LOCUS NC_021583 1295 bp RNA linear VRL 13-AUG-2018
DEFINITION Rotavirus G chicken/03V0567/DEU/2003 segment 5, complete sequence.
ACCESSION NC_021583
VERSION NC_021583.1
DBLINK BioProject: PRJNA485481
KEYWORDS RefSeq.
SOURCE Rotavirus G chicken/03V0567/DEU/2003
ORGANISM Rotavirus G chicken/03V0567/DEU/2003
Viruses; Riboviria; Orthornavirae; Duplornaviricota;
Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
G.
REFERENCE 1 (bases 1 to 1295)
AUTHORS Kindler,E., Trojnar,E., Heckel,G., Otto,P.H. and Johne,R.
TITLE Analysis of rotavirus species diversity and evolution including the
newly determined full-length genome sequences of rotavirus F and G
JOURNAL Infect. Genet. Evol. 14, 58-67 (2013)
PUBMED 23237956
REFERENCE 2 (bases 1 to 1295)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (26-JUN-2013) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 1295)
AUTHORS Johne,R., Trojnar,E., Kindler,E. and Otto,P.
TITLE Direct Submission
JOURNAL Submitted (11-APR-2012) Food Hygiene and Safety Concepts, Federal
Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277,
Germany
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence is identical to JQ920008.
##Assembly-Data-START##
Assembly Method :: SeqBuilder v. 7.2.1
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..1295
/organism="Rotavirus G chicken/03V0567/DEU/2003"
/mol_type="genomic RNA"
/strain="chicken/03V0567/DEU/2003"
/host="chicken"
/db_xref="taxon:994995"
/geo_loc_name="Germany"
/collection_date="2003"
gene 45..365
/locus_tag="RVG_s5_gp1"
/db_xref="GeneID:16414231"
CDS 45..365
/locus_tag="RVG_s5_gp1"
/codon_start=1
/product="NSP1-1"
/protein_id="YP_008136234.1"
/db_xref="GeneID:16414231"
/translation="MGNSNTNIQVSQQNTHIQASDSKLELHDQKTATLQSTQLLISIG
AIIIVALILLLLFSLILNCYLCNRLKKKNGYLKRERKISNLRDKGLDKFILDKPNDIT
SGCV"
gene 262..1236
/locus_tag="M796_gp2"
/db_xref="GeneID:16414230"
CDS 262..1236
/locus_tag="M796_gp2"
/codon_start=1
/product="NSP1-2"
/protein_id="YP_008136235.1"
/db_xref="GeneID:16414230"
/translation="MVISNEKEKFPISGTKDWINSYLINPMISPVVVYEWKDDIADLG
MITPFNECSVVPGEKLLIHKVCAIKHEHWCGHLHVPDQERSFWKHESRLCMATCDKIF
WPCGAKKIRIDGKTMEGDDFVRCKCGQFYPTKIIKNGDFTVLTFCANDYAAIEIGMSY
GEQCRNCKKTYRYYRAANGFEGDTRSWWRTDKLCVQCTPYKELCRIMMAGKQIRFIEN
NYKEMKANFGRRIRRENRSNLAIKEVNSPSIVYKLEVVEKSSEWHNSTSEMLTAINLI
YRGEFKTDALDRDIVVLSSLYGRRIFKSDSTSEMFNLIRTYLKKMSML"
ORIGIN
1 ggaatttttt tttgttgttg tgcattcggt tgggaagcca gcgtatgggc aactcaaata
61 caaatataca agtaagccag cagaatactc atattcaagc atcggattca aaactagagt
121 tacacgatca aaaaacagcg acgctgcaat caacacaact gttgatctct attggtgcta
181 taattatagt agcgctaatt ctgttactgc tattttcgct aattctgaac tgttatttgt
241 gtaacagact caaaaagaag aatggttatc tcaaacgaga aagaaaaatt tccaatctca
301 gggacaaagg actggataaa ttcatacttg ataaacccaa tgatatcacc agtggttgtg
361 tatgaatgga aagatgacat tgctgatctg ggaatgataa caccatttaa tgagtgttca
421 gtagtaccag gcgaaaaact attgattcat aaagtgtgcg caataaaaca tgaacattgg
481 tgtggacatc tgcatgtccc agatcaggag agaagttttt ggaaacatga atccagacta
541 tgcatggcca catgtgataa gatcttttgg ccttgtggag ctaaaaaaat tagaattgat
601 ggaaaaacaa tggaaggtga tgattttgtt agatgtaagt gcggacagtt ttatcctaca
661 aaaataataa agaacggtga tttcacagta ctaactttct gcgccaatga ttatgcagca
721 attgaaattg gaatgtcgta cggagaacaa tgcagaaatt gcaaaaaaac gtacaggtat
781 tatagagctg caaatggatt tgaaggagac acaagatctt ggtggagaac tgataaatta
841 tgtgtacaat gtactccata caaagaatta tgcagaataa tgatggcagg taagcagatc
901 agattcattg aaaataacta taaggaaatg aaagctaact ttgggagacg gatcagacga
961 gagaacagat caaatctagc aattaaagaa gtaaattcac catctattgt ctacaaactt
1021 gaggttgtag agaaatcaag cgaatggcac aattcaacat ctgaaatgtt gacagcaatt
1081 aatctcattt ataggggaga attcaagact gatgcactag atagggacat agtcgtatta
1141 agctcacttt atggaagaag gattttcaaa tccgatagca cttcagaaat gttcaatcta
1201 atacgtacat acctaaaaaa aatgagtatg ctctaagctg aatgacggtt ccagacgtct
1261 aaccaaccaa ccacacaaca aaacaataaa aaccc
//