LOCUS       NC_021628               1068 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus F chicken/03V0568/DEU/2003 segment 8, complete sequence.
ACCESSION   NC_021628
VERSION     NC_021628.1
DBLINK      Project: 210412
            BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus F chicken/03V0568/DEU/2003
  ORGANISM  Rotavirus F chicken/03V0568/DEU/2003
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            F.
REFERENCE   1  (bases 1 to 1068)
  AUTHORS   Kindler,E., Trojnar,E., Heckel,G., Otto,P.H. and Johne,R.
  TITLE     Analysis of rotavirus species diversity and evolution including the
            newly determined full-length genome sequences of rotavirus F and G
  JOURNAL   Infect. Genet. Evol. 14, 58-67 (2013)
   PUBMED   23237956
REFERENCE   2  (bases 1 to 1068)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1068)
  AUTHORS   Johne,R., Trojnar,E., Kindler,E. and Otto,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2012) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JQ920000.
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqBuilder v. 7.2.1
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1068
                     /organism="Rotavirus F chicken/03V0568/DEU/2003"
                     /mol_type="genomic RNA"
                     /strain="chicken/03V0568/DEU/2003"
                     /host="chicken"
                     /db_xref="taxon:994994"
                     /segment="8"
                     /country="Germany"
                     /collection_date="2003"
     gene            56..1012
                     /locus_tag="M908_s8gp1"
                     /db_xref="GeneID:16028494"
     CDS             56..1012
                     /locus_tag="M908_s8gp1"
                     /codon_start=1
                     /product="NSP2"
                     /protein_id="YP_008145316.1"
                     /db_xref="GeneID:16028494"
                     /translation="MAELGCFVWVEELDGSEDTCVFRAFSRKAVDVLTKYDFKDDDTE
                     VVQTIYGPTPPRKHLRRFKTRTNKSGFHWDNDVYDGCCKMLATVLNTAHLKGEQAKKL
                     LNSVMSVRHLEGIYKRMNDAEDRLLDDDGKTHLLSVLIMLGATKKIETTVTSEGGTIE
                     YMNKYFTIFKLDYSNYKMAPLQTIEYKITFNSDSDNIPDDAFKKLGGYIKFNYNKYMP
                     ITHGKGHWRLVHYSETAQHAERIAATLKAIKAIRPDYKTMQLSEYVTARNWMEFMLAI
                     ESGMDVQKAKDQCLFKRVQFTKEVKAHARELAISSMSVINGN"
     misc_feature    56..949
                     /locus_tag="M908_s8gp1"
                     /note="Rotavirus non-structural protein 35; Region:
                     Rota_NS35; pfam02509"
                     /db_xref="CDD:396869"
ORIGIN      
        1 ggcttttatt tttgatatag agcagtcggt ccggcaaaat cctgcctgcc gtgtcatggc
       61 cgagctgggt tgtttcgttt gggttgagga attggatggc tcagaagata cttgtgtctt
      121 tagggcgttt agtcgtaaag cagttgatgt gcttacaaaa tacgatttta aggatgatga
      181 tactgaagtt gtgcaaacaa tttatggacc aacaccacct agaaagcatc ttcgtaggtt
      241 taagactaga acgaacaaat caggatttca ctgggataat gatgtttatg acggatgctg
      301 taagatgttg gctactgttt taaatactgc acatcttaaa ggagaacaag ctaagaaatt
      361 gttgaatagt gttatgtcag taaggcatct tgagggaata tataaaagaa tgaatgatgc
      421 agaagatagg ctactggatg atgatggtaa gactcatctc ttgtctgtac taattatgct
      481 tggggcaacg aagaaaattg agactactgt aacatcagaa ggtggtacta ttgaatatat
      541 gaataagtac ttcacgatat tcaaattaga ctattcaaat tataaaatgg cgccactgca
      601 aacaattgag tataaaatta cattcaatag tgattcagac aacataccag atgatgcgtt
      661 taaaaaacta ggtggatata ttaaatttaa ttacaacaag tacatgccaa taacacatgg
      721 taaaggacac tggagactag ttcactactc agagactgcg caacacgctg agagaatagc
      781 tgcgactctt aaagctatta aagcaataag accagactat aaaacaatgc agctttctga
      841 atatgttact gctaggaatt ggatggaatt tatgctagca atagagtctg gtatggatgt
      901 acaaaaagca aaagatcaat gcttgtttaa gcgtgttcaa tttactaaag aagtcaaagc
      961 acatgctaga gaactcgcta tatcatctat gtctgttata aacggaaatt gagtactacc
     1021 caataacttg atcctgaaac ttccaaaaat ctatatcata ctacgacc
//