHATTSVECKGCSKKLCRPTGGKALLVEGCGYRRKPDH"
     gap             1456421..1456519
                     /estimated_length=99
     gene            <1457514..>1457747
                     /locus_tag="LDBPK_363950"
                     /db_xref="GeneID:13388395"
     mRNA            <1457514..>1457747
                     /locus_tag="LDBPK_363950"
                     /product="60S ribosomal protein L10a, putative"
                     /transcript_id="XM_003865461.1"
                     /db_xref="GeneID:13388395"
     CDS             1457514..>1457747
                     /locus_tag="LDBPK_363950"
                     /codon_start=1
                     /product="60S ribosomal protein L10a, putative"
                     /protein_id="XP_003865509.1"
                     /db_xref="GeneID:13388395"
                     /db_xref="GOA:E9BUA3"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:E9BUA3"
                     /translation="MSKIAPQTLVEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDK
                     RFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEG"
     gap             1457750..1457848
                     /estimated_length=99
     gap             1458908..1459006
                     /estimated_length=99
     gene            <1460202..>1460513
                     /locus_tag="LDBPK_363960"
                     /db_xref="GeneID:13388396"
     mRNA            <1460202..>1460513
                     /locus_tag="LDBPK_363960"
                     /product="basic transcription factor 3a, putative"
                     /transcript_id="XM_003865462.1"
                     /db_xref="GeneID:13388396"
     CDS             1460202..1460513
                     /locus_tag="LDBPK_363960"
                     /codon_start=1
                     /product="basic transcription factor 3a, putative"
                     /protein_id="XP_003865510.1"
                     /db_xref="GeneID:13388396"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="UniProtKB/TrEMBL:E9BUA4"
                     /translation="MPITQEQLKRRAEMVRTGGKGSMRRTTKAHHKSTGDDKKVQVTL
                     RRLGVTPFSDIDEAVFYRQDGSAYYFSKPKVQASMQTQCFVVSGDYDVKSADEVDAKK
                     D"
     gene            <1462263..>1463213
                     /locus_tag="LDBPK_363970"
                     /db_xref="GeneID:13388397"
     mRNA            <1462263..>1463213
                     /locus_tag="LDBPK_363970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865463.1"
                     /db_xref="GeneID:13388397"
     CDS             1462263..1463213
                     /locus_tag="LDBPK_363970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865511.1"
                     /db_xref="GeneID:13388397"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:E9BUA5"
                     /translation="MDAIKTYTYKSGAVYEGTFDGNMRSGRGHWTHPQGERYEGEYKD
                     NKQNGLGVYIFSETGKKYLGNWEAGQMNGVGLYFFNRDCTAYYFGNYTKDKKDGDGHY
                     MYETGVMTTQKWNMGALLQEEETQPSEIVECAVKIKELMDAVRAVAPKELGEMPPPSE
                     VRTFQFPSGATYTGQYFGTKKHGRGYWLHPEGDSYEGQFDNNHHSGWGVYVIGRSGKK
                     YVGHWRNGKMNGIGVYFFNPQETEYYVGLYRDDVKNGRGMYHFAESGASMVQMWENGV
                     LRQEMEADEATGKAYEAAIRKIVEVVKPYAPNYEPVTFGS"
     gene            <1465577..>1468480
                     /locus_tag="LDBPK_363980"
                     /db_xref="GeneID:13388398"
     mRNA            <1465577..>1468480
                     /locus_tag="LDBPK_363980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865464.1"
                     /db_xref="GeneID:13388398"
     CDS             1465577..1468480
                     /locus_tag="LDBPK_363980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865512.1"
                     /db_xref="GeneID:13388398"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="UniProtKB/TrEMBL:E9BUA6"
                     /translation="MRVMSESILLGKAELLAWAASVTGISPCDKYGDLKDGLIYLALT
                     RQLFPGEIDNAIVRLQRRGTRDAAKNWSLLTSCLRRHGIPTHLCSQQAVERGHTRYCF
                     NLLVLFYFLVRLARGHQFAVDFAQPVDPQLAAFLQSPESVLAVERRVDMGFSECSSSN
                     VGVSAIDEEEAGGQADSGAPRSVTRLSSPPSVATAPTTATPAVPLRLPLRSTALSADT
                     SSNHVAPPLRWMWAHEQSSARAFQDAGAWRAPSRCNNRGTEYSKHSPRGACDSTLVHG
                     AARAPATSGGELVAATLPPPSSLLRPSPSTACAPHLYTQNQLLREELEHVKAVSQLLL
                     TQQRGSEAAVEMRASATLHNQLAKAELDHLHAIRQLEVTLTAASVHDGGANAAPSPQQ
                     WAALAHRAEAAEATAVQLYREYHESQQVYDSTLQQLRQVFCSIADIAAATLSSMPSNS
                     DSADAAAYEETVTAAMMAQLTGVPAMRKDAFCAQMRALLLTLSSLRSTNARLQMDAAS
                     VSPYRDSGDATRDCASSFSALHASSSLPLERESLKMACAEARNACHGANPVVQRALQR
                     LTRLVDILSSALDAARQDRDRWERRCRRAETATAQADAASQGARAEGEAQWQQDLVAH
                     TVASSTCIDELSRLSRERCVRAAQAHQESQSLCSQVQEVLAMVFSTAGTHEVQWASDE
                     LVALLGAYARERASNPAMEEALAEQAETIAALRADLRRQREARERAEAQLSDGERRRQ
                     VLERKGAARQAQLRSATEKLGTQRNDSQAHAATLHRALLEETSTTSSTALASTPLAKP
                     SAAATRGTQEHIAASGAAPLTEASRHAESTPYRSTAHSLYSSPHLTGALRSPATPDDD
                     MDNAEERRLIDHHHRFQSGLHKQHASPLPSPLASASLPSSRATTAEADVPRALSTERV
                     AARAGLAAPTASPARSTRSSTDHPAAASAPPLLLSAAELERRKQAILRKYDAA"
     gene            <1469540..>1469824
                     /locus_tag="LDBPK_363990"
                     /db_xref="GeneID:13388399"
     mRNA            <1469540..>1469824
                     /locus_tag="LDBPK_363990"
                     /product="aminomethyltransferase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_003865465.1"
                     /db_xref="GeneID:13388399"
     CDS             1469540..>1469824
                     /locus_tag="LDBPK_363990"
                     /codon_start=1
                     /product="aminomethyltransferase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_003865513.1"
                     /db_xref="GeneID:13388399"
                     /db_xref="GOA:E9BUA7"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="UniProtKB/TrEMBL:E9BUA7"
                     /translation="MSASLKKTALHSFHLAQQAKMDAFAGYHMPISYGRFGVLKEHLY
                     TRQVAGIFDVSHMGQYEVRGADREKFMEHVTPVDLQRTRAGQGALTMLTNA"
     gap             1469825..1470336
                     /estimated_length=512
     gap             1475196..1475294
                     /estimated_length=99
     gene            <1475426..>1476559
                     /locus_tag="LDBPK_364000"
                     /db_xref="GeneID:13388400"
     mRNA            <1475426..>1476559
                     /locus_tag="LDBPK_364000"
                     /product="aminomethyltransferase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_003865466.1"
                     /db_xref="GeneID:13388400"
     CDS             1475426..1476559
                     /locus_tag="LDBPK_364000"
                     /codon_start=1
                     /product="aminomethyltransferase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_003865514.1"
                     /db_xref="GeneID:13388400"
                     /db_xref="GOA:E9BUA8"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:E9BUA8"
                     /translation="MSASLKKTALHSFHLAQQAKMDAFAGYHMPISYGRFGVLKEHLY
                     TRQVAGIFDVSHMGQYEVRGADREKFMEHVTPVDLQRTRAGQGALTMLTNAQGGIKDD
                     CIVTRMADHLFLVLNAGCKEKDVAHMERVLREGAMKGADVQLVPLDRSLIALQGPQAA
                     AILSEFMDDVPDMGFMQCRQRVSIKGMEVQVTRCGYTGEDGFEMSVSNTDIVAFVELL
                     MSRKAEMIGLGARDSLRLEAGLNLYGHELTEDINPVAARFMWAISKRRMAEGGFIGYE
                     PIKYFRDNASKGAVPRLRVGLVSTGPVAREKTVIEVGGKPVGEVTSGCPSPCLKKNIA
                     IGYLDRKLAKDGAKVDLVVRGRRVAAEVVTPPFVPTRYYRKPK"
     gap             1477519..1477617
                     /estimated_length=99
     gene            <1479048..>1479443
                     /locus_tag="LDBPK_364010"
                     /db_xref="GeneID:13388401"
     mRNA            <1479048..>1479443
                     /locus_tag="LDBPK_364010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865467.1"
                     /db_xref="GeneID:13388401"
     CDS             1479048..1479443
                     /locus_tag="LDBPK_364010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865515.1"
                     /db_xref="GeneID:13388401"
                     /db_xref="UniProtKB/TrEMBL:E9BUA9"
                     /translation="MPAKAPSQNRGLSPPSPSPAALHQLRCENAMLKKEKQFLTQAVA
                     SGPSTSARVNSVRYNADAVEAKLMMAYRMASEMHDAEGCKTVELQMQQRVAEMLAKVD
                     KLRQLLEMVQKDVEEVLEASGGWGRQAAA"
     gene            <1481093..>1482031
                     /locus_tag="LDBPK_364020"
                     /db_xref="GeneID:13388402"
     mRNA            <1481093..>1482031
                     /locus_tag="LDBPK_364020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865468.1"
                     /db_xref="GeneID:13388402"
     CDS             1481093..1482031
                     /locus_tag="LDBPK_364020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865516.1"
                     /db_xref="GeneID:13388402"
                     /db_xref="GOA:E9BUB0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BUB0"
                     /translation="MGCCCCYPSDFRAARQASSPLQRRPSSVEHRSFEQNVFHRAKQP
                     AKTRYICDLCGVEVDPTLFDGHQEVCRTNHLRTILAKNAALLSHANIQPSSSAKFHDD
                     AASGDKELCLVCMDRPRSYAFLPCGHISCCQECTKSLDQCPLCRQPREGLCHVSPNVT
                     AQYECKHCHELIAPTLFDGHREVCGLRQRQTQREAEEAAAAAAAAAVTVGVPVEAAEN
                     SATWQNSTKSMPSRSPPQAAVATPPDSMLSAATAPARNPTRSLSHVCLECGKTYGQLV
                     VCVPCGHRVLCYTCSQKRTTCPVCVSEIRDIIVAFD"
     gene            <1485895..>1487781
                     /locus_tag="LDBPK_364030"
                     /db_xref="GeneID:13388403"
     mRNA            <1485895..>1487781
                     /locus_tag="LDBPK_364030"
                     /product="glycyl tRNA synthetase, putative"
                     /transcript_id="XM_003865469.1"
                     /db_xref="GeneID:13388403"
     CDS             1485895..1487781
                     /locus_tag="LDBPK_364030"
                     /codon_start=1
                     /product="glycyl tRNA synthetase, putative"
                     /protein_id="XP_003865517.1"
                     /db_xref="GeneID:13388403"
                     /db_xref="GOA:E9BUB1"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR027031"
                     /db_xref="UniProtKB/TrEMBL:E9BUB1"
                     /translation="MSAASSLPAKLEGFVRTEFEDTCRRRFFYGLAFDPYGGTAGLYD
                     LGPTMCAMKSNMLHFWRQHFVIEESMCEVDTTCLTPEEVFKASGHVTRFNDVMVRDTV
                     TGECIRADKFLEEWSEAQIEKDGITAEQKDEFLHLLHDAAGMNPSQIKAVLEKHAIKS
                     PKGNPFSDPFPFNLMFATHIGPEGDRLGYMRPELAQGIILNFKRLMDSGNAQRMPFAG
                     ACIGTAFRNEIAPRSALIRVREFTLAEIEHFVNPNNKNHEKFDRVRDVEIWAWPRNLQ
                     ASNEDPIRMTIGEAVQAKVIDNQTLGYFIGRVALFLTSVGVRFYRFRQHQSTEMAHYA
                     QDCWDAELLTSYGWIECVGIADRSAYDLTQHSNASKKDLCAREEYNEPCMERQLLRQL
                     TKGLIGKTFGKKAGEVMAYLNSAPAEACEAIRAAHAAGQPATVALPSGEEVSITAQMV
                     SFEEKDVKVTGYSYTPSVIEPSFGIGRILYCLLEQSYWVRRDDGGKNDKRAVFSFSPL
                     LAPQKVALLPLMVKPELLATISEIRQELVMRGISVRVDDSSVTIGKKYARVDELGIPF
                     AITCDFEGDGSVTLRERDTASQVRVPKSEVASIVVELCNPLQPLTWDSVKAKYPAQAA
                     AAEK"
     gene            <1490240..>1490917
                     /locus_tag="LDBPK_364040"
                     /db_xref="GeneID:13388404"
     mRNA            <1490240..>1490917
                     /locus_tag="LDBPK_364040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865470.1"
                     /db_xref="GeneID:13388404"
     CDS             1490240..1490917
                     /locus_tag="LDBPK_364040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865518.1"
                     /db_xref="GeneID:13388404"
                     /db_xref="GOA:E9BUB2"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:E9BUB2"
                     /translation="MFNRLFGKEKQVQPSRSSGGGNTNTAKTMEDMDAAIELLEKREA
                     ALEKRMESELAKAKQLYAKKNTQGALQCMKRKKMYEEQLLNIGAQKQNLETLKFTVQN
                     QSMNHEVLRAQIRAKDELKRSNKQMKAEKIEDNMDDLMEEMDKANQVSEALRQPLDNN
                     FVDEDELMNELEMELDGMNLEETQVADAKLPEMPAVPSQKLPAQPVKTKTQEDEDALA
                     ALEAELA"
     gene            <1494447..>1496180
                     /locus_tag="LDBPK_364050"
                     /db_xref="GeneID:13388405"
     mRNA            <1494447..>1496180
                     /locus_tag="LDBPK_364050"
                     /product="similar to leishmania major. l411.4-like
                     protein"
                     /transcript_id="XM_003865471.1"
                     /db_xref="GeneID:13388405"
     CDS             1494447..1496180
                     /locus_tag="LDBPK_364050"
                     /codon_start=1
                     /product="similar to leishmania major. l411.4-like
                     protein"
                     /protein_id="XP_003865519.1"
                     /db_xref="GeneID:13388405"
                     /db_xref="InterPro:IPR018928"
                     /db_xref="UniProtKB/TrEMBL:E9BUB3"
                     /translation="MGGTAAATAYVRSCDGASLPTPPGCGLKLVVDLTLDDSILTGSV
                     LETEVTVTHALHQSLFPRDAASNAAGTAATSLQVSLPPITVAIQRGAVQMRYGLTYLR
                     TFPAALRDSVRVLRTAMSCDDGVTRCPSYMSMTGALVSAPLGLCCLCTSVECALTSDL
                     CNASMRAHFCFRTGAAGITCVQGEGITYHGWSVGSSSPYYTMNLSASGRGIAPTTLQL
                     TTDAPEAQNGASALQLLRASDVLPEESNPKVDISGRVLFVPSAEHSRASRGTTSTGPV
                     RDDDPAEWLLLPAPLVSVSGNDCDKVGISPDYFYSLSSTTQCNAQKGTCVRHQLADYR
                     AADLEQIAQGVGGRYIGASLGTFTRQKMGEQEFLFDTVERTGGAMLRWTVNADGLAFQ
                     PLPVHGVLDAIKFDSSTGILYVTVRNNNTYGGLYYVAVGQCQGARASHCDSDGVTHEC
                     GRTALVAGANTSSLLQFSMVSDPPEEVGRTASCTVVFRDAAAALLASKNVSWTVEHRT
                     TTPAPNAPKAEQCRRCAFRDLRCLFSTVCEWQMLLWTAVAVAVAWAPYAILAYWRMAW
                     HVGAKFLAGLN"
     gene            <1497392..>1499917
                     /locus_tag="LDBPK_364060"
                     /db_xref="GeneID:13388406"
     mRNA            <1497392..>1499917
                     /locus_tag="LDBPK_364060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865472.1"
                     /db_xref="GeneID:13388406"
     CDS             1497392..1499917
                     /locus_tag="LDBPK_364060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865520.1"
                     /db_xref="GeneID:13388406"
                     /db_xref="UniProtKB/TrEMBL:E9BUB4"
                     /translation="MGRPSLMERYFAQCQAHRTSPHPAFVAGLREGAMDINFAEIPLA
                     DIRLFAHALLDVSPAARAARSPAARSRNTSGQLSRRDAASDTSPSSRPRTSAFSRTQF
                     AKLHFSYNATVPAAQLPCGAASPPASTPWFTQNEPTLRRLPQAVAQAVKESATTLSSF
                     SWCGMPLTSMAVQGRAPLQQQRGIGRVLPSLTRVLPLCHCLTSLRLDGVPLSHAQFMQ
                     LTTPFPKSPEASADGGVTWPALEEASFVGCGLTDACKNGLVHLIRAAVPTASDSTWQR
                     SLRGGYANLDDRLLPRPAGGTVPLGHSATRGVKGLDASQNPLGDETARAVANAVPGSA
                     LRYLNMSSTSITWMGGSLLASRPVLEGTAMELLDMSNTGVSEVFSHAGGAAEAKMLVE
                     SSAAAGFRVLARGMGQLLVLRESDRSPQQSWLIQTTTAIAPQPSPASAPEPPHVESPT
                     IPTCPPASVIEMERVAPPAPPAPPAPPLPSSNTGDQHSAPQSVHNSAAAPGPAVSPYG
                     PWWPMFASWYAARDTNIPTSSADAAATGSSAAGLVKGYIPVPVPFPMLAPMPIPYTAP
                     HGEDLPFAGAATVAAAAATSPHETGAVAEDSTPFPERRVSTPPADDPIDVAAETSVPL
                     PSPTSSGEKHDKEGGGSFTGGLSNPPDAASTASQAAAVAASASDDLVHRASETAGDRK
                     FLLALISRLEAHESDVTERLEAQYQRTTAQLTSLEKDMRFRLQQLADADRKERAAAAD
                     RQTALLEALAALRAEPVAVSAEGMTETMLLQLMHLIEAGMGKVQTALGAEGAVGTKSA
                     RAGESRVSPLLRSKEAATHVGAATITDRDLVKTASQRLKELGW"
     gene            <1500554..>1501624
                     /locus_tag="LDBPK_364070"
                     /db_xref="GeneID:13388407"
     mRNA            <1500554..>1501624
                     /locus_tag="LDBPK_364070"
                     /product="eukaryotic translation initiation factor 3
                     subunit, putative"
                     /transcript_id="XM_003865473.1"
                     /db_xref="GeneID:13388407"
     CDS             1500554..1501624
                     /locus_tag="LDBPK_364070"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit, putative"
                     /protein_id="XP_003865521.1"
                     /db_xref="GeneID:13388407"
                     /db_xref="GOA:E9BUB5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027525"
                     /db_xref="UniProtKB/TrEMBL:E9BUB5"
                     /translation="MTAAVDLEGVALHGHMKGVTMLKFNRDGDLLFSSAKDTNCSACC
                     WQVKTGKLLGSYTTVGQVEGRTYDAAMVALDVNRESTLLATASAGEEVLLWSVESGAL
                     LGSVSRSLSSGASVGFSHDDTLMMVATKGRSSTSSAIQVYNVPFTVPKAGEDIAPVKT
                     PFTTFSTFETPDTITWAAWGPTNETIYYSEGGYMNILDVEANKVIRSRQIHEDENEVI
                     NRFSWDPNYLALATASTDKTSHLIDFRDLATIQVYRSDVPVNDVSISPNADHVILGGG
                     MDAASVTTQGGQSIFEVKFFHKVHGHQLGQLRCHFGTINAMSFHPDGRGFASASYDGL
                     IKMYRFGDSYDSTPGAQPLWTL"
     gene            <1503096..>1504280
                     /locus_tag="LDBPK_364080"
                     /db_xref="GeneID:13388408"
     mRNA            <1503096..>1504280
                     /locus_tag="LDBPK_364080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865474.1"
                     /db_xref="GeneID:13388408"
     CDS             1503096..1504280
                     /locus_tag="LDBPK_364080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865522.1"
                     /db_xref="GeneID:13388408"
                     /db_xref="GOA:E9BUB6"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:E9BUB6"
                     /translation="MWCLKRVPRGPSLARGSAAIVGMPRRFRAVQEASVLCSLTVVAH
                     GRRTLSTEELVDEETQWTRAMGSKYGFGNYQLFRALYKDLCDEIRREYYTKPPPPPPA
                     TRTTGVSPSLAAPEASPEVHGGADSGANDTSSGATKHSSVAGGADATSSLTQGGGMPA
                     ASQREDSTGETARAARETAATPPSQPEETYGDGSWSVQHRPEDNVVVFHRGAVKRGRL
                     AAVHAWARIELKDPPRLNAVLTFADWIPIEVCVERNGIVIHFSMASNEGGMHMRNVRV
                     YAPKSAEERAVLLDPSDDGEYARKNFYYDGPCLWHLELDMLNELYDVMQDHGVTLDWI
                     RWAASWVFYLEHVNYLRWNLGMLEELIPSSLRGPEEDFLLPVEKALLAEPVEDWLRAH
                     SI"
     gene            <1505193..>1506020
                     /locus_tag="LDBPK_364090"
                     /db_xref="GeneID:13388409"
     mRNA            <1505193..>1506020
                     /locus_tag="LDBPK_364090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865475.1"
                     /db_xref="GeneID:13388409"
     CDS             1505193..1506020
                     /locus_tag="LDBPK_364090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865523.1"
                     /db_xref="GeneID:13388409"
                     /db_xref="UniProtKB/TrEMBL:E9BUB7"
                     /translation="MLGEDLDIGFYAEDAYAAYVTDLATSLHLVPHFRSARGATLEVV
                     FTGPFRDLSAYEEAVKQGKLVPYAELPWPVAEDRGVQGVSGPTLSVTLHGWIEKLNAA
                     RKVQLMEPLFPAAELGATIAETRVMSDAGNSAPCAFASTSPPCAAESAGTSSENDTHP
                     PLKLSRFRIAGSLDFLLHLSSRDLPMGESSVPVDSPSADGRDQANPDFAGDAEDATRA
                     AHECRDALEQRDDVALARNAVNTVIKIAQMAEEHPGEVGNVFADAKERVEYIQFSAQ"
     gene            <1506960..>1508273
                     /locus_tag="LDBPK_364100"
                     /db_xref="GeneID:13388410"
     mRNA            <1506960..>1508273
                     /locus_tag="LDBPK_364100"
                     /product="S-adenosylhomocysteine hydrolase"
                     /transcript_id="XM_003865476.1"
                     /db_xref="GeneID:13388410"
     CDS             1506960..1508273
                     /locus_tag="LDBPK_364100"
                     /codon_start=1
                     /product="S-adenosylhomocysteine hydrolase"
                     /protein_id="XP_003865524.1"
                     /db_xref="GeneID:13388410"
                     /db_xref="GOA:E9BUB8"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:E9BUB8"
                     /translation="MADYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKG
                     AKIAGCLHMTVQTAVLIETLKALGAELRWSSCNIFSTQDNAAAAIAKAGVPVFAWKGE
                     TDEEYEWCIAQTVKGFSGDGLPNMILDDGGDLTNLVIDHHPELVPKIFGISEETTTGV
                     KNLYKRLSKGNLPISAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKTCCVC
                     GYGDVGKGCAAALRAFGARVVVTEVDPINALQASMEGYQVALVEDVMADAHIFVTTTG
                     NDDIITSEHFPHMRDDAIVCNIGHFDTEIQVGWLEANAKEHVEIKPQVDRYTMENGRH
                     IILLAKGRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGKYPRGDKAGVFFLP
                     KALDEKVAALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY"
     gene            <1511063..>1511464
                     /locus_tag="LDBPK_364110"
                     /db_xref="GeneID:13388411"
     mRNA            <1511063..>1511464
                     /locus_tag="LDBPK_364110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865477.1"
                     /db_xref="GeneID:13388411"
     CDS             1511063..1511464
                     /locus_tag="LDBPK_364110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865525.1"
                     /db_xref="GeneID:13388411"
                     /db_xref="UniProtKB/TrEMBL:E9BUB9"
                     /translation="MVFFIAASAAIFVLAAGAVLLYGAASILAGGFLRLALGALLLGM
                     SLSVVFSATANLLLVTFSRYDLEPRPPIIFLRSFLAAMGQPTLTGVIGLSLVALISLA
                     ASKVRVMVEEMDILIRSHAAYAARSDRTAAP"
     gene            <1512415..>1516770
                     /locus_tag="LDBPK_364120"
                     /db_xref="GeneID:13388412"
     mRNA            <1512415..>1516770
                     /locus_tag="LDBPK_364120"
                     /product="telomerase reverse transcriptase, putative"
                     /transcript_id="XM_003865478.1"
                     /db_xref="GeneID:13388412"
     CDS             1512415..1516770
                     /locus_tag="LDBPK_364120"
                     /codon_start=1
                     /product="telomerase reverse transcriptase, putative"
                     /protein_id="XP_003865526.1"
                     /db_xref="GeneID:13388412"
                     /db_xref="GOA:E9BUC0"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="UniProtKB/TrEMBL:E9BUC0"
                     /translation="MSASFPSIPGFAGPLSLKAFLEEYFGLHLTFAVETASPSPRAAA
                     AAEAPSAAGFRALRDVVLPPNQSFLVVVYVALHASSSPPPTTAHASPTPPTPAPGCAA
                     SATGFGRLRQPLTHQTAASTAHDTYVARCSPADRPNSSCSSSSSTGKNGNARGLWRSS
                     AFCLLYTNTSHRPLTDALLRHPWWASFAACLGPAAMGFIEMYCPIVLQLEAMAGGVQV
                     LGPALKHAALETSFSATAPSSEMKGPPPQGSGYVSSRGVKRAVDTGECSGFLPLQKQR
                     RVEALPKAKAGRRLQRGVVPCSRPRRDDPFASPVNRAAMPVTWAAALTRTDVPRTRLY
                     SVRVSDSDGAGDGSGGALPLPAGFLEAQWLRRHPHSLHRVLQAALPKRVAYGASARRY
                     SVGASERVTGCTSVEDIPMWHVAHVFRWLVLQPPQSGADASPTTPPKFDLPSYLRRLL
                     STVVDQCSRLDLRGAALKHTGYLEEAFRRQQQGVEPWDVQRLSTPVDVVVSYLRTLLS
                     TLRWAPLKEAKNRSFWGRDAAGSERVLDALMGAVRNWLIAGRHAIVPVSRFLDGVPVA
                     QVPWLNGFYTTTPSLPYSAATSSAARHARRERSHVQQRVWLQFVLFLTQDILPFLLRA
                     SFTITWSSKNTHKLLFFPAFVWRRLIRREVRRTRSCGAPRSQMPLAGESARSVGAERV
                     ALSSAPCACEGAATAALPTSHSAASKASAAISAPRDVWRAVRTGGVLAHRGARATLAT
                     RGGGASCLYASVRFRPDRRKLRPIAVVRSASLRSLKEMARGSPSPYSHASAIVRLLCR
                     LGCSDTDGQLPAATATLLRRVQARSRHNHHTGVHRFPHPLPPHLPHKAALRDALRCLV
                     SGLEEQRVRDGLPRLSNLSHQDEYAELRSFCEEVRRRPALPCEGPAGTAPVVSSASPP
                     SAAACCFAPYVTLVRSDASRCYDNLPQERVLAAVASLVKHDAYRVLRFTAIHALDGEA
                     ACKGGCLLRRTFTTRTIACAEAECGVLARIPRGHIYWEEEEEGRTLSGPHTTAAVSRT
                     TNASSRCGANLISGAAVRALLSEHLRHHLVVVSGGNLLEQRVGILQGSPVAMLLCDRL
                     FSDVVDTALSGILSEHAERSLLLRRVDDVLVATTSPAAAERCLQAMQRGWPSVGYLSN
                     PSKLTLSTACGSLVPWCGLLLHDTTLEVSVEWRRIGVLLASLRVGGPHYVHRGDHEPL
                     YLTQRFLAVLQLRVAPTVLCGRMNSKTRQLQTFYEVGLLWSRVVLEKVQEALPAARNR
                     CVAVLLLHPLAVCVGRLCRLLNRHQRFLAARKSACDVSAAEVRACVLTALHRTVQAKL
                     RVLQARTVRVMTAQRGRTPRGTSLKGRQKPPCTNKASSAGCKYCERRRKGRNRRCSTR
                     VCLRSFWWLAAAEVELQWRRSLGALHRAAPHPGEARGSTAPSLSPSASASLLMEDGPL
                     SMHARALSATRLSQT"
     gene            <1517941..>1521231
                     /locus_tag="LDBPK_364130"
                     /db_xref="GeneID:13388413"
     mRNA            <1517941..>1521231
                     /locus_tag="LDBPK_364130"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865479.1"
                     /db_xref="GeneID:13388413"
     CDS             1517941..1521231
                     /locus_tag="LDBPK_364130"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865527.1"
                     /db_xref="GeneID:13388413"
                     /db_xref="UniProtKB/TrEMBL:E9BUC1"
                     /translation="MSEAGGYSTFLELCTHMNAAAPAPSRHASHSDASSTQCLSSSPL
                     AEASTVMTGPDAVNSKPSGSDAAAAAASVASPPHFHFPPAKRAPQFPSLLLGSEVEQR
                     RGDENFDLHAKKGVTVPTAPFNLMSRRATLPFTAAATCHGVGGATASEGDLRLALTTP
                     VGDSKAIYGQSPTRSLNHSRVMRAPAMVADDAHQQWRLDRLASSGRALAGEDAAEDAA
                     AAKQGRPSLSDNLMSPVGAVRGDGGAGQSIDVARTPHSFISEAGTFLGAVEMSDEEDY
                     LSNLGATRRPDASSSADSVAAAAADVSALGNDIDSSPPSCACACMRGCPDPNCVSHML
                     DITVSPKAAQIGVPPKASAPAASAQLTHQRLSLSTPGGGTSATTILTPAAATPPTAHA
                     GDDAHPPEPFPDAGQGAAPFPHSDREDTRVGGEGVFNVSGDPTAAACIQAKLLSTAHD
                     ALTVQHDASGGDKRSAPCPGVSGMGVGTPTEHDARLSFTIPINLVQANTLLLTDTISE
                     VYTSSFATVTTSKSTQESSSSTQLLGSREGASIAASVSAPRSLQQHNSFGTCTTVPKL
                     GSPLQLTEELQGQKQEPRHPSSSPRDAFDIDEHSFFQVSGGAPAAAVTGPSSSPLPFS
                     RLSPGPPSSPPFARAQRRGIVAALAEMELRPKEEVVVKRCEIPDEEKTTTVNAVWPPR
                     LLWKGPDRAAEDCRDLSDAVFTVPATDSSRAAPVHAESPGDDADLADSAGVFFLAFQS
                     KLSKWLTWVGRRYQGVARRTSDAAGEEQSLQQQQQQQQQPLESPTRRSCAPQRKSNDG
                     SSGHRVSFPPGDSAEAVDNGSAAFYDARSLKRESSHLSVALSLSTSQVNSSYDGERSR
                     HSVVQEALCGLATPWNGGGNNTWYSVGWQMEPRGTGRVTNGSMQLRRFITASPLSPST
                     RDAPFPTSSGERLCGSTTPPNLSLSAESLTSTFNALTTQIFSDGAVQRLSRSLGGALN
                     SSASGTSMSGDHYSLSLPSSNDRHSRMSNSNTSAIADDRYRDTLYRLFRHPPSSLIGD
                     LTECYEAYKAMATSSNGHHVLNWGELGLLLQPEDYIDYRALFPPYHFVTFADFVEFVE
                     VLSLRYHR"
     gene            <1524861..>1525715
                     /locus_tag="LDBPK_364140"
                     /db_xref="GeneID:13388414"
     mRNA            <1524861..>1525715
                     /locus_tag="LDBPK_364140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865480.1"
                     /db_xref="GeneID:13388414"
     CDS             1524861..1525715
                     /locus_tag="LDBPK_364140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865528.1"
                     /db_xref="GeneID:13388414"
                     /db_xref="UniProtKB/TrEMBL:E9BUC2"
                     /translation="MEALKEQEQALRHSVEVEEELELESYRPIYNVLLMEMVRGQVEQ
                     VNRRQRRLNEMLEAFKEEGLLGGGGIGLHDERQIDALVKRLRARLHTDEASELETLKT
                     NNSNLKHSLDEIKLAMEKKNSEMEVLRANYARKLARTDVENDAVRAKVEAALHASTLD
                     VERMKRELSHRIDIACASIRTPRYNTSMGALRDLVQQAQEEVQRHHDELTRLVVSIGA
                     KDTFLKHESETMHSNLPSAYRTELRKMEKDQLLNLLDVLSFQEGVVDTIGKAIYIITE
                     AQHKTAVV"
     gene            <1527221..>1530250
                     /locus_tag="LDBPK_364150"
                     /db_xref="GeneID:13388415"
     mRNA            <1527221..>1530250
                     /locus_tag="LDBPK_364150"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865481.1"
                     /db_xref="GeneID:13388415"
     CDS             1527221..1530250
                     /locus_tag="LDBPK_364150"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865529.1"
                     /db_xref="GeneID:13388415"
                     /db_xref="UniProtKB/TrEMBL:E9BUC3"
                     /translation="MPRNHCRVPLEQQSSVSAASQTTPAPASDAHENTREVAPMPSIR
                     ALAARAKHRGRGRPRIYPRKTSSVHSLHPHFAPAEPGSGDHDDALTAAALPPAVSNQT
                     SITAASQHEVTQSADTFGSGAVASAELPLPLPLSPQGVPFSSSRITSASSLATAIPAD
                     AAQGGEETATFSSRPPLHSSTRSKAAVPTGVAADEADRATLGAQPLLPSMAACMAACF
                     GWRLKRCSVSEEAQITFVLQHRAIPVVRVTIESAGGAFAQACGASNETDAGAVRVNGT
                     PMSLPQCAAYLQELTHALFTLSDTTRSAPLKDRAPAAEEGDSKGEEDGNSVSSPTVQA
                     PPLLSPSEQAKATERRARKRARSRSPLRYTDSTASVSRTTELLSCATVPSLTEGPAGA
                     GGDGEEASKKVSQPHPPPLNSSDVTLSPAPPTRPPPVSLAAADVKVEAESSLLATTPP
                     RTSEQENDVDTQPLSALSTLVATMEAGESSTPLPRAPPAPRTNTGKPSVASRRAVSLA
                     DKGAATRESPTSSTVFASPTMRQRRTLAPAAAAVAAGPASAITGEHHAPLASLTPPHA
                     GLRTATFTMPLAFHHTSASPLAAGAAPEEFDVTSCNTGSNGGHQSVWCDSAGWSTDSS
                     QLWLAHTHAASRAFQCMPVPRCRVPATTKVTQPLGGEGAEGHGTSTATPASWTVPLMD
                     SAAAAALVRMTLLWRWRERSSMWTAMEDSLRMAVGSGHLRGDALEAGVQALQASEEEQ
                     RRYEGVGADAGEGGSDLGPSCGRTALDVGQVGHGAERQQTRSFPACPPRALLPVSGRA
                     VVEAQHRITDSEKERGGEEGAHGPRYVACAGGIPSADRIVIDHTYSTRGSYVMASPVT
                     TEGTTATPCRLLALQRNPQEDLHYHVYKRFMPADMRLAMEAEETLTVGAGDMAPLHGA
                     SAELSPAYKLRREQSGGEGDDNEDDEERDDGADDADEKKACDSFHASQAAPRAPAATT
                     MIDASGGDPFTDMDYVLRHRPSIRRIPMPDVESRYGP"
     gene            <1531512..>1535594
                     /locus_tag="LDBPK_364160"
                     /db_xref="GeneID:13388416"
     mRNA            <1531512..>1535594
                     /locus_tag="LDBPK_364160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865482.1"
                     /db_xref="GeneID:13388416"
     CDS             1531512..1535594
                     /locus_tag="LDBPK_364160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865530.1"
                     /db_xref="GeneID:13388416"
                     /db_xref="UniProtKB/TrEMBL:E9BUC4"
                     /translation="MTSRERVTQARHVMLLSNDAPVLNRCAKEEAHLKHRLAQSTAAF
                     ALTVQKSHAAAAREERSRESRLQAQFTALLSGTPGVVMPPFVTPSPTEGFTNASERAS
                     GYAATGANNRSVPDHTTCTDATLLSSLGLKSSSTVAADGSATPAASLPCALGFPEAYE
                     SSGFKSAIHWASVAHDETFLTAYGPRRIRKEAQTRAIAGAGGSPAAREAMPHRLMTSV
                     ACYLLNQVLCADAAVSELWREKLRQPIFDAIFSSQSIAMGHERSGAQRSGSLGDAAVT
                     NAIVHRTLGPASSLLSGTATHSDPTMSFPPRTNEYATRHDFASLRLWTEEVTLEHLEK
                     TSVCQRVRNLQNAMARRQIAVHLFQRRAHQAELQAVFTVWRTYTQQRRASRIALERYL
                     VKRNHRHVVETVFLRWRRFSLRSKVEAVQRRLLNIAADRDCAARKHATALHGLQDQLA
                     SERRQHVQETFERDTLHAQMLESHAVEIEALQLMLQMERLKTAQSGKWAMRWERVAKT
                     FRPAKPCPAMPRPIWTLARTLLSAEEELAATILKRRRDERVLLQIPYSMILQARRRLK
                     QLLLAWVNVIMEASPQASTWVTVEAFTQGRSSHPRGILLSHKQPSSRKAAARRSGATA
                     GAVAAGKDDSTCEFSIYTLMCLVRELRRCYAKAGLIEEAEDWGTSDGVSVADCYQELT
                     HLFAAQSCGGLYPPLLVHCPTSPFWFTPEGVFGGPVSHLEGSKRRKREQHTTFTWLLA
                     SLLVGHIQIMRMLPLADMGVPPGRLPMKGAATLRCKHEAEVTKLARISFPRRCGAPPA
                     GSTAAPRGTSVVASSTLLPKKRSVALPAASSSRRAAAKASMASAAAAGDVEGAGVATT
                     EMTLDALLRARFKATHDSTSSDSRRALAGKDLIDAAEDSLSDIEVFLGMVPAQLQSLK
                     GGTGANGTDDEDEDEDGSDDDDEDRWINGLLRRLFEAQDAEAQQRRTKRLQGSEFLKD
                     GAEDGHARSAAATPASALGDNEEGEGGSRDNDAAAAADTASTIYGDLLKSTVVLTGDQ
                     LRLLRSLPGRSHAFDTLRPIAIAQPEAASVVVGLSKDHSSTASYASAAPLYSFLLNTL
                     DDTVARQQWSGLARVVTSLVVRFHVLDESEDAVRQAAVLTPEEEESEELRSGSVSRRS
                     PAERAGGSPPLSTTRLPPVSVGCAPSVAAEGKGGDGAAVMASPRSGGRIAAQLVPAAP
                     PQRPQPPPFPSTTHGAQRRLPRAHSPPCVSTALDTGAALSQRAAEPGVPLLSRPKPFD
                     VQGATATAAQPPATAVTSMTLGEELRRRGAYQTNSARKSFSFSSPTDLSAQGAQSPEP
                     SSSAAPPISTEASEPMAPPPSEEVHTPVIPAAALFPSQGD"
     gene            <1539692..>1540783
                     /locus_tag="LDBPK_364170"
                     /db_xref="GeneID:13388417"
     mRNA            <1539692..>1540783
                     /locus_tag="LDBPK_364170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865483.1"
                     /db_xref="GeneID:13388417"
     CDS             1539692..1540783
                     /locus_tag="LDBPK_364170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865531.1"
                     /db_xref="GeneID:13388417"
                     /db_xref="InterPro:IPR007852"
                     /db_xref="UniProtKB/TrEMBL:E9BUC5"
                     /translation="MATTSSSTASETAVRTAWFDAIDATAAMTSTEPLQPAAEYTADS
                     YLPPLSLAGDQADFFAQLRDLDRGFAEAAPSLFLPQMTLEEACHAKPSFYQTFRGERE
                     ITETTFQPLPLKQRDEAGQEADGSAVNGRHGSRRRRQEAPAQSRGTAPLYGGFLGQEA
                     MSPSTAVQRKPDFMPIILVPSAATAPLQLMNIKQFLEHGAYVDPATLYVDLETGIVNI
                     RDSKPRSVIVKPGSFHDPHKYHVAFRQFRVVDDPDEVDDWSQVCGCIVEGKLWQLKGW
                     YPHEQPQSRHPSRLFSRIRAFLAYFEEDKVPPQCREWNVQSLALTRNLLKDQVHIALA
                     SQFWEQLYTFLDEHPMFSRYTIPLTDERL"
     gene            <1543212..>1543874
                     /locus_tag="LDBPK_364180"
                     /db_xref="GeneID:13388418"
     mRNA            <1543212..>1543874
                     /locus_tag="LDBPK_364180"
                     /product="hs1vu complex proteolytic subunit-like"
                     /transcript_id="XM_003865484.1"
                     /db_xref="GeneID:13388418"
     CDS             1543212..1543874
                     /locus_tag="LDBPK_364180"
                     /codon_start=1
                     /product="hs1vu complex proteolytic subunit-like"
                     /protein_id="XP_003865532.1"
                     /db_xref="GeneID:13388418"
                     /db_xref="GOA:E9BUC6"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR022281"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9BUC6"
                     /translation="MFRRLATRSTSFVTGAAVQARHTTILSVRKGNKVILIGDRQVTL
                     GERIVAKSSACKLRKLNDNVVIGFAGSTADAFALMEKLENKLNDFPEQLSRAAVELAK
                     DWRTDRALRRLEASLIVCSKEETLEIDGQGNVITPEADGIIAIGSGGTYAKAAARALI
                     DVDGYDAERIARKAMRIATDIDVFSNSNWDVEILTREEEAVKKEEAEKAEKAQNEAQS
                     KE"
     gene            <1545553..>1547772
                     /locus_tag="LDBPK_364190"
                     /db_xref="GeneID:13388419"
     mRNA            <1545553..>1547772
                     /locus_tag="LDBPK_364190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003865485.1"
                     /db_xref="GeneID:13388419"
     CDS             1545553..1547772
                     /locus_tag="LDBPK_364190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003865533.1"
                     /db_xref="GeneID:13388419"
                     /db_xref="GOA:E9BUC7"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:E9BUC7"
                     /translation="MGRIDSSCVAATVTPSKVGASSSCPGTATSTGKIDEPASRAAAP
                     QGRAQRCGRARPAQMHNGLSAGMCDNQQQHAAGVWQLIAGPQSASTTPPPLVMGDGTG
                     GEDHAQAAHAGVRWTKHSWEKGNDCPAGSAYGSFVGAPLRRLPPTPPFPGVRLPAWCR
                     SASATAYPLSEDGLTNELLDFFYYLQLTSHEEAARERLLGYVQACVAKLWGPCKPGSE
                     AEGTAQVMLYGSYALGLSLPSSDIDLALTFPAEEQVDVATIAVEERSGDRALLAPAVS
                     KKRQALHLERLHDLAEQLRNSATFPELEVEVYDQCRVPRIHLRDRTCGGVSCDINSSF
                     ASARIARIVARQRLWLQDSPLAAFLVRVTKAAVKQWGLHEVFWGGVASTALYCLVLRF
                     LAQMEQLCRHAQVEENLSPPRYEEAAAAHVATQLSSLACSSPLSSPQLSMPHPANESF
                     AAFTPVPAGTASTARGLNRLSAAAAVPSYVPSWVVNSRKHGLSKSSSLCDMDKNSALC
                     PVSVTACSLSDWSTMSSTCDEDREADDEVDGYTQAGLTRTSGATTTATTPISRTAAST
                     PMPAASEAHEGGTATASSALAPPVSVNSAALREGVFPSADGLTHIARSRYGASPARLL
                     LKLWKFLSADAFANGYQVADAFGDDTVWCDCGEAGDSAALPKQLPLMASLELATIAGM
                     SSADLSAASFRLPELMALFRHSSTSLENMLRYQRYPRRTVPTMLSTIFVDPRLPTNS"
     gap             1547915..1548013
                     /estimated_length=99
     gap             1549317..1549415
                     /estimated_length=99
     gene            <1550361..>1550945
                     /locus_tag="LDBPK_364200"
                     /db_xref="GeneID:13388420"
     mRNA            <1550361..>1550945
                     /locus_tag="LDBPK_364200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865486.1"
                     /db_xref="GeneID:13388420"
     CDS             1550361..1550945
                     /locus_tag="LDBPK_364200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865534.1"
                     /db_xref="GeneID:13388420"
                     /db_xref="GOA:E9BUC8"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:E9BUC8"
                     /translation="MPIHQYEGWSYERLRQQRNRAHFLLEDPYRYVTVLLISKPGRPE
                     ELKCIDSPCYHAAGPLGEGDIVEIEDLLCLRCPWHRYLVNIENGEEILLKVDPASEQG
                     AGMVGRHAALPTYPMHFADPPAEGVTVVHGEKVQRVHRAWLEEATGILSIEVAEEAVM
                     RQHPVKSDKPAGNVKNGGICMQIFDIKSRGLDKL"
     gene            <1552407..>1553987
                     /locus_tag="LDBPK_364210"
                     /db_xref="GeneID:13388421"
     mRNA            <1552407..>1553987
                     /locus_tag="LDBPK_364210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865487.1"
                     /db_xref="GeneID:13388421"
     CDS             1552407..1553987
                     /locus_tag="LDBPK_364210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865535.1"
                     /db_xref="GeneID:13388421"
                     /db_xref="UniProtKB/TrEMBL:E9BUC9"
                     /translation="MDSLPNQLMSRIAEISLSDAQIQSYGRWLAAAMGAYYVVSAWQK
                     DTPTDVQAAITGHMVQGYDRSTITTRLEQRHTRQLLQQIIGLNELRQQLRSETDKEAK
                     LRGWQRVFRLTLISIAATTYTHSLTISLLSIKNMVRVLVFLLSRRESAALSKSRSGPI
                     STLRAWWTGGRRACLTGIMMESMMAKMAEQVSQQASPFVNAELEEEVMTEEVRQLPVP
                     PPPLDGRTAFAQAQQQQESLEAAHGESLSQVEQAFSVRAVLEVAVPRIVVCAAAAVDS
                     AIAARPAHLFSVSGIVHSADLCSLLRDIALGMERRACVSEWVRRPHPSLVPMSRARSG
                     ASTSPLASVPKHLETSKGRLQPDEDEELLDEPDQSATSSEDIIEFPHGSTTLLRPDGR
                     PVRRRAGDRSEDKIIGGLLDRRLAAEEEALQEEAIRRDHLLKRQMAGFFTELSHSASF
                     GELCITYAAELLAAQFKEACDIKRVKTYDAATDTAKMAMVIAALDSCRLAALEEECEV
                     KSYMRLFCEETIRSTCAR"
     gene            <1554889..>1555719
                     /locus_tag="LDBPK_364220"
                     /db_xref="GeneID:13388422"
     mRNA            <1554889..>1555719
                     /locus_tag="LDBPK_364220"
                     /product="golgi SNARE protein-like protein"
                     /transcript_id="XM_003865488.1"
                     /db_xref="GeneID:13388422"
     CDS             1554889..1555719
                     /locus_tag="LDBPK_364220"
                     /codon_start=1
                     /product="golgi SNARE protein-like protein"
                     /protein_id="XP_003865536.1"
                     /db_xref="GeneID:13388422"
                     /db_xref="GOA:E9BUD0"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:E9BUD0"
                     /translation="MNPEARQVAVWERLRNEARQTDQLIDQQLRKLEVLALFDEEKII
                     ESAAASSSMKGVGTSSSVTPAVPGSSSSLLHSSGTSPPPASTMSFEDVESQYRGADRD
                     IDEFLHRLEQTVLSMEDACRELGPSSAAARHTERFRGMLTEKQQARRRLATEFRQRKD
                     RYELAASRLAGDARRRGGPVDDDARGGVRILMDEQVAIQHTLNRVNGLLEQAEGTRDR
                     LRMQRERFNQIGDKVLHIAEHIPFVQNLVRRIDVRRRREVVVLGTVISSLMFMFFFFL
                     "
     gene            <1557163..>1561830
                     /locus_tag="LDBPK_364230"
                     /db_xref="GeneID:13388423"
     mRNA            <1557163..>1561830
                     /locus_tag="LDBPK_364230"
                     /product="zinc carboxypeptidase, putative"
                     /transcript_id="XM_003865489.1"
                     /db_xref="GeneID:13388423"
     CDS             1557163..1561830
                     /locus_tag="LDBPK_364230"
                     /codon_start=1
                     /product="zinc carboxypeptidase, putative"
                     /protein_id="XP_003865537.1"
                     /db_xref="GeneID:13388423"
                     /db_xref="GOA:E9BUD1"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:E9BUD1"
                     /translation="MNRPRDFKRKTAHPPSPASAATVASVSPIPVRAPTMRVSSLEGV
                     DGSETPQQRQRAAESLASQGQHQAEGVVKAKSDAQATDIYGSSDSSVPMVAAADACSR
                     ASRASPLLSSSEPALSSTARLASVPGIFSSCLASAALRKTKVSEGHSSNQPPTSQQLR
                     QTLRARATVFRPPVRGGAHSPRGGVPKVCPPAPLASGAAAAHGRVASVSTSTPPPASP
                     EALSAHEEHASGVPVSRSSRSRRSSTSALPLSHTYSGAEVQGSNTNVITSSSTNNRGS
                     ARSLGNDTVISTAVGRQRPNMAAVLLPTQQLLENGYYLASDESANSSFSDTPRSARRI
                     SLGSSSSLRTTTQRLDVNSSGAVGGGRSATVATGASPSGINSLRDSRDPNSYSRGNCS
                     DDNSDIMFEEENDLCNFDEEDEEQAVLTYMDSGAEGNLPGRPSSSNRAPPPPSARQGL
                     LSATGAGDGPSIDPSSLSVSVEVGDTDYDIGEDPPSCMSVSSPPQLHRRGAPALRISA
                     CSVRSSAAADWHAPTMVRRPTSVSKASGAPSFQAAVTPAKLTTVTAVPRMLSRQHSTA
                     TAATSSRPTPLTTAAVHTPLTATSSSPRFASFSPSLQLSSMNEEELRERECKQLSLYE
                     AFFFNPTRSMWLVDDHVLAKVLEYVRIMGYEHPALKRDRLKGQPSLWSSSSAIASPIA
                     PAKSKKKAAGLRNANSTAPQNMHASSSSAAAEAVVEALAQPGSANASHTLPTAAGGSA
                     DSAAFATKHFCLKAGKPRCARQYVNRSTATAASHLFLTFSEAMRWIAEQEYVIGTVLL
                     CCARFIGDPNADGAAVLGDGVADTAPWHPRRALLQRRKPCIPLRFHPIHFAASLVCSR
                     FPQWGGMSAFTRAWETQIRLVLGSASPSHQRLFKLPDDALLLSSDCEAGNLHRVERAG
                     EPYSFLIWLEPDLGSDKRIWFRFSVTGAKEGRRLRFRLMNAAPHVKLYRQNGMMPVWR
                     DGLSQPNWGPVDSCSFRTTNRDLDGEVSFSINPRNSTETIQIAFCAPYTYADLLCHVC
                     HWHALVKSSGCDMRFEERVLCRSPDGRKLHLLIVTSRVGGAPALAATEDKSTSDAAIS
                     GGRGHTGVGADGVAAAGAGSSSGWTSPGVASPTMTIPPGKGKGGATKEAVRGPYANFA
                     SGKKVVLVSGRVHPGEVTASHGVHGLISFLLSSDVRAIQLREHFIFFIVPMLNPDGVS
                     RGHSRMDQFGNNLNRCYNDPDAETQPTVLALRRVFEHLQHTYRERFIMYLDFHSHASQ
                     SSGFMFGNNLPVSVQHWNLFFPRLVELHVRHVFSFALCRFGRVHMTSKDGASRVLFGS
                     SLIHSYTVELPHFTDRRLYADEYAAMNNGSNVLFEVTWPPLHQTSGQAGSVDVNEDGA
                     QDAENGSEGKWRGVRPAVGARGLYKRSNMLLAGRGRACRSNRESSSAQARDGSPPKKS
                     SGAAPRSQGHANSAGVGEHCSGQSSATQIGGTRLASFLQPISTPSILCQSAEVGQACL
                     LALRDYCSIGARPSPELTMFGGMDGVLRDSKRQVKLDSSRKCKKAQSVATYAGINPIY
                     KQY"
     gene            <1562972..>1564264
                     /locus_tag="LDBPK_364240"
                     /db_xref="GeneID:13388424"
     mRNA            <1562972..>1564264
                     /locus_tag="LDBPK_364240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865490.1"
                     /db_xref="GeneID:13388424"
     CDS             1562972..1564264
                     /locus_tag="LDBPK_364240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865538.1"
                     /db_xref="GeneID:13388424"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BUD2"
                     /translation="MSTSLDPSLAHMSEAAQQQDEAQRLMPEEEESHVPKAEEGASEQ
                     SSQEEASSTSSDEDEEAEEAEDGVEDDEDATFQFATDEEAEAQRQAGLAAYNEGRYED
                     ALDVQYRVVRHFSNKYGSTSAKCGKYFLDYGLSQLRLLQGQTTVDDVLQPRDEDALMT
                     CYVNLEVARVCFQKLEDEVGDEDVEVELALAEVHNALAQLSLEKEDYDAALREYEAEL
                     LQYRCLQDAAPEEEKLTVVPAGRVIGVLYGIADCFLKESDFEGAEERLRATLDEIKLY
                     PAGTIAASLVAELEDLLADAVEMKGGKFQEIQNAIKQQFAAEAEQIPTPQEFFSVDKD
                     GKHPFLSAVPGGAGDEVAENSYLSMPMSANGQALATNEHSNSLSVSLFPPQGSRSGTP
                     TGPLQHATVRKKQKRTGDDSLSNAQPESKRLRAESASA"
     gene            <1565500..>1566804
                     /locus_tag="LDBPK_364250"
                     /db_xref="GeneID:13388425"
     mRNA            <1565500..>1566804
                     /locus_tag="LDBPK_364250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865491.1"
                     /db_xref="GeneID:13388425"
     CDS             1565500..1566804
                     /locus_tag="LDBPK_364250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865539.1"
                     /db_xref="GeneID:13388425"
                     /db_xref="GOA:E9BUD3"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:E9BUD3"
                     /translation="MSSDAAATLEAEGDMLRTTGCRLVCGFLYDSHCHLRRVPPGVPA
                     VSVSRPVASVNCAGRQCDDARCGVAGLVLCGTHPSIDWDAVAQASTMRAATLIGFGVH
                     PWFVPNKVGDENPASSLFRENSSGETCCCRSRSSAEANANRAACGAAAQSLSDILRLL
                     EERLQQHPSAIVAEIGLDKLRGPPESVQVEAFAAQLRLAAAYRRPVSVHCVRHHGLLL
                     RVLQDLPAEHTPPAIILHAFTGSLEVAKSLLSLKSKKRRPAADGSATPAQDAAATAGS
                     GTAAQRTTKRGGTTSDTVRIKDLIFFGVGVSTSFAVKNFSTQTLPFLLDARRVLLETD
                     EHYSGIEALAAASAGGFPAEAEAQSSVRGGARACVCVDPQEHVTKLSGVMERIHASML
                     QNREFVQKAEASSMSVESALQDTLMHAYAAAFRSVSEKTGPS"
     gene            <1567547..>1569619
                     /locus_tag="LDBPK_364260"
                     /db_xref="GeneID:13388426"
     mRNA            <1567547..>1569619
                     /locus_tag="LDBPK_364260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865492.1"
                     /db_xref="GeneID:13388426"
     CDS             1567547..1569619
                     /locus_tag="LDBPK_364260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865540.1"
                     /db_xref="GeneID:13388426"
                     /db_xref="GOA:E9BUD4"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR028641"
                     /db_xref="UniProtKB/TrEMBL:E9BUD4"
                     /translation="MFFWGSYNFQESQLSENPDRPPLRYPGYLPPSPAMLRHRPSANQ
                     NATASSSSLQSDAASVQESLRRITALRMQVHHIACGAKHLVAAVSLVPAAEAAPAGSS
                     EPVIALYGMGNNEYGQLGHHVANYATTLTHLRLEDLMEGTVVSVACGARHTIVCTSTG
                     CVYVTGDNSFHQLGLPRQMVKPLPRGGTYAPSFTQLKSLAHVKAVYASGNASFALDRR
                     GQVYSWGESKYGHLGHNDNGERLDTQTLKTVSTNVATPQLVRWFERHRVTIVEVAVGR
                     SHMVCRSEEDVYTCGEPFFGKLGQGDIDPRLEPTRVKFPPRKQVERLLGIAAGDDHTL
                     VLKENPLIGTVVYFFGKLNNGDGQLQPTIVQLPTTAVRSVMAGRGTFCAAITQEGQLY
                     VWGKHAYTKVCNGTNAAASRTQPSKVQLLEPYSIGGAVSGGTFMVAYAAAGTVVRPVS
                     DPAAAGDGKVEVKEESGTASEEAVAATTAAHSWDVVVPHDARVGRDGLGDPEEEYEEG
                     LHALLRQYLGPSLGNAYVRQLPAAPPRTAAPAYQFEHIAVKDLSCGQKVRLWMTDIYA
                     LGTIVDELADQPPGASSSHVGKASTSSGAAATVVLSEPFQCDKISQTGAAAPSGAAAE
                     EDAVDHSPSSPKGKRVKVEWQRDDWDDEVVTLYSEDETLNEENANRWQPFWFEQNPDG
                     EYVVPKSK"
     gene            <1571715..>1572758
                     /locus_tag="LDBPK_364270"
                     /db_xref="GeneID:13388427"
     mRNA            <1571715..>1572758
                     /locus_tag="LDBPK_364270"
                     /product="phosphoglycerate mutase family member 5,
                     putative"
                     /transcript_id="XM_003865493.1"
                     /db_xref="GeneID:13388427"
     CDS             1571715..1572758
                     /locus_tag="LDBPK_364270"
                     /codon_start=1
                     /product="phosphoglycerate mutase family member 5,
                     putative"
                     /protein_id="XP_003865541.1"
                     /db_xref="GeneID:13388427"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:E9BUD5"
                     /translation="MSFTFRRFLCSVGIGFAASPLLRGAAVALCETVKPAAPPGMGSA
                     AHISANGLANHLFDEDPLPTKEELQYVKTWGVPWVEDWDRPGNRGIRADRSASHQRQV
                     IMIRHGQYGNEGVNDDKIHRLTPLGERQARETGVYLRRLFEESDKRKKLNAIYRQARR
                     AYKQAKNDGASEEQLTQLERKMDEARLVLCGAGGILVDAMPMAVHVSDMTRAKQTADL
                     ILEAFPEDVRLRKDVDPQLRERIPCAVQPVRPFTPSAEDMHVAEAVFERYFHRPVESG
                     TSVEIIVGHANMIRYLTMRALQLPPEAWLRTSLPHCSVTTITIRGTGHVSLVGMGSYG
                     HLPPDMVTVSNVK"
     gap             1575011..1575138
                     /estimated_length=128
     gap             1575722..1579366
                     /estimated_length=3645
     gene            <1580098..>1581699
                     /locus_tag="LDBPK_364280"
                     /db_xref="GeneID:13388428"
     mRNA            <1580098..>1581699
                     /locus_tag="LDBPK_364280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865494.1"
                     /db_xref="GeneID:13388428"
     CDS             1580098..1581699
                     /locus_tag="LDBPK_364280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865542.1"
                     /db_xref="GeneID:13388428"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:E9BUD6"
                     /translation="MQAAVRMEAGTHFIFQYSTREGYSCLERDVMSRNYSLITPAYGC
                     SLVKAVLSALEDAAAHAPVEIDATVKIQSTFRMYQQRKAFLMLRHHARLIQRVYRGYA
                     TRKRLNMERATVRQMTYLQTVFDMFATRIQACYRGYQSRKTRSNYYAQQAYLNVVIAR
                     SSEVLAQALSTQIEQDGLRSAEAKRARDLSYAHRTAHMHYMVSTCSVPSVYQPFAAPS
                     TANQSTPNTSHTCREVRGHSEECSLVSPIPPAVKSAGEGSDGCATNDKLMARAAAYAS
                     GQKLEDDIRRHARAARLERNTVKAKAIHGPADLTVPATASSPSPYKMIAAGPETEGAS
                     VSATSQASGTRLPALTPSQPAQRSHPVNSTAPAATATVPWEVSSARPPQKLLVPRVPP
                     LTGPSFSQTAPPATSSRTTRAGRKPRKAQQAAEDDSFHAAGTAAVPTAGPAPSAASID
                     PSMSRAAVSSFHRRFAVKRHDCLEHQLSIANGVVSDGNGSCALSSALLSAKEDAAVQR
                     SVDHKVMQGLHGDAIFKVSARRGVQ"
     gene            <1582879..>1584177
                     /locus_tag="LDBPK_364290"
                     /db_xref="GeneID:13388429"
     mRNA            <1582879..>1584177
                     /locus_tag="LDBPK_364290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865495.1"
                     /db_xref="GeneID:13388429"
     CDS             1582879..1584177
                     /locus_tag="LDBPK_364290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865543.1"
                     /db_xref="GeneID:13388429"
                     /db_xref="UniProtKB/TrEMBL:E9BUD7"
                     /translation="MRCISHRSYESTDLLTDCTVAVQQLMGSRSLLPPSPTADELLHL
                     LHESGHPCTSSTAPDSNMGVLGWPPASFSASSIKCKCPTSRRVASSFAAAGAHSMLGE
                     MLQFFAEAVVRLFTTGVADPSVRAFPSEWDRRLHAPAAASLRQHHLYELQGFSTLFTY
                     IWGQVATSLPLLREQHGEEKALIESTERDIASSTSLAMRSNCGSSAKSPAAQQPPPRL
                     PLSASAAAAHQAQPFHRAARKNGSGGLQSESASAHARPLLSLTPAALHLPNAATAPTY
                     CRGKRQKDGPISAVPSRSAAQPPTLAVLQHALTVQARAQGPFLPSIPPEGLVPSSGAR
                     KVEGPHPENAGAANDYAKHSLASVSSNSNATASHLASARILSVEQAMQLDRQRELQRK
                     LGVRRVRNYAAEDDMRNYLENYQANMRSVLEGDDVAEDGT"
     gene            <1586057..>1590478
                     /locus_tag="LDBPK_364300"
                     /db_xref="GeneID:13388430"
     mRNA            <1586057..>1590478
                     /locus_tag="LDBPK_364300"
                     /product="glycosyl hydrolase-like protein"
                     /transcript_id="XM_003865496.1"
                     /db_xref="GeneID:13388430"
     CDS             1586057..1590478
                     /locus_tag="LDBPK_364300"
                     /codon_start=1
                     /product="glycosyl hydrolase-like protein"
                     /protein_id="XP_003865544.1"
                     /db_xref="GeneID:13388430"
                     /db_xref="GOA:E9BUD8"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:E9BUD8"
                     /translation="MAKRPFGFRGVRCWRTRRLLLRTPLALAVLVAVSLVAVLWFSAD
                     ENTGVSEIPSERHFVPPAKHDANDEGEGVDADGKIAFRRPSSVSTTTLAPAEETRNGV
                     DTVWFSPNTSNFLDRNTSRLHSIFTSAGKVRVALPFGVHADTGAFVAQKPRLFAFIAS
                     WNTYERALKARGEQSAASAAVADFNEELQAFARRRVAPVKHVEVRLLRQRASRSTWAT
                     ETETALPIVGILPRESTTLVSAEELLVKSAVDQEGFAPLAAAVQPGSDNKESTVVGID
                     TRLRVSAAKGLGGGANRGAGGSTSLLPFPLLELSSVPRRRATSSASATPASPDTSPAT
                     ALLKWRTSRMTASASGEALEITLDIAHPSRSSSDGPLRAEENERTRPGARDDTNAAAL
                     EATVCSARLVRLYGFSPSFSSAHTHGGSADVSSAVAAGGLNLIPLNMSEEVELMVGGE
                     MQLPSGDARLNGVVPLLYLELSSNSAADRQQGAATAGRQTVGLLWLHPGSFFVSTVTL
                     PNPTAGHEPQCTCVRLRGTAGATGLYLLPGPTPVEVLRQYYTLTGFPTLPPRFLLGYH
                     HGLRGAVATTQQAAEDLSEAFRSAGAPLDSVWLTDPAVAAGDTPFTWNRSRFPDPLAL
                     QSNLWYRGRRYVVLRSVPTVPITTRSPLLLEGRRGGLFVSLSAADTAGWPVLSMDGVP
                     SHVVDFYNPAARKWYGGMLKYRRYVGSSNHTFISLQHSGPTVLSSAAPPQGKEALLCL
                     PPGLRARGEQLPMDVGHYGGVHHRQVHQLLTVHFVRATHDGMLRRTRYRRRALTFTES
                     YFVGTQRYAVVRVETRPRCASGVRPDSAAILTEAWRALQTAVHQCTQLGALGIPFSGA
                     NLADGLVSRLLLLQLAKSASTTATLTAPLAGVAGEGGGDGGAVGANGELTAPPALSPG
                     AMEEMEQLLVRWYQAGVFFGAMYADESAAAVDATDTGAVVSLQPSATGPWWMRLPVTA
                     ATRKAIHANLHARYALLPYFYTAAYHASEEGAIFLAPLAFTSSEASPLSQKTAMPTCY
                     AAGSALIVCPVTQPVHPPRDTSRSDGTRSADCKGFFDLWTGAWHSAAFSVAKHASWWE
                     GAAQYSAQNRALASEELGWLAADDAVPLQDLPVATSLAPVLLRSGHIVATQNVAASRV
                     NSTHIGNGEVVGDAHAPYSTHVGANWTLTVALPPLPAAQDVATPSPVLLAEGDVFWDE
                     GSHNSQHRPPTMKPGSSVPPDMPHIPANVHHCALHMKCLYEGAETSEETARLTVEVAQ
                     TSESCAEALAELVSHWNEEPQGFAERLANAKAHRDARLHELKVLQNEQEDKGLRGGRG
                     GATDYPDASALKGEDLRGLHLPNAHDEATRNDIWASHLLQRLRFLFQREEDAARLSPR
                     SSTSRATTVFVERRSSTGGTPGAQADEESAVRASVRASHDMPDTHVVLAHLISDAQEE
                     GTAGSVFGARKVVLADGSVGVRVPPRHTWRFIFSLEN"
     gene            <1591759..>1594824
                     /locus_tag="LDBPK_364310"
                     /db_xref="GeneID:13388431"
     mRNA            <1591759..>1594824
                     /locus_tag="LDBPK_364310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865497.1"
                     /db_xref="GeneID:13388431"
     CDS             1591759..1594824
                     /locus_tag="LDBPK_364310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865545.1"
                     /db_xref="GeneID:13388431"
                     /db_xref="UniProtKB/TrEMBL:E9BUD9"
                     /translation="MSFRAIPRRLAGPAIHGRAQAAALSSSAKKDQQQMAPLLQFPQF
                     HPIPFPQDKFLSIKSRSLETYTKVRGDVLQRCADLCAQLQRRQKQAGQSGRGTTAVAG
                     PVGEETSSSPAAGISAELPAYPLTPHQAEELLLLTKKVEDLVHYQGFLLTDELVWRML
                     HLCIQCGAPQLAVDGWLQKHVIAEKRGPPFPLFILEDLAATLRASLLPRLPESGASLA
                     CSSAVIATSAGSTDANLSIAFEDGLAAAQRFLRRHLLHSGWPTSDAVTTEFLGAAQTF
                     TTHLLAEHVSPVWQALEAMNLTFADLRAKNIEDEEEQEAANDEGGSKKKPDRGSSHMR
                     RGEHGTYAAWLPDAAAQTVAVRSALMSVTPLYSFHAPPSSAPPPSVAEGRRDSSKSAN
                     TASTRVHALLCSDPPFFPSETAAIVAPLRALLDTWLVLAQCAAEAKDVPLLKALLRTV
                     CLGFLTHPATATGGERDAAETEDGVQLPQVCVNEDAWCQYTAPDTEQTKDPVHQRAAE
                     LHARAMVREFVNGSLSVLQYGLLCAEQEAALWQLHDTFALISAVAASLRNLQDPQKKR
                     GSRSAITDDARLHRMSAVALAQPSSAEEADGLLRLALPCALVSSCARGQQVAGDGEHA
                     SATMAMHAFVCDALAHPAERTAHPYAEAGLYVALATGDEALLAQAATADMAMNNSGAA
                     LLLLHARALHAYRRAATRLATAHEGHEEEAPEDDAWEAWTASLRQAVSQATSGSGDAG
                     IPQAQLVETCLTVLTLGVARHQAQRAAAYVQCVQQLTTTSAAEEGDDTQGDGHNSYGK
                     AEAEKQRREAIEVGWAQLYDGTAACTQDMLKLVEQLLDASSSADATVSCLSPLSLSTL
                     AVLTRVGVYAEEEAQARTASASTTSEDLSKPAGVAPPPLPLSISLDCVLARVVRDTCI
                     RLRCASAASPTGVAPAATSSVVGNWVQWVLLTLMARRAWTDVLAVLRALDGEASGGSA
                     ANAAGTSSTLLCSTTVDPSVFAALYARAVEDGAASVCAFLRPRRERLFF"
     gene            <1595382..>1595945
                     /locus_tag="LDBPK_364320"
                     /db_xref="GeneID:13388432"
     mRNA            <1595382..>1595945
                     /locus_tag="LDBPK_364320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865498.1"
                     /db_xref="GeneID:13388432"
     CDS             1595382..1595945
                     /locus_tag="LDBPK_364320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865546.1"
                     /db_xref="GeneID:13388432"
                     /db_xref="UniProtKB/TrEMBL:E9BUE0"
                     /translation="MRRTRLVCTATPEKFSILGTTHPKPKRNGMGRNNKMRSKPSDNV
                     AWYDKGPVEWLPRPVRLTYDQLDQLRDWVMRETIAGRTEEFNKIRHLHREWSQHPLMP
                     VLGDVEPKFPLNLYKQNHRAKRRFLVRWHKANSPAYWMWMPRGPAVATPLHRSIPSQF
                     PEHWKSLARTSSSSRGGGSSGSSSVAQ"
     gene            <1596735..>1597448
                     /locus_tag="LDBPK_364330"
                     /db_xref="GeneID:13388433"
     mRNA            <1596735..>1597448
                     /locus_tag="LDBPK_364330"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865499.1"
                     /db_xref="GeneID:13388433"
     CDS             1596735..1597448
                     /locus_tag="LDBPK_364330"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865547.1"
                     /db_xref="GeneID:13388433"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BUE1"
                     /translation="MGRLDHRAEDKRSCGGRVVDALCSVFSLRIALSIIYFILVVLLC
                     IMQDISLFSTPTIRIMNIEASHIVGAKTFIADTWFKVDQSIYGANVTGRIDVKLWVTK
                     INMNVEIPYGYVPQNISQVYRVQDVPCAEFRNFFRCMQIFSLLSIFTGFIVWVFTVSN
                     FFTRMFLPLLWLFLWVTIAFTATTVAMMLRVLCDGACYGEVDEIPPFTALATPMGGFA
                     LAFISLQTYLVTSIMTVFL"
     gene            <1600272..>1600871
                     /locus_tag="LDBPK_364340"
                     /db_xref="GeneID:13388434"
     mRNA            <1600272..>1600871
                     /locus_tag="LDBPK_364340"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865500.1"
                     /db_xref="GeneID:13388434"
     CDS             1600272..1600871
                     /locus_tag="LDBPK_364340"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865548.1"
                     /db_xref="GeneID:13388434"
                     /db_xref="InterPro:IPR009944"
                     /db_xref="UniProtKB/TrEMBL:E9BUE2"
                     /translation="MLIIRFVLLVLILVFFVVALVGTVSLPLYSNRITSYNQDGKVEV
                     SLWNIVVGKVTVTGENSTNVPTSMPVRINYAGCEEFRATFRAMQAFAIGGTVFGFYAL
                     LVSCLQCFCRLKVKLPLFLFLFLAMLCELCVVFIGGAAYSKEFCKNLDKNGNLTTIIF
                     KGAGYKLDTAFILQVVALVGYAICTIITPFTQQLWCGKS"
     gene            <1604425..>1605189
                     /locus_tag="LDBPK_364350"
                     /db_xref="GeneID:13388435"
     mRNA            <1604425..>1605189
                     /locus_tag="LDBPK_364350"
                     /product="transcription factor S-II-like protein"
                     /transcript_id="XM_003865501.1"
                     /db_xref="GeneID:13388435"
     CDS             1604425..1605189
                     /locus_tag="LDBPK_364350"
                     /codon_start=1
                     /product="transcription factor S-II-like protein"
                     /protein_id="XP_003865549.1"
                     /db_xref="GeneID:13388435"
                     /db_xref="GOA:E9BUE3"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="UniProtKB/TrEMBL:E9BUE3"
                     /translation="MIDQFFVGLTPSPPARCHFAWPPLPSFSPSFTLCLPVAVRYLVC
                     RRIEARLLNKAAAVITRATNTMSASSEAAKLQTPPQQRQVHYISDNVYSLGTLSCAVC
                     GQTFPIHTNACQRSTCGWCGTLHEPGTHSALQKHHRAMRRTSDGVKTSSKMCSLDTSA
                     ALFFTEKEVTAAVEYIRQTLGGTSPFGAAPGAVGGAKSAGITEVDNRIIEEAFCETCG
                     VHRPCKTFARQTRSADEGQTIFFQCTKCSSEWQQNS"
     gene            <1606098..>1607948
                     /locus_tag="LDBPK_364360"
                     /db_xref="GeneID:13388436"
     mRNA            <1606098..>1607948
                     /locus_tag="LDBPK_364360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865502.1"
                     /db_xref="GeneID:13388436"
     CDS             1606098..1607948
                     /locus_tag="LDBPK_364360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865550.1"
                     /db_xref="GeneID:13388436"
                     /db_xref="UniProtKB/TrEMBL:E9BUE4"
                     /translation="MTKSATQASSTASPAAANAASAKEASSTICDLAATTAPVECLLQ
                     IGQPSFSTQLDFIKVNRAVASLERAVERLELLSLLDAAGPTPGMEGSHQNANGTRTAS
                     SAIAVAAASTASFYPHNSSRGPAVLAGVAHDASVATAQKVAEVLAVTQQQRGCGRASV
                     LELLAELRVLERRYGELLTQDQPTVLLHPGEPQLHPKCFAHVRDPSKAALQRELALVS
                     NRLRDTNRLLCTQLQDNPQDADNWAKVCNGRRELTALLKEAIKELTVGYKEALQTQQL
                     RQQQHQANAVLDGGLRQSIAQTGVGEDAHFGHVAFNGAGAFGLARSDSRPSSTAGGGA
                     VSTESGSRASVFLKCFGSNLQRPRVSRVVQQGPRIPLSSSYQQFAVKILQEEASQRWA
                     DDVLAKERALNQNVKQLQVDLVRERELKDKEVAERLARISALKVELRKLKTALQQRSE
                     AAKACGEAATENLQREGAAEVRDVRKAIQQDEQLLSIGATTHEVFSAYLHERTTAMDS
                     LAGEWEAKTLHELKKKEAAKIDAEGSRQACAQRLTDLEHERDAQQELKGQRDSAQKAE
                     EEARRRAEEQRDAEYAAASVLEAALKAMMTRQTISKLQKSSKKKKKKAAS"
     gene            <1609084..>1610064
                     /locus_tag="LDBPK_364370"
                     /db_xref="GeneID:13388437"
     mRNA            <1609084..>1610064
                     /locus_tag="LDBPK_364370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865503.1"
                     /db_xref="GeneID:13388437"
     CDS             1609084..1610064
                     /locus_tag="LDBPK_364370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865551.1"
                     /db_xref="GeneID:13388437"
                     /db_xref="UniProtKB/TrEMBL:E9BUE5"
                     /translation="MSKDKRPRLAKKAGKASNRKRKRVTSLPTAAPVHRAPRMQHAES
                     TPAAPKSIEDVARLFIGVGKSSSNGDEAYASTESISLQIKRAKASMRRLREGAENGAG
                     ERNSPMKRQKRSTTGTLSSATTNNTMAFERKARRQPKVAERYEDDEDDEEDVELSKAV
                     QAQTLSFLQHLNSKSSKAFWGLRDVAQGKLSAAAATTATSSSSQLPSFSRTKAAKGNA
                     KGAKKVADDGEQLWRVGGPYISSDQADDTDESKRERGRTSDSESQSSTSSSEPSWVTD
                     SSEDEDYDEAESAPVAAGATSRRNAAEPLKRGGGGGRLFQGGGDGVWDED"
     gene            <1610863..>1611885
                     /locus_tag="LDBPK_364380"
                     /db_xref="GeneID:13388438"
     mRNA            <1610863..>1611885
                     /locus_tag="LDBPK_364380"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_003865504.1"
                     /db_xref="GeneID:13388438"
     CDS             1610863..1611885
                     /locus_tag="LDBPK_364380"
                     /codon_start=1
                     /product="oxidoreductase, putative"
                     /protein_id="XP_003865552.1"
                     /db_xref="GeneID:13388438"
                     /db_xref="GOA:E9BUE6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9BUE6"
                     /translation="MSSPSSFKKLQVVSLSKDFRSSTSVVEAQLPEEVPEGMVRVSVK
                     YAGVNASDLNFTNGSYLKNARPPFDCGFEAAGTVVKIGAGVANVKEGDPVVLMQYGCF
                     AEFLDAPAEICIPVPELKPEYIVLPVSALTAAVALGEVGRVKKGDVALVTAAAGGTGQ
                     IAVQLLKHVYGCTVIGTCSSEEKARFLKSIGCDHVINYKTESLDSRLHMLCPKGVDVV
                     YECVGGQTFNDAVRHVAVHGRVVIIGSISSYKSGEAVPFSHPSGTSMTMLLLTKSASL
                     NGFFLPQFYDVIPKYMASLLQYLKAGQVKLFVDEKVFHGLSSVADAVDHLYSGTSCGK
                     VLVEIQ"
     gene            <1614266..>1615666
                     /locus_tag="LDBPK_364390"
                     /db_xref="GeneID:13388439"
     mRNA            <1614266..>1615666
                     /locus_tag="LDBPK_364390"
                     /product="UDP-N-acetylglucosamine--dolichyl-phosphaten-ac
                     et ylglucosaminephosphotransferase"
                     /transcript_id="XM_003865505.1"
                     /db_xref="GeneID:13388439"
     CDS             1614266..1615666
                     /locus_tag="LDBPK_364390"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine--dolichyl-phosphaten-ac
                     et ylglucosaminephosphotransferase"
                     /protein_id="XP_003865553.1"
                     /db_xref="GeneID:13388439"
                     /db_xref="GOA:E9BUE7"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="UniProtKB/TrEMBL:E9BUE7"
                     /translation="MTLGLVESSRNAAFAVAAHAPVLGLILLGSIVAYVGTMRYIPNV
                     ARTLLERNIFGIDINKNTEEQRQKFAAKRRAGQTEEKEFQKQAIPESLGILVGAVYLS
                     VVMVLTVCLRFLGAAGEGSDNPYVSLPGPLMTITLMLLLGFVDDVLDVKWRHKIILTT
                     LGSLPLIMTYDGSLSVLMPCVFGRFGLPTMNVTKKWLLGLAARQGEPTTTFRVTAPST
                     WFSYVVNHRSYVKVSESGTALIYLGPVYLVYLSMLCIFCTNSINILAGVNGVEVGQSI
                     VIAVASVVYNLFQMRLERQARPALRSVDAAAADARDMTSDHQLRALLLLGPFIGVSLA
                     LWRYNRYPARVFVGDSYTYFAGTVLAVSSITGVYSKTLLLFFAPQVFNFIISLPQLFS
                     IVPCPRHRVPTWNPRTNLLSNSHNYTILNVVLYLFGDMHEEKLTWAILKCQVIACVFG
                     FVVRYVLSSFLYDEVR"
     gene            <1616693..>1617721
                     /locus_tag="LDBPK_364400"
                     /db_xref="GeneID:13388440"
     mRNA            <1616693..>1617721
                     /locus_tag="LDBPK_364400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865506.1"
                     /db_xref="GeneID:13388440"
     CDS             1616693..1617721
                     /locus_tag="LDBPK_364400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865554.1"
                     /db_xref="GeneID:13388440"
                     /db_xref="GOA:E9BUE8"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:E9BUE8"
                     /translation="MSSTRDGAGGGGGSSSSRGVGLAVGSFADEWAFNNYHVSSFMAM
                     EMPATIVPRFVMDRVDCLGGSYGPFAPNYPIDVPLWLALYLRQTNTCAIQPPDYLRVE
                     YLRDVIERERTNDQGFESLPFYFFEIAKKLTERGGGSSDGGGGSDDGDTIPHAVEVIR
                     LVNEIHAMRQQKLKNLMTVFEAEGSPMFIPGVLLTNIVCHELHFLRASFGIVLQQAAS
                     MERQRQQLIRLPPVSAATPGRLPSTVGRTTLTSGMSTARTTTTLSSTGTPDVATTAMD
                     LTSKMGSDSFIHDGVANSQISALTAATSMTTAMAVRSDGGPQPTATADVAPLAQPAVK
                     KRRTLRQT"
     gene            <1619195..>1621624
                     /locus_tag="LDBPK_364410"
                     /db_xref="GeneID:13388441"
     mRNA            <1619195..>1621624
                     /locus_tag="LDBPK_364410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865507.1"
                     /db_xref="GeneID:13388441"
     CDS             1619195..1621624
                     /locus_tag="LDBPK_364410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865555.1"
                     /db_xref="GeneID:13388441"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="UniProtKB/TrEMBL:E9BUE9"
                     /translation="MFRKRGSSKEMEPEVVLLLRHQSRYPGDLLQGVVIVDIPFPSDM
                     LALEVRVCGDERSILGGLFVTDKNPEARKTTYYEQFITLRGVDHDLLDSKRSLRNCRR
                     IAEAQGVRTGFKSAPHRQSLPAGDVVPELSASVIQNASEAAVHLIPGTYSYPFSLVLP
                     DNLPASCELYRGRDGRCVLRYHAVASLIMTSGKIHTSEARLRMNPLPVQVQRWYQLHE
                     DEQQLCEAAEDGGDAYYNETESRAGVLSRLMSSAGTMRADKAEWDSEIAHQRRIRHYR
                     QFPEDQLMLEAAVYAETAGERAERKKRRACERNARERGSLLVAAETTAVTNGSARILQ
                     NQREQEDAENRSVDTKDGAAGAANESDDAATAKVYDFGPEVPSPTEAASIRGEEEYSN
                     GRFHSNSGGTNVGRRRALENRCKKKRHHHSHERDAMDSPAHTAMVENNVDKLTFTPPG
                     GELPAPMAVRHVNQTEAVSHETAHGSSEEEREGRQSRSAHPHRRSSRFQPPPWNQGFS
                     ISLRSGFLRTGKVRVLLSLRSPLVTVGIGKVGATILIDNSDGSGAISRVKYSLVTQCY
                     IRTKTEVYNFPVDTVETSSDISVEKGKVVKLPEVELPVPKSTPLTMLTEGMGTLTFLS
                     VRLYVSTALKTFSRSVATEVVLVSGQDVLNCSRRLLRWTCFFRRRNGEDARDFTLRPP
                     TINLSEKNSKLRIIDGSTRGAAREQLGPSLQRDDSDTSTMAASAVSRSMRILRTSQRI
                     SKATPPIDVRLLAKTLNYEEALFVPRDDDDGSSFPRHVDPLAGLNPFVAPASGVISNL
                     AEGDNYETLCH"
     gene            <1624025..>1626979
                     /locus_tag="LDBPK_364420"
                     /db_xref="GeneID:13388442"
     mRNA            <1624025..>1626979
                     /locus_tag="LDBPK_364420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865508.1"
                     /db_xref="GeneID:13388442"
     CDS             1624025..1626979
                     /locus_tag="LDBPK_364420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865556.1"
                     /db_xref="GeneID:13388442"
                     /db_xref="GOA:E9BUF0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BUF0"
                     /translation="MESFDPFRVVGSICGPVPVCPTLLYGTPVLMVATGRTFQLYKGK
                     ELAMMRGGPMFQDTVRAVAQAGKYRAVAEGPRLHVYVHHKPLWSSHHEAATKPSITLL
                     LAQDDLLFSVGDDKRIVVWELKTGTVLQAILVENTETVTCLALLTGYTNKMLLATAEG
                     TLQLWNFRSGACLWYSMRSSGSSSVQASRATAGGAAAITALACSRYKDIIAYGTTEGK
                     VVACNVATDEVITTFDHSESCAVTSLLFRTDKDGLLVSGTSRGEVVIWDLENRCMDGT
                     LTRSKQVRSELEALERPHVDVVHSLVMFDLPEYTSLLITGSADNALMQFRFDTVDGLG
                     VLVRERRGHMGSCTNAIFYNTDLLVTAGNDRALRVTHVFSDRASWELSQGKLGKRGRE
                     KNLGREAVKLPPATALAAATTRNYQWSSLVSLHAASALACGWRMDTRAMEFKLSGIQT
                     SAHTARALALSDCGNYAVVGYSSGNVAVLSLQNRSVRHLFDADLGADRAHDSSVECVE
                     VACGNTVVVTAGLDGVIKMWDLWTGKLKAAIPTGQPMTKSCMHEASSLFIVAQHFTIR
                     VYHANPDVGLTEEELRTPVRELEGHNSPITALALAPDTYRYVASTSGDGALLVWDLAA
                     AACVGQYRFASPALSLSFHPDALFLVTTHAGERGAYLWVNNIRYGYVPEVVLSPKVNA
                     VETLPWLHFPTAHGAAEGTAEESTNGSVPRTSAAAALTEAEEEERAAAEAEAREAAVA
                     EANLFDASQDIALARRRQTEAQQAALDAIMTEGMQLAGVPQRLWFNLTVLDQIKEKNQ
                     PLLPPKKKDVPFFLPTTQELRPTFLVMVSDNRKNDTGNAKGRLMHADMEELTPVQEML
                     VNEKHDALMDYFLSLKTAQAIDLELKRAVDYVNGSSYTAAELARMQACVKGLLSFITV
                     WLRRNKNVDFVQGLLADVVRSHGALLTRFGDALVPALEELAEVQNTLRHSVDHLVSYP
                     TCLAGTFSGSIF"
     gene            <1628187..>1630022
                     /locus_tag="LDBPK_364430"
                     /db_xref="GeneID:13388443"
     mRNA            <1628187..>1630022
                     /locus_tag="LDBPK_364430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865509.1"
                     /db_xref="GeneID:13388443"
     CDS             1628187..1630022
                     /locus_tag="LDBPK_364430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865557.1"
                     /db_xref="GeneID:13388443"
                     /db_xref="UniProtKB/TrEMBL:E9BUF1"
                     /translation="MEDACLFQPQINPRSRRLARHAPTLRERQEQDAQRRSAGREGHH
                     GQPLRGAPTPSPGPEAFAADTESDIVESVWGLWRGVAIREARETEAALVRRVHSVNND
                     DLLPQRRPRVVYVTAVLGMLNALGITSPRHDALIAKFLKAMAVEGGASEATKRDATVD
                     AARFEYVFSTVWRAAVTHRTPWSPVPAQVSVSPRSPPAVQQCGNSPNAATMRHAYPRE
                     ISRRGVPPSHMKAAPATEVGSSGGSGSAVSARSSSSPSAVCSSSEGGEEAAHSGTESA
                     SPLTSCGSGDERRSDAAESDADFLRTNIYDASPSIPDSSEKPQAGARSKELSPMSVEP
                     SAGLDPSPEPRNPGEPVITPARSSVTPRTHHCSPFAAASRFGSASVSRSRRMSSSLRV
                     IPSDSHLLSSTTSRELKRATKRVPGGLMRECTFKPVINTVYEQMPVSFSSTAIVQRRK
                     SASTARPTFQPNTQQFHQARDSLACWTRQPVKDSGDYLGKAAANPLATGVETAVRRMI
                     AARQQQQRSQSPRPSLQKGSHHSAPAPQSAVRAPVAHPRKPLLYVDVDLPQGQRDRLA
                     LYTGDDVQDVAQRFSILHGLSESLCQRLETALTAELCALSVGKAA"
     gene            complement(1630332..1630403)
                     /locus_tag="LDBPK_36tRNA2"
                     /db_xref="GeneID:13388444"
     tRNA            complement(1630332..1630403)
                     /locus_tag="LDBPK_36tRNA2"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:13388444"
     gene            <1631036..>1634407
                     /locus_tag="LDBPK_364440"
                     /db_xref="GeneID:13386706"
     mRNA            <1631036..>1634407
                     /locus_tag="LDBPK_364440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865510.1"
                     /db_xref="GeneID:13386706"
     CDS             1631036..1634407
                     /locus_tag="LDBPK_364440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865558.1"
                     /db_xref="GeneID:13386706"
                     /db_xref="UniProtKB/TrEMBL:E9BUF2"
                     /translation="MFALWRAHKLAHLVFFYKAHHTLFQHFSHASSITLYSAAKKKRT
                     RMSADLFKEALQSLSKKGVAHIKCAGLGLNDHQLQLLITAIENSPSHPEIIDVSNNSI
                     TSAGVVYLIRYLTTASVEAVDLRNNQIDEDGALTFFPLFEKKTSVKLLDVRGNPCSAA
                     TASRLYFLSKTEKCSTDVRSALLTGNAQHISFAGMTYGELEKELLRFLLHMEGLQSVD
                     FSGMDLGTAGMITVGTFVRDTQVSALSFCKCSLTNDAVLNFFQAADLANQRYPNSFDF
                     SWNIGLSNDLVRKLISTTFDQSHCITNFALTKTSVTPTYVRLVQKECELNQENPAIKR
                     AVVALRNNSSDAQEVNLQWDAPLPMCMNYLVDYIAASSVIQHLNISNSLIDDAGLELL
                     AEALQKNTSLKVIELANCRITATGIQKLFAVLQKGICLVQEVNIANNNLDEGSVQYIT
                     AALRANPRLKTLNINVNPAISPASMQEIAGLTMVNRAPPQIRSVLPLIENNSKDVVVL
                     DFSGKGVTLDDDSVWLLAQALRLNSTVRQLNLSHNSFGDTGASYLADYLADNRTMLEL
                     NLSSCTIGNRGAQNLCKALATNQALQSLDLSNNMMDADSLSALPLVLRENTALREFKL
                     ERTRVASEFVEQVKMACSLNRERAAVKRIYYRLHDGDASLTKIELSSPDEERVIDDQT
                     VSTICTVLRNNTSVEVIDLSGNVIGKNGCSALAATLSECTSKVRKIILSKNPIDDDAA
                     AELAACFPKIKTLREVILYNTNITKIGMEALAKGLEENASIVWIGITDDDTADENVSL
                     LMRNLALNNGPAALKRITLSIDAGVIVDDVDLSRPVDCSMDDSLCKFLCASLVRCPTL
                     RSLNLAHNEISSAAVPYILEVVEMCPSLASLDLSGNQIDESGAQQIIACLERVSNLRS
                     VNFAGNLFSAESLERVSQLVALNMGSEVLKKLYLTTTRGDQLPNDIDLNGTTNSYRLT
                     DEEVVVLAGLLQNSSTVKSLDLGSNSFGDEGCIAIAEVLRFNHTIEALNLAGNAIGSK
                     GGEALYFALKINPQLQHLDLEKTAIPRDVLESISSLLHVNQTPYRAVIDMRGVKLYEL
                     NDETQFRSTDYYVAQTVTLDAAIEGCKQSEVKAVE"
     gene            <1635223..>1637334
                     /locus_tag="LDBPK_364450"
                     /db_xref="GeneID:13388445"
     mRNA            <1635223..>1637334
                     /locus_tag="LDBPK_364450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865511.1"
                     /db_xref="GeneID:13388445"
     CDS             1635223..1637334
                     /locus_tag="LDBPK_364450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865559.1"
                     /db_xref="GeneID:13388445"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BUF3"
                     /translation="MPSTAEESLPPLFVLQEHADPVLSCRFYPSEVYQRDESSWFLSG
                     DAGGLVVLWNLSTRRKMISFSALTEAHRQLCGISQHRRNCGTPVAGGLMPENEVLLEQ
                     VGTPAFGPHSQSILSVGFIPLSLSSPQPTVVTENGRVVADALARDSDAEVSSGAVCPA
                     VFDHAARGTSDWAHPGRPRFRLSRRAPTHSVSSEQASSSTGDVLDSGAPGSAFTPSST
                     ICFYTHCRDQRVYIWCLERQCTDAPASSPATRVPQLVVVLTAPQHGFCPVESISKAAS
                     PFTRTYLAVPHESGGEVTIWELSWRQPNTARLTNSRELEGKGASDDPRSSSGNANAYE
                     EEEEEVNTSGMNPMDALIARAAAEEQRQAKMKQKSTRVSRESDFHHPYPSSAFPDSVV
                     SRGERASILCYVDPAATTTSSNFSVRRLCTFSACPTFKGGTIMRLTMCHDAQHLTVAF
                     ESGHIVLARYRDADVIDVADQPRGACHAGGSLPVARVRNVTRAFADSALVCWWSGRRV
                     LACSSEGGMHCYDVSATAEGLLEVHLVWSVTLRKGIGSVFLQRNLIVAGCWDSTLRLY
                     DARDGRIVSILSYQRETINEVRTAPPSIARVAAFGFDVRKPRLYAGLPGALSTKSTAC
                     IASNSTTLTQGSLPQFSESPLRETYVAGTPAPHSSSESLAAEEQLVYLFASASKDCTV
                     ALWRVDLGLVVEQTAREAITA"
     gene            <1641821..>1644247
                     /locus_tag="LDBPK_364460"
                     /db_xref="GeneID:13388446"
     mRNA            <1641821..>1644247
                     /locus_tag="LDBPK_364460"
                     /product="protein kinase-like protein"
                     /transcript_id="XM_003865512.1"
                     /db_xref="GeneID:13388446"
     CDS             1641821..1644247
                     /locus_tag="LDBPK_364460"
                     /codon_start=1
                     /product="protein kinase-like protein"
                     /protein_id="XP_003865560.1"
                     /db_xref="GeneID:13388446"
                     /db_xref="GOA:E9BUF4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BUF4"
                     /translation="MMMKSYRPPASFQQGRYIPNKVLGTGTYGQVIRCYDTVMGKDVA
                     VKVAQSDAAYRRSALNEISALLCLKENEDSVNILDSFEDAGHVCIVSELLDRNLFEVL
                     RNRGFGPLSLREVRQVALRVLSALASLHNSGYIHCDIKPENIMLRRSTPVSSDSSSPM
                     LGPFTSENASSRSSNKSGEQNNFPNALAPGQEALKLDTNANVHNQLWRNTSSIDSLVG
                     STHSAAFQDGDLNMGFSPRTGNRLGGYSKQQHGQRGSGDATASISGAGMRHSGSLDGL
                     FGMPAAAVGASGTGNNTRNDLRVNRNTLGNKDSESQERTQFNPDANPYCRTCLIDFGA
                     VRRFNENTYYDVQSLWYRAPEVLCGLPYTTAIDSWSVGCVLFELFTGKPLFPGESLQH
                     QLSLIVQHVGHPSQAALTLGCLATQFQLPMVYMSHDARREHVRQWILSSREAGLQRWR
                     KHQMQKLQEAHIAGNQPLWSHPTADVPSTKSEEDALLTATPYGESDVDGASEELELLV
                     DLVCDLLNPDESQRLSCTQALRHPFLNNASKCRSAAPCPCTATPAACFPAVSAAPAPM
                     PCIMATTTTVQPVMMTASPLSVPMGCSPASPFVMHPVHSAPAATVPFTVAPLESMVGV
                     EMEVSTLGVSSQHQPPQAFSTYPAVAASTVYTTNSTGQVMQCTVPVFTQVTHQVAPNV
                     GHAFLPLGMTAQNPAGGTYCSPTTTASQQQYPPSGMSISPTFSPRGALVHAHVPLGFT
                     STTASNPAAVAAPAASVQPLGASSYVLASAGTVPCMHDYHSEMASAGMSPYILCHFQP
                     PHACATVMSP"
     gap             1658008..1658373
                     /estimated_length=366
     gene            <1659477..>1660772
                     /locus_tag="LDBPK_364470"
                     /db_xref="GeneID:13388447"
     mRNA            <1659477..>1660772
                     /locus_tag="LDBPK_364470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865513.1"
                     /db_xref="GeneID:13388447"
     CDS             1659477..1660772
                     /locus_tag="LDBPK_364470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865561.1"
                     /db_xref="GeneID:13388447"
                     /db_xref="UniProtKB/TrEMBL:E9BUF5"
                     /translation="MNSTTTISTDPDASFSRAASRVSTPGTMSVLVPYKRPGQKSSMA
                     PGGASQQQRSLQSAYAGKSIRTSASTLSSSVPPHGAGAASRGDQSRRGNGAPDGTLNS
                     YSSHPAAPLDRPRDEEFDAVERRARMALESIATRDEDLEPSMGDHIEVLQSYRTACEA
                     RAMYREAYLVQQVLRNLRLEEESRHVRGITEQQMEERRILEEAHRQEFREFHHSWNAR
                     IDAFEEEQLDAELALLERQNEELIRFQEEMRNFQPRLLRYSRSLLESRLKQQTLAKQR
                     DYVAAQAQKAHAEAIEVGDIERFEAARMSLFERREYAARHRHQQELYALRTKVESRRL
                     YLERYRKQELDVLLQRYINARRSMESQQNIVRNKTGTLLLKHACNMKTDNSGTAVLVE
                     SAGSGAFGTMVQRRQACELRASQGPPDGASASVHDGSTM"
     gene            <1662225..>1667285
                     /locus_tag="LDBPK_364480"
                     /db_xref="GeneID:13388448"
     mRNA            <1662225..>1667285
                     /locus_tag="LDBPK_364480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865514.1"
                     /db_xref="GeneID:13388448"
     CDS             1662225..1667285
                     /locus_tag="LDBPK_364480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865562.1"
                     /db_xref="GeneID:13388448"
                     /db_xref="UniProtKB/TrEMBL:E9BUF6"
                     /translation="MLGTLFFDESRVSTAFRARVRQQAGASHESSATRHILSSTSLAG
                     SAAHDGVARLHDGGGLVPAHGCTFSCRGEVALPSLQAALLWWLDADVSVVQLLVVNNT
                     QSSKAARSCQSRLLTVELPVASPSDLVTCGVTRSYMGDNGVAVVWVQRGVSGEGEEEA
                     LCPGFAHVTVQREADNTGHSNLLLYPDERVVQCAPLSRVPSSFFQSALAGSGSAACVV
                     AALPDDATQRTVSIVVLTDGSRVWRAELFADGTTAVSGFRDEYRRNMLRSFCDGNEEV
                     RLLDTRSVVADLQRLASPAASNAPSFADSGAEEGSTSPRGSTWIRRLLGGGGRAGANA
                     ADGSDGAASGVLDVALPAVVKKRLYAAVTAVQQSRFVALTRWNGQLEVYDTASGTLKL
                     ARAYPIGILPQAILRPIDGNFSGRGAKAPGGKSALCALPPGPLAQWATQCSTTQLLHV
                     VSCCSGGGGRACFWSALPPLAPSSSRIVGLEEASDAGEVLAQHCTLSVAPPTQSSFPL
                     ACAVTSDGRKMILVSDVGTEEDGHLLCTRTLAALTLRGDQASEDGVATVVQVMEATGG
                     AAFGDLLRTGRMHGYLCQGARMQSVVAQDNAVLMVERGPQMCRLYALEEAAPDAMRLA
                     NERVVVGVDEEDVYAMAHDMVGDDAIATYVGGALLPSHRVHYVPLFEASLLLPGAAVP
                     STADDTDGFALYWEGVSVLQACPHGSRLMSDLLQDVLLATTPIARLSSLPRFLSEAHL
                     SGYAAALQRNAAATKASVHAAIRMALLPPSTAAAGETAHALYRFSRLYATHATLGELL
                     SRITFLTTTYLGWQSTYSVAHALSSTGEDDAALSTADWVSHWLITALEVLVAAYHAVP
                     AAGADLVQLALVDDSVSQPSSNAIVAALLPTLTDTAACDDDSVACGWGPSTLSMIQVA
                     NRLLRCGTPSTARACAVWVKQLAHRFPLLQHYQLLSLLETTAISTQSERAVALCERVC
                     QALAREAPGDVTTALLLEGLLLTDVSGPGSAFLQLSLDDVAAFLAADPTLGPKLYAVG
                     VLRRTITVGSLHTTLSHCVTHRYLYTNLATCIEAVERMHRCASVTASTPTQAPFSQLR
                     HALEELQVDALLASAFARVSEGDVACGFHDMQTALDLITRHKCLPSYAELLQVILGHV
                     VEVACASQANMNALLRATTIGAAQLEESLILRWYNYIARLPTKSATEATEALRYRAIM
                     GLHRYLMNRHDYAQCARLMSSLATLIRCSPLRRSASAGISVSELAGLALHAAEMIAPS
                     APVPETAAGEQGETGQAAPQGTSHDPALMVGSPLSLGYSWQPSTSASSAPIDLNSPTL
                     GATARGPRWLTRADIPCLRRRLYQAHCERQLWRRGCTLDCTDLWVEGAPADAYQAGVE
                     KLVAALMQARLWPQAFRFACLSAVYDPCTVLVEWAVDLLRASRDYGSDEVAAAEGVHA
                     ELTAAWAELIGYCGEISNLENQFYAYVRTVTAALTYAYSQVPTALLAAHRAADAYTAM
                     TTLFHVALILRRKAEAVELGQRRNEEDGGDKEEADELPSSSSNREAGATAAGRDAEKR
                     GEMHLEDIRCNVWRAWCAAARIGIDMAAERQPRCASAAALYQRTVGAIMGAGEVMAEE
                     DAAQMHAGVVVAGTVSAASSAARRTFSAFTAGALDPMAVCANELLRIPAYRASLNLVV
                     RGEATVREFQDLMGRPCS"
     gene            <1669005..>1671479
                     /locus_tag="LDBPK_364490"
                     /db_xref="GeneID:13388449"
     mRNA            <1669005..>1671479
                     /locus_tag="LDBPK_364490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865515.1"
                     /db_xref="GeneID:13388449"
     CDS             1669005..1671479
                     /locus_tag="LDBPK_364490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865563.1"
                     /db_xref="GeneID:13388449"
                     /db_xref="GOA:E9BUF7"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BUF7"
                     /translation="MKRSRQDNRRLGPAAAAMRRRDVYRDGRQAEEQVSIQKLFRDAV
                     AMQKFHSPNQSGAGARVMIHSREELALYRQKRRAELEESVRRGFRAIGNWIRYARWEA
                     QQRDFDRMRAVMERAVPVHGENANLWRDYAELEESNGFAEHARQVWSRGVTALPSSVD
                     LWVKYLAMEQAAGQDQRVRDVFHRWLAGDAVPPCAYALAALYEAQQRRQAGCRDILRR
                     CVERFNTPASWLLYGATEQQVFGDHERAVKVLETAMRALPDEDLWGLEECRVPLALAE
                     AHVAAGSAVQARNVFHNALEHVADHPLLLEKVLASYSRFERLYGDGEHSEQVARLRTI
                     QLYEERLRKNTSDFDAYLTLYSLYRDQERESRLRASGSINKMPEAVVGGNAALASTAL
                     VTSPAAAASPSRQVLERALQIPPRDPYGAQQRAVLVMEYARACEDDGELDAARRTLAQ
                     EIKNFPFEAALCPRLWVEAAAMEERHGATAQARRLLRAGSQVTKDVRLFEEAIQFGER
                     QRDNVIEAMHAAAHETTPPSAQEVEEACAPYVAELRTDYQNAIQAFPFDVQWWLRYAK
                     LEEQQQEILRADALYGACIRTFNDEAERVRSFAQRYDLLGHVDAAWAHRIHLHTRRAR
                     ALQRQASRRKGCAAGAETARVELATLQEELLHLYATLLQDVWNAYRHEAVAWFSRYFE
                     AGEGSGSGVLAGAAPKTLPSSLTPATARWSEAVEAVAGYMERMSAIKIGQGASEGATA
                     ALREMLKSMVEAERHAIRRSLGWTEQTTQFDAVQRAREWGELLLSPLLEEWSKFELTH
                     GGSLEAVAAAMEKPVKRRTRLFKARP"
     gene            <1672823..>1676518
                     /locus_tag="LDBPK_364500"
                     /db_xref="GeneID:13388450"
     mRNA            <1672823..>1676518
                     /locus_tag="LDBPK_364500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865516.1"
                     /db_xref="GeneID:13388450"
     CDS             1672823..1676518
                     /locus_tag="LDBPK_364500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865564.1"
                     /db_xref="GeneID:13388450"
                     /db_xref="GOA:E9BUF8"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BUF8"
                     /translation="MERTVSELVSQHGPTPHMGLLRCQMERRGRHSLKGYKKRFWVVD
                     ERNGWLEVYKNDQEHVPIEVFRAADIRNVIYSDDKQNRFFMMLVQTRGPRDIKFRMGS
                     FEERESWSKAITHIMDVYSAINKHKNVLGMVLRRAKTVSEALGVNISIDSGRLLAEVP
                     EDLLQYVAEAVDIALVSVTAIVRSFKEEGADMPRSYILYVHAITEEQSPYQRKETKYS
                     PEGRTMTMNVCLLRVKSERVSFVVTQPEEVFRLVQSSVFRNPVIEGWIESEPNCARAC
                     AAIQDYLELPAGRSSWITFQWGQHVSDSAKVEAFLQRFVTATFFERALQSVRDAVVRV
                     ERLIADTNAQTTAKSFTGGSPAAPARDGGCSSPFSERRQMTTPGVTVQPDSIVFSNSS
                     LAATSATGGFGGAAGGGFHTHQPATPPLANNAAGGGSDAALAIRFIRENVAGLCIQLD
                     KRVVEKGTAPPPIVTLHASEYEQHCRPAFLLVAKCHRVLPRKHHVTKDVLSEELYEVA
                     YNAFLQQQLSLLRTELNGIFHKQVKVVIMWDLLFRAAAGLKTPVSAEELPHLLRYVKD
                     VCLSRLQHVAQVLRHARSDVPGHVEDHSYLYKAFCSCVGTVVVNFLPYTVSSDANVFE
                     PNLQAGVLTDTLYCTKEESMPSLMAALGHAHRGSASKTTRVSVMGAGFHGVLLYAAEA
                     KLGAWCESYFSDPENATPDPRRQLVEDEFDSDTDGTSVGMLQDPDFGEAVAYERSAEI
                     RPLTMQRVVNAIYDSQRHAPVDLKIGSEDIMRAIHAFVSAFGDDKRPSKHDVARVLII
                     NLQRLRQMYVRAVDDETTSLLTFEQARQLLRDFCEYQTNEQYIDVALREVPRLGTEPA
                     SPQEGQEGSQRESHEPVRTMKEEMDADVSDSGHPLEENNAYPRSPRPRAMNEASLSVV
                     SNGTANGAEVTRRGNRRCSLSRRRLQSNSKRASAIVASRTAESPSARSALVTPGAMSD
                     RSEPHIRVPSTTSDAFDFASVTDVALTVLLPREARLARLAWRVGFVFGLENTGKSLII
                     NSMRGIARPTVATVGLSQQVVAFDEWVWALNELGGRESFRKNWRYYALRIDTVHFLMF
                     VLDVLNGQALGEARQYLKEVTNHYHEAPLLVIFNNFREGHRRFDIREFEALIHLDKLR
                     RRHGADVLSCVCDITVVHSKNRQLPRTLSSTLRTLSSLLKARSKSENGGDGGAPPVPK
                     ATTTFSASVVGGAAGAAAAGAGVGHST"
     gap             1678680..1678778
                     /estimated_length=99
     gap             1680098..1680196
                     /estimated_length=99
     gene            <1681023..>1683272
                     /locus_tag="LDBPK_364510"
                     /db_xref="GeneID:13388451"
     mRNA            <1681023..>1683272
                     /locus_tag="LDBPK_364510"
                     /product="trypanothione synthetase-like protein"
                     /transcript_id="XM_003865517.1"
                     /db_xref="GeneID:13388451"
     CDS             1681023..1683272
                     /locus_tag="LDBPK_364510"
                     /codon_start=1
                     /product="trypanothione synthetase-like protein"
                     /protein_id="XP_003865565.1"
                     /db_xref="GeneID:13388451"
                     /db_xref="InterPro:IPR003615"
                     /db_xref="InterPro:IPR007921"
                     /db_xref="UniProtKB/TrEMBL:E9BUF9"
                     /translation="MTVNVASEVSPLPYGEHQGSFRGVVACSNRDDGYFSGENNYVDT
                     SIYTGFRYQCVEYARRFLLLTTGCVFANCGRASEIYAMDHITHVETGAQYTLHRHHND
                     GTATQKPAPGDIIVYPYHPELTPWGHVGVISFVDDNRVGIAEQNHYFGPFTSPNESYL
                     DGERCVERYAMLTFDEATKTWHIREPGSMPSAAGWLSYPDAPTREQIHAPFTPLPCAI
                     KVRSTPFDQDDHPFLTHYHLHNGFDIPSGCVRHAYGMRNGTAETLVGATSAAARVLRF
                     TLHLLFRRGRLGPSFRALPTNPLNATLPEGAGASAEACREVDALFKVLAEKDVVNATE
                     TTPDRLRQAVATYFDIPIEWMMAMERDFAKGETHMAAVVSFYPNIETDSAALEAFRAA
                     RKRSGTWAAPAVGTVPRTTANASTPVAEEPLAVSYPATAEEFPVKNPHDEAWHVAKVN
                     FGNARVMTELSQLNKVQQELTGTIALMTPSMRPFISTQYRMDFAGYLKVVEAVYGPRT
                     SFTIVMSDDQPMDGLLRELVWTLQNLCELVEYPVRVVNEKDLTFVNGKLHATPSAVSP
                     EAGSRTTNIAPSGAYDVNFVYALCEWPRILADREATHAALYLAAVDPASDVVFAKPLW
                     SCLCSGAVNVSDDAERAHDSHSPRSTSVRFFDVCRRLYLLASPKQQPKTWDLEVSEYK
                     DSCRRIHVDAETVPMHSPAHLNADSLMINLAGSCYMGHVGGTLSVESENTGVHAGHPA
                     SLMFMFPAD"
     gene            <1684002..>1685630
                     /locus_tag="LDBPK_364520"
                     /db_xref="GeneID:13388452"
     mRNA            <1684002..>1685630
                     /locus_tag="LDBPK_364520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865518.1"
                     /db_xref="GeneID:13388452"
     CDS             1684002..1685630
                     /locus_tag="LDBPK_364520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865566.1"
                     /db_xref="GeneID:13388452"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:E9BUG0"
                     /translation="MSATAESSAVGSSFFLGMNPSPQAFAKYAKKHNIFLHPDVAFLV
                     PTKTMGMGVFAARPLHAGTVVISCPETSGVSPYMKEVPTSPCVAALHASPTAMEDAAL
                     FDALVLMAELGRENSPWRPWLEVCPRMAHHFFDLSSAQAAVLGTESVMGGWTGANLEA
                     PRTVEDTTVVASATLGLAGVTGVAQALGELRVMQRWATAQAIMAALPDVWPADKASFG
                     LFSEALSQVFSRNFHREDLPGREGPYLLPGLDILNHSFAANTAFEVRGGGRKHATAFT
                     VVTTRAVQKGEQVYGCYGRIGAARFAVEFQFVTKAVLRNDLVRCSAASLATVATLLQY
                     WKAARETPGCTVDSSAITAYLQRCTDGAALAVGAGAMAWKPAFFGGDSAADVEARRKE
                     MERRVERLQRLGILYDEGLYLVRPYATWEAEEAAEPASTFRWSTPAAHEEEIAENRRV
                     LAATVYLLTASKSVYDEVYHRVTADWEPPESAQMSAAVRDFLHIRIVAAQLQHDAACG
                     VFGDSSRDVVRRQLVQDVLVSEMETLRYYANSFA"
     gene            <1687215..>1693796
                     /locus_tag="LDBPK_364530"
                     /db_xref="GeneID:13388453"
     mRNA            <1687215..>1693796
                     /locus_tag="LDBPK_364530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865519.1"
                     /db_xref="GeneID:13388453"
     CDS             1687215..1693796
                     /locus_tag="LDBPK_364530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865567.1"
                     /db_xref="GeneID:13388453"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BUG1"
                     /translation="MGKLTVKVHKCELYRPVSSGNCAVNPRVTIVVDGTYRFQTNIKK
                     NTFDPEFRVSFVVGNTHRLAVIEVSVHDVQEPSGLVLPGIGVLAAKRGLVRELNGVRM
                     DEGEGVGASTAGPTGGGGSSGISSGTSSSFKARLPVLLGRCYISIERLVHHERKRRKY
                     YLATPLPPSSATATAGSNGCATAASVAANAIAAGASPATMASDVGPSFLQQALPTGIA
                     GTITISLESDSLGEPPSELSLNEPLETAYVRRLRRFLMCYDPPKVAMLDVMMAHVRDT
                     TEVGPHNNSRRRYSNSNGTGTVALAASSAPASRIHKQDRSSATSATSGTTTPLRPGAD
                     SVTSPTGGASTLLMSSHDQVDSLMWNPSNNCPNRVLQLDHKRSPPSSNGSPPFVAALR
                     TRSVCLGGRAELTADLPDERETFEGMMNRLCAEYHASEPGDFRVVLRVEGCTNINKET
                     WNQSLIGSDDVFVIFRSESEEFETNMVTLQNTVVWSEANTVAMDVVNPHRFYVTVILM
                     GRSGSKTYEIGRCNVSAAPLSNGYVSRRNMFLCMAESVTRVAVNGVVHLLVRPVNFSL
                     TPPDMAESVDDFYDRLGRFFKRYDPLQLPMVDVLARARLRDHDTYMKDLVIQYGREPG
                     TVRMLVAVESLISLRETADRDLSGQDVRVLLTMGSCGVRTKTFAVRQFAPTNVRENYV
                     FDVVRETDLIRIEVVNARDDNLVYGRVDFSCLNTQRSVMNKRDLYLVGAAGTRDAYFS
                     GIVRVSLYSDEVGHNYEVDMKLEDAFTGRLRRYVYRRIPESLHRVNLAVATVFDIESF
                     MAQLAVEYGDEDPTYALYFTVVGCRQLRSGFGGINPYVVVRVGIDAYQTKTARANEEP
                     DYFEFCEFYYDRPEGMAITLVVMDQADIGRDEEVGRAVIPLANVQPSRQYNDWLPLLS
                     EKKSGKVREVGTIGFKYTVVDLNLVDRTRARLIKEQHRERSARRPSLAKGRSESRLTS
                     LAPSGTSGADFLNSTWSTNANASSGFAHRWNTFKRYLLQTPLMAYSTRTLSMGNSAGD
                     ESDRFEQSMSESTTLIMAGQDASLFKSGRSVTSRLPTMNLMDLGISTVEEFCTAEVSE
                     LHSAGYSETDADLPASLEMTYRPPTHERDTLTGPCSSVNGEGGAESGKAARMQLSVRL
                     LSCTNLFKPGHNMPNPYVLLSTISESHRSRVQFCTTEPRFNETFLFTVEDPQIDYLTV
                     TVLTDTPYGLRKLGHCTLSMRNVQRGTMRTRWTSLVIHPFEPAAMECGFVYLSLGAIN
                     FGINYLPSVEAENRLREQIREYLTLHARRQLHRLEWYVGEFSQLESILLGGWFRDSGN
                     DAGADDTGTRVADLEVTVLGVSNLYCGGFLAEGSCVVKAKVDGQTRAKTRPITGAQGS
                     FVVPEGQDSLRFTVPEPMTTLVRLSVVLNGKTGAGECYVSLADLHRGVAKERTLMLVM
                     DSRSSHAEAVGFIRISVFCSNYGSSAPAPTEEELALHSRLTRFFYYYIPTELAMVDVK
                     YATTLNVAAYLSRMVEKYGPEPGNYRLRFRVDRCRNLVFKNDNTPLHVFCIVRAGLQE
                     FQSSIVEGHSECVFGESFDLIIGLPQQEKVELILMRYYPSKQVELGRTQLELRALRRA
                     EENSMELALVSNAGTKAAGVSGILKVSSFPVDFGRDGGMHLRTQSTLAYGLDGHSALA
                     QTMCLFSSPTRMGAANTVSGPRSSAPSDHDALKEPLVTERKTPPPSASRMISTFLNDS
                     LGEQGGTVPPTVRGSTSASVTIVGFAGLNMRDAQIYIRVSEHDKTLFKTKPIPAEQLV
                     ALEASTATFTIDNVAADYDKQYTLKLGFRKLLGSEALCHADFCVLRCPAGKTVEKRLR
                     LYDVNSQYLGICRLSITLPPIHLPALQWQHLSPAVFEPLMDDVASLVSTYMPKDLRRL
                     DLILCHAPDIRRLHRALRLQLAPSVVATVYVAIHSVDLHSVTVRHSCVVTASVGHFTS
                     EAVRRQLGSSQVYPYGMSKEGISNLDFPLLRIDISATGPAAILTLCVCDRASKAKSVE
                     VGRTVVSLRALLTPAVFDMSEKVQVPLVSVSHAANRVHASLAGTVTFSLMPPAFESYG
                     ASVRFASSVVEGFDRAYVRYYTDRICRLLSHYDANSLVDIHSRLYESYVSCKCWETGL
                     PACLSELVVRWGPELDSFEPPPALKSRDGAQQSRIAAMEKSENKESGPYELMPNAERQ
                     PAR"
     gene            <1697164..>1702041
                     /locus_tag="LDBPK_364540"
                     /db_xref="GeneID:13388454"
     mRNA            <1697164..>1702041
                     /locus_tag="LDBPK_364540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865520.1"
                     /db_xref="GeneID:13388454"
     CDS             1697164..1702041
                     /locus_tag="LDBPK_364540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865568.1"
                     /db_xref="GeneID:13388454"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:E9BUG2"
                     /translation="MPSTRCSTSSQSRRTGTAAADLASRSPTRSMRRTRQEKGKPCYE
                     AVETREEVTTYIVTANHVHAAVERSPPHQEHVLKGSDRRTQSCSGAARQEYPRLAYYG
                     NDRAPRTNQSAPEMTGDNARRRPQFGALAVDPGSRYGSAANRGRPTCSDNATSNFATR
                     RHAAGAHPSRSSRIVKAPADISTLEDYKTPTRRRRSGGRYAYDHGVGHTEAPPAWRGG
                     RHGRRSFPADVHAHDNVDVEETETNSAAAAAAAEPYHFRIRLHECRGVFADLKASCRP
                     PPAVYFAVHTVEERGHSDIADKGSYNPVFYDEFMFSSVDPEHDALVCTLVAASSVNTS
                     RGSRMRRDKKVAECVLALHNLAWQVERKVWVPLVRHPGTSQAYEQGEVLVSIYSADFG
                     YDDVATEEEEAACSAAIHDTLTRYAPQELHRLDWMTSAYVNKGPEALSQLRASYRART
                     VEPVPVRVTVQRVEGLTDEAGGPTRASDIYVVVGDGRVERRSKTVPYRRCATVNQEFN
                     LALANPAVDALSVTVLGNGRKLGEAVAGLTNVQAGKAKEVTLMLVRAAETGDASNGGQ
                     VTLTLQTEKYSSPYQMSAKQEARLRERVLAHLWCYLRDDLHRLDAIVGSIDNEEVYMQ
                     KWARTVGPEQKPRRLQVSVREARNIIADGGLPPRCYARITAGPTTVRTELATVRNGVV
                     TFKDSFRVQVYDLAHDAVEVMIVAEGDDGEREMSRVCFGVATLPRQCLVLRTLHLVSA
                     ATKRAAHVQGELTVELLAEDFGLTGALAVAAAENTSFASSVHMQRLEAIMQRSSPEKL
                     HRVPYMLDTAPPGKAERVVEDEAKQHGGDVAVAPMTVKILGVKAFKPAVDFYVKVYLN
                     NEPILRTGDVRGSTVVTIDIEDNNEATVRLKDAPQAVMTFKIAQHRTLRKTAVLGEAE
                     VALVNLVRGEKNVLWVPFFQPAKASASGSGGESRRCSASCTSDSRDNVVKLKGNRMPN
                     SNGTAAARQQRLPGASLARHGAAAASPVGMLGLELQSNAFPETTVTEYKLGDESGRKG
                     VSAQEAVTEDVTSLIAKMRPSELPKVQPMIAQCTSLKSAHDELRAELSTRPILCTVYV
                     NIESVDLATETGKTQEAQGGVAVEAVYGSERQESRKRTGFANDALHQRQLYTQIRLDI
                     PAKLDGAISGRNGATSRSAAYAKGAPALELRLIGVHGNEGASGAVLVPAGGLASGGAF
                     GEGSKGAYHYDAADSDSDATADPYYAGGENNLHSYIRFPQNRGRLRSTTQPEEEHMRR
                     PSKMRIMQQGQRQSHPHRNGGSTVSSHSNHYHNIPEDQYSSYREEDGKRYLGGANNIH
                     SYVGSPGQSFRHSIAGSERTPPRHQVGLANASGSNRQAGSTSRSSTAASVAYKWSAPY
                     RGEIGVVRLSLRALLTRPLYTIGDTLRVPIVAPVIPAKLSYHARCSPAVNQRCIVGHV
                     TLRLTLPAFEHVPESLRLGGHNNMSKVVPGYVHYYERRISAYLRSHNARDLVSFHYDL
                     YERDVVSGCWPVSLPQWMQTLIKRFGPETEYVGPVPSLPLVPEEWELVRQRADALRRE
                     REAALAPWKQGSKVGDDHTDDHIDVYSSRGASPSVHSRGNSPGRSAWADRRKGSSVNG
                     RLDAGTASAEAVHRF"
     gene            <1704275..>1705930
                     /locus_tag="LDBPK_364550"
                     /db_xref="GeneID:13388455"
     mRNA            <1704275..>1705930
                     /locus_tag="LDBPK_364550"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865521.1"
                     /db_xref="GeneID:13388455"
     CDS             1704275..1705930
                     /locus_tag="LDBPK_364550"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865569.1"
                     /db_xref="GeneID:13388455"
                     /db_xref="UniProtKB/TrEMBL:E9BUG3"
                     /translation="MSSYDAMSAVSSNGAAVPEINLHPRLMTYRPDSDSYTSSARQTP
                     RSSRAVPTNAELAYAGVTAQDGVVQQLSSRSEERGSLAGPREVSAQSNSGHRVLRAIT
                     ACGPIDEPLQFSQPQQRRAVRDTPREQQPQQHQSQLTRNISHGVVTRNPTGAVSSREP
                     IRPGRSSRSSTPRIPSKYNDPYAHVTSVVQEYRQSRISALEAQYRVVRTHSNTSISQG
                     YDTRQSQSASPRSAEARHNASAHRRPSARPRDESRRVSSASSRTRQNSPLPRAMEEEY
                     LRGGVPRAALDAPHIRYAEALQNMYNYSSSAQRLACMSSMSSNMTTEYVPDVARRIPD
                     RFKYVPPTEEERRHHREATLRALEEWRRRQWAGQNASCDEDMAAGGAAVEPRNRNLAK
                     NQAGTRSQQPQPARWAPSASYAPRESQLQQASHEKAAAWALQKEFGNTSDSFSGQTRD
                     SFTPSKKHSAKKASKIRGAAEQHDDYSTNEGAGEWERLQSSVGKRSGTPISRRQNGAG
                     SRASSRKGRKSPPESARLEDGMKLNSFRQKLLFDIVAPTVSIA"
     gene            <1707404..>1710073
                     /locus_tag="LDBPK_364560"
                     /db_xref="GeneID:13388456"
     mRNA            <1707404..>1710073
                     /locus_tag="LDBPK_364560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865522.1"
                     /db_xref="GeneID:13388456"
     CDS             1707404..1710073
                     /locus_tag="LDBPK_364560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865570.1"
                     /db_xref="GeneID:13388456"
                     /db_xref="UniProtKB/TrEMBL:E9BUG4"
                     /translation="MRPVAASACLYMDDSRGSALFPQPSTPEPQRFQFRSLRWCPEAQ
                     TPTAQRNGSVPYAAEEVAYMYADEEGVPHAQRSNVGHLTRSQPQDDSASPCTPRTVCQ
                     PRTRQRAELASAHPFSASLRTAHASAAPLQQSPCSFMPSIADAPVVRRTRSLSCPSAD
                     RSVAPARCSVGYGTSSGVAGQNIGRHTTVLSAVPPAGVNMCGSPSAVSAACSTVPLHS
                     ALSTTAHSMANEQGRALPERHDGVDLPACGSNDGFFAHTYTTQPCATSASVPRLTRLS
                     LSSSGHSPAVPTNWSIGRPTTLRCRDTDSDVHCDWGAIQGEDEAEKKSLIGCATQVWR
                     VSAEVRMPLQCSHGTEAKEEETLLGDPTSHGGDYLTNGRDVFASSPPIAWQPAPLPAS
                     FAASQLDLSGCGQDNAVLLSGVPVASAEEEAHNESREVTRSNAIPTTGDIAATKSNGS
                     FAGLEAAPRKGYARSNSGTPPRSDLGSPNNAANLKAQGRAANGASAGVELASRAAASE
                     TNSHHFGASLCANIGSGCSARLGIAAEWRDHMCTATPQGRGVWVDAPAQLRGSEYPPS
                     TTTAEAVAARLAHISIHTSPTPKRLAFEEEELAERVSGGGSPTLIPAVRIVVDGAARR
                     RACNDASAAQGGGGSTEVGLLGKGAGGLGSSGMRWASAFGDSGHRELCSSHIPSGLQL
                     LRSRKRCLAEMQATDTQERHADTLVTVGINDAHDASYLVPDRVGSMSLATPFENLEEE
                     GGDGDEEAVKRQRREEQRRTRLQHLLPASLNTMDDLIPSPARALGTGVAPCSFLLSSR
                     MCSAVHGIQSAQDQQHQQDRTRNDDPVSWSQMSSISYVTPASQSTSMGLWGMSSTLSQ
                     DHHGGAVVCSVGSGSQVLTPLPTNVTPQPSRKP"
     gene            <1712471..>1713700
                     /locus_tag="LDBPK_364570"
                     /db_xref="GeneID:13388457"
     mRNA            <1712471..>1713700
                     /locus_tag="LDBPK_364570"
                     /product="proteasome regulatory ATPase subunit"
                     /transcript_id="XM_003865523.1"
                     /db_xref="GeneID:13388457"
     CDS             1712471..1713700
                     /locus_tag="LDBPK_364570"
                     /codon_start=1
                     /product="proteasome regulatory ATPase subunit"
                     /protein_id="XP_003865571.1"
                     /db_xref="GeneID:13388457"
                     /db_xref="GOA:E9BUG5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BUG5"
                     /translation="MLADVAAPSSSSTAPGSNTAVSDYFLQKIHELRATQKRTLDNFE
                     RLEAQRNDLNRRVRHLKEEVQMLQESGSLVVDVVRVMGKNKVLVKAGSGQGKMVVDVD
                     KSVDFKDLTPNARVALRSGTSAIHYILPTKVDPLVSLMKVEKAGKESTYDEIGGLSRQ
                     VKEIKEVIELPVKHPKLFEALGIEQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVS
                     GAELVQKYIGEGARMVRELFVMAREHSPSIIFMDEIDSIGSSRLESGENGDSEVQRTM
                     LELLNQLDGFEASKNIKVIMATNRMDILDEALLRPGRIDRKIEFPAPDEAARFEILKI
                     HSRKMNLTRGIDLKDIAKKTSNCSGAELKAVCTEAGMFALRERRVHITHEDFVLAVAK
                     VMHKDQDKNVSLKKMWK"
     gene            <1718386..>1726104
                     /locus_tag="LDBPK_364580"
                     /old_locus_tag="LDBPK_364590"
                     /db_xref="GeneID:13388458"
     mRNA            <1718386..>1726104
                     /locus_tag="LDBPK_364580"
                     /old_locus_tag="LDBPK_364590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_024473498.1"
                     /db_xref="GeneID:13388458"
     mRNA            <1718386..>1726104
                     /locus_tag="LDBPK_364580"
                     /old_locus_tag="LDBPK_364590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865524.1"
                     /db_xref="GeneID:13388458"
     CDS             1718386..1726104
                     /locus_tag="LDBPK_364580"
                     /old_locus_tag="LDBPK_364590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_024329267.1"
                     /db_xref="GeneID:13388458"
                     /db_xref="GOA:E9BUG6"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:E9BUG6"
                     /translation="MTMGSLALLSDIRAAYLAGYDAVQRSGEKILSPVRGAIERAKTT
                     AVTKAARQRLEEHLRLLCTTICISGEEYVRTFPANLYVPLLTEILTAANVAQRSDGYV
                     MNPLSSEVCDSDMPSYFSVANQPSHKVGLASRSNKLLSSCLPALGMQAASPVAVFALR
                     ALALIADMVPSGSFAFCPSRSKDTIATLALYLSDPEFLVVNEDLAEELLKCFLYVSML
                     TYDACIDARVPARTVEMLLSLEPHHLRVLCVQVVSNLLARARESDLEGVWAPVMAKLL
                     ESFDSFLLESSFRLSAPETTPQVATDGSSTPTAATVADTTAFTTPTAARSLTRKEATL
                     LQHYMEAIAHAVDRLFVGVASMKAHKKLLDHMIRVCVQVLQLSLNIIPSTCGEWLRSV
                     ALSPILAFYLTNPPFVLPVLLQLHVWEAVCGCMLTLVERRAVGTRASGAAAGITALES
                     EVAGGAPDDSAAMQGNSSAHTTSSAAASSTSLESNAQRGRGEDDSSNAVADATRSSAA
                     RRGVPALSTGPVLTTDVTTIPFIADELRLLPLLEFLLVLLPCARRGHSHTDFRHITLP
                     YFGWTWEDDFHNETECNEALSRRLERVYQQTRSCRKHELFAITHGKQRVFYTDFLSKS
                     YVSERRERHCLHRKPLLTGYVHGTQDALLRGCTCCASEPAPRFSTWVNRNYMRLRTAD
                     TEASGRRGEFPSSSSSSCASSGDAADEEDGSQAPGSAPQSSAMARGSSSPSLHSNSAR
                     DRGRGYVSPSSSPHRLHRINTLQTPNVRASDADDGGGNRDTTTSPSASERPRGSGTTR
                     EGSGGATIVHHGNRLPHPAYSGVDEVDADDEDCYNSINGHQDEPQQRNPRRRGGGLGF
                     LLCRCDSDTTASSQGRSRQMHMRGYLPETPPFTHHRNDSLAITVLPMEAVLESPGERL
                     QADPSTRKSFLGKGVLSSMLVTVVPALLSVLDNCVNPVVARHSVTLLLRCLSLSADLR
                     TQVTGESIELFTGSRSGEEAAVAAAASEVSEKSGWRRMSFRKWITGGSGSRPRRWQRV
                     EWEATQAALQRLVPSLREVLVSLYVADGVNIVAERQETFGYMRDDLLVADELARVGLS
                     TEFFGFQLALPSELHVCTADAIALLLRLFPSAKPSARAASDPKSRALKKSRKVNILHR
                     PPRHNISGDKDARLQASPTQSMSSLGSSTKASAAGQPTTLAAQAALQRQHSQDLRTTV
                     ASLALPETPAFQRGTPVSQGGRGHVTKSSSKTHRPAHVQKQDSTDGNATNGQPPPLLS
                     FTTLSRPSTMSLSLSANESYSASVDTVQDCLSKASPADSRGIGSTGVFTLHQSTLLVS
                     YASQILRRSIKACAAAQQIHESMNHKIFHTRVAIGSPEPGDGGALQLQSRELTLRLFP
                     DSRCPYHSTFLACTETFFHASQALLVALLAAGASLPATSGATAAAPRDLVTQPATAVF
                     SPAAIAAAPSAAVARLQGPQPGRQGPSACLTAQPAESAYTSAPVQSQAPSQLKGGEEL
                     SVGVELPFIPVTVNAGAMQEAINRAMEDNIGLYRRLPPALRGLLGFYDYCKHCNIELR
                     AAIVETPEILGEMATHLEKWLASRARQRENVECSNASFALSLYVSNNSWDSSSSRGVD
                     ALLASQQHLRLDSAARGKLLCLTADFATTIGRDLGLATLDLAPSVVMKQPCSFQKRAK
                     RFKMFDAIRFLVWRPLSIFLDLRTPTTAKQLRSSSLSTADAASVAWGEATEAEKSVVM
                     VGCTELRVVTGVKLRDPIMSVLPTTTVGLLAEAVAAQVQLPRASVFSPSFTLKSSQLP
                     PSPRPLHASQERQSLSEPDSGRGGAGSPCLTSQNGFEERRLDPTATVTTASATEPPIS
                     ADRILFFLNDTPLFSPMTTLLDALTAFAVSGASLRDLVERQRRSSESVDAHSSKISAT
                     LPTLPFWTLTHALEFVVLAEPLPASLILGLATTASASSATSCCCCGCDGFRPAFLCSP
                     KHLFDAAPPNGPLALFSALSTVMREEVGSSLAVLESNQQRLSSAVVHELYHQLKMFML
                     PPLLWCSGIGVSSHGGPGDRVVGTAATLSSGAFPLPSYVLWRYPFIFSAEMRLSIFRF
                     FISAQRSLSHEEAKHLLQNYRHLLVRHAPAEEARAATSGAAGDTEKTLNIVGLQWLSE
                     EVVRRRRVTLTVQRHNILRCAEELIRLATCNVTIDVAFEGEAGIGNGPAMEFYEMVAE
                     ELLDPKHDLWRTEPIPIDERADSSSLRAAPSPTRSANPSPRTAATGAPQRRRPCAPLF
                     PAAKQTPTSLHYWKLLGVLLGRLLVIGTTSSLYFHPLLLRRLRGESLMSTADEASQNM
                     SQVDAALELTLHRLETMNAGSLAACELFFTIPVSEADGYVPGAVEELPLIPGGANRQV
                     TVDNVHEYTHSLRAYYLHTVPDLVLLHLRQGLQLTVNPLYLQLFTVDELGRLLGSPLD
                     SKVWETREQFARDVEAAHGYHIKSDVVQYLLDIVPTWSAQMQHAFLKFVTGSSAVPYG
                     GLTQRIKVVRRDVDVPAADLSVTPTTHSFGASAAGLVTTSSFTGGGVNYDNSLPTVST
                     CFLYLKLPRYSSKAVLQDRLRFAVCEGQSFFSLT"
     CDS             1718386..1726104
                     /locus_tag="LDBPK_364580"
                     /old_locus_tag="LDBPK_364590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865572.1"
                     /db_xref="GeneID:13388458"
                     /db_xref="GOA:E9BUG6"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:E9BUG6"
                     /translation="MTMGSLALLSDIRAAYLAGYDAVQRSGEKILSPVRGAIERAKTT
                     AVTKAARQRLEEHLRLLCTTICISGEEYVRTFPANLYVPLLTEILTAANVAQRSDGYV
                     MNPLSSEVCDSDMPSYFSVANQPSHKVGLASRSNKLLSSCLPALGMQAASPVAVFALR
                     ALALIADMVPSGSFAFCPSRSKDTIATLALYLSDPEFLVVNEDLAEELLKCFLYVSML
                     TYDACIDARVPARTVEMLLSLEPHHLRVLCVQVVSNLLARARESDLEGVWAPVMAKLL
                     ESFDSFLLESSFRLSAPETTPQVATDGSSTPTAATVADTTAFTTPTAARSLTRKEATL
                     LQHYMEAIAHAVDRLFVGVASMKAHKKLLDHMIRVCVQVLQLSLNIIPSTCGEWLRSV
                     ALSPILAFYLTNPPFVLPVLLQLHVWEAVCGCMLTLVERRAVGTRASGAAAGITALES
                     EVAGGAPDDSAAMQGNSSAHTTSSAAASSTSLESNAQRGRGEDDSSNAVADATRSSAA
                     RRGVPALSTGPVLTTDVTTIPFIADELRLLPLLEFLLVLLPCARRGHSHTDFRHITLP
                     YFGWTWEDDFHNETECNEALSRRLERVYQQTRSCRKHELFAITHGKQRVFYTDFLSKS
                     YVSERRERHCLHRKPLLTGYVHGTQDALLRGCTCCASEPAPRFSTWVNRNYMRLRTAD
                     TEASGRRGEFPSSSSSSCASSGDAADEEDGSQAPGSAPQSSAMARGSSSPSLHSNSAR
                     DRGRGYVSPSSSPHRLHRINTLQTPNVRASDADDGGGNRDTTTSPSASERPRGSGTTR
                     EGSGGATIVHHGNRLPHPAYSGVDEVDADDEDCYNSINGHQDEPQQRNPRRRGGGLGF
                     LLCRCDSDTTASSQGRSRQMHMRGYLPETPPFTHHRNDSLAITVLPMEAVLESPGERL
                     QADPSTRKSFLGKGVLSSMLVTVVPALLSVLDNCVNPVVARHSVTLLLRCLSLSADLR
                     TQVTGESIELFTGSRSGEEAAVAAAASEVSEKSGWRRMSFRKWITGGSGSRPRRWQRV
                     EWEATQAALQRLVPSLREVLVSLYVADGVNIVAERQETFGYMRDDLLVADELARVGLS
                     TEFFGFQLALPSELHVCTADAIALLLRLFPSAKPSARAASDPKSRALKKSRKVNILHR
                     PPRHNISGDKDARLQASPTQSMSSLGSSTKASAAGQPTTLAAQAALQRQHSQDLRTTV
                     ASLALPETPAFQRGTPVSQGGRGHVTKSSSKTHRPAHVQKQDSTDGNATNGQPPPLLS
                     FTTLSRPSTMSLSLSANESYSASVDTVQDCLSKASPADSRGIGSTGVFTLHQSTLLVS
                     YASQILRRSIKACAAAQQIHESMNHKIFHTRVAIGSPEPGDGGALQLQSRELTLRLFP
                     DSRCPYHSTFLACTETFFHASQALLVALLAAGASLPATSGATAAAPRDLVTQPATAVF
                     SPAAIAAAPSAAVARLQGPQPGRQGPSACLTAQPAESAYTSAPVQSQAPSQLKGGEEL
                     SVGVELPFIPVTVNAGAMQEAINRAMEDNIGLYRRLPPALRGLLGFYDYCKHCNIELR
                     AAIVETPEILGEMATHLEKWLASRARQRENVECSNASFALSLYVSNNSWDSSSSRGVD
                     ALLASQQHLRLDSAARGKLLCLTADFATTIGRDLGLATLDLAPSVVMKQPCSFQKRAK
                     RFKMFDAIRFLVWRPLSIFLDLRTPTTAKQLRSSSLSTADAASVAWGEATEAEKSVVM
                     VGCTELRVVTGVKLRDPIMSVLPTTTVGLLAEAVAAQVQLPRASVFSPSFTLKSSQLP
                     PSPRPLHASQERQSLSEPDSGRGGAGSPCLTSQNGFEERRLDPTATVTTASATEPPIS
                     ADRILFFLNDTPLFSPMTTLLDALTAFAVSGASLRDLVERQRRSSESVDAHSSKISAT
                     LPTLPFWTLTHALEFVVLAEPLPASLILGLATTASASSATSCCCCGCDGFRPAFLCSP
                     KHLFDAAPPNGPLALFSALSTVMREEVGSSLAVLESNQQRLSSAVVHELYHQLKMFML
                     PPLLWCSGIGVSSHGGPGDRVVGTAATLSSGAFPLPSYVLWRYPFIFSAEMRLSIFRF
                     FISAQRSLSHEEAKHLLQNYRHLLVRHAPAEEARAATSGAAGDTEKTLNIVGLQWLSE
                     EVVRRRRVTLTVQRHNILRCAEELIRLATCNVTIDVAFEGEAGIGNGPAMEFYEMVAE
                     ELLDPKHDLWRTEPIPIDERADSSSLRAAPSPTRSANPSPRTAATGAPQRRRPCAPLF
                     PAAKQTPTSLHYWKLLGVLLGRLLVIGTTSSLYFHPLLLRRLRGESLMSTADEASQNM
                     SQVDAALELTLHRLETMNAGSLAACELFFTIPVSEADGYVPGAVEELPLIPGGANRQV
                     TVDNVHEYTHSLRAYYLHTVPDLVLLHLRQGLQLTVNPLYLQLFTVDELGRLLGSPLD
                     SKVWETREQFARDVEAAHGYHIKSDVVQYLLDIVPTWSAQMQHAFLKFVTGSSAVPYG
                     GLTQRIKVVRRDVDVPAADLSVTPTTHSFGASAAGLVTTSSFTGGGVNYDNSLPTVST
                     CFLYLKLPRYSSKAVLQDRLRFAVCEGQSFFSLT"
     gene            <1727807..>1729267
                     /locus_tag="LDBPK_364600"
                     /db_xref="GeneID:13388460"
     mRNA            <1727807..>1729267
                     /locus_tag="LDBPK_364600"
                     /product="alternative oxidase, putative"
                     /transcript_id="XM_003865526.1"
                     /db_xref="GeneID:13388460"
     CDS             1727807..1729267
                     /locus_tag="LDBPK_364600"
                     /codon_start=1
                     /product="alternative oxidase, putative"
                     /protein_id="XP_003865574.1"
                     /db_xref="GeneID:13388460"
                     /db_xref="GOA:E9BUG8"
                     /db_xref="InterPro:IPR002680"
                     /db_xref="UniProtKB/TrEMBL:E9BUG8"
                     /translation="MQMMMRLHIRVALTSLPSSRGYVSKEGGYLGTRRPASQATSSVG
                     FSASMSASSSNALGTSSARIKPSSYLYCSFMGHSTRFAAMAPPLTRAGITQLEREPLA
                     HSTPGRINDHICIGMVKTLRWLADRAFRERYIHRATMLVTVAAAAPAAGSVAAYLRML
                     FRRSNSSSACTGDSQMPTTAEASSPFLAFGGSPSAGAAPPIPPACRSFAMARPSLYMS
                     TSSATMEGTGSTPEHSYVDELRGLLAQCESHAVHYQVLSCMAEITLLERGLVLLLQAV
                     HFTIYLALFLLYPRMGFRLMAYTAEESSVVWTQMVNDVDLGKIAEPRVPQLALHYWGL
                     EGVFTAQAAPLPKTVAPQEQEAALYKTSEGLVTEQIPVTDAPISGASPDGGDNGHRAA
                     TPLSRSADHVPVPFAAAGSCDDSAVDSKESEERVITTSDRGAGPGASVLTLRDVALLI
                     RSDEMIFRDLNHELANKLDMQPSWTQRLLASLGGEK"
     gene            <1730276..>1732873
                     /locus_tag="LDBPK_364610"
                     /db_xref="GeneID:13388461"
     mRNA            <1730276..>1732873
                     /locus_tag="LDBPK_364610"
                     /product="gamma-tubulin complex subunit, putative"
                     /transcript_id="XM_003865527.1"
                     /db_xref="GeneID:13388461"
     CDS             1730276..1732873
                     /locus_tag="LDBPK_364610"
                     /codon_start=1
                     /product="gamma-tubulin complex subunit, putative"
                     /protein_id="XP_003865575.1"
                     /db_xref="GeneID:13388461"
                     /db_xref="GOA:E9BUG9"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:E9BUG9"
                     /translation="MSSTTDWARFLAALEKRGVRFDQVQYATDRQEVIRATGITDALS
                     IAVVETVWQRHCNSGRDASDSIPLDHQGASASNPTPTRTLAPLLSQPAPDERGPATSA
                     RASNGGVAGLPALHELSQLTRLPEELQDTVLATEVLAAAVGLGGVFLQYTPAAPGTSS
                     GISPKEGFQVSPLVPASMRSLCETVLPVADAFMALRCIEKAEYSSCSLVLMALGEVVS
                     EINTSYAHQVSKLQLWSEGRPMPLMGVVSEILRVGHHVVRLRQVLPMDLICSALAEAA
                     AAAPTSSTFASPSTGLVGPRILNHLCDQVNKYSGSCEDHELLTLLLRRSLVPYLRMLQ
                     RWMHSGVLDDPYGEFFISEVYHPARPSPTAASHQQQRHVGQFFLDALAPSATGAGREG
                     ELGASGSSTASQGRFGLKRRATAQQDVVAFDRRFSLNKSLVPVFLNTPSRIAKMVFFA
                     GKYCCLLREYGAALPAFRTAAVCGGAGAAAAAAGSRPDGPDDALLTWSGADQLQRQVQ
                     ESFEISSGAVIQLLFSPSVDLLGHLKSLKLYFLQERGDWVVDFLDSAESLLAEHPDRV
                     KQHSMQVLLQAAVARSCSSDPYHDLIGCSFANCTLEELLQEQNRQRDSGGDTLTAAVG
                     EGATTALPSRRSMGGNGGEVDARRSLELLQLETDLQWPLTLVLDGKVTHRLNVIFRLL
                     VWVKTCERHLCELWYTNEILGEFSAAYGLKHQFVQFLRQFQFYAAHFVLEPLWSRLIA
                     RIGQADSVFAISQALTDFFDGVETGLVLSSTQRFRSLAHILELTERFCAVGMHSSTAT
                     MPLIEATLHSVEDQFLRALSELASPIGPDYPQLVPLLTWIDFSRFYDQNNVYHVQHGA
                     ASSAAGRSM"
     gene            <1735893..>1738790
                     /locus_tag="LDBPK_364620"
                     /db_xref="GeneID:13388462"
     mRNA            <1735893..>1738790
                     /locus_tag="LDBPK_364620"
                     /product="ATP-dependent RNA helicase-like protein"
                     /transcript_id="XM_003865528.1"
                     /db_xref="GeneID:13388462"
     CDS             1735893..1738790
                     /locus_tag="LDBPK_364620"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase-like protein"
                     /protein_id="XP_003865576.1"
                     /db_xref="GeneID:13388462"
                     /db_xref="GOA:E9BUH0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BUH0"
                     /translation="MSLKKKTFKQRIRKNDMKQRHQIGSGLRKRMGAARRIRNRYDSV
                     DDGTRPMEMIVSEIAEGTAVPSQEAVLDPRSLTDLLLRPAASLVSNNGASASANVATT
                     SCAVASKSNCCSAIPWKRKSSKSSALLTSVPLAAEKVLPSLPLAPDDPLALPDTRVFE
                     EEERQQRLAREAAARQNENKNLYRHSGQPYLFWERVGLHPALLQALRELHFTHPTPVQ
                     EEVLPNVLASGDELLARQRSSQADKKSKMHKRVGGSGGSAVQDVVVSAETGSGKTLVF
                     ALPILQDLLTTLGTERVTTATPASPAETVHKKATAQAGSDAAVARAELKAKRQKRIMH
                     SLIISPTRELALQIDAAIRQLTKFAPQVVVGCVVGGMAQERQQRVLNRHPHILICTPG
                     RLWDLVQKNEGCYLGHSVSRRLHYVVLDEADKMLQSGRFAELQTLLERIHCEVLPAGF
                     AQDREEGAEPGEISVESGRWDPDTETFIPFDKEETGATKPRVKKLVAETVTEATEAPV
                     ETKKGKKRARESVEAAAAADVSSSSKMKKAKKVAADVTPTKSRKTAKTSAKQAAGLRE
                     EEDEEAADEEETASKYGDTNAETDHGDARQKKDEPHPIPMPPEPAAAHRVITYVTSAT
                     LSLQTNYERRDFSARKSIIRTSNADVLNKVLQQLEIKLSNAQVFSLAESANVAARVNE
                     TYLRCPDNSKDLYLYYFLKTYHDDRAIVFVNAISMLRRLVKLLEVLGIAVAGLHASMQ
                     QRQRLKFIDKFKQGKIHVLVATDVASRGLDIDGLKYVVHYQVPRTTEAYIHRCGRTAR
                     CGGTGLSVLLVNAQEHMSFRKLMESLGRKESEVETFAMQATIVHQLHSHLRIAWQIDK
                     LQKEIGKSRANNQWVNRMTKEADLETDDMFDDTADAENREKQKAIRILQRELQLLGRK
                     STGQYGGKGAFRTSAYALGAKQAEQHLKERADRQTIRVASKKKNFAANGKK"
     gene            <1739961..>1740545
                     /locus_tag="LDBPK_364630"
                     /db_xref="GeneID:13388463"
     mRNA            <1739961..>1740545
                     /locus_tag="LDBPK_364630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865529.1"
                     /db_xref="GeneID:13388463"
     CDS             1739961..1740545
                     /locus_tag="LDBPK_364630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865577.1"
                     /db_xref="GeneID:13388463"
                     /db_xref="UniProtKB/TrEMBL:E9BUH1"
                     /translation="MRRAGWRAVTPTAAVVGSTRVPQALALPSSASSWSLCDCSYVSA
                     QCRFHHAVGLLGRTRITRFDLRKHEMEKRRLRELEKAGIDPTDDDDAPWIAPEEQQRL
                     DEEEERRRAEMEEQRQAFIKKRAEEDAVKRQKFKEFRAKQIAMSRHRKEAAAEKKEEA
                     RQHRQQTSRVEVAKEANAAEDGADAKGASHHGTQ"
     gene            <1741065..>1741271
                     /locus_tag="LDBPK_364640"
                     /db_xref="GeneID:13388464"
     mRNA            <1741065..>1741271
                     /locus_tag="LDBPK_364640"
                     /product="60S ribosomal protein L22, putative"
                     /transcript_id="XM_003865530.1"
                     /db_xref="GeneID:13388464"
     CDS             1741065..1741271
                     /locus_tag="LDBPK_364640"
                     /codon_start=1
                     /product="60S ribosomal protein L22, putative"
                     /protein_id="XP_003865578.1"
                     /db_xref="GeneID:13388464"
                     /db_xref="GOA:E9BUH2"
                     /db_xref="UniProtKB/TrEMBL:E9BUH2"
                     /translation="MVLGMRLLPFDYPLPPLRVCPSLPFLNPFHHNVTRVHFSTLTTS
                     ARALRGHTLHGFISLSHKDGRRSR"
     gap             1741333..1741431
                     /estimated_length=99
     gene            <1742942..>1744051
                     /locus_tag="LDBPK_364650"
                     /db_xref="GeneID:13388465"
     mRNA            <1742942..>1744051
                     /locus_tag="LDBPK_364650"
                     /product="asparaginase-like protein"
                     /transcript_id="XM_003865531.1"
                     /db_xref="GeneID:13388465"
     CDS             1742942..1744051
                     /locus_tag="LDBPK_364650"
                     /codon_start=1
                     /product="asparaginase-like protein"
                     /protein_id="XP_003865579.1"
                     /db_xref="GeneID:13388465"
                     /db_xref="GOA:E9BUH3"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="UniProtKB/TrEMBL:E9BUH3"
                     /translation="MLYISSGLVGRKAMSGELSPEEDTSGAKVLLINMRSHQSDLLDQ
                     AQRSNVNRRRFFLDILHCNEDLHRPGVPSFDVMQLEKLKLSADHTHEDWIELAQLIKK
                     EYHHYRGFVVESGSDNMVTTSTAVSFLLENLGKPVIFTGSLIPGHRIYTDMTRNIILA
                     LAFASCSQICDVCILFDEMLYRANRTIKMSRCSLRPFDSPHFPPIASMRGGVLIIRKV
                     LLRPHPTGRLRIEAELSTKVLTLELGPGAPFEFFRAAIEYTSAPALILRCYGSGNGPT
                     RRDFMKRLLAIAKTRDLVVVICTHNRYGVVALSEYEAGRQLMGAGAISAGDMTHEAAM
                     VKLKYLFGLGMSPEQVRKYFAVDMRGEVSSPSAKL"
     gene            <1745180..>1746028
                     /locus_tag="LDBPK_364660"
                     /db_xref="GeneID:13388466"
     mRNA            <1745180..>1746028
                     /locus_tag="LDBPK_364660"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865532.1"
                     /db_xref="GeneID:13388466"
     CDS             1745180..1746028
                     /locus_tag="LDBPK_364660"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865580.1"
                     /db_xref="GeneID:13388466"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BUH4"
                     /translation="MGSSSSRQTPLPARSANTAATAEVTANTTDYQEYIKFRDQLLDF
                     ALGESAFDYTERLFAQKPDSPEVMALLAETTFLYDKTKNKVSREHWCDRLDLLQRGVD
                     VSRKCINENKDYGPCYRTYVMCATREAEALYYMKSFTGLGLVENYQAIMRKGVKGMEL
                     LPTDAEIPNTLGALCARCCFRWYDPSRVYAWFYGLPTTRRLRELSVDFHKKACENDPK
                     NLEYACRLAQAYFQLGDLANARRWYVKVRDEMPPQELKDEKWQGVAHTQLSTAFVKPK
                     WNVPFA"
     gene            <1747154..>1749184
                     /locus_tag="LDBPK_364670"
                     /db_xref="GeneID:13388467"
     mRNA            <1747154..>1749184
                     /locus_tag="LDBPK_364670"
                     /product="mitochondrial intermediate peptidase, putative"
                     /transcript_id="XM_003865533.1"
                     /db_xref="GeneID:13388467"
     CDS             1747154..1749184
                     /locus_tag="LDBPK_364670"
                     /codon_start=1
                     /product="mitochondrial intermediate peptidase, putative"
                     /protein_id="XP_003865581.1"
                     /db_xref="GeneID:13388467"
                     /db_xref="GOA:E9BUH5"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:E9BUH5"
                     /translation="MLRRLVSCASPLRLRGCGAATVFGNARFASTANASAAPPTSSPK
                     APTYGTVPDIPNLNFLSSPDNLLNTVDGTVDVCEALLKEIPKAKTPQAKHDLIDSTSN
                     VLCLLLDPCEFVRQIHPDENYKRSASLAFQKGYEYMCEVNSRRDLYDVIKELDSSEGR
                     KGLTPESVKNVVQLRRDMESNGIHLPDAQRAKVTEMNIEKEELAMRFLTEQGSANPFG
                     TLRYLLQCRYELAQLLGFESYAEQQLRGTMLENQENVWHFLCSIASKYRQQAEAEMDL
                     IRKHVGEVRNRANITDEYRARVASSMRRDAEPENALEYFSVANCVRGIQCLCSEVFGV
                     KLEEVPLNPEEVINNSVKKFHVYDEHKRFLGVIVLDMYMNEMKYCQAGHLTLQLGCVP
                     HQEALATVGLRLPKRQYPVVVLTANVGALKPAQRRPDGTYDDEATLMQPNEVTTVFHE
                     FGHAMHTIFGQTQVQNLAGTRASIDYVETFSQLFEQFLSSHEFLKLWAHRINTREPIS
                     FDIVQKRNSAANMFKHLDMLDQVVLSAVDQALHGPQPLTVYFPHGDQGHVGKRTLGDL
                     GDYGRGGFNMARALIQVAKPVSVAEPTETGVLSTLSFEHLSGYPAGYYGYLYSLSVAR
                     RIWTKKFERDPLNRDAGRELAEKVMCHGAACDPRETIEKYLGDNLTDIDIWA"
     gene            <1750533..>1751015
                     /locus_tag="LDBPK_364680"
                     /db_xref="GeneID:13388468"
     mRNA            <1750533..>1751015
                     /locus_tag="LDBPK_364680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865534.1"
                     /db_xref="GeneID:13388468"
     CDS             1750533..1751015
                     /locus_tag="LDBPK_364680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865582.1"
                     /db_xref="GeneID:13388468"
                     /db_xref="UniProtKB/TrEMBL:E9BUH6"
                     /translation="MMRSSFVHKAAAAAAGGGMTATSSDHKMASLHKLLTGEVQFRNN
                     ALLKACNIEHNFGSKWKSDIEAYAKCLPPDERSCLERQVARVTLTRYTTRELAEYCGE
                     GPEHVDAVAREANIAQAKAYAQKNGADKLEAYVKAESKNAGWSEAEAKNFMDAVKAAK
                     "
     gene            <1752538..>1753365
                     /locus_tag="LDBPK_364690"
                     /db_xref="GeneID:13388469"
     mRNA            <1752538..>1753365
                     /locus_tag="LDBPK_364690"
                     /product="chaperone protein DNAj, putative"
                     /transcript_id="XM_003865535.1"
                     /db_xref="GeneID:13388469"
     CDS             1752538..1753365
                     /locus_tag="LDBPK_364690"
                     /codon_start=1
                     /product="chaperone protein DNAj, putative"
                     /protein_id="XP_003865583.1"
                     /db_xref="GeneID:13388469"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:E9BUH7"
                     /translation="MGAVKFQLYKTLGVPVESSIEDIARSYRRLALKYHPDRNPEGVE
                     KFKSISNAYAVLSDPERRAAYDLTGFVSDSAESPHAMSDEAARQQRSVELADQVRNFF
                     ATYAGSAEEQADVVRGYEKCNGDFKKMVREYLLFDNGVEAEVQRLHRLVSTLIEVGNL
                     SPTPAWESTSTPEAILRLEKAMHRERQEAEKVLKDMAGSGTGAAGAADGDLSSLQVMI
                     RQRQQSSYESMLSRLENKYVTKRNNARESSKRTREAAPTARKDERASKRHRKASHHR"
     gene            <1755181..>1757550
                     /locus_tag="LDBPK_364700"
                     /db_xref="GeneID:13388470"
     mRNA            <1755181..>1757550
                     /locus_tag="LDBPK_364700"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_003865536.1"
                     /db_xref="GeneID:13388470"
     CDS             1755181..1757550
                     /locus_tag="LDBPK_364700"
                     /codon_start=1
                     /product="amino acid transporter, putative"
                     /protein_id="XP_003865584.1"
                     /db_xref="GeneID:13388470"
                     /db_xref="GOA:E9BUH8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:E9BUH8"
                     /translation="MQSLAARRSLLVHDVRASQRQSFAGRISHRVASRLSLAAPPVEA
                     RTGTVAGTIINTLCSVIGAGVLSLPLALYFSSIIVGLVVLLVFSSFAAFSVYCLVVGC
                     DATGRYSITEVIAFAIYPPQLWEEYLRKQGAAKETAREEEQHVARQHHMPASASSGVR
                     SSSLNGESAVTAPQQTEEAPTSMDAKQHSDPGEGVASDEEGSEDTLPYRHRHGSHRYD
                     RRRDDGHSCAEASRTKECTERHPHASFLAPSASTNARLRDAYAREEWRRRRCRRVITA
                     LMELIVFSSNYGALVIYSKVIADSMPPVVSYATHTDGFLVSKYFWLITGGVVFFVLSC
                     SRNMEELKWSSLLGFLTILYIVVLILYRYHTQKRYDYPHVDPRSYGTVHWLRLSVGVL
                     QTISTFGLALSYHYNVPYFYKELQDRRPDCMMQSLAVAFPIVVVCYAVTGVVGYLTFG
                     TEVAAPRVGGNIVSNYPKNDLLMNIGRLGLFVHFACVFPVLSICTRRGLHRLTMIALT
                     WADQSALMMEAARASGAQLTEGVRRAEVSTATVSSLSPTAAPTNGAGVEDGAHVCGHI
                     PGETSPLLQRHGSPTPGYEVFANSSPPHLASLGQQYNAELPLSGRRNSAAADRPWDAL
                     CADASGAEQVRASHPGSEQLGTIDVDRDVGSPDQTTMLAIVIEAAFLVITSVLIAATV
                     SGIDFVIHLIGTLFSTFIVMVAPGMVGWCVFSPSGPFGSASAAVAACSGGDGKFSGAL
                     VSDLLSRFRLIRLKQLMCLLNVVLGICVTCVGVATLVYETFWGKPIPAL"
     gene            <1758701..>1760245
                     /locus_tag="LDBPK_364710"
                     /db_xref="GeneID:13388471"
     mRNA            <1758701..>1760245
                     /locus_tag="LDBPK_364710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865537.1"
                     /db_xref="GeneID:13388471"
     CDS             1758701..1760245
                     /locus_tag="LDBPK_364710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865585.1"
                     /db_xref="GeneID:13388471"
                     /db_xref="GOA:E9BUH9"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BUH9"
                     /translation="MTTLLTCSSEQRVAPLSLASMRCRMAALRRAASQPNALLLRAPL
                     FRPTSSLMMSVRCRSDSGFAKSRPVKYVSTEAPELRRGGSSAEAGSYKTVNGVLSADY
                     VGGLSNVTAEKFRGMQPVGTWERGDGDGESDETANGSAEVMEVDFTSDEKLSKLEKLY
                     RGAHKGDKILSPRERQLFSRMIYEKFYKVGVQSVVDPAILYQASLEVHWVEEWAAGRA
                     RAERWSEEEARRQVKRSLLERVDLHKPLSYIIGSQPFFGCDIHCEAPLLCPRPETEMW
                     THWMVYKHLARAERRTFTTGFSPAVSPIRILDVCCGTGCIGVALAKHLPSAVVTALDI
                     LPEAVRVSRENAMRNGISPARYSAMESDMFSCFLEGQVSGQPGDSADLSEDRPFGTVK
                     DAYAGTYDVIVSNPPYVLPEQYVGLPCTITHWESKTALVGDDYRESRQYLYFKELCVH
                     GAKLLKPRARRNDMLRDAPNIAIEVGLQAHMVADLMEKSKLWRDVEVHLDYAQQERWI
                     TANSSH"
     gene            <1761270..>1762073
                     /locus_tag="LDBPK_364720"
                     /db_xref="GeneID:13388472"
     mRNA            <1761270..>1762073
                     /locus_tag="LDBPK_364720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865538.1"
                     /db_xref="GeneID:13388472"
     CDS             1761270..1762073
                     /locus_tag="LDBPK_364720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865586.1"
                     /db_xref="GeneID:13388472"
                     /db_xref="InterPro:IPR021298"
                     /db_xref="UniProtKB/TrEMBL:E9BUI0"
                     /translation="MVLLECKRLPKEEYSKDYDAFIASVPSTTNIGEATDAIQKMQNT
                     RVRLTWMMAAAKQMIKDCMVDAEKQHYLTGPIGDTERYLSLERTERRQLCVQSELDAL
                     VEAFKGGVMILFPAECSGSDACQRLAAILDNDTVSDVEKSKAHRILSMIDDGATNENT
                     LSGRAVMWWSAKPLARDSDFVKYIGKNDKTKITVKLAAEGSAAPPREPAVDAKAQAEL
                     MQHFYRKQEEMKKLVEDEDISFGNSAWANPHGLKNQLQGLDSIHYKGAF"
     gene            <1763029..>1763625
                     /locus_tag="LDBPK_364730"
                     /db_xref="GeneID:13388473"
     mRNA            <1763029..>1763625
                     /locus_tag="LDBPK_364730"
                     /product="60S ribosomal protein L18, putative"
                     /transcript_id="XM_003865539.1"
                     /db_xref="GeneID:13388473"
     CDS             1763029..1763625
                     /locus_tag="LDBPK_364730"
                     /codon_start=1
                     /product="60S ribosomal protein L18, putative"
                     /protein_id="XP_003865587.1"
                     /db_xref="GeneID:13388473"
                     /db_xref="GOA:E9BUI1"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:E9BUI1"
                     /translation="MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGF
                     NKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAKSKAAPIAVVVGDVLDDVRMARI
                     PAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG
                     ASGVPGSHSKPYATNRGKETKRGRRTGRSYKRKAFRHV"
     gene            <1765203..>1768367
                     /locus_tag="LDBPK_364740"
                     /db_xref="GeneID:13388474"
     mRNA            <1765203..>1768367
                     /locus_tag="LDBPK_364740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865540.1"
                     /db_xref="GeneID:13388474"
     CDS             1765203..1768367
                     /locus_tag="LDBPK_364740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865588.1"
                     /db_xref="GeneID:13388474"
                     /db_xref="UniProtKB/TrEMBL:E9BUI2"
                     /translation="MPSAQSSVLQGGAATGPRRLSAIDLQRITAILEACGVSKVHGST
                     HIYAHPESIHLISPRDLSFLVLHADVLATHTDLLYDVRAFTGILWGMMQHADRGIERV
                     LRAVEGNSAAVAESARGGSVGGTPSSSSPAPAPAHTFVYTNVSKVYSAMFPHLVQVFR
                     VATLLRAYESTDARAEVRDTRRIAQVDIDVVARLAGRLNHLFLCEAGERSAGALGGAG
                     ALNVTATYTNVGHHLFRTTESALSSVLLLLSSLAARPGSDAGPILRYFHDVGAWKASA
                     LGILITESYSMSIQAVLFSLFRRSREFDNVEEVAAKLLLQRLASRPPYQWRTFRLLYF
                     SVQDIGASDMQAAEDRHGSSAFGQLLVFCRIQHALQWCLTTDGRDSADEHATVKSLRK
                     AVSAQVQRAWSEQSSADRAGSPSHKSRTDAPPRLLSYYELLVLAALQGMPEADLTKDA
                     ELLRRAEQTKLSAEPEVLTPTFLRMLIAFCYTVPAPTDPALSHAMLSTSSTLALYESL
                     AKHIFQIPLCASAAVADEVNQLFATAALRTDTLVDLCVWSAIHNTREDELELAEGVAA
                     KENSAAAAANPAVVSPAPHARARAGPAKTAGLPLPPIPSPRAAEVSTEAAMPSLPPPP
                     TPATALFHLMRRDVSLLFAGNEDVLQHTPEAARARAKNFPYGFRTMTLTTVRLLFAAL
                     RTAELYHHIPPTDMLPVIAQLFALRAYYPLSPSETEAERKAARRMLALMQNTLALLPQ
                     EMKATTVNQLLCRTLVPMSTMTGQADQLQLALFEAYLRSMATASAANAVTDELMLQHW
                     VDIAVPAITNRHSVTLSIAGHDFLIAAFRAEKYVSPLFVPTYIALYVPSVELFSTGGS
                     VGQRSTYSPLPVSVIQHFARMVRAACHGIERCDSTALARLFEEAASREGEATMPGSVH
                     AAAAYMASLSPAQRAALRKLTPTNAVLLVVSALFDCLCLLWNNTPGYVKVAQDLFVAY
                     FSGLCNLLQCASTPVLQRVCASIEAIEVEHLRGSGNVQLQFLKYVSSVVDAVQGPSKV
                     GIAEWFLKMNKRIQEQNYGKHSKL"
     gene            <1769502..>1771103
                     /locus_tag="LDBPK_364750"
                     /db_xref="GeneID:13388475"
     mRNA            <1769502..>1771103
                     /locus_tag="LDBPK_364750"
                     /product="ABC1 protein, putative"
                     /transcript_id="XM_003865541.1"
                     /db_xref="GeneID:13388475"
     CDS             1769502..1771103
                     /locus_tag="LDBPK_364750"
                     /codon_start=1
                     /product="ABC1 protein, putative"
                     /protein_id="XP_003865589.1"
                     /db_xref="GeneID:13388475"
                     /db_xref="GOA:E9BUI3"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BUI3"
                     /translation="MMRASQPCRDAPLCNIARGLQRIASAMLARTRGSEAGVVSGAAS
                     AASWTANSADGSVDPEVAQRYTSSSLTLPVDVAEDLSQPTTPKDMQYKRVPSSRVGRA
                     AGFASLFMQLGWEKMAGSIPASGLLSERGHQHIVDTLCRMRGAVLKLGQMLSIQDEST
                     IPPHVAALFERVRDQAFAMPPAQLHHTLAKEFGNANWRADLFDAFDDTPVAAASIGQV
                     HRATLRPGAAGTDPTEPPVVVAVKVQYPGVAQSIDSDVANLKMLMSFGVLPPGMFVDK
                     ILQELRKELSAECRYTLEASKQMRYRDLVAADPALSSLFYVPKVYQAITTDQVLVSEY
                     VRGVTIDQIGKRPDVPQELRNYIAENFMALTLKELFVWRFMQTDPNFSNFLYNAKDKR
                     VYLLDFGASREYSREFVDDYLDVVTAAATKDCESIIAKSITLGFLTGQEVQEMLDAHC
                     ASVLLLGKPFQDRAHPFDFAAQSLPCLIQANVPTMVKLRLRPPPSPVYSLHRRLSGAI
                     LLATKFKATIQSGRLFWDIHDQLRK"
     gene            <1774607..>1775716
                     /locus_tag="LDBPK_364760"
                     /db_xref="GeneID:13388476"
     mRNA            <1774607..>1775716
                     /locus_tag="LDBPK_364760"
                     /product="elongation factor-2 kinase-like protein"
                     /transcript_id="XM_003865542.1"
                     /db_xref="GeneID:13388476"
     CDS             1774607..1775716
                     /locus_tag="LDBPK_364760"
                     /codon_start=1
                     /product="elongation factor-2 kinase-like protein"
                     /protein_id="XP_003865590.1"
                     /db_xref="GeneID:13388476"
                     /db_xref="GOA:E9BUI4"
                     /db_xref="InterPro:IPR004166"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BUI4"
                     /translation="MALVKTKLAAAPQPSRTPTPGSSPKEWTPPTHTHESPEHLSTDE
                     PDVLVPAHKYVYDVKTCAWKGVDTMLRVLHPNRGLSQGTMRVCFALEELDETGFSSRM
                     VAKMFRHNISKVVESDYFNEGEAQCICGIFAEKFNRVQVPAGFQRHVVSFLQCETVRI
                     KLSEVPEAYQHKRSGFFSYRTTDSADILFTMEPRLAGNFTKYTNNFGDVYDGFERRQS
                     LEEEKKRHRVLMAVEAFSHFTLVESGGSMLVCDLQGVNDFLTDPQIHTEDGKGLGMGN
                     MGQDGIRKWMEAHVCNEVCRAIMLEPLSKGLRNFTRTAENESRVSYYQILRAKLRSQT
                     PVRPEDIIPLSKPLSLMSDDERLEYAMRLSALLSE"
     gap             1778493..1778591
                     /estimated_length=99
     gap             1779452..1779550
                     /estimated_length=99
     gene            <1782482..>1785907
                     /locus_tag="LDBPK_364770"
                     /db_xref="GeneID:13388477"
     mRNA            <1782482..>1785907
                     /locus_tag="LDBPK_364770"
                     /product="related to elongation factor-2 kinase efk-1b
                     isoform-like protein"
                     /transcript_id="XM_003865543.1"
                     /db_xref="GeneID:13388477"
     CDS             1782482..1785907
                     /locus_tag="LDBPK_364770"
                     /codon_start=1
                     /product="related to elongation factor-2 kinase efk-1b
                     isoform-like protein"
                     /protein_id="XP_003865591.1"
                     /db_xref="GeneID:13388477"
                     /db_xref="GOA:E9BUI5"
                     /db_xref="InterPro:IPR004166"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BUI5"
                     /translation="MEKESLEAPNSANGSFSVVNHDLIKPSDARSKTNSNATASATRP
                     SRDRADSVRVSRQHMYVDIDQVGFCNDATSMVWVPDTRGPTSSLRTNDESSSTKGGDG
                     FAVPSSQTRIPAIALARYVRSSSVGDAAPVIVRGHKYVFNNRTRRWLAHPITVRVLHH
                     NRGIHQDKYFATFAMELLDPVKPATPMLAKVYRHNIDLVSETDYYSLGQAQALCEEFA
                     REYTCTAARSHYVKFHLPLLTNRVVVRLDMDSVLDPAVRTARKGFFSYRTQDTRQVMF
                     FMEPNTVACEALGISFASCEVDEGKCYSRGDAMWSRDIYRDIADGFSHFTYVRSRACM
                     VAHGFVRSNGYLLDPLFHTTDSERFTMGDAGRSAMEDWVKRHRCGDTCRALGISNFNN
                     DGERVKKAAACVNPLDMEENHYTDYLRSVRQMRVIVHMDAAQILCDYKKDSTVDTVSE
                     SSDFTPTMAALQPMPISSVSRKVTCDAVKYVFLPTCAKWMEVPMRLTVAASAVPDTVD
                     GTYAFFAIEEVREGGRPVPMRARFLLRPEARDADYYHFGDAYCVCVTLGQVFREYCAN
                     NVFARDLDFYAAYAVRVPQANIPDYIKAAMHDSDFFARTTADSGDVMFVAEAEFQPFS
                     PRCLPNAEGVSKDAEGFDDLALRNVVDAFSHFTLHKSGNHLLVCQFKCQDGLLMHPNI
                     NTSSGCGFETLNDGQAGIDAWVRKHTCNEVCKFLGMEPLPRQLKLYDISSSPLMRYIR
                     HMQEHKMDSDEMLELAPPSRRMSDRMLPAASDAAASQSERARASSSATASTATAADAS
                     FVRPTPPNSEETMLRPWVKRGCKASAASAKGTAAQRRTLTQRELMRLQSKGIDTKYII
                     PATRYDLNIDDLTWTSKRIFVRIVNPERGIGQGGMRVCFEITDVDPDACAESVMVAKM
                     YRRTIKNVVEKDYFTSVMVQKLSSLFAKDFNKERNEDGHLLLNVLDGAVIALDRADLP
                     PELLAQRTGFFSYRTEDTERVVFCVEQRLLGRFTKYNGNMGEAYPTNECRLSPPAARE
                     RTMVFEAVEALSHYSLERSEGGLLVCDMQGVRNDLTDLEVHSYDGQSLDIGNFGARGI
                     QKFALRHRCTSVCKSLNLRNLRDRHFTVTDDVKTKNRFVALFERIKEIGNMEE"
     gap             1788929..1788943
                     /estimated_length=15
     gap             1790438..1790556
                     /estimated_length=119
     gene            <1791672..>1792679
                     /locus_tag="LDBPK_364780"
                     /db_xref="GeneID:13388478"
     mRNA            <1791672..>1792679
                     /locus_tag="LDBPK_364780"
                     /product="myosin heavy chain kinase a-like protein"
                     /transcript_id="XM_003865544.1"
                     /db_xref="GeneID:13388478"
     CDS             1791672..1792679
                     /locus_tag="LDBPK_364780"
                     /codon_start=1
                     /product="myosin heavy chain kinase a-like protein"
                     /protein_id="XP_003865592.1"
                     /db_xref="GeneID:13388478"
                     /db_xref="GOA:E9BUI6"
                     /db_xref="InterPro:IPR004166"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:E9BUI6"
                     /translation="MNPATQDAAAAEEESPVVCTAKKYIFDLHSYAWKESDCLIRIPR
                     PHKGMGHGGMRVCYAVEDVDEEGAGTPMVAKMFRRNISDVVEKDYFNEGAAQCMCEEF
                     ANNFNRIHLTNIHKPNISFLQCYVVRIPRDSIPVASQKKRTGFFSYKTQDTGEVMFVM
                     EPMLSGKFTKYNSNYGETYREDKKAALTSSEAKRRTEVFEAAEAFSHFTLVESGGSML
                     VCDLQGVNDFLTDPQIHTEDGKGLGMGNMGQEGIDKWIEKHECNEICRALGLQPLLGA
                     VPSSTACAKEENLNLGLRAQLQSQNPVRLRDLVPLTKPLEEMTEAERIEYALKVSRLT
                     D"
     gap             1793099..1793197
                     /estimated_length=99
     gap             1794103..1794201
                     /estimated_length=99
     gene            <1796872..>1798011
                     /locus_tag="LDBPK_364790"
                     /db_xref="GeneID:13388479"
     mRNA            <1796872..>1798011
                     /locus_tag="LDBPK_364790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865545.1"
                     /db_xref="GeneID:13388479"
     CDS             1796872..1798011
                     /locus_tag="LDBPK_364790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865593.1"
                     /db_xref="GeneID:13388479"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:E9BUI7"
                     /translation="MPSPHLAGGLNAMSVIDDAISGEFFSTAPNNNNRSHHDSLMASP
                     QATQKLSLVELIERFNMSSAPVNTTSSSAFNFDSLYEQLTGGGGAEELSQSPMDYTEK
                     APNLIPTGQPDNAQASPCDRHHDNGGDPSPDANGISGGAMAKNSIPIDTLRALHDQHL
                     TTSVRVAYERGRPKVLKILGGAADTPGRLGIDPRSSCEVLVEFKRNRVLQYESHEYVA
                     PGSYVIVGGDRGEDLGLVVYVWCEVAQEGNGHGHAGGGAGALDKTASASRKRQVVGVG
                     LTDSKLPRSIGVGNGTVLRLASETDVQQLLGTQAELERRAIDVCAQLVLDHSLPMVIV
                     DAEYQFDKKKLTFFYEAQQRMDFRELVRHLYKTFRARIWMELVDA"
     gene            <1801815..>1802783
                     /locus_tag="LDBPK_364800"
                     /db_xref="GeneID:13388480"
     mRNA            <1801815..>1802783
                     /locus_tag="LDBPK_364800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865546.1"
                     /db_xref="GeneID:13388480"
     CDS             1801815..1802783
                     /locus_tag="LDBPK_364800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865594.1"
                     /db_xref="GeneID:13388480"
                     /db_xref="UniProtKB/TrEMBL:E9BUI8"
                     /translation="MSACRVTPFSAGLQFTRKDVHEPPADTAVDNKSGVSDGEPQAAG
                     RTPVREEARCFESEEERLLWKAARLRHSIETDLVPRQELAERALRHGRRQLVKLQRLS
                     PSAAFLTFRQKCAAWCDRLRLFEELVVRTMLREAVDGAARSGDVKAPARWRKSNQWPA
                     ITNFLELQLHLCFAVKGSAAVEASSPEQSSRENSAVYRHLAAIWAAQQERLLTCDLLH
                     RYYTLRDILHGWGNAWHVRASCADDGDNVSSTARSRLPHEPDGSCICPFTAWESLSEV
                     DRLTSYSKICSHHLTEDVVECLEALMFTHFADVWCHVESVTSGVST"
     gene            <1803695..>1805053
                     /locus_tag="LDBPK_364810"
                     /db_xref="GeneID:13388481"
     mRNA            <1803695..>1805053
                     /locus_tag="LDBPK_364810"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865547.1"
                     /db_xref="GeneID:13388481"
     CDS             1803695..1805053
                     /locus_tag="LDBPK_364810"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865595.1"
                     /db_xref="GeneID:13388481"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BUI9"
                     /translation="MSDSEAPCQDGLAAATCKKPPQRAWVDDEDVPVEQETPAFFKES
                     HVKPAWALSDTTRADKDQSDSHEGAVPGYRRSAEALARKRFRSDDLDTLLSRKEPLLS
                     SKHDRPHSAVPAVLSLLPLPRDSARTIHWHRNGQLAVVGGNQHIYTFHAAGGFVEQLS
                     KVHVNKRIETTALSENGEEVLIAAHEAYAPQLLNIATEQLTTLAFLDTRDTAVHRNGR
                     RDNTRDEFFVSKLVCRPNDPVSRGVAMARGSSVTLASLSSGSVLSHITADTAVVDVTF
                     LSSTELAIATNNKVLLYDVRKLSRFTRELTDNAALDITTCGFSASRSSGACERAMAIG
                     SASGVVSVYDSATLRSAAAAAASVAAGSRPKLLRELKQLVTPISCLCFGEDSQGDSVL
                     AFATRGQKGGFRLARMPELNVVPSFPAVSTRHGFVQSMTIAPTVPILSVGERQKVTNY
                     AL"
     gene            <1807396..>1809390
                     /locus_tag="LDBPK_364820"
                     /db_xref="GeneID:13388482"
     mRNA            <1807396..>1809390
                     /locus_tag="LDBPK_364820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865548.1"
                     /db_xref="GeneID:13388482"
     CDS             1807396..1809390
                     /locus_tag="LDBPK_364820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865596.1"
                     /db_xref="GeneID:13388482"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ0"
                     /translation="METCVRYVLDDVDYDWCERQNVAPESLQRGVTYLEWAYASSLLR
                     AATPRVATPEDSGTAAADSVVPGYGEGRHSLSTQSSSPTGAAAAGSGRHTTSGRQNGK
                     DKASAGDAAVRLCALCSKPVQLLTSQSRSGALERGTGGVNTLQKRGGGATHLAGALSS
                     SPTARGGARVGGGHARGTSAPQPSGLVLPTKRAFGDVSAGIASPSHDLQSRGLRCSDC
                     GVVAHLRCWFFSEPPKLPEAWICDGCTIYAHHRKRSAGMCCICGRAGGVLLPYVPSAL
                     RDDSDAVKPSSMQTPAFHGRSSSAAALFDTVCHAVCALSMPELAVHPQVTVLRRNGLV
                     DMQMRPYVYPLRRVGKHKCAMNCRFCQHLGGRCVQCSHPHCFEAMHASCAAEAHTVDC
                     QAELPILPATASPRRTSAGARGGASTLDATTQPISLGCSLSSPLMGTTNWTRCSPYCR
                     KHYGYSVGNSVGSAELGHKAEAEALALDLTGLLTGGDGVTSPVVRKRGRGRPPAALVK
                     QREAERDLILKLRAYWLERREQRRETSALLASEINARVRPIGEASMRPEIVKISAEKV
                     RLSHFLSLVPEWQWQLVSIVEGELPLPDEEYDDVQKFRKAAHTRRSGNTRSLYDKMCE
                     SAVQLGLLCRAAEAIKEQCRLRRASVEQELAALRILSGWR"
     gene            <1810428..>1810907
                     /locus_tag="LDBPK_364830"
                     /db_xref="GeneID:13388483"
     mRNA            <1810428..>1810907
                     /locus_tag="LDBPK_364830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865549.1"
                     /db_xref="GeneID:13388483"
     CDS             1810428..1810907
                     /locus_tag="LDBPK_364830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865597.1"
                     /db_xref="GeneID:13388483"
                     /db_xref="InterPro:IPR019184"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ1"
                     /translation="MRVRTYHKHAIQRNSPALQGLLALHTMFSVFYSAPVWFTYLGIR
                     WHVASVTSQQRIWMICVLIIWFCTEILRLHLGCLANKRTLFGELVAFLTMTLVPQLLL
                     VCVLLGFLPECTDLEFSVCVTQILLLVLECLTAMQLLMRVTRNNVVDFYVSLGSPYC"
     gene            <1811707..>1813125
                     /locus_tag="LDBPK_364840"
                     /db_xref="GeneID:13388484"
     mRNA            <1811707..>1813125
                     /locus_tag="LDBPK_364840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865550.1"
                     /db_xref="GeneID:13388484"
     CDS             1811707..1813125
                     /locus_tag="LDBPK_364840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865598.1"
                     /db_xref="GeneID:13388484"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ2"
                     /translation="MDISYQLWSLVEQARRSSTMPPARITLPARQTRTAAETQATDSL
                     LITSQALDRAADVAIGRATAHISAVMAALDAVTPSSLAHLQNSLLLSDAELLSVSSSL
                     KAFTETLTKVTALTEARRWRGRLTGAPSTATGRDDALEGLAVDKPDGQDGKTRSGVVA
                     HLRQAVSTLQRRIASKRLHVALAKEELALYKTELFLYGHCGVVACSDEVAAELARRME
                     ATHKEAGLRGQQGAKALELAEVNVLSDGGGGQQRRHHTSSKSPGPMPGFGTTFRVVDG
                     MVQRAAETVKAAGSHADSALHVALTGGHAAARQLLNAGTASVAEILMLGAGARRGGCG
                     NLSIPAVEALVTTAGGGAPRLPTLQPYQLTNEEEAYLREQNRALLEAQRQASAQDAKA
                     VEALVRELSQLTSLMSEQVVQQTEQFSLIVKNTEAAHTNVKKAMSEVEKPLSAFWNPT
                     RQLVAVLWVCMAVLLAVNWASR"
     gene            <1813841..>1817563
                     /locus_tag="LDBPK_364850"
                     /db_xref="GeneID:13388485"
     mRNA            <1813841..>1817563
                     /locus_tag="LDBPK_364850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865551.1"
                     /db_xref="GeneID:13388485"
     CDS             1813841..1817563
                     /locus_tag="LDBPK_364850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865599.1"
                     /db_xref="GeneID:13388485"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ3"
                     /translation="MWLNAARRCVRSYPGDATAQLTHVSSAARKQPRAAAFILPAGTA
                     RCYATGPAGTDNLAGVSPASAAKVKADSSPVSSKTKSSRFVRTCGNAAPPATSSAEPN
                     GGAIPQGEADARWSALHVNLSAPPGLTSAASVAAYLQRLQSLLRHGRHSFMRACAVHE
                     LGKILLPSVKGIDGATVLLLLQTLRMADADEAMPLVQDATTWMGLHGFHLTPPQMTTA
                     IELLLHFDRSVARELAVALVQRTPRSTLCSFSTARVVPILTAMLPTLTYGRNSNLALQ
                     SIAQLEQARENNVIAAEGLRDGCLSDEFLSVSSGCLTQLLRALWAFRRANQGLYSTVA
                     ATEWRSLEEAACRILATPEKCAEVSLAELINVMTDLTQWRKQRNGSGSAETAVNNARG
                     QLFAALLLRLEAITERLRRCSPEPSERGFILPEPLTMSDISVAWSHCLAHAKTRSPSH
                     DLPSLADSGDGADAACAFGTSLQALQAALWGVVAARCSAESQSIDAVQLAAFMCSELV
                     VSWMTHAHQARDEALAQAVGDDTSAVLPDLASLIPEATLQGVVDGISAQLLADSITWT
                     PQMVRQAVTLLGNSRDPAHRARALELARKWYRQLQSRAQEGERLQPIELLAFFVPTLL
                     QEEKKGVAQAVRASLSRWSVAEVLYFFTEIAMHGGRAGGVESMTVLRDSGKLLGVYAA
                     KASAPQLVGLVECYGLAQVRSDDFCEAVASRVSELLRATVADASREKTYLSAAPPTTA
                     SESQANSFAAGEEQAMQTEPAAANSTRPGAITSPGVTISQLARLLRSLALMETRQVSP
                     FIDAVHIITRAADADQGTAEQITQLIAAYAKMLIWCYPVLRALAERLLRMDKSEVTLS
                     HLVTAQLALLRMDVTLPSFTARFYEELSKMHKPAAGQSRVSAAGCASLHDMVVQLSIL
                     ARLRGHPSETPLDDAVAEVLIERIVAHSDHLKVDEVAEVLLSLSRLGKGNSAAFGSLN
                     VRTLGMLPKSPPRVMAHVVEAYALAGRGDDTELFTLVADRTVAMRHEMASVTIASVLA
                     SFAKAGVRNDRLFIEVIPRVRHVATYGTPRDVVNVVSAYAAVNLWHYKLFARLADRAI
                     QLRADFRTPEVVALLKAYATVQMRYDRLFTEFAPRIQTLVHLLSPADLASIVSSYAQL
                     DIRCPPVWKATAAQAVMVTRSFSLEDAKTLLEAYASQSFFNQECVSALTERFPELASI
                     SWGSAETVAEGNERSSSGSDGSESEHCGQNKSSQGV"
     gene            <1820534..>1821226
                     /locus_tag="LDBPK_364860"
                     /db_xref="GeneID:13388486"
     mRNA            <1820534..>1821226
                     /locus_tag="LDBPK_364860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865552.1"
                     /db_xref="GeneID:13388486"
     CDS             1820534..1821226
                     /locus_tag="LDBPK_364860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865600.1"
                     /db_xref="GeneID:13388486"
                     /db_xref="GOA:E9BUJ4"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ4"
                     /translation="MSTYGKVYLVSGNNGKLAEVQSYLAHAKIVAEAVKFDLPETQNS
                     SAEKISWDKAVEAYRVVNKMPVGKPLRHGGTPVLVDDTSLEFDALCGLPGPYIKWFLD
                     RLGVEGLLKMVKGFAAPLEEDSGAAAPAHRGANAVCILSLCHGVDEATGQPLVEQFRG
                     VCRGALPPVPRGGVGFGWDSIFAPEAQTPAYAKTFAEMSAEEKNTLSHRAKALKMLTE
                     YLKTHALELRGT"
     gene            <1823829..>1825586
                     /locus_tag="LDBPK_364870"
                     /db_xref="GeneID:13388487"
     mRNA            <1823829..>1825586
                     /locus_tag="LDBPK_364870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865553.1"
                     /db_xref="GeneID:13388487"
     CDS             1823829..1825586
                     /locus_tag="LDBPK_364870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865601.1"
                     /db_xref="GeneID:13388487"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ5"
                     /translation="MPEGEVVFDDASVASSEKTPLNKDMLDAPPRKDTRLRAKWLRCV
                     TVAGVLLLIAPLYLWKNFHAMRAAGEDPISVVTPLSDNFDIHELIRELNDNGEKIYLS
                     SLISKEADGCARDVPGLPRGKQTVVTFKTIENAEREAVVYVPKSYPTPVGGTAPKPVA
                     LLLLFHGLNDNCKHFMDATGFVPYAELDGFVLVSVCGSLGYLGTGWNAGMCCGFLEEK
                     PNDVAFAKQVVTELSQSVCIDKTRVMAAGFSNGAMLAEVLACDAPEMFRAVASVSGVV
                     EIRPGNDAALTACTAAVEKASSTVRTSVLMVHGTADLLVPWDGNKLLGFPSIVKNLEG
                     WRERNGCTDETNTTISTDTYVNIIYANCSVGKRAGSLPASDEEHEESKTCLEDDPYWG
                     LNSVANKTGDAPSGVEDAALVDRERCISRTEAEYLSVRRESKRHVTRLRHEWRSRDQR
                     CQKRDRTKVEHAKAHEKHDDKKVYHTKDSIWNQHDGTDFHLRPHLHLKEKPSQEGLHR
                     HVAVNHRRLRHLPFGAVPKESCEVPVQRDGPLCLQDGISQVELVRVKGGGHSWPRDID
                     FSTTDYIYNFGIRVFGRYN"
     gene            <1826940..>1827623
                     /locus_tag="LDBPK_364880"
                     /db_xref="GeneID:13388488"
     mRNA            <1826940..>1827623
                     /locus_tag="LDBPK_364880"
                     /product="60S acidic ribosomal protein, putative"
                     /transcript_id="XM_003865554.1"
                     /db_xref="GeneID:13388488"
     CDS             1826940..1827623
                     /locus_tag="LDBPK_364880"
                     /codon_start=1
                     /product="60S acidic ribosomal protein, putative"
                     /protein_id="XP_003865602.1"
                     /db_xref="GeneID:13388488"
                     /db_xref="GOA:E9BUJ6"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ6"
                     /translation="MPKSKRAKIVPLTKTQAKTREDKDKLIERIREALEDYSDVYTFQ
                     LHNIRTNILQQIREERAGDSRIFLGNNKIMMIAIGRDEESAQKPNLHKLSPFLTGLCG
                     LLFTNLSKKEVKEYFATVGAPVYARTGQTATESLVLKGGPLPQFPHSMFDHLAKLGLP
                     IKLDRGVIVLLQDTTVCEPGDTLSAEAAQLLKLFGVQSAEFKMDLTAHWTNGVAKKVS
                     NSASKRSGK"
     gene            <1828842..>1831637
                     /locus_tag="LDBPK_364890"
                     /db_xref="GeneID:13388489"
     mRNA            <1828842..>1831637
                     /locus_tag="LDBPK_364890"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865555.1"
                     /db_xref="GeneID:13388489"
     CDS             1828842..1831637
                     /locus_tag="LDBPK_364890"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865603.1"
                     /db_xref="GeneID:13388489"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ7"
                     /translation="MSSLDTRDAVKHYELRHNVLLQSILPGGLLSSLELKERCEALLV
                     PRQVSLEVLHIAPYFLATAQRPSTESSAKAAPPLSALFGEEDDAAERGGSPQQGNDAA
                     NDGGRAGGVTFPPENIDAFRAVLTRFLEYHLLHFDGFGNSEFTNLSGQRGSFAEDLDH
                     VKRFGHFGQVAVLADADALRPRGSGASADGTSAAAGNLPCHPSSLQIFIIDKPLMDSE
                     EVRLVREALHKLTVSAVSKIEAKMCTPRLTTSLVDIPFLMGDQDAGHLTAHMKQSSEQ
                     YALSAPSAARVAAANAIDATDTNSCDGSLTETVVIEDFEDEPPEDPDLEAYVAKYTHI
                     SERQRQRSESTLSAREMLNSGGNANAQDEVSRAPCLSHSLPSAHGHQDVAVAGAGCPP
                     NASRAAGTKTAAAAKTSMHANVLCHEYSRECIKDYRRVVAADNEIFYSEFERLMSLRC
                     AGSLARVMSEYVSKNQHLQQPIRSSAVYNKFVERCHALLRRTPRLSADRERLTIMQEG
                     VERYVTSRLYHQIFNVSEDERRKNERMQQKLLRLENMAPADLDALPEVELHHVWGQAM
                     FELDGMDFFKSPREKLRCGMRSCELLSLAVGDILRQRREAKRAENAAKTAASGNAGGV
                     PLAFGADEFLPCFLLLVLRARPLSFVQNVLYIEKFRCPALMSTEESYCLATLQSSLLF
                     WENFGEDGQMDAACTTASPPGSAEATSHNGGSASIRALTKAPPSLSGIMQQQQPPPQM
                     TEKDLLPSVRQASSTGRQQAGLTNISQPGSEAAAVSEGRSMEEEAPTVLDVLFGWANR
                     NLAPLASEIGLGGKAGGSDGDGSARQSDSLGTKPASITGPGAVGRLSPPRGTVAAPTS
                     GSERADEVKDTSCAADVFHAALAPALSPPHLASNMSPRARVRQLLVTQNKTFEQLTLA
                     ELQMIVEEARQLLLEGK"
     gene            <1832807..>1833193
                     /locus_tag="LDBPK_364900"
                     /db_xref="GeneID:13388490"
     mRNA            <1832807..>1833193
                     /locus_tag="LDBPK_364900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865556.1"
                     /db_xref="GeneID:13388490"
     CDS             1832807..1833193
                     /locus_tag="LDBPK_364900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865604.1"
                     /db_xref="GeneID:13388490"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ8"
                     /translation="MLKPSRLVGLSASILGTHLHMSAEQHTEAQVSELEKRATSAEKQ
                     LQALRVKLEDGAGAAASGAKLEARLRELLKLMCEDRDECEMIRAQRDELMEENARLRA
                     QVMKGEYRIKHLLRTIEEIEQAGAPQ"
     gene            <1834007..>1834246
                     /locus_tag="LDBPK_364910"
                     /db_xref="GeneID:13388491"
     mRNA            <1834007..>1834246
                     /locus_tag="LDBPK_364910"
                     /product="cytochrome b5 1, putative"
                     /transcript_id="XM_003865557.1"
                     /db_xref="GeneID:13388491"
     CDS             1834007..1834246
                     /locus_tag="LDBPK_364910"
                     /codon_start=1
                     /product="cytochrome b5 1, putative"
                     /protein_id="XP_003865605.1"
                     /db_xref="GeneID:13388491"
                     /db_xref="GOA:E9BUJ9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:E9BUJ9"
                     /translation="MKEYTREEVAMHCTSQDYWVIVDRHVYHLDAEFVTTLHPGGLII
                     LESAGKDGSVMFHEHHNLERVRPILEEYCIGKLKK"
     gene            <1837953..>1843439
                     /locus_tag="LDBPK_364920"
                     /db_xref="GeneID:13388492"
     mRNA            <1837953..>1843439
                     /locus_tag="LDBPK_364920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865558.1"
                     /db_xref="GeneID:13388492"
     CDS             1837953..1843439
                     /locus_tag="LDBPK_364920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865606.1"
                     /db_xref="GeneID:13388492"
                     /db_xref="UniProtKB/TrEMBL:E9BUK0"
                     /translation="MRSETIMRRAHRHASGHGMGGVMSSTSATVVPAAELADAEAEKL
                     SSADRSGGNGTSNCNDAAKQATVLERLWRPVECVLMDICYAIDDRFIIPQNITAVPAL
                     IEEEFTHRQGFFMLLGHFISISTLMVFAAYSRRLSNLVSGASPVMGEILFCVSHLSQV
                     TQEQLGWSLFCTGFLSPSTFEWATTESGISGGVAILGGAGSPGSKRQMLGANGGGGFG
                     ASGASAGGSQGSTGMGGGSAGGIAGCPYTGGNLVRYLLGRKANSMIRQESLRSYLYSS
                     FYSPSAFLAEQTVWFVLLAATMDLVSMQRLAVAAFFANVVGWLPVYSVKSLAGLGVAL
                     VVVFMYWIPSSEVDDAVLSVTFLQRPMHRLLSAYCASLCITLLFAETLLLEDVRRVIV
                     HAVFTLPQRLLRVGGHHPVVAKIVHGCAWLRCEYFYFVDFYFFLGMMCWLSLVLMETA
                     AGISVFGTAALLTAVPWLVGSGWRETPMQALKDTVIYVGFYVVVAILLAHVVPWSGLA
                     FLSNALQSGAVLFLMAARCECKQPGGSAYVLLWVAMMCVYLYLKAGAMRGTTGSSTWS
                     LYDSNPRANFAKAAYAVWCGGPETEEGALSLLRSACITFWQLLSKGLSEEGIQVLHFN
                     VVVLGSMLLFSTTVRAVVVEGVRFSSPGPAVSTSAEATATPAAALAASSVSLLPTSTT
                     AASAKGDHNGGAAQTLAGRQCCFRSVLNGSHCSAPTSSSCAKSRAAAHAVGAKASSSS
                     TASIMRRSWQAPTHAAAAAIDACGRGKCSDGVAAPEEGGSEESVAEALVEMEKVIEEA
                     KEATREVWSVAQGVDEQPAWPAPPAATGVSPVEDEEAPAVLEEETEMPAAPLTSTSSP
                     SMSKREDNQKEQRPQLSTASLTQNPASVDSVDEAVREENEKTPPQPISGLDSKKTEVA
                     STVFPRDESDLIQHASRSASLEEIVNCTATSFTSTMCRSDMSSAILSSFRHEQAASLT
                     SRSSTAAETPLETRRERQEREREKDRRYERERVKTPASTASCASALPFPATKAQREEA
                     QTPPQQRTSKSSGGQKTSTDTETPTAASSAPALPLPRSHTESLKKAAETPMSPLVTSR
                     QTAVTESKELVRSKNSGADARTTAASAAKAARLTESTALAGAASAAAGVGVGAKKDKG
                     KAARDNGEGKKADGKVKMAADKSSTNSKAVTEPSPGDAKAVESAAASGPVTFPLPKPR
                     HEHKSAGEAVATATAKAPAAAAKGAAGDAASGEKRGSHKAAPFSMPEKAGAAAAKKAA
                     AAAAAPPQISASAPAPTASSSSSVATAPAVLPLPLPRSVQAAETDSAAGAAQTSPASG
                     EQPHEVPLQQALRDLRWASAASHVTPAAGTDGSGQVSASGPKHDVKSKPSAAAAADDA
                     EESDVSYDLVRALNFLRLKINYAAGVDDGDDDDGSSSTVSNADCRHNPTSFLHSDSPE
                     HSTTTPKRSLSNAPEVKLDVSAAADLGVDANVSRTVPQRTDEAGAAHESFALAQPSKN
                     ESLMSTPQRVSQAIQSVSEWTAKSRSGFGDCRTDSFASTNHNSANSSGNCALHDRRSP
                     VFHVFSTHPNAAVAATAAESSLSPHPRPVHMDVASHGSELLPSEMVESGMELSAATRY
                     MDFNAACSSLGHYQVPQIVAPPSPPLESRQSSSSHMPFSVSTFNHSGSQMSSMSSIGR
                     SNSDTAGDRSSVLPRMRGAPNGRVSVIEQMATQKTQQSVSVADTMQQMQFGASSMQQA
                     MMVMMRAPDGQMALYPMVYNQPVYMADANGVMQPAQSVQMTSHPPPQQQQIVYAAAAP
                     SPGQAVEVAYHIAPDGSYMMTAIPQMPQQMMGQYQQQQEPYQRF"
     gene            <1845210..>1848188
                     /locus_tag="LDBPK_364930"
                     /db_xref="GeneID:13388493"
     mRNA            <1845210..>1848188
                     /locus_tag="LDBPK_364930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865559.1"
                     /db_xref="GeneID:13388493"
     CDS             1845210..1848188
                     /locus_tag="LDBPK_364930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865607.1"
                     /db_xref="GeneID:13388493"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BUK1"
                     /translation="MNIHISGNLSKPTVIFIAGWPDTCDVFRDNVMATLATDYRIVGV
                     TLPGFDDEHPFLEELRKRGDAEGLNQLGKLRGGGNGVSTACTATGSTWMSTLSPMRFL
                     TSAGAAPQPNDSSSRGGGACARTPLQAFGLPCRCAALEPFRTSWKGHSFQDLVTLLEI
                     AVDTAMETCNYCPTVRSPISAEAQASARRSGGGESEASEPTTDAFAAHQLPPTYTRPV
                     LIAHDWGCLLAYELLLARPRLFSRIVALDVGAYCFESDAAHVERMCALVSGQGKGTPA
                     DMARSPFAAAEAQAAVNKEKAANSSASGREVDAIAQTTTATCDPNLAQRGRIVPAAGA
                     APTLTLLRRQSTSPLDAAPALSTLPQMRSGPSTPGTKRSLALQYAIRRRRGAALPQRA
                     EARKRLFIVLYQFFLIACELFVPHRLARWLVGWFASVSGRPSYSYDPQMVVTPTMELL
                     NHTLNAQFFARHPLAVENRGALQLPMLLQTEETKASPSSSAAAVATVEGGYCKSKGPA
                     QATAAGWKIMLIPYLEKMSVTAFRGSATSGNQGQLQSNGRPLSKRGVCEAFEGNCGTI
                     RKSTHSGRAQRHRLYGDSSTDSCASVDGMGDNLEGDGVAGRSGTTFDKKNPTDDAHVV
                     FSSYAKGADMVFDEWKSLAAGTRGTVDEGPSGLGSSGELDPYTSVNGIAAPVWVTEDP
                     LTLTGAQSFMETNRATGVGSKDVSFLMAADGTFAGDGSRADTFGVSSSTGARQMHVAK
                     RRLFYQAVVFPPLNSVATGSSSTSFYGDLDDGDSDRSSVGPRSTVLSRLRKSNRTSPL
                     RPAVPVHASPWHSWIYLRFWLGTFVLRLVALVSWLLGEKPSMQPSSVPGEGMAASSAT
                     GAPSRASSNVMTTAMTTIYRRLPATPSLAADVSTLPGNGDVVLQPKSHAPLVTQRYFV
                     PLPIPILFMYGGEKRVMFHADHWCSYIRQYQRPRDGISDVVEVQGGGHWFFAEKKYQK
                     KVADRIAEFLAAEPTTPYEV"
     gap             1848601..1849186
                     /estimated_length=586
     gene            <1850033..>1852216
                     /locus_tag="LDBPK_364940"
                     /db_xref="GeneID:13388494"
     mRNA            <1850033..>1852216
                     /locus_tag="LDBPK_364940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865560.1"
                     /db_xref="GeneID:13388494"
     CDS             1850033..1852216
                     /locus_tag="LDBPK_364940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865608.1"
                     /db_xref="GeneID:13388494"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9BUK2"
                     /translation="MELDHLKDDVLMGDTNEVTVPAAIVASAPVLDMGFHPRLPIMAA
                     GLVTGEVEIYKRKSVDEMVKIPLQNDFSSWIFSGQYREDEVVMNYHHHNMLMHPSGSV
                     SSMEFTDDGNYLVSASGDRTISVMDCVSLRLVIHIPDEEVRARTAGKKKLNSMNKKND
                     PTAKSGKTTRKKAAAAGRSSRSGPTVPVNPHKYGISSLNVCDENLIATGDDDGLIAVW
                     DMRERRPVYVYHEHGDYVSQLCYFTDAQELVSSSGDTCLGAYDMRAGKVRDFSVRRKD
                     ELNCFAFINSSGVSNATFIPSIVCGTPHGGLPLWKYGSWARPYDVMDRHPAECEAIIS
                     FHGESTSFNHNLILTGACDGLVRVLQMYPVRRNLCQLSARDYTYSHSSVLGNQSSSGR
                     HQQQGNYVVRRARGQETISRMRVSHDANLLAVSGSDNIIDFVDIAFMNDEAELDQLRG
                     RAEQHHLRTLRELDRELEEEEKREGRLLEGRGADGEGGENDVDEASSVPSSSNASSQP
                     SEDSDTDVKTEADVQTRLAWREVLRQRFAKIGVAQKKRAHFDGSSDNDDDGGTPAAKK
                     KASEKAPQRSDVRGQKTAKSRESVAASIRPPSSDTGASLPSKVSRRVDSVMSGTGRSC
                     NQEALKKKRQAPVEASALSATMVATDAANTNPPSAAASCVAAVESMDSMEVYRTERQK
                     KRERAAAARWLKEERRKKINFTYEKRRRRVGGFFGDMVNRDDHGG"
     gene            <1854472..>1858908
                     /locus_tag="LDBPK_364950"
                     /db_xref="GeneID:13388495"
     mRNA            <1854472..>1858908
                     /locus_tag="LDBPK_364950"
                     /product="methionine synthase reductase, mitochondrial
                     precursor-like protein"
                     /transcript_id="XM_003865561.1"
                     /db_xref="GeneID:13388495"
     CDS             1854472..1858908
                     /locus_tag="LDBPK_364950"
                     /codon_start=1
                     /product="methionine synthase reductase, mitochondrial
                     precursor-like protein"
                     /protein_id="XP_003865609.1"
                     /db_xref="GeneID:13388495"
                     /db_xref="GOA:E9BUK3"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:E9BUK3"
                     /translation="MSDETVFMDAGERLYVLYGSETGNAESIAKRLHHDATNNHGFPD
                     AACMTLNQAVSMKLFDAQLAEDAPASLCVVIVCSTTGEGEPPQNAARFRRWLRNAAGT
                     LHKLRYCLLALGDTNYNSFCAPGIFMDNKLRDMGAVCCYPRGEADDSVGLHLVVNPWL
                     EGLWSALKQSGTEGIAATGQETCATEDIRIDMSVAQEAALLYSHSSPLCAATALFLHE
                     RITELGGKADLYPIQHFNPTTSLRRPPTVLFFVLGTEGDADAQCEQCACAAQQLPPLG
                     PLSAWIGNSDPCTPPPAEAVELHRWMSDPSIRFFNSLFVSRKPDGASRAAALDADLKA
                     LATNCKLEYLCRCQLSGEVPSVAISADDVFLWVEKVLHSLPGVTADTVYIRRTMDDSF
                     DTRVGAAFRAAHAPGLRSGSATESDYVARGGSAPTLIGQRLYRVGLEDDCGRGDAGHA
                     SSENGGSHGAGASRKTHEVVDDLLTPIVFLYSGHSSFVKQCAMNIFSGAGQHHLRCSI
                     SELSNFQRMGFPRHATFVFIVSGVLTEPMSRVLKVLRTLQSQKKDIEGVSFAILGIGK
                     TSESGRFNACALELETLLLKVKANKIHCTGLADVDSSSLVPIVQSWESSLWGAIVRPM
                     KSTAYLDIASPGIQVQRSVAPLATSGSSVGAALCLAGALVGESVIRDAGGNGGVGGGN
                     DLVEHSKFGDFLSASASPSLLPLPGGVGPSRGADLQGSSLVTVPGSSLPGNSSTPTTV
                     AAGATPGSDKTDASAAGAGLADALSPWDTTPLHREKARHTPVVFLYASAGMSKAIAMH
                     AMRSAEEKGFPTAVHPFAHFQFVDYHAHPNVMLFCEAGAEWQTNGGRRFRKFLTNPSH
                     HPGTLSSVRFAVLGLCATPADVVHPAFCWAKLLLRLQANRIFPVLIMPSISQLHSLGM
                     PWINCVLSSLALLPSSVVVPSPPRDPNAPGAGELTIGPSRVGTAAAPRARDDDADNDA
                     VEEAADAGEEVQRSVSADMGSCGADVSTEQDSCTEWSMENRIAYRVDGVVQSWKLLTC
                     PTVRHPVVQLDFSVSVGTQWAPGQTIAVVPSNSTAQVEALLRLFHLTRDEPFLPPAIA
                     GPGVSVFPTSPLYEAVDFPVSCGTVLMRYVELRVTGIHKPLFELLARPCASEEAKAAV
                     QTMYAELLADRTPRDLCEVLEAVGAAAHSLPPFRHIVENLSLLQPRQYSICSSHRADA
                     TTLSICFKVVEKGLCTRWMYEQCLSAAGLPLVSVASAAPTHAEGCTAPSAVRQPVLSN
                     TAIVAKVRVVIPFEIRSASVFRMPRDPLVPMILVGSGTGIAPFRAFLQEREACLTERQ
                     LPSGCTCPKGKLCGCSCEKATRHGQAVCGTINVFFGCRRRYEDYLFRDELSHWKDSGV
                     VHSLAVAFSRDTNDGRFYGGGCYVQDKIQECGVALMDLILQRNAYVFVCGDADGMAKE
                     VHRTLRQLIQQHLTLSDAAAATYLERMSKDGRYLREVWSTGV"
     gene            <1860150..>1864583
                     /locus_tag="LDBPK_364960"
                     /db_xref="GeneID:13388496"
     mRNA            <1860150..>1864583
                     /locus_tag="LDBPK_364960"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865562.1"
                     /db_xref="GeneID:13388496"
     CDS             1860150..1864583
                     /locus_tag="LDBPK_364960"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865610.1"
                     /db_xref="GeneID:13388496"
                     /db_xref="GOA:E9BUK4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BUK4"
                     /translation="MAVHISSSTVVASLWGSEDVTAIPLQPSGQFLSLRLSPATAIAD
                     NTVTSVAFHPVDETCFVLGTGAGKAYGVSLQENKLFLLADVGERGALRCATFCPGYLT
                     SPIVVFASTGNRLLFLDWQRGTVLQDVLATAHQRPILRIVTGASTESLFCTVSADAFS
                     CWEPVASSEGAFALGPSSSAVPVTNHQGPTSTAGTAGSFPKDRSTFGFSMPRYGCSGS
                     ALPTECTLELQRSCDVVPRLTDRVTHRFLGVHILHPALFVSVEGSGVLSLWSRAAAAG
                     DTEAVAHQGPLRLQQSATTPSVLRVRCSAQCGALIVLGADAATVDELGDHVEPVVAFV
                     VGQTLEGAGIVRLPSGGTGAPARDRATAVTEVSAVQSDCVACLLSTGVVHVVLPSTFH
                     LVFSIPPPSLGTLRHRLGPRSHWSFAPSGPTFGAMWCEHLLLLLHLPTARRGYAGAAH
                     AIEMATLRVGSRSAPSGEAVAGSKRTPVKPKSSRLGGRADDAAAAAHGVAVVAQSFLR
                     SCQAPRSTPSRQAAVADSAHSRVDAALAVLSRCRPPIIVPKKGFPDIWPDVNEVDLRA
                     AEQQLTARRTSDAKEADKDTTANGPLAWSSAAVFCDTLSPSSCQYNVNQLQAHLLKHG
                     VFPHQYRPAIWRFLAGLPSKAKTASQFAALARRPPHLAVLQLMNPFPLPPSSTRDAVE
                     SALSCLCWASPVFTLASYLPVLVYPLSLVFHDDVQSVVELVLMFFLNWGRDFFVCHPH
                     GPAMLLMAMERQLRRLDEPLCQHLDAMGAGVAVWGWELLTSFFTDSFTGAEWVQVMDH
                     IITAPPLFLFAFHVTFVRTRLRPQLTSALSVDEVRGVLRRAPTAAAAPTAPSPPKSLQ
                     RLIEEGYRLYHSWSCESGDSATDLSSFKVFQTLTPQFEYPVNFAHDSVVLAERLRELS
                     LLQRSRDEEKRAAAHLEALRKASAAASAVEAAFLLQQRARVAAKYDASAAAWQVYVAV
                     ERSRQEREAEERQLKWEALQTRTRNAEELEALRAEMNMVECQLRHDMVDRHMEQLKWR
                     LAAHLTDEELVRLQKDADAQVERAVQRIEEDEQRHAEDALHYETAPPLSIEVLPGEEN
                     KAAVGNAALPTRVVEDSHPSTQPSSTATMKEEGCDNTKQQSAKRGRGVSAKRQEWEAA
                     TEGRAPAGCIGASIQPPDARVALHEQRLCCYSSSLSAASSSASSSVSLTAADETGGGA
                     SGPLHHSSQATPPSSATLSQAPVPVDGSGGRPAEGELPARVLEKASPSGGVDPTSRRP
                     RLVPPPRHAYCDVAGEHRETALNQRRFLELRDRVLSRAEAYTQPGVVDPFRRYRPPYR
                     GDGSATMTASCTPTVTATSSCPSSSTAPSSRRRLFDNYEPDQRRPGGGKRPYDQQQRR
                     QLQPPVDSYTATVTRTSATSSTGQSMSGSTSTTSSYESPSTYTSYDYDYSATVSTTWR
                     TGETRSAGSTACGSSLAWPARPRSDRLAQDDGRKHLCASRR"
     gene            <1865864..>1870069
                     /locus_tag="LDBPK_364970"
                     /db_xref="GeneID:13388497"
     mRNA            <1865864..>1870069
                     /locus_tag="LDBPK_364970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865563.1"
                     /db_xref="GeneID:13388497"
     CDS             1865864..1870069
                     /locus_tag="LDBPK_364970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865611.1"
                     /db_xref="GeneID:13388497"
                     /db_xref="UniProtKB/TrEMBL:E9BUK5"
                     /translation="METSPKTASANVDLYVLEYMVNMRWLLRYAAHELDPTVEQQYPD
                     FVARVVQLDMVLSNTTFEHSCTLGDVPFGIVRLAREAVLYLLVSDHLLGGCPPTMHPF
                     LQRAVVAESSGAARRSPRRAPVSADLNVSFPSDGDGDDTDGGVSRTVTELDGRPLNSI
                     DPSSEEMLKLAEVEVQGKEAQAMLLLLRWLFSEGVLSEDDVLATVEMDRPDDGSVNTQ
                     AGPPAPAATGYERFRRHQKLARHLAQLVPFYFGAHLLLSRSLLLQYCSTLLTRDAVMH
                     HVAHLRSVVSRAAPRLSAVPPPSSVEGALLEWLQVVVDSINASEDGAVVLARLQDCSA
                     LRAFIQHGPFCEDVMDPADRDFFRLVQSGESVCVALLFYYPDAVPLPGLSMALRAAEN
                     SVARREDTDAGLELLHQHLSLCYWTAILAAARQLGVWTLLRAEEIVRYGRTALPLHLF
                     CLIQQLFAVLATNAEEDVRVSADTAWWEQMESRDGLTAMMRANGADAGSDSQEWSDTA
                     KTTKSRAALSGAQQVLRRSMHNTLSPPVFAAPDASGDGAGTAQVRMGSGHDGRPHERR
                     VVAPPSSTGRATESLETDECRAVHSGVNVPATGEDDTDGDTAQFSIEAVHTQRGAQTV
                     SGTGPEETLETAASVLRPMVTGRGGALTRTSAPASGTATTTMSLDTLTIAPAANLHDG
                     QRRTDSRADVFGAHVMDTYARAEEECVPNSGATAAGDLTAQPALVLSEPRPTCADALL
                     HTRAVDAVLHGSATAAYAKLPTATTAVADVPVVAAPAPTKRLSRERGHAESSLRSAGS
                     GYKASRDAPVVAQPAEASRGTSSIIARAAERSMSSSLTESSGFVMRKAPQDPKEANEA
                     AREISDSVDFSDSKHMSPAATTTDFQCTAEESPSLQAFAAGMGTEESTAVLDSAMARP
                     LLASTTLTSAVIPAVRMVVFPKHDAEKGFEDPETHAAVPRRICDAAYTDLSSSLGWPP
                     TTRGKATVAAHVPSSVAPVGGSARSPPKASASSLSREDDSRSSHSRKCPRVTGVAVED
                     ESRVVFRDEAEACARAMGKYSPLSPPPEELEPLQTRWHDCETGMAVVDHAMVACDLPT
                     PLSHEHTLRRVGGDALPTMNGENTEEYRALPPSMLSPSPVYPVSSARRGHEHASDGMR
                     DDNTPHRKVSEGADSLEVSPLPLALTRSLSEVYGTDYALMLEDMAASDVDLLRRRHRT
                     TEESWYSSASWPYHRSWRGAAESLASAISSTQNIAQVRELLDRLTGISLTDLADKDKQ
                     ELYNALAQQQAVVNELKTALHGGSTHVGGRGQFSNATHRPTLQRRRRAQLRPPPEETD
                     DRGEQAFAHAGRAVRRKPRDTLGEGAGTWRSLMSPMTAESGGSAAHTVQSDVDGQLAE
                     TDVSSQVNEPLQFSASTSLPAST"
     gene            <1870848..>1871318
                     /locus_tag="LDBPK_364980"
                     /db_xref="GeneID:13388498"
     mRNA            <1870848..>1871318
                     /locus_tag="LDBPK_364980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865564.1"
                     /db_xref="GeneID:13388498"
     CDS             1870848..1871318
                     /locus_tag="LDBPK_364980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865612.1"
                     /db_xref="GeneID:13388498"
                     /db_xref="InterPro:IPR013717"
                     /db_xref="InterPro:IPR016542"
                     /db_xref="UniProtKB/TrEMBL:E9BUK6"
                     /translation="MTEDSQGAQIAINGFIGSILIVVGSITYVLWAVLPDDVLHRLHL
                     TYYPDRYWAVAIPAILVMFLFHYFTTSWLLVLVTTHPLTDGRCITDVDSKPDKEIEVG
                     ALADSSSSVPPWVDIPVSVASHLLFEPWNEKVRYNAPGPTEMMNGENGRRGRFV"
     gene            <1872022..>1873875
                     /locus_tag="LDBPK_364990"
                     /db_xref="GeneID:13388499"
     mRNA            <1872022..>1873875
                     /locus_tag="LDBPK_364990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865565.1"
                     /db_xref="GeneID:13388499"
     CDS             1872022..1873875
                     /locus_tag="LDBPK_364990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865613.1"
                     /db_xref="GeneID:13388499"
                     /db_xref="UniProtKB/TrEMBL:E9BUK7"
                     /translation="MSLMRSCVRLQQTALEVSTLHRLLRHCARHPERFELAEMYKLGI
                     LLKDSNDALALSSNTELLKSLASRYAQIRENASPFQKSLLDAVLPRSQSVSTSRSSAA
                     GAGAAEAQLTTGSPSAPDGALPVTAHEYFKAIMELAKDAEAEHYRAVAREARASSRGP
                     LHDASVDMQEGVSPGRSGTAAPAPSRSDDTSAAGLGEALGSSRTEVLEAHLTALEPNL
                     RQLSPAETCHLIKTLAKFNYTNYEHAVLLTRRGCEISGQLKCRELCQLFFNLHKLHTR
                     DSLVAIVNHLLEHTTEMTADDVFLLSQALERQENTSSASQRLLAPLVAQAIKKLPDAP
                     SAAYHRALLVSMARYNVAHRATLQVVLRDWVEHWKATTSERDLLKMFEAAASLMSAAK
                     LEGLQQLVERLTELAPTMDVCLMDRAMDLLSMVPMDMSTKCMMSILARLVGEAGHLSV
                     RQVVFILQLLSTYPPAKGHTAVVSMAYAASIRAPSMDTESLESVVISLAMLQLYTDDF
                     FTIAHVLQAQKGGMRSFAAVQELLRHCTSEMAATERGLGMLANVICTVAPMLNDEELA
                     SCRRALVNLGVQDRNVLQGIFARAKKLHRTQSTGHARKKRLGSYDPMADLL"
     gene            <1874778..>1876430
                     /locus_tag="LDBPK_365000"
                     /db_xref="GeneID:13388500"
     mRNA            <1874778..>1876430
                     /locus_tag="LDBPK_365000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865566.1"
                     /db_xref="GeneID:13388500"
     CDS             1874778..1876430
                     /locus_tag="LDBPK_365000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865614.1"
                     /db_xref="GeneID:13388500"
                     /db_xref="UniProtKB/TrEMBL:E9BUK8"
                     /translation="MSRAAAGTAAGVAVMGLFSPALSTGNRPASLDYIFQRIRLNLVP
                     LNAQDIYQICTVVYNNDTLGVLSDAELMRGIADAFQRSDQRVLNPFQASLVMDTLRRA
                     GINASPKEVMVPEEEAISPETLLNVLRAMNVHGGTRDERKIDEVLKNIPAVLDEFSPT
                     QLSLALCELAKLRCANAEAMNRIAKRLFEKTEDLSAMEVSLTTIALAKTRGMPYGTVR
                     RAFALSEQRLDEFQPDDYVNVLLGLQAAGKQYSRTFVKLVEAALGKVENLDAVTLTQF
                     LVTFTALDYGKREHLEIFADALVDVASDLDQQNLVQSLVALQRLDLLHEELFSALAAC
                     LMRYAKNLEPRFIAPVMDICSGVSHNTDGLMHVLLDRAVECTRMLHPNDLADILDIVA
                     LYPGARGHALVEVFGRQARLRLELFNPVALARATRGLAHLGYRDVDYYTQAADTGFRF
                     GFKDWSSLEPILMGMCFNEEAPVRTIKVLASFVSQMAKSMSLQEVERANRYLVRLKCE
                     EDHVYRSLANRVMHFVKEITPDMPQELQVLVQRGAVNRLTEG"
     gene            <1877320..>1878273
                     /locus_tag="LDBPK_365010"
                     /db_xref="GeneID:13388501"
     mRNA            <1877320..>1878273
                     /locus_tag="LDBPK_365010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865567.1"
                     /db_xref="GeneID:13388501"
     CDS             1877320..1878273
                     /locus_tag="LDBPK_365010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865615.1"
                     /db_xref="GeneID:13388501"
                     /db_xref="InterPro:IPR013744"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BUK9"
                     /translation="MEGRLVILPRDGMHKTSMFLVGTAHRCILAVGSQSEGLLATPYV
                     QEMADALKGEWTIAHVVLGSSHVGRSAPSHEADADDVDAALALLVKEHSMNEVVLYAS
                     GTGVQVALEALASAAHAEVVTRVILQGGIVSPQRSKLFSVEATKRRLEMARALIAEKR
                     GDDTTAMAKVYDMAVTPARLSRNATLTVQEALWQPVLGESESTCKQTLRGVTVPTLFL
                     LSTEASYTAAAKDAVPAVQRAARDAIGLPTEDVQVTLLPTTIDEHRCALNGNGALAVK
                     AVSDFLQGADARRAQFEPGTTVVALEAKQKKEVTLVNGVCA"
     gap             1878862..1878942
                     /estimated_length=81
     gene            <1880799..>1883579
                     /locus_tag="LDBPK_365020"
                     /db_xref="GeneID:13388502"
     mRNA            <1880799..>1883579
                     /locus_tag="LDBPK_365020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865568.1"
                     /db_xref="GeneID:13388502"
     CDS             1880799..1883579
                     /locus_tag="LDBPK_365020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865616.1"
                     /db_xref="GeneID:13388502"
                     /db_xref="UniProtKB/TrEMBL:E9BUL0"
                     /translation="MFSESDESTYTVHEVHRDDGGAVPKPVESQTEPETSSHLARYYR
                     LGTKERHAFDEHMRHLRQQVAAVERERQFRVSHPFQPKTCTPFATVADAVTDAAQADS
                     PSRLAPPVASGIGSSSSPSGVRPVFERLAAQAVQLEMRRRHREEQRRRAEAASLRGAF
                     QPHINHTAPIYAERLQHLDLVPVEERLLHYGEFVARERQRKQELKEVEQTVAWQSTQA
                     SVVGAGTSQPRGPEERRQQQEEFLARNHRFLAERSKHRQCAEAAAAEAFSFQPKISAT
                     SAALDEARQRCANAVSTSELGQLLNRSVDAPPLSISKTSANAGRRSDALYALAVARQR
                     QRMEKLDHNSSNSGETTNGVDKGKAVEGPKATHQPLTNPTSAKWIAEGAHGPFFQEDF
                     VRRQALYEEVKREEAALRATAVQEPELSSGRPAAHKVDAKQLNQRLYYSAKTAREASE
                     RRRQALVSARECPFRPQLSPGTKYVLQHMPSRDGDVVKRLTSQRGSGSSGGARVAMDN
                     DLYAPAPAHQPSLQGHSRSPSQQRKTEVKNSTEVGQDTRRRRTSLRTASPRTEARGER
                     ADGSGDELPAQQQQRKQHGRPLTLDQVEHFYQRQIAALQQRKDLIQERREGKAMEELV
                     ECTFRPRTNTDRHVGMESGAGEGADTAVSVNHVTGVSAFLERQAVARVRKAEHDELVR
                     TVGLPRHKSAGSNGTSSRTTALSPFKFQTEMRRQRLPSSPLESKQRREAAPFSTAALT
                     TAERALHEAIEQSRRCPGASSQAPLFPLPGCAHASEDGVHFDDRGHVAAASKDVEEPT
                     SRVPPSTLSTEKKGRGDAAAVGVGYDRPSLFSLISPNTFSGRSLGSAAYESGNGKGTP
                     AGRGFASDKPSPSALKGSKQRLTASVKRQRRNRSVSFVEEAADTPVAGVALRGRKSFA
                     DPAHLAFLSGEL"
     gene            <1884482..>1886017
                     /locus_tag="LDBPK_365030"
                     /db_xref="GeneID:13388503"
     mRNA            <1884482..>1886017
                     /locus_tag="LDBPK_365030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865569.1"
                     /db_xref="GeneID:13388503"
     CDS             1884482..1886017
                     /locus_tag="LDBPK_365030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865617.1"
                     /db_xref="GeneID:13388503"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BUL1"
                     /translation="MPPLAPRRRRRTSELKFRHTKRRRVSGALVKRGIEKEFDRTLPF
                     WRCFIDLRLTTGRVPEVVTRHTQVLCRIPCKVFKRVDVVWARTTVQLRPVHAPTWQER
                     KNGPRPPRASYPVPAKAAAERAVAQARATTGTPPSGTDGDRALRVYTIDTVHFVHEDA
                     YKRGRGSDHSFHVQSVVLRDAPHILQCVGGSMVSFSLIIYTSLRLAHACDARKCTPQQ
                     LGRQLEAVMTAYDESSSTMATESTSQRANNTSSAAVATGTGHGGGAAQQVHSTTQPGR
                     ASLAHDGDFKSSSEIAAFSVLQAWCPPPTVRVLILGMGGNSMAHALRVVLGADALIEV
                     VEVEPAVVASCMQMGTLHDSDTKTKVHLQDADQCLANLPPTAYDFIYMDIFEPMQATM
                     RNLHPWVLATRTLLKPGGLLVMNDHHLPSAAGVAPYAKVFGEGNVQAVNLRGWSESIV
                     VCVAPGDASTDKYSLNVSKTHADIAFNIYETLVPGWLPHLSWLVKAKTYRHEGVRCRL
                     WTS"
     gene            <1887020..>1887856
                     /locus_tag="LDBPK_365040"
                     /db_xref="GeneID:13388504"
     mRNA            <1887020..>1887856
                     /locus_tag="LDBPK_365040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865570.1"
                     /db_xref="GeneID:13388504"
     CDS             1887020..1887856
                     /locus_tag="LDBPK_365040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865618.1"
                     /db_xref="GeneID:13388504"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9BUL2"
                     /translation="MASLSAARVARFTSRWLTEELNSFARSGNWEGALQMFEHMQQSS
                     LVRRNVFHYTTVLTACTRAGQMDAAMMVFRQMKANQVKPNVYTYTTLINGCANAKKLD
                     LALRIFAEMRLVEVPPNVKTMTALISVCSRCGQWKKGLQVLDQCEEFFIAPNALTYTA
                     AMDGCRRAGVCTPAIALLEARMTDPSQVRPNEVTYNTVLGACAAAKDHKAALRVYARM
                     TADGYEPIEYTRELLREVFRGTSLDGLADNLTVRVKTSKWEAYVPDSDPATALRAAQE
                     GG"
     gene            <1888627..>1890156
                     /locus_tag="LDBPK_365050"
                     /db_xref="GeneID:13388505"
     mRNA            <1888627..>1890156
                     /locus_tag="LDBPK_365050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865571.1"
                     /db_xref="GeneID:13388505"
     CDS             1888627..1890156
                     /locus_tag="LDBPK_365050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865619.1"
                     /db_xref="GeneID:13388505"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BUL3"
                     /translation="MNQTSMEELLAANADAAQELRGVAVLDVPAFDPDGPPRTFISNR
                     SSSSAMMSEAMRRRANVLWRALYPRTAPPTTAAVATSSKNGVGADAATQTDPPCHDVV
                     RQGIVTVVSNTSGEATSKPSASASSGMLTHKRARDGDDIVSVNPEQLKARSALVVSKA
                     AAEEAEARKYSPPPKWRLAKVLVGHQGWVWATAVEPGNKWFATGSFDAIIKVWDLETG
                     VLKMNLTGHKEAVRSISLSKVSPYMFSGSDDHSVKCWDLERNEVVREFFGHKSAVHCV
                     AAHPSLDVVISGGRDKTVRVFDLRSRAVVHTMLGHTDSVMSLVVQQEEPQVISGGSDG
                     FIYLWDLASGKPLQRLTRHKKPVRGLAFTAAGDALVSCGADEVRVWKLPSGHFVTNAS
                     TRVLDGHKSRPATSASAGGADEVGEYSYRWSCCAVSPRNVLAVGSQDGELAFYDWNIP
                     QPRRVAGRHYAPYQWAKTKSLPGTLHGEGGINALTYDVSGTRLITAESDKSVKIWRMR
                     D"
     gene            <1890844..>1892262
                     /locus_tag="LDBPK_365060"
                     /db_xref="GeneID:13388506"
     mRNA            <1890844..>1892262
                     /locus_tag="LDBPK_365060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865572.1"
                     /db_xref="GeneID:13388506"
     CDS             1890844..1892262
                     /locus_tag="LDBPK_365060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865620.1"
                     /db_xref="GeneID:13388506"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BUL4"
                     /translation="MTSGYCSYASASGSGHERVTRILVVGEASVGKTLLIRRLCDHIF
                     GDTSITSTDEVSAPESPYQSQSAVADDDLGPKWGPTVGIAVDALKRTTTVLDDTVTIP
                     NVAMSTPYDTAAMTRYTAPPSNFHSGENGNYPSCSVYGTPCSTSGYGGSNSVLQYRGQ
                     GFVGSNTSFALPHLVASASPPRRQTVLQTVEFHELGGTHGYRDVARMLLRNIHYDGVM
                     FVYHRRSLTSTLYLKEWYRWIRSVLSASPDIGSDYGAEANKPAKSSKTMPRFMLVGTQ
                     LPGDELPAAAAGLAKTTAETLHMACGAISDETLLDGNLEVKLRALQSPQTLTQRRGVR
                     HALGKVLRRLAWPYHVWWCVSHPFFLLSKQYQEELGPRSRLGACGSRVVERFVWLLYQ
                     AEQALMYVMAVILFGPYQEAVVLGHSRLKQTLEEMLKDELCVSQAHVCRLDSNMSLQS
                     SLDDVVAFFDILLRQDAPDEGR"
     gene            <1895049..>1898675
                     /locus_tag="LDBPK_365070"
                     /db_xref="GeneID:13388507"
     mRNA            <1895049..>1898675
                     /locus_tag="LDBPK_365070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865573.1"
                     /db_xref="GeneID:13388507"
     CDS             1895049..1898675
                     /locus_tag="LDBPK_365070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865621.1"
                     /db_xref="GeneID:13388507"
                     /db_xref="UniProtKB/TrEMBL:E9BUL5"
                     /translation="MDSDLSKTFGSVRSAHAYDQRVSSTRQASSSFVNINQKRSWRPT
                     SSLFQPILDYMSSAPFALAAANPFLRLFVERNAEGGGFSMRDYQVTPILLGQSRCGCD
                     SAGGADALTREGITPIVNGGLFWGCDALGDSPAAAYSGACLGTSGLVVEEDGVMEAWC
                     GKPCDDEKIHDDDSGPRSGASARVPRVIPLYISGVDAPQGLSPLSNHCYPYVGVNRVA
                     PSTTQAVSLSLKSSSAAAADMRDRMCLWECGRSTALEMSLCVCITCKSGAALHLLTLG
                     AWWLSRYYGVSLRLHHVHSAQLAAFKAAQRALSPKEIQLENCVISEDLLQCISTCSDL
                     LSLSIISCSASQQVTLRCIDSILRKGNEMRPVDFSDAHGTTLNGYASGGMGRHDMRQG
                     FRRSRNNNNGLSANNAPTDPGREVTNWYLSGVRSLGSLKQLRCLHILHTPLHETFLQA
                     LTTCSSLECIILHRCRGVRSLEPLRRLEHLQSLSLHGLSVTDTDLLSLTGCTQLRQLV
                     LDECRQITDLSFLANLRGTLERLLMPRTLLSNANMHHIGLCDKLVELHLQSLRQLTDI
                     GVLKDLTALRVLNLSDNLVTDEGCSALHCMPSLQRLNLASCRCITSLAAAFTASGRCM
                     HRLLSLDVSHTNISDAGVLCVQECTDLRYLNLCGCSELRRLSWLQKMSSLRWLNLGGT
                     RVTDEETKRYLPCTRNLRFLSLSGCSSVRSLFFAVKLPQLEYLNLESTSVADSELACL
                     CHCRKLRYLSLESCVDIRDVSPLCALPALLELNISLTAVGASTGGALSTTSGGSDGRS
                     TPHGSSTLISSTSSAASARSTSPLSSISSASPVSPSIGASRFPVVQVLHLNGCSRMTR
                     LEELSRCYPQLRVLYADRISVMPPRGVGIGFTGMDERRRLGTTPRHRGLLQHTHSVSV
                     STDEPNSEGPPGANKSVAHIHQALQQYLPQPPAGPRPRTPHAVAFRHHSYHRVSSCGN
                     EPRTRSRTVSLRFPGEAARVLRLALRRSSVTDAMLEQLCVTFACVSCLDLTRCTEVQC
                     LSGLENLYALRELTLTQSSVDNDGVRVVSACETLEVLRLTECRGVSDVNSLGGLRKLR
                     VLCVARTQVTNQGLEGIGQCLALQYLNCAECRYLSDVNALSSLKHLIELHLERTDVVD
                     AGICGVMRCSALQRVYFTRCQRLTTMGDVRTLWPQLEVLDVYGTSIPTRVAGQGQQFA
                     CAVI"
     gene            <1901532..>1903364
                     /locus_tag="LDBPK_365080"
                     /db_xref="GeneID:13388508"
     mRNA            <1901532..>1903364
                     /locus_tag="LDBPK_365080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865574.1"
                     /db_xref="GeneID:13388508"
     CDS             1901532..1903364
                     /locus_tag="LDBPK_365080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865622.1"
                     /db_xref="GeneID:13388508"
                     /db_xref="UniProtKB/TrEMBL:E9BUL6"
                     /translation="MSGITVQLVFAFVGTRVPYFMLESATAASSPARSPFGNASLVSF
                     NAAAQPTLRADSARTSPHLTPCIPTNLFTAQGLLSHLAKALEPSLHAAAAPEAATTES
                     ASLSPTVPLPFHKPPVFELFDYASLDPLEGSAALHDEQVLLVLCDIATTAQLVEALQL
                     EWLEVYSGAHHPHHRSCSASTLEPAHTTDMAVCTTEEKLRNVAHAQQALCKPVGLHLS
                     LLSKELLSREATLTAQKEQLAQMRSCAAAGTAPAAAPATAIGGDGVSTPMLCGRAASF
                     PLLVELEPSLASEPALSATDATHLQKLEAPLALCEARVRAVESLMQRAAKHHAKLLEL
                     AASERATEEAFQSGNVSRACAEYLERTEQDRSAAEAIIADYQVEMTRQVKVVRQLVAY
                     ITQVRRLVSKAKYEMGVVELILSRLSLTSLRPRLMEEAEALLRRRVILRRAARRQMLL
                     LQETEFVELQQDLESFSQRMEVQKVLPEKVRWYLRAPLPSLMPEEDPVATLLDHALID
                     REEDEAQELVEKTRVHMTDSLDPAKNALQITEALLPVERLARRLEEARASAAQYKSRV
                     EELEERLKMYETAEALSPPPLQDSVVKSLSTERPAEGGGSFEEG"
     gene            <1906720..>1907427
                     /locus_tag="LDBPK_365090"
                     /db_xref="GeneID:13388509"
     mRNA            <1906720..>1907427
                     /locus_tag="LDBPK_365090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865575.1"
                     /db_xref="GeneID:13388509"
     CDS             1906720..1907427
                     /locus_tag="LDBPK_365090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865623.1"
                     /db_xref="GeneID:13388509"
                     /db_xref="UniProtKB/TrEMBL:E9BUL7"
                     /translation="MSLLALNVCLISSSFDVVALPLSSTLCPVEVDDDVEDTSLCYGL
                     APLTEKGRKGYGYAHCTVMQFCARALDLKAVREIVRETWLKFRKHVLESKESLVLTGV
                     ADGPIFATTEDGRAVRLPNITVERSPNLMWLHETIVRELGQYQVKVGSEDVAKSAFHR
                     KFPADSNSTTPEWMLSFMSKYAHENYTPHITLGACTEKNVAAFSFLQKTEIPWRECRL
                     VVSHMGNFCSCFELLES"
     gene            <1908844..>1909563
                     /locus_tag="LDBPK_365100"
                     /db_xref="GeneID:13388510"
     mRNA            <1908844..>1909563
                     /locus_tag="LDBPK_365100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865576.1"
                     /db_xref="GeneID:13388510"
     CDS             1908844..1909563
                     /locus_tag="LDBPK_365100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865624.1"
                     /db_xref="GeneID:13388510"
                     /db_xref="UniProtKB/TrEMBL:E9BUL8"
                     /translation="MSVFLQIISVCATLAALCMVASPVITVKSMRAAKSVGSMTITFF
                     CAQFLNCNVWSMYGVQTLALPVIICNTFGSAVAAYCILTFLTVARMEEKAGHVLKSTS
                     YGASLKTATLTIFLIALLLLLFLYLMNFSSSDFAAQLNGILGGCCSVFMLSSPLGMAK
                     AIIHERNAEPLQPATVMFATLNSVLWMLYGLLSLDMYITIPNVLCTLACIFQIFLLVR
                     YGRHPAEHVEITETIAPVPLD"
     gene            complement(<1911021..>1911962)
                     /locus_tag="LDBPK_365110"
                     /db_xref="GeneID:13388511"
     mRNA            complement(<1911021..>1911962)
                     /locus_tag="LDBPK_365110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865577.1"
                     /db_xref="GeneID:13388511"
     CDS             complement(1911021..1911962)
                     /locus_tag="LDBPK_365110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865625.1"
                     /db_xref="GeneID:13388511"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9BUL9"
                     /translation="METCDGVDGVAGAPKMTESLILQQCRTHQGYSTPELNEKLYLHH
                     LGFTQLDGLAAFTGCVVLYLDHNALSDLAGLAALTRLDSLYLSCNALSHLDSMPRLPL
                     LRTLDVAQNQIVTLNGLDEAAPQLQTLLAGRNKLQSLDGVQGLSGLLSLDVSHNCIED
                     EEATSACLCGNRATLRTLLLHGNELCRRTPHHRKRWIAAFPALRFLDEYPVFDDERAR
                     AEAFAGGGAAAEAEIRSAQRTRALAEAREQFAYYGDIREAQRAARLRNGAETQATPYF
                     LAHTPSINKTVLQDAEDEPIYIPATRGAAVHQDPLRG"
     gene            complement(<1912585..>1913250)
                     /locus_tag="LDBPK_365120"
                     /db_xref="GeneID:13388512"
     mRNA            complement(<1912585..>1913250)
                     /locus_tag="LDBPK_365120"
                     /product="exosome-associated protein 4, putative"
                     /transcript_id="XM_003865578.1"
                     /db_xref="GeneID:13388512"
     CDS             complement(1912585..1913250)
                     /locus_tag="LDBPK_365120"
                     /codon_start=1
                     /product="exosome-associated protein 4, putative"
                     /protein_id="XP_003865626.1"
                     /db_xref="GeneID:13388512"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:E9BUM0"
                     /translation="MKRADGRESPRAVRAIHVATNVLANCHSSACVEIGKTRVLCGVR
                     PPQHLVQEYRGTRGRVSCQVHRSLASSSNLDNSGDRDMALALEGVAEQAVVLERIPQL
                     LVGALIEVVHDDGAVWDAATTALCVALTAGGVEVYDTFSACSAALRRDGAIIVDLTRE
                     EAATAMASVVVCSGLSLGGVYYCCHKGACEATTMSQLVQAATKGLQVRKVPLLEQIRN
                     QLV"
     gene            complement(<1913690..>1919827)
                     /locus_tag="LDBPK_365130"
                     /db_xref="GeneID:13388513"
     mRNA            complement(<1913690..>1919827)
                     /locus_tag="LDBPK_365130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865579.1"
                     /db_xref="GeneID:13388513"
     CDS             complement(1913690..1919827)
                     /locus_tag="LDBPK_365130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865627.1"
                     /db_xref="GeneID:13388513"
                     /db_xref="GOA:E9BUM1"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BUM1"
                     /translation="MSPWASSHVNDTPVENSSFYSRQGTSYTLAADEEALLLQELVNI
                     TAGAAPFVSTAAQEEHAAGGLEKRPGEAASLLGSRETGIRVPAATDTANGDCASSAPK
                     VSASEPAATSPAASPAHSSTHTGKGASSSKRRRAVASPTSSKTAVLKEEQDILDAIFA
                     AVDGQQSSVSGDLLGETSSAAAAEAPATSADSDEEIDEVDLVLEQAKQLTSSTVLCET
                     QRGELILHVHEHMALRSKLADLRKTAGEPTCVAVAEPFDISARAPTHASTASPAARTP
                     SQSLSCAMGTSLGVVVLFDRRWTVLGICGSVEASVVNARGAVVSLSLCTSTAALVGVD
                     ETCDGRTAATGHARGTFVLWSLHTFSPLRVVSDESRVPVLRVMHLHRDPTRILVLDSS
                     GAVRFFQFWKVMAKYMLRATSVTSALVAAPISDIDTLPCPSSFYMANLTTLKQHMPCS
                     NGEESDGDVSAPWLCAPPPLPPATATAAGISRTTWPAIAGKHFVAAVSNDAVLVYVVE
                     TGLQGTVTGVARHSHPPSSALSNELVRFVVMELGTSTPRLLLCISWNTEVELLLVNLR
                     LPEPSGSRKTAAAEPMLEGLERLALLRVSAPLVQMVPLAGCSVLLCDQNSDAQLMDAS
                     VAVMVERHRFGSLEYVGFAGRLCGVKYHGTAASNRAAALLMGKEHAYGISLRSWRERL
                     SSLLARRKYTQALDLAKGFAEEVALSTVGFSSNAANCRRELHQLMERILIAYVESRLA
                     ALPRTEATGKSSGGPPKQSAGNSGPICGTECLLDVLQQIASYCSAVDGLNLLYGPVAL
                     ALQQRGLLSHLLYVLEQFMRHGIITYMPETLIERFIHLFLDDAELDAVEVALGMRPRA
                     PQDGKEARGDVLDAGQVADSAAKISGRDRVELALMFLDSGAPTLLRLAQEHGLVRLTV
                     TILSLRQQRYVDALAYALDEEQKADDGLHGSDRGTDVCASRVLACPNLFGSPDAASVA
                     VDFVECTLKGVSLLPGASLAIGEQRPAKRAILEYLLRTAPSDGRNTHSSAVGGGVHNL
                     LRFLRRQPEHAMRVLLFALSDEGPCSPWGGADGLSRTQFVSSVYFILTGGSRTRPRHA
                     TESDLLSASGQRQGPLDLFRIDDDSLNRLPALRTLKATELAQRPFPPYIAVHTFLAGA
                     AIFNELFLSTDAGELASDEPDRPPVRLDVWLDLVIQDVLFAFQSAERAEERRELQEHL
                     LRVLAPDLLPPYRVAVFQSDFTRLRMARCLAALFCKEQRYAEAIACYTDPLQNCVDAH
                     LQQDVFKMLRDEMQHLQDMRTQTMNRAQQESSQSQRLENSARDSDRDAASLMGGSATS
                     EVGGGFDDIVEQHFSKESSLISPTVTATTTAPIDAAIKALQRAVMSQVELLVRIDATA
                     LAQFIFDYLPSNQREVINLLRGSSAAFMDYLDELVTQGDQAVANDMSLQNTYIELLCA
                     HAPRRVYSYLQEKGNRVTYDVQLALRAVRKHRIADAAVYLLEKAMMIEDAMTVMLRAV
                     RELLGALREEVLTRVTTGAEAAAEAQGDQDRDGSSPPLFTSTPGTEAGEAATQRGCRR
                     RSTRGKDAPPLTFELATLDSATELWRFVGIGEELCGRHQAERVTGGSSTTDAAAPLAA
                     VSSRTFSSATHAFPGGSPQHPEYWFRLLDVFMVPRRLLCEMMTQDDRLHALDTAPVPA
                     RPFASSDPTGMSNELDAAAHIAMASHAGAAAASLAHPLSAAGPPQHLASLTTPLSRGQ
                     RRCVEALVAVYTQYTSSILQSMMRSLDIAVVVDKVVQDNKDGTFRALKPILLDMMATL
                     SFDLEASRLCKLATERDVILLGRELYQMLNRSVVPQSDCCAFCHIHLCKPPLPQPAGD
                     EVGAAAAVGLVPSAVSVYTCGHAFHTVCAAQAMGSRQGCGICMRSRCSSGKPGGSEVC
                     GNASGASAAWPSTSGGAAADRAGHRDHADPVTTVVMRAAERTIDVARMQRRVRQTKMK
                     MDHPEDLYSVLKSLLAWDTTASDSSLGKAGPGVTRDRSGNCVLAPSPSVPAVAGQVHD
                     PVTGGVTTTQDKVLDTLTDAEILELFGGA"
     gene            complement(<1921763..>1922845)
                     /locus_tag="LDBPK_365140"
                     /db_xref="GeneID:13388514"
     mRNA            complement(<1921763..>1922845)
                     /locus_tag="LDBPK_365140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865580.1"
                     /db_xref="GeneID:13388514"
     CDS             complement(1921763..1922845)
                     /locus_tag="LDBPK_365140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865628.1"
                     /db_xref="GeneID:13388514"
                     /db_xref="UniProtKB/TrEMBL:E9BUM2"
                     /translation="MPLPPVESGPAAMTRRNFLVEMNRLRVSQYMPTRKQLEEEDLRI
                     ATIRQEEKRAKHAEWAESRRKAADSYNAAGTNSVRPLPGSVSRSMRASGKGQPAENTY
                     KLEKEEEAAKKREYNRLYEQEAKHQLAIRQATLKQMHDDEVRQMEALRKVNEEEDRKV
                     AEAHAQAMEEERQYMERLKQSNKRELAARKAEQQAKEARDRQLQELVNENNRHRAEMD
                     ERRLKNVTRMLHLQNEQFHREAMLNKKASEAKHYEEVAAIEERNRLLTKEEQEAAQRK
                     KEQFRQEFEDCIARDKEFRRTHNYDEPMEVTRQRNELAAQSYRLVLEEERLQNAERRQ
                     QYRKDLMDQIMAKQTYRMTHLDEAGI"
     gene            complement(<1927595..>1929685)
                     /locus_tag="LDBPK_365150"
                     /db_xref="GeneID:13388515"
     mRNA            complement(<1927595..>1929685)
                     /locus_tag="LDBPK_365150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865581.1"
                     /db_xref="GeneID:13388515"
     CDS             complement(1927595..1929685)
                     /locus_tag="LDBPK_365150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865629.1"
                     /db_xref="GeneID:13388515"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="UniProtKB/TrEMBL:E9BUM3"
                     /translation="MSAEFTEQDKEDLREIFRIYDFSKVNKVDDSVALAQKAGQTPAE
                     LFDDLYQLFKIQKLPQRETVARRMREAVLNATDADIESVIRQSEMKGFTERDALRSLE
                     RKYSVQHLNRRVLLASRGSHSSPQCKVLEEDSELGHAAGSLHHIKVNETSMTSSTPPA
                     TSGDVTEKASDSSLMLARPPSKLSGAPTREDLDEVIAEEVREWVAKMVGDKYNADVCS
                     MPNFVDALRSGVLLHVLLQKMESPPISDEDLKLPKRTTGFFVRDNVATFLTTAKRRYD
                     LVDAQLFTVSDLVDGKNDRQVVTCLMSIARIAYSAGTIKDAPNIIVYEHEIEQQQNRL
                     TRLDLDRIVQEAEADEGMPSLVARPDGPAEWPSSKVAPVPDTTSPTVRSCDECHGFVT
                     PPTQESLGVCESAFTQHELAAPEVTVEGLVRCPAPDTAAVCDTDKVDDKRGEDTAAAA
                     SASPAGTHPPSTGAIECAAEPNVLSAPTDVREHSLPGSASVGQASPTRTPLAPAKSDE
                     TLAAVAQNIAVAQPTETTEETTAALGTDVSDAAPSGRRRSGEEDSDGGGRVFYLRDGM
                     IHPAKPTPIEEKVVGEHRKKTGPRVVWKSTSTPLEATQPPRYHSRHWDGIDVALGRHL
                     NAHYAKHRQSPWRFRTVTATSGEYVLYNRLDASRRVVFLRIIQKRLFLRNAGKHQRWI
                     EIDEALEGLEKLEV"
     gap             1930780..1930878
                     /estimated_length=99
     gap             1932692..1932790
                     /estimated_length=99
     gene            complement(<1933502..>1934629)
                     /locus_tag="LDBPK_365160"
                     /db_xref="GeneID:13388516"
     mRNA            complement(<1933502..>1934629)
                     /locus_tag="LDBPK_365160"
                     /product="translation initiation factor 2 subunit,
                     putative"
                     /transcript_id="XM_003865582.1"
                     /db_xref="GeneID:13388516"
     CDS             complement(1933502..1934629)
                     /locus_tag="LDBPK_365160"
                     /codon_start=1
                     /product="translation initiation factor 2 subunit,
                     putative"
                     /protein_id="XP_003865630.1"
                     /db_xref="GeneID:13388516"
                     /db_xref="GOA:E9BUM4"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR005251"
                     /db_xref="InterPro:IPR011559"
                     /db_xref="InterPro:IPR027363"
                     /db_xref="UniProtKB/TrEMBL:E9BUM4"
                     /translation="MMSKPHHATLESIKYTPGSLRLLDQRKLPLETVFDDVLTVEDIW
                     SAINEMRVRGAPAIAVSAALGIAVATQRKVANGELKSGSEVQAFFLSSCDFVMTSRPT
                     AVNLFNCLRDLKEQVEKLDPTKAAAEVAQACVELAEAVYTKDVAFNEGIMRHGAAHIL
                     AVAKAEGRDKVSILTICNTGALATSRYGTALGVVRQLFYDGKLERVYACETRPWNQGA
                     RLTVYECVQEGIPCTLICDGAASSLMLNRKIDAVVVGADRICQNGDTANKIGTYNLAV
                     SAKFHGVKLYVAAPSTTLDAKTASGNRVEIEEREPTEITTNMVTKQRVVADGPHLSVW
                     NPVFDITPGELITGGIITEKGVQAPTASAPYYDIASIIAQP"
     gene            complement(<1936779..>1937606)
                     /locus_tag="LDBPK_365170"
                     /db_xref="GeneID:13388517"
     mRNA            complement(<1936779..>1937606)
                     /locus_tag="LDBPK_365170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865583.1"
                     /db_xref="GeneID:13388517"
     CDS             complement(1936779..1937606)
                     /locus_tag="LDBPK_365170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865631.1"
                     /db_xref="GeneID:13388517"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:E9BUM5"
                     /translation="MSVHEEEIDMILSMFSDECKRYEGTPDSVIVHLPFHFELQVTLP
                     PHGYPDASYPQLYLLSSPNAQLTSAFSQEVNRRMRDELPLGIPMLALLIPLAQSVAEE
                     LKDVKEKAEKARQDEAVEEMSELQQKEEHRRETGIAIWSGEAIVDRRSRFVAHMARVH
                     SMDEVREVVGHLRSVKSIACAAHPAIYAYRFTDTNGVLQKDSDDDGESGASIKMMFLL
                     DHLQVDGYAVVVTRWWGGILLGPDRFKHIMEVTKNLLLTIPEREKEMAASAKRKPLR"
     gene            complement(<1938221..>1940368)
                     /locus_tag="LDBPK_365180"
                     /db_xref="GeneID:13388518"
     mRNA            complement(<1938221..>1940368)
                     /locus_tag="LDBPK_365180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865584.1"
                     /db_xref="GeneID:13388518"
     CDS             complement(1938221..1940368)
                     /locus_tag="LDBPK_365180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865632.1"
                     /db_xref="GeneID:13388518"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:E9BUM6"
                     /translation="MRPFRLVQRRRHCISRLRATDGFERQPQQRRSIITNTSSSYAQF
                     ASATSGIGAEMKAKGFHHSTPNFNTTEFTDAADPSDLANDIVTESAVAVKFARDIYGP
                     WLVMTDDLQGELFVDHDGFVYYRPANGLGYGIGKLQVLDAGATGTAFTCQLESYSYQP
                     TNTVVPQYGLTFDITGMVKRVTAKSSDYTTFSLVGVWRRSNRNKDAPALLPSQRSCSD
                     AAVEGAAAALSPESLGNEGALGGPGEKTSGQFNAAKLSPWDPSTAARPFAPNAELQSV
                     FAQVFPGRLRVESHVQRAEATREPPAARHLAGSASKPSLIHLDLEQYATGNIPGIYYI
                     PDYISAAEEAQILTFIQGTPEELKSKLTKRTCQEWGCTMCESCQKSFVSDANMPPWVQ
                     ELIDMQVYDGLFTPTTFPNSVRIHEYHQGDGIGPHCDGPIYVPMVTVLSLASSCLMSF
                     YPKQPLYENHPMDHYNDTFKFGEGDIGRRVPLQSVVMEPRSLLIFSGEGYYHYPHGIS
                     DKAEEVLTPDVAGEVVNRRFLRDPDVQSISRTYRASITTRNLMTRCSHQPARAEYAMK
                     RAWYLYNHLPVPSELFTPAPQLSQQQRSAGLSTGGSSGSRELSDGSATPSPQKRVESS
                     FSACAPPGAVAFDTELREAIYEMRAKQEDLRNNVEELKQLVALSIPAQTTFQTETATI
                     LNHLSSSVLQLESKVDDLLDEVESAKRKSSTDT"
     gene            complement(<1941477..>1944407)
                     /locus_tag="LDBPK_365190"
                     /db_xref="GeneID:13388519"
     mRNA            complement(<1941477..>1944407)
                     /locus_tag="LDBPK_365190"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003865585.1"
                     /db_xref="GeneID:13388519"
     CDS             complement(1941477..1944407)
                     /locus_tag="LDBPK_365190"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003865633.1"
                     /db_xref="GeneID:13388519"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:E9BUM7"
                     /translation="MPISSDVDVVAAVPVLKPLLALAGSSPVSWKHLSTHDGYSVSEL
                     PPIPALGLPRKCYRTQFVVNGDLDSFQRVLSDEASIREFDPALKEMRILERRASKTLL
                     YTSYVSPSPWLVTPRDFCVWSATIFTTLEQLKRVCSEAKEGSAQTSNSSLAVRKFFCT
                     CQQSGEAPDPGQTVYLQNSVTARVSDSAAVPTPQCGKLFVRGVVYCFGYVAFADPSIQ
                     GKLRVTHYCCVDPAGQIPTWLVVAAVEENTKKLRKMAELVEAAAAAAAPAAEPTSACL
                     NAPSADPLPATEPQEPAFTLPGSAEKPSEEAKGEGVSTPLFTKAPCDEAPSLAVPTVE
                     GASDRGAYPSPDAEGKAALSMPSESTDVSPSPQPMPKEQRSFPPPPATCRNTATHDPS
                     LTSMPPQPPGTAASVDPRVEILSLLARSNGWCTRREVEEIQYAELRVLPEPLRSKGSL
                     CIAMRVSAVVRCTLDTLVAVLRDPALFPEIDPELVRVAAASTSSGASSRTASREPSTP
                     GHGTASTAGELRHYQFDANDSFRCPWEMILHCTDFELTQIDGGRHGFHTPGVPAATHV
                     WVSADSTTFCYRGVRPDGYHQLMQVRVFGVTAVAVPRSAESVRVSQYMLFDACAPLSP
                     ISHSSWHISFQKKCPTEEFVSGVSRWMEGRMNRLRRLSEERHRRRSSSAMVALDKVPL
                     LRFLYAVHCAEGGRALESPEAAWYGDVLARAIRWTGEGGCSSLRTEAGSGDPPMVVLS
                     TLFPCSLAQLRDYMLFSPPRHRYALESGVHKYEELAAPPDFTIVRVEYGAASASFPRV
                     RLTVLEAFGELHGVNVPCPTLVLSRAGVDGDVGDECDELDFTESSGHLRVSADTRFED
                     GRVFCSGWVATTLEGSGSQSCANGPWAALRSPHSGPAPVSPELCTEQSTSDGKAEEAA
                     LHQLERIVVTQYLSIGFPSAHQRDLDADGLPCGCIAEQAALLQRFRDSVCTWGSSIAA
                     RRSE"
     gene            complement(<1947835..>1948875)
                     /locus_tag="LDBPK_365200"
                     /db_xref="GeneID:13388520"
     mRNA            complement(<1947835..>1948875)
                     /locus_tag="LDBPK_365200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865586.1"
                     /db_xref="GeneID:13388520"
     CDS             complement(1947835..1948875)
                     /locus_tag="LDBPK_365200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865634.1"
                     /db_xref="GeneID:13388520"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BUM8"
                     /translation="MFSRTVFRCAPAVEDIVAAFKVLGLTYNPRAPASSRPGVDDVRR
                     QYLEMARLHHPDLSSGDDNRMKVINTAYELIQSSGILHSAYDAPAGAREGVAGQQGGE
                     ARTATRFARKAGARRRRMPDDFASGDDSSWSMKTSLDWQAIMNSTETLSEEEMKNPAN
                     HPFSHSKFFTFEDDLTIYRMIRGGATVRQVSRSLGKPATFIERRLQNAQFKLRVQYVL
                     RQDKRKSAAASSGSMRQTTSTPITEPATRRALRRSPYEDAHVGSTAAAFSSPVRKREW
                     EPSYPEWRAPRYRDQMTLEEQGRLDGLLRETPRAAHAAGKSASSPHCAVHCAASKMGR
                     SYENYKRLRPNL"
     gap             1953152..1954057
                     /estimated_length=906
     gene            complement(<1957659..>1958654)
                     /locus_tag="LDBPK_365210"
                     /db_xref="GeneID:13388521"
     mRNA            complement(<1957659..>1958654)
                     /locus_tag="LDBPK_365210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865587.1"
                     /db_xref="GeneID:13388521"
     CDS             complement(1957659..1958654)
                     /locus_tag="LDBPK_365210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865635.1"
                     /db_xref="GeneID:13388521"
                     /db_xref="UniProtKB/TrEMBL:E9BUM9"
                     /translation="METMATTVSPSALCLPGGLQTLSASCYRHNPYALTLLQEKDRER
                     AVESFGYIYSVLTDEGRALPSPPQQRKKARRGVTGNKGSSKYDSSCRDPEMQQLDSLF
                     TKSGAAADSSNDDGVSETSSDCGSHYAKEVLATYPPGFSVTSSQLHPGTSSATAAVPG
                     AVQSVIRYASVNFRFGSAWFVAPFRTFTGDMVVVQYPGNNSLHMGLVSAITTAKPITF
                     YTEDNMDPNYLSPEELQTVPRLLRHARDFDKETKLDLRRHDLSSLANARKLAAEIGAP
                     VQFLDAEWLLDLSAVTFLVKVFGNTALADKLVDELAMQEGAEVVFTYPVSSATMY"
     gene            complement(<1960258..>1961946)
                     /locus_tag="LDBPK_365220"
                     /db_xref="GeneID:13388522"
     mRNA            complement(<1960258..>1961946)
                     /locus_tag="LDBPK_365220"
                     /product="delta tubulin, putative"
                     /transcript_id="XM_003865588.1"
                     /db_xref="GeneID:13388522"
     CDS             complement(1960258..1961946)
                     /locus_tag="LDBPK_365220"
                     /codon_start=1
                     /product="delta tubulin, putative"
                     /protein_id="XP_003865636.1"
                     /db_xref="GeneID:13388522"
                     /db_xref="GOA:E9BUN0"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002967"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="UniProtKB/TrEMBL:E9BUN0"
                     /translation="MATVHVFVGQCGNQVGTAFLDTIASEAEASVDEGYQMRVSAMDF
                     RPALRPPPARPHHQRSAVAGSATGPSREPSEVARRIGHQQYYSLSYYAQEKERAAIDT
                     SLPQPRCVLVDMEPKVIAATVQRANGQREQHESSPSSSSSPQSASRRLYSLAPQQCVT
                     RGEGSANNWAFGYHQQGQSRRDAIVECLRRESEQQGTVVSTFHVLHSIAGGTGSGVSC
                     LVAEEIKTMFPRSMLLHSVVWPFRCGEVVTQWYNVVMAVSTLGGLADGVFIAYNDAIA
                     EELKGARANRGFKDAGEVSFQLINQRISGVLAPLHLPQLLYTLPSPQKDLSKNRILGT
                     GSGAAQGILGSGPSGCVAEGAAPQRYATASDVVEALSLDPAMKFFTGSLAPQMVTGST
                     TWAAVLGEAARTAQHSFTAPSALASSADTGFSCSEGKATTGRVADASVFYMQNRSCLW
                     AIRGVAAHTDGIRELRHLMADTASSPFPMTSLFVSPAEEWRATPSYTRPDHSVTLYGP
                     TPMVGASLADAAGRAEELLHVGAFVHHFERYGVSKTELRDAAAVLYDTAAAYHL"
     gene            complement(<1964458..>1965516)
                     /locus_tag="LDBPK_365230"
                     /db_xref="GeneID:13388523"
     mRNA            complement(<1964458..>1965516)
                     /locus_tag="LDBPK_365230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865589.1"
                     /db_xref="GeneID:13388523"
     CDS             complement(1964458..1965516)
                     /locus_tag="LDBPK_365230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865637.1"
                     /db_xref="GeneID:13388523"
                     /db_xref="UniProtKB/TrEMBL:E9BUN1"
                     /translation="MSLLRGSVSINRTLVTIVLLLTLPLLLDLTRLPDSSAAQEYVFS
                     LLTPCDGVGLCNLCGEVLEMVDLVQRALANPFQDKLTLSPEEWDAHGLQSYQRCLREP
                     FLRGCDTLLHKIRMQRIDFAKGILEQVVEDVQFRQKWGSLGEDYVIDNAVQLTTYIFD
                     SQERSLGGRRDPRKEDGAARNIVYQPSTLSLGGDPEVESLVTRVWFLRRDVLLLHQDF
                     CYPVCEGRLTVFGRVQVALLRFYVRHAIKPRLLLLRQQHRGTLVVAELMMIGLAFCVE
                     RVMRPGLTCSGTVARRSGRVHGGTASSTSTGSGLVSGVHGEDSAAAATSGGGSGDGGG
                     GGKLHCRPGRRRRWVVVV"
     gap             1967915..1967969
                     /estimated_length=55
     gene            complement(<1967970..>1968296)
                     /locus_tag="LDBPK_365240"
                     /db_xref="GeneID:13388524"
     mRNA            complement(<1967970..>1968296)
                     /locus_tag="LDBPK_365240"
                     /product="40S ribosomal protein SA, putative"
                     /transcript_id="XM_003865590.1"
                     /db_xref="GeneID:13388524"
     CDS             complement(<1967970..1968296)
                     /locus_tag="LDBPK_365240"
                     /codon_start=1
                     /product="40S ribosomal protein SA, putative"
                     /protein_id="XP_003865638.1"
                     /db_xref="GeneID:13388524"
                     /db_xref="GOA:E9BUN2"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="UniProtKB/TrEMBL:E9BUN2"
                     /translation="MTAVESGSKVLRMKESDAQKLLAMRCHIGTRNQSSAMKKYIYGR
                     TAEGSHIIDLHMMWEKLILAARVIAAVENPKDVCVCSSRLYGTRAIYKFSQHVGTSFH
                     GGRFIPG"
     gene            complement(<1969273..>1971810)
                     /locus_tag="LDBPK_365250"
                     /db_xref="GeneID:13388525"
     mRNA            complement(<1969273..>1971810)
                     /locus_tag="LDBPK_365250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865591.1"
                     /db_xref="GeneID:13388525"
     CDS             complement(1969273..1971810)
                     /locus_tag="LDBPK_365250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865639.1"
                     /db_xref="GeneID:13388525"
                     /db_xref="UniProtKB/TrEMBL:E9BUN3"
                     /translation="MSSPVKPTTSASDNLFKSLERDFEEAMRALEGEESLGHFRLEYD
                     KLYRALKKSHASENEIATQCQQLTQELLSNAAKMQAAVKLAQGDHSTIESLKKEIEKA
                     WRAVDVANEKDQRAREMVKTLKQEIQSLQSMIHDGTSLSTDHTSTLEQLKIDNKRLLT
                     ESEDMTKQMDTYTKEMAERTATLAALKTSTEEAVQERKLLASRLELVRQEYNRERNAR
                     ERAEYQCCELLLTLKTREKALQERQERLTLIHAHAETHKAELEKQQRRRQALQQQLET
                     AEKQLYHTKQSYNDSVDTTVELNERLHAMEKQIAATGKTILETRDECARVTRVEERDF
                     REFDRLKQQIDNIRKDEDRIAYEEETVRKRIAAVKQETRSLQEALELLERECSALEKK
                     GAREESLQTATQALVQNELAQQAELEASISQETEIGRRLRDTLQRLEKERENCVNEVS
                     QMSGQSKSASEELKMAVFQVEEVQRKLDESERRLTQQQAKYEHMRAERNQLSKRLVDA
                     QDEIVEYRQRVKVVDHQVHQFKEELALKARKCQSDKSQYKISKERLMKARQLVNDSTA
                     SFDATMEEGERVGQEIKQLLKVVQECDKGLCGQQREFMKMSNERDTLAAQLTRRNDEL
                     ALLYQQLQLIQDTVNAGEAAYRDRLDDLRLLHLKLREIQHQSMLAQVRGGEVSTAKKR
                     LRAKQKEVLLEQAQVAALAEELENPQNESRWRRVGGNYPSMAELESKMKLLQRDLLTK
                     SEECMKQEMALEEKQRLMMEMHAMAARQPGPEVAQQLNAYQKDLQKKNAQMKQKASEL
                     NMTATHKAELRYEVARLRRAVDEMRQKYYEVKVKNGTFSAAELVPAS"
     gene            complement(<1972753..>1973919)
                     /locus_tag="LDBPK_365260"
                     /db_xref="GeneID:13388526"
     mRNA            complement(<1972753..>1973919)
                     /locus_tag="LDBPK_365260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865592.1"
                     /db_xref="GeneID:13388526"
     CDS             complement(1972753..1973919)
                     /locus_tag="LDBPK_365260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865640.1"
                     /db_xref="GeneID:13388526"
                     /db_xref="UniProtKB/TrEMBL:E9BUN4"
                     /translation="MSALNDSRTTSGRPLPGGKPHALRPQGIPPLLCGDDVGASRGGG
                     DIGDFETAFEQLHSIRSEEEGDVDASSSPELRLRRVQRDVYRHERQIASLLSEKHEHC
                     EHLATVYEELEKVLRKIQLAPLEDLKEHAASPSASTFCAPSSDEDGYAASSTVSALAS
                     SLQQRFHQVLQMHQDRVYDVLVDYRQQIDKNEYETGRRLCALEDAIAQIQSDVRELQH
                     TASIQVEELRHVQQDVRQCVEAVAAQQEAQRAALDHTGEARDTKAAKLLSKIQDDVAR
                     LRADAKAVRTQQIESGKDVEEQIRSLLSAQHRAEEALEVHSASIAQLQNQDSLEGAFH
                     EVKDWLGDLEKRMVSRGELLQWTESLQSEIHQMRRVTGGVLSHTIQPTAPGHDA"
     gene            complement(<1975705..>1977000)
                     /locus_tag="LDBPK_365270"
                     /db_xref="GeneID:13388527"
     mRNA            complement(<1975705..>1977000)
                     /locus_tag="LDBPK_365270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003865593.1"
                     /db_xref="GeneID:13388527"
     CDS             complement(1975705..1977000)
                     /locus_tag="LDBPK_365270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003865641.1"
                     /db_xref="GeneID:13388527"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:E9BUN5"
                     /translation="MLRRTLRRLMPSDAIGSVHPDVLWGYQQGQYAGPGWANLIKSLP
                     LETLAMQGGSTMANLNDRTGTFLDPEDPRHPLALMQFGIMGKMDGTFHQLAYGDFGRV
                     PKGSRLMQVLYENYLEPFSMNRVCAQLYFYQKVPNNYHASVDATAEYVGQTASLVGQV
                     VIGLGACIMEGVTI