LOCUS       NC_021587                678 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus G chicken/03V0567/DEU/2003 segment 11, complete sequence.
ACCESSION   NC_021587
VERSION     NC_021587.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus G chicken/03V0567/DEU/2003
  ORGANISM  Rotavirus G chicken/03V0567/DEU/2003
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            G.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Kindler,E., Trojnar,E., Heckel,G., Otto,P.H. and Johne,R.
  TITLE     Analysis of rotavirus species diversity and evolution including the
            newly determined full-length genome sequences of rotavirus F and G
  JOURNAL   Infect. Genet. Evol. 14, 58-67 (2013)
   PUBMED   23237956
REFERENCE   2  (bases 1 to 678)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 678)
  AUTHORS   Johne,R., Trojnar,E., Kindler,E. and Otto,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2012) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JQ920012.
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqBuilder v. 7.2.1
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Rotavirus G chicken/03V0567/DEU/2003"
                     /mol_type="genomic RNA"
                     /strain="chicken/03V0567/DEU/2003"
                     /host="chicken"
                     /db_xref="taxon:994995"
                     /country="Germany"
                     /collection_date="2003"
     gene            60..605
                     /locus_tag="RVG_s11_gp1"
                     /db_xref="GeneID:16414235"
     CDS             60..605
                     /locus_tag="RVG_s11_gp1"
                     /codon_start=1
                     /product="NSP5"
                     /protein_id="YP_008136239.1"
                     /db_xref="GeneID:16414235"
                     /translation="MAEVSEFDFKIKKDKKKQEKTKSKKMVVKDNETVVTHEEKSERG
                     SVYSEESSSHSSSNYAEAYERLQRELNASESNDNKCKRTIRNWADEVEKQESESENEY
                     DVPDTEFIPKKTNIIDMGSEAKEQIMNEISKIRMEMDVIKEAMKPQGVDAAFNLILKN
                     VDNLSTKQKHALVNAIVMSMK"
ORIGIN      
        1 ggaatattaa agtgtcgctt ggtggctgga aacactgagt ggcagcctct tgccctagca
       61 tggctgaagt ctctgaattt gatttcaaaa taaagaaaga taagaagaaa caagaaaaaa
      121 cgaaatcgaa gaaaatggtt gtcaaagata atgaaacagt agtaacacat gaagaaaagt
      181 ctgaacgtgg ttcagtctat tctgaagaat catcaagtca ttcatcaagt aattacgctg
      241 aagcatatga aaggctacag cgtgaactta atgctagcga atcaaatgac aacaagtgta
      301 agcgaacaat tagaaactgg gcagatgaag ttgaaaaaca agaaagtgaa tctgagaacg
      361 aatatgatgt accagataca gaattcattc caaagaaaac aaacataata gatatggggt
      421 ctgaagcaaa agagcagata atgaatgaaa tatcaaaaat tagaatggaa atggatgtaa
      481 ttaaagaagc aatgaaacca caaggcgttg atgctgcatt taacctcatt ctcaagaatg
      541 tagacaacct atctacaaaa caaaaacacg ctcttgtaaa cgcaatagtt atgtcaatga
      601 aataatcaaa taacagagtg cggtgaaaat cgcctgacat gactaggggt tagcccctga
      661 ggtgactaat aaagaccc
//