LOCUS       NC_021634                678 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Rotavirus F chicken/03V0568/DEU/2003 segment 11, complete sequence.
ACCESSION   NC_021634
VERSION     NC_021634.1
DBLINK      Project: 210412
            BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Rotavirus F chicken/03V0568/DEU/2003
  ORGANISM  Rotavirus F chicken/03V0568/DEU/2003
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus; Rotavirus
            F.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Kindler,E., Trojnar,E., Heckel,G., Otto,P.H. and Johne,R.
  TITLE     Analysis of rotavirus species diversity and evolution including the
            newly determined full-length genome sequences of rotavirus F and G
  JOURNAL   Infect. Genet. Evol. 14, 58-67 (2013)
   PUBMED   23237956
REFERENCE   2  (bases 1 to 678)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 678)
  AUTHORS   Johne,R., Trojnar,E., Kindler,E. and Otto,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2012) Food Hygiene and Safety Concepts, Federal
            Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277,
            Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JQ920002.
            
            ##Assembly-Data-START##
            Assembly Method       :: SeqBuilder v. 7.2.1
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Rotavirus F chicken/03V0568/DEU/2003"
                     /mol_type="genomic RNA"
                     /strain="chicken/03V0568/DEU/2003"
                     /host="chicken"
                     /db_xref="taxon:994994"
                     /segment="11"
                     /country="Germany"
                     /collection_date="2003"
     gene            61..570
                     /locus_tag="M908_s11gp1"
                     /db_xref="GeneID:16028506"
     CDS             61..570
                     /locus_tag="M908_s11gp1"
                     /codon_start=1
                     /product="NSP4"
                     /protein_id="YP_008145322.1"
                     /db_xref="GeneID:16028506"
                     /translation="MDASSIMMNIMNITGNDTAANGSVETLTNMINNYITNNPGTFLY
                     TIITTLSTMFAISKIGVIKVISKPLVSISKKIKELVMVCVDRMLNKVGVDVAITDQMR
                     LNMDLDYIKNELNELKMLVVKNTLCRTVFVDRAQQTDKQQDTSKVKSKLDSTANATHV
                     DTVMTETVN"
ORIGIN      
        1 ggcttttaaa cctcatctta gttatacgta ccctcagtgg ttttgacaag ctgtattgaa
       61 atggatgcta gtagcatcat gatgaatata atgaatataa caggaaatga cactgctgca
      121 aatggtagcg tggaaacact tactaatatg attaataatt acattactaa caatccaggc
      181 acgtttctat acacaataat caccacgcta tcaacaatgt ttgctatatc taaaattgga
      241 gtaattaagg taataagtaa accactagtt tcgatttcga agaagattaa agaactggtt
      301 atggtatgtg tagatagaat gcttaataag gtaggtgttg atgtagctat aactgatcaa
      361 atgagattga atatggatct tgactacatt aaaaatgaac taaatgaact gaagatgcta
      421 gtggtaaaaa atacgctatg cagaactgta tttgtagatc gtgcgcagca aacagataag
      481 cagcaagata catcaaaggt aaagtctaaa ttggatagta ctgcgaatgc tacccacgta
      541 gatacagtga tgaccgaaac cgtaaactga gtgctcctgt tggtttagcc atctcccaac
      601 agggcagcgt ataacatact gtaccaagcc tcgtgcccag ccagagtgca gcgatcagct
      661 aacggatgag ttatgacc
//