GenomeNet

Database: RefSeq
Entry: NC_024443
LinkDB: NC_024443
Original site: NC_024443 
LOCUS       NC_024443               3368 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Roundleaf bat hepatitis B virus isolate
            RBHBV/GB09-256/Hip_rub/GAB/2009, complete genome.
ACCESSION   NC_024443
VERSION     NC_024443.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Roundleaf bat hepatitis B virus (RBHBV)
  ORGANISM  Roundleaf bat hepatitis B virus
            Viruses; Retro-transcribing viruses; Hepadnaviridae;
            Orthohepadnavirus.
REFERENCE   1  (bases 1 to 3368)
  AUTHORS   Drexler,J.F., Geipel,A., Konig,A., Corman,V.M., van Riel,D.,
            Leijten,L.M., Bremer,C.M., Rasche,A., Cottontail,V.M.,
            Maganga,G.D., Schlegel,M., Muller,M.A., Adam,A., Klose,S.M., Borges
            Carneiro,A.J., Stocker,A., Franke,C.R., Gloza-Rausch,F., Geyer,J.,
            Annan,A., Adu-Sarkodie,Y., Oppong,S., Binger,T., Vallo,P.,
            Tschapka,M., Ulrich,R.G., Gerlich,W.H., Leroy,E., Kuiken,T.,
            Glebe,D. and Drosten,C.
  TITLE     Bats carry pathogenic hepadnaviruses antigenically related to
            hepatitis B virus and capable of infecting human hepatocytes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 110 (40), 16151-16156 (2013)
   PUBMED   24043818
REFERENCE   2  (bases 1 to 3368)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUN-2014) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3368)
  AUTHORS   Corman,V.M., Drexler,J.F., Glebe,D. and Drosten,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAR-2013) Institute of Virology, University of Bonn
            Medical Centre, Sigmund Freud-Str. 25, Bonn 53127, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to KC790373.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3368
                     /organism="Roundleaf bat hepatitis B virus"
                     /mol_type="genomic DNA"
                     /isolate="RBHBV/GB09-256/Hip_rub/GAB/2009"
                     /host="Hipposideros cf. ruber"
                     /db_xref="taxon:1508710"
                     /country="Gabon"
                     /collection_date="2009"
     gene            join(2147..3368,1..1478)
                     /locus_tag="HM84_gp1"
                     /db_xref="GeneID:19737426"
     CDS             join(2147..3368,1..1478)
                     /locus_tag="HM84_gp1"
                     /codon_start=1
                     /product="polymerase"
                     /protein_id="YP_009045991.1"
                     /db_xref="GeneID:19737426"
                     /translation="MHPFSRLFRSIQSLGEEEVHALLGPPEGALPLLADADLNRRVAA
                     DLSLQLPPTASIWVHKAGGLTGLYSDKPKSFNPHWKTPEFPQLHLRPDLIEYLTHRLG
                     PLTSAEKRRFRLCIPARFFPNKTKYFPLYKGIKPYYPDNLLTHFFLTSHYLRTLWEAG
                     VTYLRETQSSASFNGSPYPWEQKQHNHGTERINSKPSRVLPGTRSTTRLRKAGNGPCT
                     RPLHLLGQSPLQRSRQREASSLGKGRSSPRLGSRTHTSSRRPFGVNRDLPGGTNHFPP
                     RWLDHKNSDRKTSHHHTTSTYQTKQAKGGAKGRILPNSYTTATSSRTYQSEAFSDTSH
                     NTTQSEQGEDTHSPYSSGAGHSSSPEHDQPDVEGAIRPSPLCAWSYLRSHPACGPHCL
                     KQCTLLLDDWGPCSRHGEHLIRTPRTPRRISGGVFLVDKNPNNSAESRLVVDFSQFSR
                     GDSRVLWPKFAVPNLQALTNLLSTNLCWLSLDVSAAFYHIPLSPAAMPHLLVGSPGLE
                     GLAASVSPQPKQPDNHEMHILHNLCGRANLLSLLLLFKTFGRELHLLAHSFIMGFRKI
                     PMGVGLSPFLLAQFTSALASVVRRTFAHCVAFSYMDDVVLGARTPQHLESVYASVCSL
                     FSSLGIHLNPSKTKWWGKHLHFMGLVLSPAGALPQTKHQSRALSCLKRLPTYVVLDWK
                     LLQRLTGLLGFLAPFTACGYPALMPLYAAVQARRGFEFSPAYKGFLLQLYSHLLPVAR
                     QRRAVCQVFADATPTGWGLVNHQLAAYKAGRFPRPLPIHCAELIAACLARRWSGARVL
                     GVDNTIVCSGKFTHFPWLLGCTANWMLRGTSFCYVPSELNPADAPSRGLLGILLAPPP
                     LLFRPSTGRTSLFAVSPPAPFHRPDRVSFASPVRTFKDTWRPP"
     misc_feature    2168..3361
                     /locus_tag="HM84_gp1"
                     /note="DNA polymerase (viral) N-terminal domain; Region:
                     DNA_pol_viral_N; pfam00242"
                     /db_xref="CDD:278663"
     misc_feature    <477..731
                     /locus_tag="HM84_gp1"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:295487"
     misc_feature    483..485
                     /locus_tag="HM84_gp1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     misc_feature    741..1475
                     /locus_tag="HM84_gp1"
                     /note="DNA polymerase (viral) C-terminal domain; Region:
                     DNA_pol_viral_C; pfam00336"
                     /db_xref="CDD:278751"
     gene            1..675
                     /locus_tag="HM84_gp2"
                     /db_xref="GeneID:19737423"
     CDS             1..675
                     /locus_tag="HM84_gp2"
                     /codon_start=1
                     /product="surface protein"
                     /protein_id="YP_009045992.1"
                     /db_xref="GeneID:19737423"
                     /translation="MGNISSELLGPLVGFQVVFFLWTKILTIAQSLDSWWTSLSFPGG
                     IPECFGLNLQSQTCKHSPTSCPPTCAGFRWMCLRRFIIYLLVLLLCLIFLLVLLDWRG
                     LLPVCPLNPNNQTTMRCTSCTISADALTSFPYCCCSKPSGGNCTCWPIPSSWAFAKFL
                     WELASLRFSWLNSLVPWLQWFAGLSPTAWLLAIWMMWYWGPGLLNTLSPFMPLFVLFF
                     LLWGYI"
     misc_feature    <1..654
                     /locus_tag="HM84_gp2"
                     /note="Major surface antigen from hepadnavirus; Region:
                     vMSA; pfam00695"
                     /db_xref="CDD:279085"
     gene            1220..1645
                     /locus_tag="HM84_gp3"
                     /db_xref="GeneID:19737424"
     CDS             1220..1645
                     /locus_tag="HM84_gp3"
                     /codon_start=1
                     /product="X protein"
                     /protein_id="YP_009045993.1"
                     /db_xref="GeneID:19737424"
                     /translation="MAARLHCELDAARDVVLLRPLGVEPRGRPFPRPPRDPPRAAAAA
                     VPPFHRSDLPVRRLPACAFSSAGPCVLRFTCADLQRHMETPLNFVTWQGARQRGHFLR
                     TLDYWDWYIKQSLMNQWEELGLGERLNTYVLGGCRHKLK"
     misc_feature    1220..1639
                     /locus_tag="HM84_gp3"
                     /note="Trans-activation protein X; Region: X; pfam00739"
                     /db_xref="CDD:109783"
     gene            1657..2310
                     /locus_tag="HM84_gp4"
                     /db_xref="GeneID:19737425"
     CDS             1657..2310
                     /locus_tag="HM84_gp4"
                     /codon_start=1
                     /product="core protein"
                     /protein_id="YP_009045994.1"
                     /db_xref="GeneID:19737425"
                     /translation="MYLFHLCLIFCSYPTVQASKLCLGWLWDMDIDPYKEFGASSQLI
                     SFLPEDFFPNLAELVETTTALYEEELVGKEHCSPHHTALRSLLNCWGETVRLITWVRN
                     SVEGPLIQDAIVQQVQASVGLRMRQLMWFHLSCLTFGQPTVIEFLVSFGTWIRTPQAY
                     RPPNAPILSTLPEHTIVRRRGGSRATRSPRRRTPSPRRRRSQSPRRRRSQSPASSNC"
     misc_feature    1657..1734
                     /locus_tag="HM84_gp4"
                     /note="Hepatitis core protein, putative zinc finger;
                     Region: Hep_core_N; pfam08290"
                     /db_xref="CDD:285489"
     misc_feature    1744..>2205
                     /locus_tag="HM84_gp4"
                     /note="Hepatitis core antigen; Region: Hepatitis_core;
                     pfam00906"
                     /db_xref="CDD:279277"
ORIGIN      
        1 atggggaaca tctcatcaga actcctcgga cccctcgtag gatttcaggt ggtgtttttc
       61 ttgtggacaa aaatcctaac aatagcgcag agtctagact cgtggtggac ttctctcagt
      121 tttcccgggg ggattccaga gtgctttggc ctaaatttgc agtcccaaac ctgcaagcac
      181 tcaccaacct cctgtccacc aacctgtgct ggctttcgct ggatgtgtct gcggcgtttt
      241 atcatatacc tcttagtcct gctgctatgc ctcatcttct tgttggttct cctggactgg
      301 aggggcttgc tgccagtgtg tcccctcaac ccaaacaacc agacaaccat gagatgcaca
      361 tcctgcacaa tctctgcgga cgcgctaacc tcctttccct actgctgttg ttcaaaacct
      421 tcgggaggga attgcacctg ctggcccatt ccttcatcat gggctttcgc aaaattccta
      481 tgggagttgg cctctctccg tttctcctgg ctcaattcac tagtgccctg gcttcagtgg
      541 ttcgcaggac tttcgcccac tgcgtggctt ttagctatat ggatgatgtg gtattggggg
      601 ccaggactcc tcaacacctt gagtccgttt atgcctctgt ttgttctctt ttttcttctc
      661 tggggataca tttaaatccc tccaagacta aatggtgggg caaacatctg catttcatgg
      721 gactcgtcct gtcccccgct ggggccctgc cacaaaccaa acatcagtcc cgtgctctct
      781 cttgtctcaa acgtctcccc acttatgtgg tcctggactg gaaacttctg caacgcctaa
      841 cgggcctttt ggggtttcta gcccccttca cggcctgcgg ctacccggcc ctcatgccgc
      901 tttacgcggc cgttcaggcc aggcgcggtt ttgaattttc cccggcatac aaagggtttc
      961 ttttgcagct ctacagtcac ctcctccccg ttgctaggca acggcgggcg gtttgccagg
     1021 tgtttgctga cgcaaccccc actggctggg gcctggttaa tcatcagctc gctgcttata
     1081 aggcgggtcg ctttccgcga cctttgccca tccactgcgc ggagctgatc gccgcctgtc
     1141 tcgctcgccg ctggtcgggg gctcgagtgt tgggggtcga caataccatc gtgtgctccg
     1201 ggaagttcac gcacttccca tggctgctcg gctgcactgc gaactggatg ctgcgcggga
     1261 cgtcgttctg ctacgtcccc tcggagttga accccgcgga cgccccttcc cgcggcctcc
     1321 tcgggatcct cctcgcgccg ccgccgctgc tgttccgccc ttccaccggt cggacctccc
     1381 tgttcgccgt ctccccgcct gcgccttttc atcggccgga ccgtgtgtcc ttcgcttcac
     1441 ctgtgcggac cttcaaagac acatggagac ccccctgaac tttgtcactt ggcagggggc
     1501 ccgtcaacgt ggacactttc taagaacttt ggactactgg gactggtaca ttaaacaatc
     1561 attaatgaat caatgggagg agctgggctt aggtgaaagg ttaaatacat atgtattagg
     1621 aggctgtagg cataaattga agtgatccac ttcatcatgt atctttttca cctgtgcctg
     1681 atcttttgtt catatcccac tgttcaagcc tccaagctgt gccttggctg gctttgggat
     1741 atggacattg atccttataa agaatttgga gcttcatctc aactgatctc tttcttgcct
     1801 gaggactttt tcccaaatct tgcagaattg gtcgagacca ccacagctct ctatgaagaa
     1861 gaattagtag gtaaggagca ttgctcccct caccatactg ctttacgatc cttgctaaat
     1921 tgctggggag agactgttag attaataact tgggtcagga attctgtgga gggaccactc
     1981 atacaagatg ccattgtcca gcaagttcag gcctcggtgg gcctgcgcat gagacagtta
     2041 atgtggttcc atctctcatg cctaacattt ggacagccca ctgtcataga atttctggtc
     2101 tcttttggaa catggatcag aaccccgcaa gcttacagac cccctaatgc acccattctc
     2161 tcgactcttc cggagcatac aatcgttagg agaagaggag gttcacgcgc tactaggtcc
     2221 ccccgaaggc gcactccctc tcctcgccga cgcagatctc aatcgccgcg tcgccgcaga
     2281 tctcagtctc cagcttcctc caactgctag tatctgggtg cacaaggcag gggggcttac
     2341 gggactctat tctgacaaac ccaaatcatt caatccacat tggaaaactc ctgaatttcc
     2401 acaattacat ctgagacctg accttatcga atatttgacc catagacttg ggccactcac
     2461 atcagctgaa aaaaggagat tcaggctgtg cattccagcc agattttttc caaacaaaac
     2521 taaatacttt cctctttaca agggaatcaa gccctattat ccagataacc tgctcaccca
     2581 cttctttctg acatctcact atctcagaac tttgtgggaa gcaggagtca catatttgag
     2641 agaaactcaa tcctcagcat cctttaacgg atcaccttat ccctgggaac aaaaacagca
     2701 taaccatggg acagaacgga tcaattccaa acccagtagg gttcttcccg ggacacgaag
     2761 tactaccaga cttagaaaag ctgggaacgg accctgcact cggcccttac acctattggg
     2821 acagagtccc cttcaaagat ccagacagag agaagcttcg agcctgggca aggggagatc
     2881 ctcccccaga ttgggctccc gcactcacac ctcctcgcgg aggccttttg gggtcaacag
     2941 agatctccca gggggtacta accactttcc acccagatgg ctcgatcaca aaaacagtga
     3001 caggaaaacc tcccatcatc ataccacctc cacctaccaa accaaacaag caaaaggggg
     3061 ggcaaaagga cggatcctcc ctaattctta cacaaccgcc acctcctctc gaacctacca
     3121 atcagaagcc tttagcgaca cctcccacaa caccacccaa tcggagcagg gggaggatac
     3181 ccactccccc tactcctccg gtgcgggtca ctcatcctca cctgaacatg accaaccaga
     3241 cgtggaggga gcgatacggc catctcctct ctgcgcctgg tcctacctcc gctcccatcc
     3301 agcctgcgga ccccactgtc tcaagcagtg cacccttctc ctggacgact ggggaccttg
     3361 ctctcgac
//
DBGET integrated database retrieval system