GenomeNet

Database: RefSeq
Entry: NC_021583
LinkDB: NC_021583
Original site: NC_021583 
LOCUS       NC_021583               1295 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus G chicken/03V0567/DEU/2003 segment 5, complete sequence.
ACCESSION   NC_021583
VERSION     NC_021583.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus G chicken/03V0567/DEU/2003
  ORGANISM  Rotavirus G chicken/03V0567/DEU/2003
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            G.
REFERENCE   1  (bases 1 to 1295)
  AUTHORS   Kindler,E., Trojnar,E., Heckel,G., Otto,P.H. and Johne,R.
  TITLE     Analysis of rotavirus species diversity and evolution including the
            newly determined full-length genome sequences of rotavirus F and G
  JOURNAL   Infect. Genet. Evol. 14, 58-67 (2013)
   PUBMED   23237956
REFERENCE   2  (bases 1 to 1295)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1295)
  AUTHORS   Johne,R., Trojnar,E., Kindler,E. and Otto,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2012) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JQ920008.
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqBuilder v. 7.2.1
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1295
                     /organism="Rotavirus G chicken/03V0567/DEU/2003"
                     /mol_type="genomic RNA"
                     /strain="chicken/03V0567/DEU/2003"
                     /host="chicken"
                     /db_xref="taxon:994995"
                     /geo_loc_name="Germany"
                     /collection_date="2003"
     gene            45..365
                     /locus_tag="RVG_s5_gp1"
                     /db_xref="GeneID:16414231"
     CDS             45..365
                     /locus_tag="RVG_s5_gp1"
                     /codon_start=1
                     /product="NSP1-1"
                     /protein_id="YP_008136234.1"
                     /db_xref="GeneID:16414231"
                     /translation="MGNSNTNIQVSQQNTHIQASDSKLELHDQKTATLQSTQLLISIG
                     AIIIVALILLLLFSLILNCYLCNRLKKKNGYLKRERKISNLRDKGLDKFILDKPNDIT
                     SGCV"
     gene            262..1236
                     /locus_tag="M796_gp2"
                     /db_xref="GeneID:16414230"
     CDS             262..1236
                     /locus_tag="M796_gp2"
                     /codon_start=1
                     /product="NSP1-2"
                     /protein_id="YP_008136235.1"
                     /db_xref="GeneID:16414230"
                     /translation="MVISNEKEKFPISGTKDWINSYLINPMISPVVVYEWKDDIADLG
                     MITPFNECSVVPGEKLLIHKVCAIKHEHWCGHLHVPDQERSFWKHESRLCMATCDKIF
                     WPCGAKKIRIDGKTMEGDDFVRCKCGQFYPTKIIKNGDFTVLTFCANDYAAIEIGMSY
                     GEQCRNCKKTYRYYRAANGFEGDTRSWWRTDKLCVQCTPYKELCRIMMAGKQIRFIEN
                     NYKEMKANFGRRIRRENRSNLAIKEVNSPSIVYKLEVVEKSSEWHNSTSEMLTAINLI
                     YRGEFKTDALDRDIVVLSSLYGRRIFKSDSTSEMFNLIRTYLKKMSML"
ORIGIN      
        1 ggaatttttt tttgttgttg tgcattcggt tgggaagcca gcgtatgggc aactcaaata
       61 caaatataca agtaagccag cagaatactc atattcaagc atcggattca aaactagagt
      121 tacacgatca aaaaacagcg acgctgcaat caacacaact gttgatctct attggtgcta
      181 taattatagt agcgctaatt ctgttactgc tattttcgct aattctgaac tgttatttgt
      241 gtaacagact caaaaagaag aatggttatc tcaaacgaga aagaaaaatt tccaatctca
      301 gggacaaagg actggataaa ttcatacttg ataaacccaa tgatatcacc agtggttgtg
      361 tatgaatgga aagatgacat tgctgatctg ggaatgataa caccatttaa tgagtgttca
      421 gtagtaccag gcgaaaaact attgattcat aaagtgtgcg caataaaaca tgaacattgg
      481 tgtggacatc tgcatgtccc agatcaggag agaagttttt ggaaacatga atccagacta
      541 tgcatggcca catgtgataa gatcttttgg ccttgtggag ctaaaaaaat tagaattgat
      601 ggaaaaacaa tggaaggtga tgattttgtt agatgtaagt gcggacagtt ttatcctaca
      661 aaaataataa agaacggtga tttcacagta ctaactttct gcgccaatga ttatgcagca
      721 attgaaattg gaatgtcgta cggagaacaa tgcagaaatt gcaaaaaaac gtacaggtat
      781 tatagagctg caaatggatt tgaaggagac acaagatctt ggtggagaac tgataaatta
      841 tgtgtacaat gtactccata caaagaatta tgcagaataa tgatggcagg taagcagatc
      901 agattcattg aaaataacta taaggaaatg aaagctaact ttgggagacg gatcagacga
      961 gagaacagat caaatctagc aattaaagaa gtaaattcac catctattgt ctacaaactt
     1021 gaggttgtag agaaatcaag cgaatggcac aattcaacat ctgaaatgtt gacagcaatt
     1081 aatctcattt ataggggaga attcaagact gatgcactag atagggacat agtcgtatta
     1141 agctcacttt atggaagaag gattttcaaa tccgatagca cttcagaaat gttcaatcta
     1201 atacgtacat acctaaaaaa aatgagtatg ctctaagctg aatgacggtt ccagacgtct
     1261 aaccaaccaa ccacacaaca aaacaataaa aaccc
//
DBGET integrated database retrieval system